2P0PA

Calcium binding protein in the free form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
b'MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
molecule tags Metal binding protein
source organism Nostoc sp.
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
total genus 40
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0pA02
2K2VA 2P0QA 3URGA 2P0PA
chains in the Genus database with same CATH superfamily
2L3SA 3J7AF 2G3RA 5FU7C 1M3AA 1SRMA 2YHTA 1RI0A 3RKYA 4DA4A 2EAYA 3G71A 2O2OA 4Q5WA 1D3BA 4MDXA 2CYZB 1EZZB 5FRMA 2OTJQ 2EGAA 4FYXB 4C5HA 4JJBA 5GAOq 1JU5C 2RHIA 2P0KA 3A8LB 3EG1A 4PLIA 2BE7D 2L3RA 4ZTFA 2MOXA 4Y91A 2DEUA 2KXCA 1WQWA 2LCCA 3CC7Q 4J6XA 3EGUA 3CC4A 2KYMA 1UGVA 1G8XA 3S6WA 1MMNA 4E7IA 2LCSA 1ZBJA 5C6SA 1VQLT 4PJOD 3M0TA 2DKGA 2DL4A 4JLGA 2GGRA 2Z0WA 3ZL7C 2D8HA 1KC8R 2VXFA 5GANd 2FEIA 2EYWA 4FCYA 3CXCP 1GRIA 3PFSA 1K73U 1YJWA 2QA4A 3QJ6A 1PRLC 2LQNA 3VYGA 5HK3A 1K9AA 1VQ7Q 2DXTA 3Q1JA 1B3QA 2I0NA 3ZBDA 3CCMT 1GBRA 4HCCA 2DAQA 4AG2C 2ABLA 4Z88A 1GFCA 1IHWA 2DK3A 2EKHA 1M2VB 2LQKA 5GANh 5GAMe 1VQMQ 2HKNA 1WXTA 2CKKA 4M7AA 1VQ9A 5GANe 1RABB 4KUIA 1YHQQ 1Q86C 5D6WA 4DEXA 2Y4YA 2BZ8A 1OPKA 3QYGB 4C5GA 1BCMA 4ELZC 5IT9E 3QG1A 5LJ3j 1N9RA 2HEQA 2D1XA 2DXBA 3FC3A 4YTLA 4KGXB 1GCQA 2C0IA 2FPEA 1YITQ 4XU1A 1RAGB 2FZGB 1H3HA 4J7FA 3PMTA 3I56T 3CCQA 3EGDA 9ATCB 3M59A 5KYWA 3L2UA 4E7HA 3OSVA 2NUTB 3CCVA 3CCSA 4ANJA 2D6FA 2EW3A 4IIMA 4J7IA 1AEYA 4JZ3A 3OYHA 2ZPHB 1WHJA 1WFWA 2QDLA 3C94A 5GANg 4GLMA 2LX7A 3E9FA 2COYA 2GF7A 3VU3C 1X43A 4CRIA 4E7ZA 1Y0MA 2K79A 2CZ1B 4M77G 2OAWA 2EGCA 2HNIA 3H6ZA 4ZGJB 2JVVA 4ZGEB 1YITA 4HT9A 1S1NA 1Q81R 1YNZA 2M9UA 4BACA 4C8QG 1K76A 5DLQE 4PJLA 4HT8A 4XU0A 4J9FA 3EGDB 3OQ5A 3LH5A 3SEMA 4N0AA 2LVMA 4AFSC 3MP1A 1WQ7A 2GNCA 4FSXA 3UDCA 4DEYA 3TSZA 2KRNA 1UGRB 2HL5C 1ZA2B 1X6GA 1G2BA 1UTIA 3BY7A 2HL3A 5AYFA 1VQOQ 4C5EA 3SWNC 1T0HA 2RH2A 4QVZA 2E3HA 1WHMA 2YUQA 3BFMA 2E65A 1PD1A 2DRMA 1UB4A 3QWXX 2E4HA 3NGPA 3HFNA 3NPFA 5A2QE 1KQSA 1SSFA 2DX1A 2MCNA 2DYBA 3RMSA 3CCMA 3I55A 1BIAA 5CKBA 1JRIA 5DLOA 3GPLA 1M2VA 4LNPA 2AIRB 1M1GA 2CUBA 3CMEQ 2MYSA 4A63B 2HDAA 1BKBA 3P8DA 1YI2Q 1BYMA 3LX7A 1UHFA 4ATOA 2CS7A 3PMIA 2E6ZA 4XTVA 1K9MU 2RN8A 3UWNA 2A36A 4R0KA 1K1ZA 2QI2A 5FLXE 3HKSA 2A3LA 2QA4T 2YRDA 1HD3A 1YJ9A 5KYUB 4C0FA 5L23A 3INZA 2PVDB 4A53A 3REBB 2XIDA 1WLPB 1H3ZA 2AK5A 5DY9A 5J26A 2RO0A 1YJNQ 1ACMB 3NTHA 4PJOA 1O9SA 2MIOA 1BU1A 2R5MA 1W4SA 1UGQB 2LMJA 4N4IA 2DXCA 1N8RC 1QVFA 3SD4A 2V8KA 2HSPA 5IXBA 4A4KA 3UT1A 2DA9A 5GAN6 3ZEHA 1CKAA 2QA4Q 3HRTA 1BI2A 2RI5A 4LN2A 3M0SA 2ZPGB 3OYJA 2EJ9A 2X4YA 2DJQA 4IUVA 1Y96A 3CBOA 1SG5A 1TTHB 5CKDA 1OYXA 1W70A 2AZVA 5A0DA 2EWNA 2JS0A 3JRZA 1VQ8A 2GBQA 3I5SA 4MDWA 4RMOA 1M1KR 3MEAA 2K57A 2SRCA 3U23A 1G83A 1QCOA 1U5SA 1WJQA 3HL8A 4F17A 3PT9A 1M90R 2E5QA 2RJEA 2L3QA 2EYYA 1HK9A 2DO3A 3VV0A 3M0UA 2EQJA 1QVGS 3G71T 2QG9B 3L2QA 2RNAA 1AWXA 5GANj 4BI3A 4BE0A 2K2VA 5GANf 1RADB 3I35A 1VQKA 2NLUA 3WXMB 1R8OB 2W0ZA 2E6NA 1G5VA 3PVQA 1RAEB 4D6WA 3EFRA 5IN1A 4C8QF 4RCBA 3QWYA 4HXJA 8ATCB 1QW1A 5FWBA 4M78F 1Q86R 3P8HA 3QHSA 2DLPA 4M7DD 2LQ8A 1PHTA 1VYUA 2YWWA 1NEGA 2DIQA 1I07A 3FEOA 1Q7YC 2DVJA 1AZGB 3CCLQ 4M78A 1VIFA 2P4RA 3CBMA 3OYYA 1IREB 2EPDA 2PUKB 4EIKA 3SHWA 1VUBA 3OYBA 1YWPA 2XMFA 1WXBA 1PM3A 2MF2A 1M90C 4FYVB 1X27A 1VQ8T 2FG0A 4M7DC 3CC2A 1QP3A 2PVGB 3CPWS 3JCMb 2OI3A 3LGFA 4BE2A 1RUWA 4B6MA 1ZSZB 5IHIA 3H0HA 1YI2T 4RTUA 2CT4A 3CPWP 1T3LA 4PFPA 2R57A 3ASKA 4OB1B 5GAN5 3EG3A 2V26A 4M78E 5CCAA 2JTFA 1VQKQ 2CSQA 1WHHA 2PUOB 2J6KA 3A5ZB 4FT4A 1XTDA 2DNUA 3I5RA 2J6OA 2XKOC 4OP0A 5GMKm 1K73C 5KYXA 2NUPA 3G1JA 4BI8B 1ZSZA 2A0FB 4NL2A 4E7SA 2JJ9A 1YJNT 1K0SA 1I0CA 1IO6A 2K2MA 1G3TA 3M9QA 3OW2A 2RJCA 2QQ9A 4C92A 4IIOA 3MJXA 2A28A 5GMKl 1WNLA 3MEWA 1OOTA 1PCXA 3CC4T 3RBBB 1OEBA 3CD6A 1MV0B 4JDSA 2H3EB 1UGPB 4JZ4A 5GJVB 4PJOF 2FRWA 1Y96B 3JB9J 3CCRQ 2RI2A 4LE9A 3L2VA 1Q7YR 5J3BA 3HRSA 3OBYA 4LXCA 1G3WA 1VQ7A 4OVAA 2H3JA 3GNGA 3BW1A 4LDUA 3CQTA 3CCJQ 3QDFA 3VS3A 2M16A 4J9HA 1MMGA 3X25B 3ME9A 4M7AE 2JMCA 4PK4A 1D1BA 2JOYA 3JB9I 2ECZA 3L2ZA 1D3BB 2KNBB 4LDVA 1W6XA 2RQTA 1OU9A 1M1KU 4L5GA 4C92C 1M30A 3OB9A 3C12A 2DERA 2HMAA 2ROTA 1JJ2A 2DETA 4RG2A 2BKDN 3GBQA 1R77A 3MCAB 2BE9B 1NJIC 1UUEA 2KAFA 3OYAA 1BK2A 2Y4XA 2Y90A 2DL7A 2LC4A 3V8JA 4BDYA 4IURA 1G3YA 4FT2A 3VS4A 1FWZA 4KH1B 2XI9A 3M0PA 5EC7A 1K8AC 1WZOA 3VUBA 2CT3A 4RTZA 3UA6A 4JRQA 3DB4A 2K5FA 4F7UA 2O88A 3V7SA 1AZEA 2F5TX 5GAN8 2DM1A 1KHCA 1H641 2VGMA 4HVWA 4LUDA 2ZPEB 3FLGA 2JS2A 4Z89A 4M77C 1EIFA 1N6AA 2LZ6B 2O4XA 3ZFJA 1ABQA 3G6ET 2J7IA 3META 5CQXA 4JS5A 1YIJQ 4OB2B 3TREA 1GCQC 4O6JA 3OW2S 3VJPA 4E6RA 5GAN7 3NTIA 5D6XA 3VS5A 4M77E 2BZYA 2VVKA 1NLOC 3UA7A 3CCSQ 2MWOA 3JCMc 1I5LA 2BIVA 3OMGA 3RR6A 4FYWB 5GAOm 1SHGA 4C8QA 5HCKA 1V1CA 2EGEA 2VGNA 4HA8A 3OS2A 1MGQA 4M78D 1CKBA 1JXOA 3A1PA 3N5BB 5CKHA 2DTOA 2RHZA 1Q82C 1HJDA 1VQ6Q 2EQUA 1LJOA 3PVLA 4XU3A 2MAMA 3FJPA 4CI0C 3PGGA 2DILA 1TUGB 2NUPB 2KXDA 5LJ3f 4BE1A 1WHLA 1T3SA 4M77A 3OYIA 3SB2A 4RG8A 1B07A 3JB9D 3M4GA 1NM7A 3OYGA 1KD1C 3CCST 4M7DB 4GY5A 4B9XA 2DMOA 5CR2A 4A4FA 4M77D 2K7AA 3CCEQ 3X28B 4N0AC 1YJWQ 4ME7A 2KVQG 2P84A 5GAN3 1VQPA 2RD1A 3MP8A 4II1A 4C8QC 2DRKA 2BUDA 3SWNA 4R55A 2FB7A 2JM8A 3FDRA 3CC7T 1SRLA 1RAAB 1YIJA 1OI1A 2IIMA 1PKSA 3REAB 1D0YA 2QYZA 5LJ5d 2J06A 3TSWA 2KY9A 1M5Q1 1YJ9T 1NG2A 3QSUA 1AD5A 3CC2Q 2KT1A 1UFFA 1IHVA 3M5AA 4JPBW 4QQDA 1H8KA 2DPPB 2MK5A 3MP6A 4M7AF 1JJ2S 2CH4A 1N27A 3M54A 2LT4A 5KH6A 4OMFB 1K73R 4J5YA 5LJ5h 3IQLA 1ZSGA 4C0DB 4XU2A 3GIBA 2O9VA 2E64A 3RDVA 1ZA1B 1C0MA 4QQ6A 1UEBA 1BI1A 1LPLA 1WGSA 1YJ9Q 1RAFB 1ZUYA 1OZ3A 1N9SA 2V8JA 3PE0A 1ZBXA 2CP2A 1X69A 2P0PA 1Z9QA 3CC4Q 1K9MR 3RIRA 1I81A 3D7SB 1UDLA 1MV3A 3VRZA 2X51A 2KBTA 2V1QA 8AT1B 3BE3A 3S3NA 3JCMe 1I4K1 2K5LA 2HAXA 3HSBA 4RTXA 2C06A 3JV3A 2DYIA 5GAMf 1AWJA 4HVVA 2ENMA 2OX7A 2ZGWA 2CREA 2GQVA 2IVWA 3TU4K 1VQPT 3M57A 1AHJB 4PKCC 3KBGA 4LDYA 4RTTA 2O9SA 4IUQA 2CZ0B 1ZUKA 2FHDA 4HVUA 1JQQA 1M90U 1JBMA 5C0MA 4M77F 3CCUA 2QXFA 2R58A 2EQKA 5A0LA 3LWIA 5LJ3g 1QVGP 3JB9F 4J83A 4AFUC 3HTRA 2V8IA 2X4XA 2K6DA 5GJWB 1YFNA 3M53A 4LDXA 1UHCA 2KYBA 2FPDA 4EDUA 2R5AA 2EYXA 1VQNQ 4ORZA 1TUCA 2CP6A 2JZ2A 4BD3A 1YJNA 5KE3A 1S72Q 1AWOA 1KQSP 2QEXT 1Q95G 1BI3A 4QT7A 1VQOT 4PLLA 2JTEA 1OX8A 1Q81U 2O31A 3T9NA 4D8KA 5KCHA 1RACB 1N5ZA 2L5QA 3DLLA 2MPXC 2LT1A 2RK1A 1ZLMA 3OYKA 3EFOB 1PKTA 5CKFA 3M0QA 1UG1A 4QW2A 2RMOA 1IB8A 1O75A 1XOVA 3GOXA 2DL5A 3UPUA 3JSCA 2KRSA 1NZ9A 3CEYA 2QEXA 4VUBA 1E6HA 2CGHA 2HCKA 3JAME 2LX9A 2D0QB 3CCLT 3SDZA 1B7TA 3HFOA 1SHFA 2DJZA 3L2RA 1XQHA 1D1CA 2AZSA 3LW5E 1TSFA 2MI6A 2DVEA 4FM4B 1QVFP 3THKA 1GL5A 1X01A 5LJ3h 3V7RA 1VQMA 3DKMA 4MMLA 5IH2A 1VQ4A 2VV5A 2YLBA 1NE8A 4C0ZA 3VS2A 1Y07A 4DBRA 4KGVB 4M7DE 4RKUE 5M9OA 1WJRA 1SF9A 3E19A 2V1RA 3J81E 3OYLA 2RF0A 3JCMP 4CC3A 1VQLQ 4XQ3A 4PJOC 2VYTA 5GAOl 2DXUA 2XD0A 3CCET 3H41A 1NJIU 1RLPC 1VQ4T 3SFMA 1E7OA 4EMGA 4PL6A 4E2FB 3JB9H 1VQKT 1VQ7T 1YCSB 2X3WD 2EJFA 3PNWC 1FXXA 3MHXA 4JUVA 3AT1B 2LQWA 1K8AU 1CSKA 5I2SA 2L2PA 5EG2A 3AHUA 1KFZA 3CD6T 2BTTA 2QQRA 1W1FA 3QIIA 2RQUA 2ZPFB 3KUFA 2QAZA 3CCVT 3CMET 2L89A 4PJMA 2E3IA 3TVTA 3FJ5A 2YLCA 4BDZA 2CP0A 1A0NB 5IAYA 2COZA 2M02A 2L3PA 4KRTA 1V29B 5I22A 2IG0A 3CCQQ 5LJ5j 3EG9A 1KQSS 7AT1B 5LJ5f 2HQEA 1WXUA 2HBPA 1Y7XA 2KE9A 2KDSA 1YITT 4X1VA 2OTLQ 1JXMA 2OAUA 4PJOG 4M7AB 1J3TA 3H0FA 1TG0A 3G6EQ 1XJWB 3OA6A 1IRXA 4JJNK 1K8AR 2K4YA 1VYVA 4JRIA 3QPHA 1GCPA 4LD6A 2F1LA 2ATCB 1N8RU 2QQAA 1QWEA 4D8DA 4FSSA 4XTZA 5CIUA 1WPYA 2DL8A 3EAEA 1LVKA 4M75C 3MO8A 4M7AG 1ZHIA 2DD5A 5GAN4 2KRMA 1WI7A 1KD1U 4M78C 1WHKA 3NHNA 1VA7A 1NPPA 2L8DA 1YN8A 4A4HA 2DTHA 3I9QA 5GAMj 1VQ8Q 2F2VA 1BI0A 4L59A 3WVEB 2DE0X 4M7DA 4Y28E 2JM9A 1BCOA 4AT1B 2D8JA 2DEQA 1G3SA 1LCKA 1VQ9Q 5DM7R 2DBKA 3CMAQ 4Y92A 3G71Q 1VQ6A 4CC2A 2ZZDA 4F16A 3G4SQ 1DJ7B 3ULRB 2VWFA 3QJYA 3OS5A 3PTAA 2P4TA 3URGA 1YIJT 1VYTA 3CXCS 2EFIA 2DL3A 1ZSZC 2RM4A 1M1FA 1X6BA 2XDDA 3UATA 4EMKC 3A8OB 4PNOA 2XDPA 4JJDA 4OF1A 1OV3A 4M78G 2DD4A 3LGLA 3QZ5B 3CMAT 4BY6B 2QASA 1BB9A 5HY6A 5KYNA 2K3XA 3SWNB 3H8ZA 4N4HA 4F7UE 2YT6A 1KG1A 4JLIA 1YCYA 1JO8A 1QKXA 4LDWA 3VUZA 4C92E 3RUXA 3QBYA 2ZPIB 4HCZA 5FU6C 4F7UB 1YBYA 5KCOA 2L0AA 2KI7A 3GLXA 3VYHB 1U1TA 3CCVQ 3M4YA 1RAIB 3P8BB 2M51A 2LJ1A 4Z02A 1FMKA 3VS6A 4M75E 1MMDA 2NWMA 1S72A 2GTJA 1VIEA 1R0BG 3I55T 3CC7A 2X4WA 3HHTB 2RPNA 5CQYA 4EMKB 3MPUB 3CCQT 2DTIA 3M56A 3VS7A 2E12A 2G6FX 2HQXA 4E7JA 4M75D 3JCMJ 3OYDA 3DLMA 5IXFA 5KE2A 4BY6C 5J39A 5GAMd 2DZ9A 4IUPA 1SEMA 4X9CA 1PNJA 1XNIA 4C8QB 2AT1B 1YHQA 3DB3A 3MEVA 1Q86U 1UJ0A 2LDMA 2HZYA 4JS4A 1I8FA 4CC4B 2QGFB 5FU6B 4M7AD 1VQ5T 1W2BP 4EMHA 4IUUA 3LLRA 2JT4A 1KJWA 3V8KA 1YP5A 5AT1B 4LD9K 2EIFA 5GAMh 1QWFA 2GFAA 1TOVA 2QGGA 2XU8A 1TS9A 2FZKB 2GTOA 1MUZA 3J80E 3OYMA 4A4GA 1M9SA 4PJJA 3H0IA 4MMKA 5KYWB 4FYYB 3H9NA 4GBQA 3FIFA 3NTKA 2I2LA 4C92G 1SPKA 4XTXA 1Q81C 4RTWA 3JCMf 2YXYA 4KBMB 3M58A 2KK4A 4DOVA 2WSFE 3OS1A 3E9GA 2KMTA 1QP2A 1M3BA 2E1HA 1M1KC 4M78B 4DBQA 3HRUA 2MWPA 1JEGA 1GFDA 4M75A 2YUNA 3EGXB 2KT8A 2OTLT 2CP7A 4HKEA 1VQ6T 3CXCA 1KSWA 3L2WA 1WDXA 3CBPA 1TU0B 4PFZA 4J6YA 5HK0A 4KT0E 5ECAA 2D0NA 4NOYA 2WACA 2OTLA 5LJ5e 1M2OA 4BB7A 2J6FA 5IHNA 5A0GA 5D7UA 1K4US 4IUTA 3R6OA 1EFNA 2KROA 1C6VX 4ZTJA 2MMPA 1JB0E 2FL7A 4J8OA 1HXDA 4DOWA 4N4GA 2A7YA 2CSIA 3C4SA 2KEAA 2E70A 1TXQA 2FO0A 5FU7B 2HQHA 4F7UF 3EH1A 4ESRA 4MZPA 3VRYA 4ZGDB 2A08A 3QKJA 2YDLA 4C5IA 4JRKA 5I2MA 2M0OA 3OSSC 2LJ3A 2CZ6B 5CVIA 3JCMW 1QVPA 1VQ9T 2E10A 1VQ4Q 3I55Q 1VQOA 2OJ2A 4K11A 5LJ5g 1PC0A 2X35A 2JW4A 4J9DA 2RHYA 2K3YA 3CPFA 1WX6A 2YRCA 4X34A 2ZPBB 1Q82U 3GNFB 4FW1A 2ZCFB 4OGEA 5LJ3e 4JJCA 2ROLA 4JRPA 3OBWA 2PTKA 4OMNA 5FW9A 5GAN2 3G4SA 4AFQC 4PJOB 4OMOA 4OMQA 1NYGA 1ZX6A 2K3BA 4QQGA 2YUPA 1SKUB 1YJWT 2LJ0A 3C0CA 3QXEB 4AFZC 2ZAEA 3CCMQ 1VOMA 1RL2A 3S3MA 1KC8U 2EYQA 4PJNA 3EH2A 4A4EA 1WA7A 4J9GA 3X26B 1OX9A 3F70A 3CCUT 2RHUA 4B9WA 1K0XA 4AG1C 2K9GA 1X2QA 1FYNA 4XTUA 2LNVA 3JCMd 1YI2A 3RESA 2XHCA 3PIPA 3JCMQ 2VKNA 5GMKi 1VQPQ 4AMCA 2JTMA 3RNJA 1B34B 1RI9A 1I1JA 2LNHB 1UE9A 1YWOA 2YUOA 1TH7A 4F14A 2B8AA 3OYEA 5GAOr 1UGSB 3M55A 3OYNA 2OTJT 2CZ7B 3EGXA 3FRNA 2P0QA 2GQIA 1D0XA 4J9CA 4J9EA 5KYUA 1U8RA 4M7AC 2RI3A 2F2XA 1GBQA 4IKFA 4LUEA 4C92B 3CCUQ 4FW2A 3LWHA 2RB6A 4ELYC 2YSQA 2D9TA 1BBZA 1R0CB 2FZCB 5KYYA 1W2BS 1Z9ZA 1QLYA 4E7LA 1KD1R 5KYXB 2XICA 3KFVA 3VKIA 3CMEA 1X6OA 3QYHB 4OB3B 2HKQB 4FIBA 3OYCA 1QVFS 1M8VA 3G6EA 3BDUA 3EHRA 1UECA 3G7ZA 1B34A 1IZ6A 1KIKA 5L8RE 1C1AA 4F04B 3X20B 3EG9B 2JN0A 3G4ST 1M4ZA 4HCBA 3V7CA 1PSFA 4P5NA 1ZUUA 1BIBA 1X75C 1IGQA 5CO7A 4M77B 1UJYA 1ABOA 2PQWA 5IHKA 3JCMh 4RUGA 1U3OA 2SEMA 1MNDA 3CCEA 2EQIA 5KYYB 3PIOA 2NUTA 1PWTA 4OMMA 5CAIA 3L1AA 3CCRA 4OB0B 1WHGA 1QCNA 2RJDA 1IXDA 2KSSA 1E6GA 4UC4A 2JXBA 3EFSA 3KXTA 4X9DA 1PG5B 3MKDA 4OGCA 4E47A 3A8GB 3TQ7P 3EG2A 3QZ9B 5GMKe 2KQWA 2WSCE 4M75G 3C95A 3R6NA 3RERA 4NL3A 4M7DF 3LYIA 3BDLA 1TUDA 1AWWA 3TEEA 4Z8AA 1EX4A 4C8QD 4OMPA 3VS1A 2O4XB 2YRVA 3ER0A 3OYFA 3RMQA 1M3CA 2CP5A 2AHJB 1VQNT 4GLKA 4QKUA 3A8MB 4OMLA 5CKEA 2QEXQ 2PZ1A 2CUDA 3CCJA 4ZN3A 3LH0A 4RTYA 2PNIA 4QVCA 2DIGA 3A98A 1VQ5A 2HD0A 4FU6A 4J6WA 1NBEB 2ED1A 2E5KA 3L42A 4V2SA 1M27C 3V8LA 3RKXA 3JB9G 2VASA 4C0GA 3QUIA 5GAOn 1D09B 1AVZC 3JCMX 1FMVA 3CD6Q 4NS5A 5I21A 4R56A 5FRNA 2E41A 3QO3A 2CH4W 2DFUA 1QVGA 1U06A 4F7UG 2RK2A 4TVRA 3A8HB 3EFOA 3UF4A 3TCJA 5FROA 1V76A 2FRYA 1FMWA 1PRMC 2B86A 5GMKh 4WCIA 4C92F 2LCLA 2K5IA 2VC8A 2VB6A 2VXEA 1OPLA 2RHXA 1U1SA 2AKKA 2XK0A 3HP9A 1WIEA 2NUZA 1QQJA 2PU9B 4MZMA 3FB9A 3O8VA 4XTWA 4ZNXA 4KGZB 1M8MA 4A54A 2IPOB 2X4JA 2EBPA 4RCCA 2A37A 4BI4A 4M75F 1VQNA 1TWBA 1AOJA 3QDRB 1OULA 4M75B 4C92D 4ZN1A 3E1SA 2QTXA 1IGUA 3O5ZA 3CC2T 3MEUA 5D6YA 2BZXA 3NMZC 2X3XD 2XDBA 2EKOA 1QCFA 1H92A 4QVDA 1Y57A 1MNEA 3GF5A 2QQSA 2KR3A 2LTOA 4XAXB 3I56Q 6AT1B 1K9MC 1NEBA 2COWA 2NYSA 4PJOE 5FWCA 2QQBA 3CCJT 2JNGA 5GAMg 3GP8A 4PFOA 4C0DC 2QK0A 2EQMA 1NYFA 1PD0A 2DBMA 3EHQA 2JMAA 5I11A 1GXIE 1X2KA 1VQ5Q 2RQVA 4E7KA 1S72T 1P92A 2X9HA 2RJFA 2O01E 3S3OA 3JCMV 1D0ZA 3X24B 1OZ2A 2M1HA 4M4ZA 2RQRA 1F1BB 1RAHB 2XG8D 3CMAA 4MZTA 3CCLA 2QTVA 1KQ1A 1VQLA 1NLPC 1VQMT 4J9IA 1LOJA 2EJGA 5LJ3d 2WSEE 4C8QE 4XK8E 2FVUA 2RA2A 1YHQT 1WYXA 1JJ2P 2F2WA 1KHIA 2LRQA 2HBWA 1NJIR 2LP5A 3OMCA 4RTVA 1MMAA 3CPWA 2KGTA 4EMKA 1OQKA 2J05A 4DBHA 5GAOp 2EYZA 4O5VA 2HSEB 2CP3A 3JCMg 1HSQA 3OY9A 3HPWA 4CC7A 3OS0A 2ED0A 4XTYA 4KULA 1FX7A 1QMCA 2DZCA 4KUDK 4EPCA 2DF6A 4FL6A 1ZQ1A 2QDYB 3VS0A 1AT1B 1T0JA 3EG0A 1RLQC 1QKWA 4WF2A 1LNXA 4DBFA 5GMKj 4L6V5 3E2UA 5LL6S 5CK9A 3OW2P 1SSHA 1KC8C 2FYKA 2RQWA 1OU8A 3RKWA 4KH0B 2PVOB 2W10A 1I5OB 1Y71A 2H8HA 1KQ2A 2C0TA 2OTJA 2FPFA 2F5KA 3I56A 2M0YA 2GCXA 1Q82R 1MHNA 2AKLA 2EVRA 3M0RA 4BUGA 1D1AA 4HCKA 2F69A 1PSEA 4DQ2A 2ESWA 1ARKA 1HYOA 2VUBA 4WTOB 2GFUA 3CCRT 2C0OA 4J9BA 1NPRA 3WVDB 1W2BA 4M7DG 2CDTA 1N8RR 5HKCA 2JUFA 3NFCA 1KK7A 1WJSA 1Q7YU
chains in the Genus database with same CATH topology
3OYLA 3J81E 1YJNT 3J7AF 1G3TA 2G3RA 3M9QA 5FU7C 3JCMP 3OW2A 2RJCA 2QQ9A 2YHTA 4QQGA 4XQ3A 4C92A 4PJOC 1RI0A 2VYTA 2DXUA 3RKYA 5GAOl 4DA4A 2EAYA 2XD0A 3CCET 3G71A 5GMKl 1YJWT 4Q5WA 1WNLA 3MEWA 1NJIU 1D3BA 4MDXA 1VQ4T 3SFMA 2CYZB 3CC4T 3CD6A 3QXEB 4PL6A 4EMGA 5FRMA 3JB9H 1VQKT 1VQ7T 4C5HA 2EJFA 4JDSA 5GAOq 2RHIA 3PNWC 1FXXA 1RL2A 1UGPB 2P0KA 3A8LB 3MHXA 4JUVA 2EYQA 4PLIA 3S3MA 1KC8U 1K8AU 4PJOF 5I2SA 1Y96B 3JB9J 2L3RA 4A4EA 4ZTFA 2RI2A 4Y91A 3X26B 3F70A 5EG2A 3CCUT 1WQWA 3AHUA 2LCCA 2RHUA 3L2VA 5J3BA 4B9WA 3HRSA 4J6XA 3CC4A 3CD6T 2QQRA 3OBYA 1G3WA 1VQ7A 4XTUA 2LNVA 3S6WA 3QIIA 4OVAA 2H3JA 3GNGA 3BW1A 3JCMd 2ZPFB 3KUFA 4LDUA 4E7IA 1YI2A 3RESA 2XHCA 5C6SA 3PIPA 3CCVT 1VQLT 3CMET 4PJOD 2M16A 3JCMQ 2L89A 2DKGA 4JLGA 3X25B 3ME9A 4M7AE 5GMKi 2VXFA 2YLCA 2JOYA 5GANd 3JB9I 4BDZA 2JTMA 5IAYA 1B34B 3L2ZA 1D3BB 3PFSA 1K73U 1YJWA 2QA4A 3OYEA 1TH7A 3QJ6A 2B8AA 4LDVA 5GAOr 1UGSB 3M55A 3VYGA 1V29B 5HK3A 3OYNA 2OTJT 2CZ7B 2IG0A 2DXTA 3Q1JA 1M1KU 4L5GA 5LJ5j 3FRNA 3ZBDA 4C92C 3CCMT 2P0QA 1KQSS 3OB9A 5LJ5f 3C12A 2HQEA 2DAQA 4HCCA 1U8RA 4M7AC 2HBPA 1Y7XA 2KDSA 1JJ2A 1YITT 2RI3A 4IKFA 4RG2A 4C92B 2BKDN 2DK3A 2OAUA 4PJOG 3MCAB 4M7AB 2LQKA 1NJIC 3OYAA 2KAFA 1K73C 5GANh 2RB6A 4ELYC 3LWHA 2Y4XA 2D9TA 2Y90A 5GAMe 2LC4A 3V8JA 3OA6A 2CKKA 4BDYA 4IURA 1W2BS 1G3YA 4FT2A 4M7AA 4JJNK 4E7LA 1FWZA 5GANe 1VQ9A 2K4YA 4JRIA 2XICA 4KUIA 2XI9A 3QPHA 1Q86C 5D6WA 3VKIA 3CMEA 1X6OA 2Y4YA 1K8AC 3QYHB 3VUBA 4LD6A 4JRQA 3DB4A 3QYGB 4OB3B 2K5FA 4C5GA 4ELZC 4F7UA 1N8RU 5IT9E 2QQAA 4FIBA 3OYCA 1QVFS 3V7SA 3QG1A 2F5TX 5LJ3j 5GAN8 1N9RA 1M8VA 3G6EA 4XTZA 3BDUA 5CIUA 1WPYA 2DXBA 3EAEA 1KHCA 3G7ZA 1H641 2VGMA 3FC3A 4M7AG 1B34A 3MO8A 4M75C 1ZHIA 1IZ6A 2DD5A 5GAN4 4YTLA 2ZPEB 5L8RE 3FLGA 3X20B 1KD1U 4M77C 2JN0A 3G4ST 4M78C 4XU1A 1M4ZA 1EIFA 4HCBA 1N6AA 3V7CA 1PSFA 4P5NA 2O4XA 3PMTA 4J7FA 3I56T 1BIBA 1X75C 3ZFJA 3CCQA 5CO7A 3G6ET 4M77B 1NPPA 2PQWA 2L8DA 3M59A 3META 5CQXA 3JCMh 4A4HA 4JS5A 2DTHA 4OB2B 5GAMj 3TREA 3L2UA 3CCEA 4E7HA 4O6JA 3OSVA 3PIOA 1BI0A 4L59A 3OW2S 5CAIA 3VJPA 3WVEB 3L1AA 3CCRA 3CCVA 4OB0B 5GAN7 4M7DA 3CCSA 3NTIA 5D6XA 2RJDA 2D6FA 2KSSA 4M77E 4Y28E 4J7IA 4UC4A 2MWOA 3EFSA 3KXTA 4X9DA 3JCMc 4OGCA 4E47A 3A8GB 3OYHA 2ZPHB 1I5LA 2BIVA 3OMGA 5GAOm 2DEQA 1G3SA 4C8QA 3C94A 3QZ9B 5GANg 5GMKe 2KQWA 2WSCE 5DM7R 3E9FA 4M75G 3C95A 2GF7A 3VU3C 4NL3A 3RERA 4M7DF 3LYIA 3BDLA 2VGNA 4HA8A 4CRIA 1VQ6A 3OS2A 2CZ1B 1MGQA 4M77G 4M78D 3H6ZA 2HNIA 4ZGJB 2ZZDA 3N5BB 5CKHA 2JVVA 3TEEA 4ZGEB 1YITA 4HT9A 2DTOA 2RHZA 1DJ7B 1Q82C 2M9UA 4BACA 2EQUA 1LJOA 4C8QG 4XU3A 3QJYA 5DLQE 2MAMA 4C8QD 4HT8A 3FJPA 4XU0A 3OS5A 4CI0C 3PTAA 2P4TA 3PGGA 3OQ5A 3URGA 2O4XB 1YIJT 3CXCS 2YRVA 4N0AA 2LVMA 2EFIA 5LJ3f 4BE1A 4M77A 3ER0A 3OYFA 3MP1A 3SB2A 4RG8A 1WQ7A 2RM4A 3RMQA 3OYIA 3JB9D 1M1FA 3M4GA 2AHJB 3OYGA 2XDDA 1KD1C 4FSXA 1VQNT 3CCST 3UDCA 4M7DB 4GLKA 4EMKC 4GY5A 3A8MB 3A8OB 1UGRB 4B9XA 5CR2A 4PNOA 2XDPA 4OF1A 5CKEA 4A4FA 3BY7A 4M77D 4M78G 2DD4A 3X28B 4N0AC 3CCJA 4ME7A 5AYFA 4ZN3A 4C5EA 3LH0A 3LGLA 3SWNC 3QZ5B 3CMAT 2KVQG 2RH2A 4QVZA 5GAN3 1VQPA 4QVCA 3BFMA 4BY6B 5HY6A 2DIGA 2E65A 1VQ5A 2HD0A 4FU6A 4J6WA 2K3XA 2RD1A 3SWNB 3MP8A 3H8ZA 4II1A 1UB4A 3L42A 4N4HA 4C8QC 4F7UE 4V2SA 3V8LA 4JLIA 1YCYA 1KG1A 3RKXA 3JB9G 3HFNA 2BUDA 4LDWA 3SWNA 5A2QE 1KQSA 1SSFA 4C0GA 3VUZA 3RMSA 3RUXA 4C92E 4R55A 3CCMA 3QUIA 5GAOn 2FB7A 3FDRA 3I55A 3QBYA 3CC7T 2ZPIB 1BIAA 4HCZA 5FU6C 3JCMX 1OI1A 5CKBA 1JRIA 1YBYA 4NS5A 4F7UB 5I21A 5DLOA 4R56A 5KCOA 5FRNA 2E41A 3QO3A 3GLXA 3GPLA 3VYHB 1U1TA 5LJ5d 1M1GA 1QVGA 3M4YA 3P8BB 1BKBA 4Z02A 2KY9A 1M5Q1 1YJ9T 4F7UG 3P8DA 4M75E 2RK2A 3QSUA 1BYMA 3LX7A 4TVRA 4ATOA 3A8HB 2CS7A 3PMIA 3TCJA 2E6ZA 4XTVA 5FROA 1S72A 1K9MU 1VIEA 3M5AA 3I55T 3UWNA 4QQDA 3CC7A 2DPPB 3MP6A 2X4WA 3HHTB 2QI2A 5CQYA 4M7AF 4EMKB 5GMKh 5FLXE 3CCQT 1JJ2S 1N27A 2DTIA 2A3LA 3HKSA 3M54A 4C92F 2LCLA 3M56A 2LT4A 2QA4T 2K5IA 2VC8A 2E12A 2HQXA 1YJ9A 5KH6A 4OMFB 4E7JA 4M75D 2VXEA 4C0FA 4J5YA 3OYDA 2RHXA 3JCMJ 3INZA 1U1SA 3HP9A 2PVDB 2XK0A 5LJ5h 4A53A 2XIDA 3DLMA 2PU9B 4MZMA 5KE2A 4C0DB 3FB9A 3O8VA 4XU2A 4BY6C 3GIBA 5J39A 1H3ZA 2E64A 5GAMd 2DZ9A 4XTWA 4IUPA 5DY9A 4X9CA 5J26A 4QQ6A 4A54A 2RO0A 1XNIA 1UEBA 2X4JA 4C8QB 4RCCA 1BI1A 3NTHA 4PJOA 4BI4A 1O9SA 1YHQA 3DB3A 3MEVA 2R5MA 4M75F 1Q86U 1WGSA 1VQNA 2LDMA 1W4SA 1UGQB 3QDRB 4JS4A 4M75B 1OZ3A 1I8FA 4C92D 4N4IA 1N9SA 3E1SA 4ZN1A 2QTXA 2V8JA 5FU6B 2DXCA 1N8RC 3CC2T 4M7AD 3MEUA 1VQ5T 5D6YA 1QVFA 1ZBXA 3SD4A 2P0PA 2V8KA 4IUUA 4EMHA 3LLRA 3RIRA 1I81A 3V8KA 4A4KA 2EKOA 2XDBA 4LD9K 3UT1A 2EIFA 5GAMh 2GFAA 5GAN6 4QVDA 2XU8A 3ZEHA 3HRTA 3GF5A 1BI2A 2QQSA 2RI5A 3J80E 3OYMA 4A4GA 1M9SA 3S3NA 2ZPGB 3OYJA 2EJ9A 2X4YA 2LTOA 4IUVA 1I4K1 3JCMe 1Y96A 3CBOA 4MMKA 2K5LA 4XAXB 1K9MC 5CKDA 2HAXA 3HSBA 2C06A 1OYXA 5A0DA 2EWNA 3FIFA 4PJOE 5GAMf 3NTKA 2I2LA 2QQBA 3JRZA 1VQ8A 4C92G 4XTXA 1Q81C 4MDWA 3CCJT 2ZGWA 3JCMf 4RMOA 2JNGA 3MEAA 2K57A 5GAMg 3GP8A 2GQVA 2IVWA 4KBMB 4C0DC 3TU4K 1VQPT 2EQMA 1WJQA 3HL8A 3M57A 1AHJB 3M58A 3KBGA 4PKCC 3PT9A 2KK4A 4DOVA 1GXIE 2WSFE 4LDYA 3E9GA 3OS1A 4IUQA 4E7KA 2E5QA 1S72T 2CZ0B 1P92A 2RJEA 2KMTA 2RJFA 2FHDA 1QP2A 2O01E 1M90U 1HK9A 1JBMA 2DO3A 2E1HA 3VV0A 3S3OA 5C0MA 3JCMV 4M77F 3CCUA 4M78B 1M1KC 2EQJA 2QXFA 1QVGS 3HRUA 2MWPA 3G71T 2R58A 3X24B 3L2QA 1OZ2A 2M1HA 4M75A 2EQKA 5GANj 5A0LA 4BI3A 3LWIA 5LJ3g 2XG8D 3CMAA 2K2VA 4MZTA 5GANf 4BE0A 2OTLT 3JB9F 4J83A 3CCLA 1VQKA 4HKEA 1VQ6T 1KQ1A 1VQLA 2NLUA 3WXMB 3CXCA 3L2WA 3CBPA 1R8OB 2E6NA 1VQMT 1G5VA 4D6WA 4J6YA 1LOJA 3EFRA 5HK0A 5IN1A 2EJGA 4M7DG 5LJ3d 2V8IA 2WSEE 4C8QE 4C8QF 2X4XA 4XK8E 4KT0E 4RCBA 2FVUA 2RA2A 1YHQT 4NOYA 3M53A 4LDXA 1QW1A 2WACA 4EDUA 2R5AA 1KHIA 5LJ5e 2LRQA 2OTLA 4M78F 4BB7A 3P8HA 3QHSA 3OMCA 2JZ2A 4BD3A 5A0GA 1YJNA 5KE3A 3CPWA 4EMKA 4IUTA 2QEXT 4M7DD 3R6OA 5GAOp 1BI3A 2LQ8A 1VQOT 4O5VA 4PLLA 4ZTJA 2MMPA 2DIQA 1JB0E 3FEOA 2FL7A 4J8OA 3JCMg 1Q7YC 1Q81U 1HXDA 3T9NA 3HPWA 3OY9A 4M78A 1VIFA 4DOWA 3OS0A 5KCHA 3CBMA 4XTYA 4N4GA 3OYYA 1IREB 1FX7A 2A7YA 4KULA 2PUKB 2L5QA 3C4SA 2DZCA 4KUDK 4EPCA 1VUBA 2E70A 4FL6A 3OYBA 3DLLA 5FU7B 1ZQ1A 2LT1A 4F7UF 2QDYB 2RK1A 4MZPA 3OYKA 4ZGDB 2MF2A 1M90C 1VQ8T 4WF2A 1LNXA 3QKJA 5CKFA 4M7DC 5GMKj 4L6V5 3CC2A 1QP3A 2PVGB 3CPWS 4QW2A 4C5IA 3JCMb 1O75A 4JRKA 5LL6S 5CK9A 5I2MA 1KC8C 2M0OA 3LGFA 4BE2A 1XOVA 2FYKA 3GOXA 3OSSC 3RKWA 3UPUA 3JSCA 5M9OA 2CZ6B 2PVOB 1YI2T 1NZ9A 5CVIA 3JCMW 1QVPA 1VQ9T 2R57A 1Y71A 3ASKA 3CEYA 4OB1B 5GAN5 2QEXA 1KQ2A 2E10A 4M78E 4VUBA 2CGHA 5CCAA 1VQOA 2OTJA 3JAME 2F5KA 3I56A 2JTFA 2GCXA 5LJ5g 2LX9A 2D0QB 3CCLT 3SDZA 3HFOA 1MHNA 2DJZA 2PUOB 3L2RA 3A5ZB 1XTDA 2X35A 1XQHA 4FT4A 2F69A 2RHYA 1PSEA 4BUGA 4DQ2A 2K3YA 3CPFA 2XKOC 4OP0A 4X34A 2VUBA 3LW5E 2ZPBB 1Q82U 3GNFB 2GFUA 2MI6A 5GMKm 3CCRT 2ZCFB 2DVEA 4FM4B 4OGEA 5LJ3e 1X01A 5LJ3h 3V7RA 1NPRA 1VQMA 3DKMA 4MMLA 3WVDB 1VQ4A 4JRPA 3OBWA 2VV5A 4BI8B 1W2BA 5HKCA 2YLBA 1NE8A 4C0ZA 4NL2A 2JUFA 1Y07A 3NFCA 5GAN2 3G4SA 1WJSA 1Q7YU 4M7DE 4PJOB 4RKUE 1WJRA 1YIJA 3E19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2V A;  2P0Q A;  3URG A;  2P0P A; 
#chains in the Genus database with same CATH topology
 2L3S A;  3J7A F;  2G3R A;  5FU7 C;  1M3A A;  1SRM A;  2YHT A;  1RI0 A;  3RKY A;  4DA4 A;  2EAY A;  3G71 A;  2O2O A;  4Q5W A;  1D3B A;  4MDX A;  2CYZ B;  1EZZ B;  5FRM A;  2OTJ Q;  2EGA A;  4FYX B;  4C5H A;  4JJB A;  5GAO q;  1JU5 C;  2RHI A;  2P0K A;  3A8L B;  3EG1 A;  4PLI A;  2BE7 D;  2L3R A;  4ZTF A;  2MOX A;  4Y91 A;  2DEU A;  2KXC A;  1WQW A;  2LCC A;  3CC7 Q;  4J6X A;  3EGU A;  3CC4 A;  2KYM A;  1UGV A;  1G8X A;  3S6W A;  1MMN A;  4E7I A;  2LCS A;  1ZBJ A;  5C6S A;  1VQL T;  4PJO D;  3M0T A;  2DKG A;  2DL4 A;  4JLG A;  2GGR A;  2Z0W A;  3ZL7 C;  2D8H A;  1KC8 R;  2VXF A;  5GAN d;  2FEI A;  2EYW A;  4FCY A;  3CXC P;  1GRI A;  3PFS A;  1K73 U;  1YJW A;  2QA4 A;  3QJ6 A;  1PRL C;  2LQN A;  3VYG A;  5HK3 A;  1K9A A;  1VQ7 Q;  2DXT A;  3Q1J A;  1B3Q A;  2I0N A;  3ZBD A;  3CCM T;  1GBR A;  4HCC A;  2DAQ A;  4AG2 C;  2ABL A;  4Z88 A;  1GFC A;  1IHW A;  2DK3 A;  2EKH A;  1M2V B;  2LQK A;  5GAN h;  5GAM e;  1VQM Q;  2HKN A;  1WXT A;  2CKK A;  4M7A A;  1VQ9 A;  5GAN e;  1RAB B;  4KUI A;  1YHQ Q;  1Q86 C;  5D6W A;  4DEX A;  2Y4Y A;  2BZ8 A;  1OPK A;  3QYG B;  4C5G A;  1BCM A;  4ELZ C;  5IT9 E;  3QG1 A;  5LJ3 j;  1N9R A;  2HEQ A;  2D1X A;  2DXB A;  3FC3 A;  4YTL A;  4KGX B;  1GCQ A;  2C0I A;  2FPE A;  1YIT Q;  4XU1 A;  1RAG B;  2FZG B;  1H3H A;  4J7F A;  3PMT A;  3I56 T;  3CCQ A;  3EGD A;  9ATC B;  3M59 A;  5KYW A;  3L2U A;  4E7H A;  3OSV A;  2NUT B;  3CCV A;  3CCS A;  4ANJ A;  2D6F A;  2EW3 A;  4IIM A;  4J7I A;  1AEY A;  4JZ3 A;  3OYH A;  2ZPH B;  1WHJ A;  1WFW A;  2QDL A;  3C94 A;  5GAN g;  4GLM A;  2LX7 A;  3E9F A;  2COY A;  2GF7 A;  3VU3 C;  1X43 A;  4CRI A;  4E7Z A;  1Y0M A;  2K79 A;  2CZ1 B;  4M77 G;  2OAW A;  2EGC A;  2HNI A;  3H6Z A;  4ZGJ B;  2JVV A;  4ZGE B;  1YIT A;  4HT9 A;  1S1N A;  1Q81 R;  1YNZ A;  2M9U A;  4BAC A;  4C8Q G;  1K76 A;  5DLQ E;  4PJL A;  4HT8 A;  4XU0 A;  4J9F A;  3EGD B;  3OQ5 A;  3LH5 A;  3SEM A;  4N0A A;  2LVM A;  4AFS C;  3MP1 A;  1WQ7 A;  2GNC A;  4FSX A;  3UDC A;  4DEY A;  3TSZ A;  2KRN A;  1UGR B;  2HL5 C;  1ZA2 B;  1X6G A;  1G2B A;  1UTI A;  3BY7 A;  2HL3 A;  5AYF A;  1VQO Q;  4C5E A;  3SWN C;  1T0H A;  2RH2 A;  4QVZ A;  2E3H A;  1WHM A;  2YUQ A;  3BFM A;  2E65 A;  1PD1 A;  2DRM A;  1UB4 A;  3QWX X;  2E4H A;  3NGP A;  3HFN A;  3NPF A;  5A2Q E;  1KQS A;  1SSF A;  2DX1 A;  2MCN A;  2DYB A;  3RMS A;  3CCM A;  3I55 A;  1BIA A;  5CKB A;  1JRI A;  5DLO A;  3GPL A;  1M2V A;  4LNP A;  2AIR B;  1M1G A;  2CUB A;  3CME Q;  2MYS A;  4A63 B;  2HDA A;  1BKB A;  3P8D A;  1YI2 Q;  1BYM A;  3LX7 A;  1UHF A;  4ATO A;  2CS7 A;  3PMI A;  2E6Z A;  4XTV A;  1K9M U;  2RN8 A;  3UWN A;  2A36 A;  4R0K A;  1K1Z A;  2QI2 A;  5FLX E;  3HKS A;  2A3L A;  2QA4 T;  2YRD A;  1HD3 A;  1YJ9 A;  5KYU B;  4C0F A;  5L23 A;  3INZ A;  2PVD B;  4A53 A;  3REB B;  2XID A;  1WLP B;  1H3Z A;  2AK5 A;  5DY9 A;  5J26 A;  2RO0 A;  1YJN Q;  1ACM B;  3NTH A;  4PJO A;  1O9S A;  2MIO A;  1BU1 A;  2R5M A;  1W4S A;  1UGQ B;  2LMJ A;  4N4I A;  2DXC A;  1N8R C;  1QVF A;  3SD4 A;  2V8K A;  2HSP A;  5IXB A;  4A4K A;  3UT1 A;  2DA9 A;  5GAN 6;  3ZEH A;  1CKA A;  2QA4 Q;  3HRT A;  1BI2 A;  2RI5 A;  4LN2 A;  3M0S A;  2ZPG B;  3OYJ A;  2EJ9 A;  2X4Y A;  2DJQ A;  4IUV A;  1Y96 A;  3CBO A;  1SG5 A;  1TTH B;  5CKD A;  1OYX A;  1W70 A;  2AZV A;  5A0D A;  2EWN A;  2JS0 A;  3JRZ A;  1VQ8 A;  2GBQ A;  3I5S A;  4MDW A;  4RMO A;  1M1K R;  3MEA A;  2K57 A;  2SRC A;  3U23 A;  1G83 A;  1QCO A;  1U5S A;  1WJQ A;  3HL8 A;  4F17 A;  3PT9 A;  1M90 R;  2E5Q A;  2RJE A;  2L3Q A;  2EYY A;  1HK9 A;  2DO3 A;  3VV0 A;  3M0U A;  2EQJ A;  1QVG S;  3G71 T;  2QG9 B;  3L2Q A;  2RNA A;  1AWX A;  5GAN j;  4BI3 A;  4BE0 A;  2K2V A;  5GAN f;  1RAD B;  3I35 A;  1VQK A;  2NLU A;  3WXM B;  1R8O B;  2W0Z A;  2E6N A;  1G5V A;  3PVQ A;  1RAE B;  4D6W A;  3EFR A;  5IN1 A;  4C8Q F;  4RCB A;  3QWY A;  4HXJ A;  8ATC B;  1QW1 A;  5FWB A;  4M78 F;  1Q86 R;  3P8H A;  3QHS A;  2DLP A;  4M7D D;  2LQ8 A;  1PHT A;  1VYU A;  2YWW A;  1NEG A;  2DIQ A;  1I07 A;  3FEO A;  1Q7Y C;  2DVJ A;  1AZG B;  3CCL Q;  4M78 A;  1VIF A;  2P4R A;  3CBM A;  3OYY A;  1IRE B;  2EPD A;  2PUK B;  4EIK A;  3SHW A;  1VUB A;  3OYB A;  1YWP A;  2XMF A;  1WXB A;  1PM3 A;  2MF2 A;  1M90 C;  4FYV B;  1X27 A;  1VQ8 T;  2FG0 A;  4M7D C;  3CC2 A;  1QP3 A;  2PVG B;  3CPW S;  3JCM b;  2OI3 A;  3LGF A;  4BE2 A;  1RUW A;  4B6M A;  1ZSZ B;  5IHI A;  3H0H A;  1YI2 T;  4RTU A;  2CT4 A;  3CPW P;  1T3L A;  4PFP A;  2R57 A;  3ASK A;  4OB1 B;  5GAN 5;  3EG3 A;  2V26 A;  4M78 E;  5CCA A;  2JTF A;  1VQK Q;  2CSQ A;  1WHH A;  2PUO B;  2J6K A;  3A5Z B;  4FT4 A;  1XTD A;  2DNU A;  3I5R A;  2J6O A;  2XKO C;  4OP0 A;  5GMK m;  1K73 C;  5KYX A;  2NUP A;  3G1J A;  4BI8 B;  1ZSZ A;  2A0F B;  4NL2 A;  4E7S A;  2JJ9 A;  1YJN T;  1K0S A;  1I0C A;  1IO6 A;  2K2M A;  1G3T A;  3M9Q A;  3OW2 A;  2RJC A;  2QQ9 A;  4C92 A;  4IIO A;  3MJX A;  2A28 A;  5GMK l;  1WNL A;  3MEW A;  1OOT A;  1PCX A;  3CC4 T;  3RBB B;  1OEB A;  3CD6 A;  1MV0 B;  4JDS A;  2H3E B;  1UGP B;  4JZ4 A;  5GJV B;  4PJO F;  2FRW A;  1Y96 B;  3JB9 J;  3CCR Q;  2RI2 A;  4LE9 A;  3L2V A;  1Q7Y R;  5J3B A;  3HRS A;  3OBY A;  4LXC A;  1G3W A;  1VQ7 A;  4OVA A;  2H3J A;  3GNG A;  3BW1 A;  4LDU A;  3CQT A;  3CCJ Q;  3QDF A;  3VS3 A;  2M16 A;  4J9H A;  1MMG A;  3X25 B;  3ME9 A;  4M7A E;  2JMC A;  4PK4 A;  1D1B A;  2JOY A;  3JB9 I;  2ECZ A;  3L2Z A;  1D3B B;  2KNB B;  4LDV A;  1W6X A;  2RQT A;  1OU9 A;  1M1K U;  4L5G A;  4C92 C;  1M30 A;  3OB9 A;  3C12 A;  2DER A;  2HMA A;  2ROT A;  1JJ2 A;  2DET A;  4RG2 A;  2BKD N;  3GBQ A;  1R77 A;  3MCA B;  2BE9 B;  1NJI C;  1UUE A;  2KAF A;  3OYA A;  1BK2 A;  2Y4X A;  2Y90 A;  2DL7 A;  2LC4 A;  3V8J A;  4BDY A;  4IUR A;  1G3Y A;  4FT2 A;  3VS4 A;  1FWZ A;  4KH1 B;  2XI9 A;  3M0P A;  5EC7 A;  1K8A C;  1WZO A;  3VUB A;  2CT3 A;  4RTZ A;  3UA6 A;  4JRQ A;  3DB4 A;  2K5F A;  4F7U A;  2O88 A;  3V7S A;  1AZE A;  2F5T X;  5GAN 8;  2DM1 A;  1KHC A;  1H64 1;  2VGM A;  4HVW A;  4LUD A;  2ZPE B;  3FLG A;  2JS2 A;  4Z89 A;  4M77 C;  1EIF A;  1N6A A;  2LZ6 B;  2O4X A;  3ZFJ A;  1ABQ A;  3G6E T;  2J7I A;  3MET A;  5CQX A;  4JS5 A;  1YIJ Q;  4OB2 B;  3TRE A;  1GCQ C;  4O6J A;  3OW2 S;  3VJP A;  4E6R A;  5GAN 7;  3NTI A;  5D6X A;  3VS5 A;  4M77 E;  2BZY A;  2VVK A;  1NLO C;  3UA7 A;  3CCS Q;  2MWO A;  3JCM c;  1I5L A;  2BIV A;  3OMG A;  3RR6 A;  4FYW B;  5GAO m;  1SHG A;  4C8Q A;  5HCK A;  1V1C A;  2EGE A;  2VGN A;  4HA8 A;  3OS2 A;  1MGQ A;  4M78 D;  1CKB A;  1JXO A;  3A1P A;  3N5B B;  5CKH A;  2DTO A;  2RHZ A;  1Q82 C;  1HJD A;  1VQ6 Q;  2EQU A;  1LJO A;  3PVL A;  4XU3 A;  2MAM A;  3FJP A;  4CI0 C;  3PGG A;  2DIL A;  1TUG B;  2NUP B;  2KXD A;  5LJ3 f;  4BE1 A;  1WHL A;  1T3S A;  4M77 A;  3OYI A;  3SB2 A;  4RG8 A;  1B07 A;  3JB9 D;  3M4G A;  1NM7 A;  3OYG A;  1KD1 C;  3CCS T;  4M7D B;  4GY5 A;  4B9X A;  2DMO A;  5CR2 A;  4A4F A;  4M77 D;  2K7A A;  3CCE Q;  3X28 B;  4N0A C;  1YJW Q;  4ME7 A;  2KVQ G;  2P84 A;  5GAN 3;  1VQP A;  2RD1 A;  3MP8 A;  4II1 A;  4C8Q C;  2DRK A;  2BUD A;  3SWN A;  4R55 A;  2FB7 A;  2JM8 A;  3FDR A;  3CC7 T;  1SRL A;  1RAA B;  1YIJ A;  1OI1 A;  2IIM A;  1PKS A;  3REA B;  1D0Y A;  2QYZ A;  5LJ5 d;  2J06 A;  3TSW A;  2KY9 A;  1M5Q 1;  1YJ9 T;  1NG2 A;  3QSU A;  1AD5 A;  3CC2 Q;  2KT1 A;  1UFF A;  1IHV A;  3M5A A;  4JPB W;  4QQD A;  1H8K A;  2DPP B;  2MK5 A;  3MP6 A;  4M7A F;  1JJ2 S;  2CH4 A;  1N27 A;  3M54 A;  2LT4 A;  5KH6 A;  4OMF B;  1K73 R;  4J5Y A;  5LJ5 h;  3IQL A;  1ZSG A;  4C0D B;  4XU2 A;  3GIB A;  2O9V A;  2E64 A;  3RDV A;  1ZA1 B;  1C0M A;  4QQ6 A;  1UEB A;  1BI1 A;  1LPL A;  1WGS A;  1YJ9 Q;  1RAF B;  1ZUY A;  1OZ3 A;  1N9S A;  2V8J A;  3PE0 A;  1ZBX A;  2CP2 A;  1X69 A;  2P0P A;  1Z9Q A;  3CC4 Q;  1K9M R;  3RIR A;  1I81 A;  3D7S B;  1UDL A;  1MV3 A;  3VRZ A;  2X51 A;  2KBT A;  2V1Q A;  8AT1 B;  3BE3 A;  3S3N A;  3JCM e;  1I4K 1;  2K5L A;  2HAX A;  3HSB A;  4RTX A;  2C06 A;  3JV3 A;  2DYI A;  5GAM f;  1AWJ A;  4HVV A;  2ENM A;  2OX7 A;  2ZGW A;  2CRE A;  2GQV A;  2IVW A;  3TU4 K;  1VQP T;  3M57 A;  1AHJ B;  4PKC C;  3KBG A;  4LDY A;  4RTT A;  2O9S A;  4IUQ A;  2CZ0 B;  1ZUK A;  2FHD A;  4HVU A;  1JQQ A;  1M90 U;  1JBM A;  5C0M A;  4M77 F;  3CCU A;  2QXF A;  2R58 A;  2EQK A;  5A0L A;  3LWI A;  5LJ3 g;  1QVG P;  3JB9 F;  4J83 A;  4AFU C;  3HTR A;  2V8I A;  2X4X A;  2K6D A;  5GJW B;  1YFN A;  3M53 A;  4LDX A;  1UHC A;  2KYB A;  2FPD A;  4EDU A;  2R5A A;  2EYX A;  1VQN Q;  4ORZ A;  1TUC A;  2CP6 A;  2JZ2 A;  4BD3 A;  1YJN A;  5KE3 A;  1S72 Q;  1AWO A;  1KQS P;  2QEX T;  1Q95 G;  1BI3 A;  4QT7 A;  1VQO T;  4PLL A;  2JTE A;  1OX8 A;  1Q81 U;  2O31 A;  3T9N A;  4D8K A;  5KCH A;  1RAC B;  1N5Z A;  2L5Q A;  3DLL A;  2MPX C;  2LT1 A;  2RK1 A;  1ZLM A;  3OYK A;  3EFO B;  1PKT A;  5CKF A;  3M0Q A;  1UG1 A;  4QW2 A;  2RMO A;  1IB8 A;  1O75 A;  1XOV A;  3GOX A;  2DL5 A;  3UPU A;  3JSC A;  2KRS A;  1NZ9 A;  3CEY A;  2QEX A;  4VUB A;  1E6H A;  2CGH A;  2HCK A;  3JAM E;  2LX9 A;  2D0Q B;  3CCL T;  3SDZ A;  1B7T A;  3HFO A;  1SHF A;  2DJZ A;  3L2R A;  1XQH A;  1D1C A;  2AZS A;  3LW5 E;  1TSF A;  2MI6 A;  2DVE A;  4FM4 B;  1QVF P;  3THK A;  1GL5 A;  1X01 A;  5LJ3 h;  3V7R A;  1VQM A;  3DKM A;  4MML A;  5IH2 A;  1VQ4 A;  2VV5 A;  2YLB A;  1NE8 A;  4C0Z A;  3VS2 A;  1Y07 A;  4DBR A;  4KGV B;  4M7D E;  4RKU E;  5M9O A;  1WJR A;  1SF9 A;  3E19 A;  2V1R A;  3J81 E;  3OYL A;  2RF0 A;  3JCM P;  4CC3 A;  1VQL Q;  4XQ3 A;  4PJO C;  2VYT A;  5GAO l;  2DXU A;  2XD0 A;  3CCE T;  3H41 A;  1NJI U;  1RLP C;  1VQ4 T;  3SFM A;  1E7O A;  4EMG A;  4PL6 A;  4E2F B;  3JB9 H;  1VQK T;  1VQ7 T;  1YCS B;  2X3W D;  2EJF A;  3PNW C;  1FXX A;  3MHX A;  4JUV A;  3AT1 B;  2LQW A;  1K8A U;  1CSK A;  5I2S A;  2L2P A;  5EG2 A;  3AHU A;  1KFZ A;  3CD6 T;  2BTT A;  2QQR A;  1W1F A;  3QII A;  2RQU A;  2ZPF B;  3KUF A;  2QAZ A;  3CCV T;  3CME T;  2L89 A;  4PJM A;  2E3I A;  3TVT A;  3FJ5 A;  2YLC A;  4BDZ A;  2CP0 A;  1A0N B;  5IAY A;  2COZ A;  2M02 A;  2L3P A;  4KRT A;  1V29 B;  5I22 A;  2IG0 A;  3CCQ Q;  5LJ5 j;  3EG9 A;  1KQS S;  7AT1 B;  5LJ5 f;  2HQE A;  1WXU A;  2HBP A;  1Y7X A;  2KE9 A;  2KDS A;  1YIT T;  4X1V A;  2OTL Q;  1JXM A;  2OAU A;  4PJO G;  4M7A B;  1J3T A;  3H0F A;  1TG0 A;  3G6E Q;  1XJW B;  3OA6 A;  1IRX A;  4JJN K;  1K8A R;  2K4Y A;  1VYV A;  4JRI A;  3QPH A;  1GCP A;  4LD6 A;  2F1L A;  2ATC B;  1N8R U;  2QQA A;  1QWE A;  4D8D A;  4FSS A;  4XTZ A;  5CIU A;  1WPY A;  2DL8 A;  3EAE A;  1LVK A;  4M75 C;  3MO8 A;  4M7A G;  1ZHI A;  2DD5 A;  5GAN 4;  2KRM A;  1WI7 A;  1KD1 U;  4M78 C;  1WHK A;  3NHN A;  1VA7 A;  1NPP A;  2L8D A;  1YN8 A;  4A4H A;  2DTH A;  3I9Q A;  5GAM j;  1VQ8 Q;  2F2V A;  1BI0 A;  4L59 A;  3WVE B;  2DE0 X;  4M7D A;  4Y28 E;  2JM9 A;  1BCO A;  4AT1 B;  2D8J A;  2DEQ A;  1G3S A;  1LCK A;  1VQ9 Q;  5DM7 R;  2DBK A;  3CMA Q;  4Y92 A;  3G71 Q;  1VQ6 A;  4CC2 A;  2ZZD A;  4F16 A;  3G4S Q;  1DJ7 B;  3ULR B;  2VWF A;  3QJY A;  3OS5 A;  3PTA A;  2P4T A;  3URG A;  1YIJ T;  1VYT A;  3CXC S;  2EFI A;  2DL3 A;  1ZSZ C;  2RM4 A;  1M1F A;  1X6B A;  2XDD A;  3UAT A;  4EMK C;  3A8O B;  4PNO A;  2XDP A;  4JJD A;  4OF1 A;  1OV3 A;  4M78 G;  2DD4 A;  3LGL A;  3QZ5 B;  3CMA T;  4BY6 B;  2QAS A;  1BB9 A;  5HY6 A;  5KYN A;  2K3X A;  3SWN B;  3H8Z A;  4N4H A;  4F7U E;  2YT6 A;  1KG1 A;  4JLI A;  1YCY A;  1JO8 A;  1QKX A;  4LDW A;  3VUZ A;  4C92 E;  3RUX A;  3QBY A;  2ZPI B;  4HCZ A;  5FU6 C;  4F7U B;  1YBY A;  5KCO A;  2L0A A;  2KI7 A;  3GLX A;  3VYH B;  1U1T A;  3CCV Q;  3M4Y A;  1RAI B;  3P8B B;  2M51 A;  2LJ1 A;  4Z02 A;  1FMK A;  3VS6 A;  4M75 E;  1MMD A;  2NWM A;  1S72 A;  2GTJ A;  1VIE A;  1R0B G;  3I55 T;  3CC7 A;  2X4W A;  3HHT B;  2RPN A;  5CQY A;  4EMK B;  3MPU B;  3CCQ T;  2DTI A;  3M56 A;  3VS7 A;  2E12 A;  2G6F X;  2HQX A;  4E7J A;  4M75 D;  3JCM J;  3OYD A;  3DLM A;  5IXF A;  5KE2 A;  4BY6 C;  5J39 A;  5GAM d;  2DZ9 A;  4IUP A;  1SEM A;  4X9C A;  1PNJ A;  1XNI A;  4C8Q B;  2AT1 B;  1YHQ A;  3DB3 A;  3MEV A;  1Q86 U;  1UJ0 A;  2LDM A;  2HZY A;  4JS4 A;  1I8F A;  4CC4 B;  2QGF B;  5FU6 B;  4M7A D;  1VQ5 T;  1W2B P;  4EMH A;  4IUU A;  3LLR A;  2JT4 A;  1KJW A;  3V8K A;  1YP5 A;  5AT1 B;  4LD9 K;  2EIF A;  5GAM h;  1QWF A;  2GFA A;  1TOV A;  2QGG A;  2XU8 A;  1TS9 A;  2FZK B;  2GTO A;  1MUZ A;  3J80 E;  3OYM A;  4A4G A;  1M9S A;  4PJJ A;  3H0I A;  4MMK A;  5KYW B;  4FYY B;  3H9N A;  4GBQ A;  3FIF A;  3NTK A;  2I2L A;  4C92 G;  1SPK A;  4XTX A;  1Q81 C;  4RTW A;  3JCM f;  2YXY A;  4KBM B;  3M58 A;  2KK4 A;  4DOV A;  2WSF E;  3OS1 A;  3E9G A;  2KMT A;  1QP2 A;  1M3B A;  2E1H A;  1M1K C;  4M78 B;  4DBQ A;  3HRU A;  2MWP A;  1JEG A;  1GFD A;  4M75 A;  2YUN A;  3EGX B;  2KT8 A;  2OTL T;  2CP7 A;  4HKE A;  1VQ6 T;  3CXC A;  1KSW A;  3L2W A;  1WDX A;  3CBP A;  1TU0 B;  4PFZ A;  4J6Y A;  5HK0 A;  4KT0 E;  5ECA A;  2D0N A;  4NOY A;  2WAC A;  2OTL A;  5LJ5 e;  1M2O A;  4BB7 A;  2J6F A;  5IHN A;  5A0G A;  5D7U A;  1K4U S;  4IUT A;  3R6O A;  1EFN A;  2KRO A;  1C6V X;  4ZTJ A;  2MMP A;  1JB0 E;  2FL7 A;  4J8O A;  1HXD A;  4DOW A;  4N4G A;  2A7Y A;  2CSI A;  3C4S A;  2KEA A;  2E70 A;  1TXQ A;  2FO0 A;  5FU7 B;  2HQH A;  4F7U F;  3EH1 A;  4ESR A;  4MZP A;  3VRY A;  4ZGD B;  2A08 A;  3QKJ A;  2YDL A;  4C5I A;  4JRK A;  5I2M A;  2M0O A;  3OSS C;  2LJ3 A;  2CZ6 B;  5CVI A;  3JCM W;  1QVP A;  1VQ9 T;  2E10 A;  1VQ4 Q;  3I55 Q;  1VQO A;  2OJ2 A;  4K11 A;  5LJ5 g;  1PC0 A;  2X35 A;  2JW4 A;  4J9D A;  2RHY A;  2K3Y A;  3CPF A;  1WX6 A;  2YRC A;  4X34 A;  2ZPB B;  1Q82 U;  3GNF B;  4FW1 A;  2ZCF B;  4OGE A;  5LJ3 e;  4JJC A;  2ROL A;  4JRP A;  3OBW A;  2PTK A;  4OMN A;  5FW9 A;  5GAN 2;  3G4S A;  4AFQ C;  4PJO B;  4OMO A;  4OMQ A;  1NYG A;  1ZX6 A;  2K3B A;  4QQG A;  2YUP A;  1SKU B;  1YJW T;  2LJ0 A;  3C0C A;  3QXE B;  4AFZ C;  2ZAE A;  3CCM Q;  1VOM A;  1RL2 A;  3S3M A;  1KC8 U;  2EYQ A;  4PJN A;  3EH2 A;  4A4E A;  1WA7 A;  4J9G A;  3X26 B;  1OX9 A;  3F70 A;  3CCU T;  2RHU A;  4B9W A;  1K0X A;  4AG1 C;  2K9G A;  1X2Q A;  1FYN A;  4XTU A;  2LNV A;  3JCM d;  1YI2 A;  3RES A;  2XHC A;  3PIP A;  3JCM Q;  2VKN A;  5GMK i;  1VQP Q;  4AMC A;  2JTM A;  3RNJ A;  1B34 B;  1RI9 A;  1I1J A;  2LNH B;  1UE9 A;  1YWO A;  2YUO A;  1TH7 A;  4F14 A;  2B8A A;  3OYE A;  5GAO r;  1UGS B;  3M55 A;  3OYN A;  2OTJ T;  2CZ7 B;  3EGX A;  3FRN A;  2P0Q A;  2GQI A;  1D0X A;  4J9C A;  4J9E A;  5KYU A;  1U8R A;  4M7A C;  2RI3 A;  2F2X A;  1GBQ A;  4IKF A;  4LUE A;  4C92 B;  3CCU Q;  4FW2 A;  3LWH A;  2RB6 A;  4ELY C;  2YSQ A;  2D9T A;  1BBZ A;  1R0C B;  2FZC B;  5KYY A;  1W2B S;  1Z9Z A;  1QLY A;  4E7L A;  1KD1 R;  5KYX B;  2XIC A;  3KFV A;  3VKI A;  3CME A;  1X6O A;  3QYH B;  4OB3 B;  2HKQ B;  4FIB A;  3OYC A;  1QVF S;  1M8V A;  3G6E A;  3BDU A;  3EHR A;  1UEC A;  3G7Z A;  1B34 A;  1IZ6 A;  1KIK A;  5L8R E;  1C1A A;  4F04 B;  3X20 B;  3EG9 B;  2JN0 A;  3G4S T;  1M4Z A;  4HCB A;  3V7C A;  1PSF A;  4P5N A;  1ZUU A;  1BIB A;  1X75 C;  1IGQ A;  5CO7 A;  4M77 B;  1UJY A;  1ABO A;  2PQW A;  5IHK A;  3JCM h;  4RUG A;  1U3O A;  2SEM A;  1MND A;  3CCE A;  2EQI A;  5KYY B;  3PIO A;  2NUT A;  1PWT A;  4OMM A;  5CAI A;  3L1A A;  3CCR A;  4OB0 B;  1WHG A;  1QCN A;  2RJD A;  1IXD A;  2KSS A;  1E6G A;  4UC4 A;  2JXB A;  3EFS A;  3KXT A;  4X9D A;  1PG5 B;  3MKD A;  4OGC A;  4E47 A;  3A8G B;  3TQ7 P;  3EG2 A;  3QZ9 B;  5GMK e;  2KQW A;  2WSC E;  4M75 G;  3C95 A;  3R6N A;  3RER A;  4NL3 A;  4M7D F;  3LYI A;  3BDL A;  1TUD A;  1AWW A;  3TEE A;  4Z8A A;  1EX4 A;  4C8Q D;  4OMP A;  3VS1 A;  2O4X B;  2YRV A;  3ER0 A;  3OYF A;  3RMQ A;  1M3C A;  2CP5 A;  2AHJ B;  1VQN T;  4GLK A;  4QKU A;  3A8M B;  4OML A;  5CKE A;  2QEX Q;  2PZ1 A;  2CUD A;  3CCJ A;  4ZN3 A;  3LH0 A;  4RTY A;  2PNI A;  4QVC A;  2DIG A;  3A98 A;  1VQ5 A;  2HD0 A;  4FU6 A;  4J6W A;  1NBE B;  2ED1 A;  2E5K A;  3L42 A;  4V2S A;  1M27 C;  3V8L A;  3RKX A;  3JB9 G;  2VAS A;  4C0G A;  3QUI A;  5GAO n;  1D09 B;  1AVZ C;  3JCM X;  1FMV A;  3CD6 Q;  4NS5 A;  5I21 A;  4R56 A;  5FRN A;  2E41 A;  3QO3 A;  2CH4 W;  2DFU A;  1QVG A;  1U06 A;  4F7U G;  2RK2 A;  4TVR A;  3A8H B;  3EFO A;  3UF4 A;  3TCJ A;  5FRO A;  1V76 A;  2FRY A;  1FMW A;  1PRM C;  2B86 A;  5GMK h;  4WCI A;  4C92 F;  2LCL A;  2K5I A;  2VC8 A;  2VB6 A;  2VXE A;  1OPL A;  2RHX A;  1U1S A;  2AKK A;  2XK0 A;  3HP9 A;  1WIE A;  2NUZ A;  1QQJ A;  2PU9 B;  4MZM A;  3FB9 A;  3O8V A;  4XTW A;  4ZNX A;  4KGZ B;  1M8M A;  4A54 A;  2IPO B;  2X4J A;  2EBP A;  4RCC A;  2A37 A;  4BI4 A;  4M75 F;  1VQN A;  1TWB A;  1AOJ A;  3QDR B;  1OUL A;  4M75 B;  4C92 D;  4ZN1 A;  3E1S A;  2QTX A;  1IGU A;  3O5Z A;  3CC2 T;  3MEU A;  5D6Y A;  2BZX A;  3NMZ C;  2X3X D;  2XDB A;  2EKO A;  1QCF A;  1H92 A;  4QVD A;  1Y57 A;  1MNE A;  3GF5 A;  2QQS A;  2KR3 A;  2LTO A;  4XAX B;  3I56 Q;  6AT1 B;  1K9M C;  1NEB A;  2COW A;  2NYS A;  4PJO E;  5FWC A;  2QQB A;  3CCJ T;  2JNG A;  5GAM g;  3GP8 A;  4PFO A;  4C0D C;  2QK0 A;  2EQM A;  1NYF A;  1PD0 A;  2DBM A;  3EHQ A;  2JMA A;  5I11 A;  1GXI E;  1X2K A;  1VQ5 Q;  2RQV A;  4E7K A;  1S72 T;  1P92 A;  2X9H A;  2RJF A;  2O01 E;  3S3O A;  3JCM V;  1D0Z A;  3X24 B;  1OZ2 A;  2M1H A;  4M4Z A;  2RQR A;  1F1B B;  1RAH B;  2XG8 D;  3CMA A;  4MZT A;  3CCL A;  2QTV A;  1KQ1 A;  1VQL A;  1NLP C;  1VQM T;  4J9I A;  1LOJ A;  2EJG A;  5LJ3 d;  2WSE E;  4C8Q E;  4XK8 E;  2FVU A;  2RA2 A;  1YHQ T;  1WYX A;  1JJ2 P;  2F2W A;  1KHI A;  2LRQ A;  2HBW A;  1NJI R;  2LP5 A;  3OMC A;  4RTV A;  1MMA A;  3CPW A;  2KGT A;  4EMK A;  1OQK A;  2J05 A;  4DBH A;  5GAO p;  2EYZ A;  4O5V A;  2HSE B;  2CP3 A;  3JCM g;  1HSQ A;  3OY9 A;  3HPW A;  4CC7 A;  3OS0 A;  2ED0 A;  4XTY A;  4KUL A;  1FX7 A;  1QMC A;  2DZC A;  4KUD K;  4EPC A;  2DF6 A;  4FL6 A;  1ZQ1 A;  2QDY B;  3VS0 A;  1AT1 B;  1T0J A;  3EG0 A;  1RLQ C;  1QKW A;  4WF2 A;  1LNX A;  4DBF A;  5GMK j;  4L6V 5;  3E2U A;  5LL6 S;  5CK9 A;  3OW2 P;  1SSH A;  1KC8 C;  2FYK A;  2RQW A;  1OU8 A;  3RKW A;  4KH0 B;  2PVO B;  2W10 A;  1I5O B;  1Y71 A;  2H8H A;  1KQ2 A;  2C0T A;  2OTJ A;  2FPF A;  2F5K A;  3I56 A;  2M0Y A;  2GCX A;  1Q82 R;  1MHN A;  2AKL A;  2EVR A;  3M0R A;  4BUG A;  1D1A A;  4HCK A;  2F69 A;  1PSE A;  4DQ2 A;  2ESW A;  1ARK A;  1HYO A;  2VUB A;  4WTO B;  2GFU A;  3CCR T;  2C0O A;  4J9B A;  1NPR A;  3WVD B;  1W2B A;  4M7D G;  2CDT A;  1N8R R;  5HKC A;  2JUF A;  3NFC A;  1KK7 A;  1WJS A;  1Q7Y U; 
#chains in the Genus database with same CATH homology
 3OYL A;  3J81 E;  1YJN T;  3J7A F;  1G3T A;  2G3R A;  3M9Q A;  5FU7 C;  3JCM P;  3OW2 A;  2RJC A;  2QQ9 A;  2YHT A;  4QQG A;  4XQ3 A;  4C92 A;  4PJO C;  1RI0 A;  2VYT A;  2DXU A;  3RKY A;  5GAO l;  4DA4 A;  2EAY A;  2XD0 A;  3CCE T;  3G71 A;  5GMK l;  1YJW T;  4Q5W A;  1WNL A;  3MEW A;  1NJI U;  1D3B A;  4MDX A;  1VQ4 T;  3SFM A;  2CYZ B;  3CC4 T;  3CD6 A;  3QXE B;  4PL6 A;  4EMG A;  5FRM A;  3JB9 H;  1VQK T;  1VQ7 T;  4C5H A;  2EJF A;  4JDS A;  5GAO q;  2RHI A;  3PNW C;  1FXX A;  1RL2 A;  1UGP B;  2P0K A;  3A8L B;  3MHX A;  4JUV A;  2EYQ A;  4PLI A;  3S3M A;  1KC8 U;  1K8A U;  4PJO F;  5I2S A;  1Y96 B;  3JB9 J;  2L3R A;  4A4E A;  4ZTF A;  2RI2 A;  4Y91 A;  3X26 B;  3F70 A;  5EG2 A;  3CCU T;  1WQW A;  3AHU A;  2LCC A;  2RHU A;  3L2V A;  5J3B A;  4B9W A;  3HRS A;  4J6X A;  3CC4 A;  3CD6 T;  2QQR A;  3OBY A;  1G3W A;  1VQ7 A;  4XTU A;  2LNV A;  3S6W A;  3QII A;  4OVA A;  2H3J A;  3GNG A;  3BW1 A;  3JCM d;  2ZPF B;  3KUF A;  4LDU A;  4E7I A;  1YI2 A;  3RES A;  2XHC A;  5C6S A;  3PIP A;  3CCV T;  1VQL T;  3CME T;  4PJO D;  2M16 A;  3JCM Q;  2L89 A;  2DKG A;  4JLG A;  3X25 B;  3ME9 A;  4M7A E;  5GMK i;  2VXF A;  2YLC A;  2JOY A;  5GAN d;  3JB9 I;  4BDZ A;  2JTM A;  5IAY A;  1B34 B;  3L2Z A;  1D3B B;  3PFS A;  1K73 U;  1YJW A;  2QA4 A;  3OYE A;  1TH7 A;  3QJ6 A;  2B8A A;  4LDV A;  5GAO r;  1UGS B;  3M55 A;  3VYG A;  1V29 B;  5HK3 A;  3OYN A;  2OTJ T;  2CZ7 B;  2IG0 A;  2DXT A;  3Q1J A;  1M1K U;  4L5G A;  5LJ5 j;  3FRN A;  3ZBD A;  4C92 C;  3CCM T;  2P0Q A;  1KQS S;  3OB9 A;  5LJ5 f;  3C12 A;  2HQE A;  2DAQ A;  4HCC A;  1U8R A;  4M7A C;  2HBP A;  1Y7X A;  2KDS A;  1JJ2 A;  1YIT T;  2RI3 A;  4IKF A;  4RG2 A;  4C92 B;  2BKD N;  2DK3 A;  2OAU A;  4PJO G;  3MCA B;  4M7A B;  2LQK A;  1NJI C;  3OYA A;  2KAF A;  1K73 C;  5GAN h;  2RB6 A;  4ELY C;  3LWH A;  2Y4X A;  2D9T A;  2Y90 A;  5GAM e;  2LC4 A;  3V8J A;  3OA6 A;  2CKK A;  4BDY A;  4IUR A;  1W2B S;  1G3Y A;  4FT2 A;  4M7A A;  4JJN K;  4E7L A;  1FWZ A;  5GAN e;  1VQ9 A;  2K4Y A;  4JRI A;  2XIC A;  4KUI A;  2XI9 A;  3QPH A;  1Q86 C;  5D6W A;  3VKI A;  3CME A;  1X6O A;  2Y4Y A;  1K8A C;  3QYH B;  3VUB A;  4LD6 A;  4JRQ A;  3DB4 A;  3QYG B;  4OB3 B;  2K5F A;  4C5G A;  4ELZ C;  4F7U A;  1N8R U;  5IT9 E;  2QQA A;  4FIB A;  3OYC A;  1QVF S;  3V7S A;  3QG1 A;  2F5T X;  5LJ3 j;  5GAN 8;  1N9R A;  1M8V A;  3G6E A;  4XTZ A;  3BDU A;  5CIU A;  1WPY A;  2DXB A;  3EAE A;  1KHC A;  3G7Z A;  1H64 1;  2VGM A;  3FC3 A;  4M7A G;  1B34 A;  3MO8 A;  4M75 C;  1ZHI A;  1IZ6 A;  2DD5 A;  5GAN 4;  4YTL A;  2ZPE B;  5L8R E;  3FLG A;  3X20 B;  1KD1 U;  4M77 C;  2JN0 A;  3G4S T;  4M78 C;  4XU1 A;  1M4Z A;  1EIF A;  4HCB A;  1N6A A;  3V7C A;  1PSF A;  4P5N A;  2O4X A;  3PMT A;  4J7F A;  3I56 T;  1BIB A;  1X75 C;  3ZFJ A;  3CCQ A;  5CO7 A;  3G6E T;  4M77 B;  1NPP A;  2PQW A;  2L8D A;  3M59 A;  3MET A;  5CQX A;  3JCM h;  4A4H A;  4JS5 A;  2DTH A;  4OB2 B;  5GAM j;  3TRE A;  3L2U A;  3CCE A;  4E7H A;  4O6J A;  3OSV A;  3PIO A;  1BI0 A;  4L59 A;  3OW2 S;  5CAI A;  3VJP A;  3WVE B;  3L1A A;  3CCR A;  3CCV A;  4OB0 B;  5GAN 7;  4M7D A;  3CCS A;  3NTI A;  5D6X A;  2RJD A;  2D6F A;  2KSS A;  4M77 E;  4Y28 E;  4J7I A;  4UC4 A;  2MWO A;  3EFS A;  3KXT A;  4X9D A;  3JCM c;  4OGC A;  4E47 A;  3A8G B;  3OYH A;  2ZPH B;  1I5L A;  2BIV A;  3OMG A;  5GAO m;  2DEQ A;  1G3S A;  4C8Q A;  3C94 A;  3QZ9 B;  5GAN g;  5GMK e;  2KQW A;  2WSC E;  5DM7 R;  3E9F A;  4M75 G;  3C95 A;  2GF7 A;  3VU3 C;  4NL3 A;  3RER A;  4M7D F;  3LYI A;  3BDL A;  2VGN A;  4HA8 A;  4CRI A;  1VQ6 A;  3OS2 A;  2CZ1 B;  1MGQ A;  4M77 G;  4M78 D;  3H6Z A;  2HNI A;  4ZGJ B;  2ZZD A;  3N5B B;  5CKH A;  2JVV A;  3TEE A;  4ZGE B;  1YIT A;  4HT9 A;  2DTO A;  2RHZ A;  1DJ7 B;  1Q82 C;  2M9U A;  4BAC A;  2EQU A;  1LJO A;  4C8Q G;  4XU3 A;  3QJY A;  5DLQ E;  2MAM A;  4C8Q D;  4HT8 A;  3FJP A;  4XU0 A;  3OS5 A;  4CI0 C;  3PTA A;  2P4T A;  3PGG A;  3OQ5 A;  3URG A;  2O4X B;  1YIJ T;  3CXC S;  2YRV A;  4N0A A;  2LVM A;  2EFI A;  5LJ3 f;  4BE1 A;  4M77 A;  3ER0 A;  3OYF A;  3MP1 A;  3SB2 A;  4RG8 A;  1WQ7 A;  2RM4 A;  3RMQ A;  3OYI A;  3JB9 D;  1M1F A;  3M4G A;  2AHJ B;  3OYG A;  2XDD A;  1KD1 C;  4FSX A;  1VQN T;  3CCS T;  3UDC A;  4M7D B;  4GLK A;  4EMK C;  4GY5 A;  3A8M B;  3A8O B;  1UGR B;  4B9X A;  5CR2 A;  4PNO A;  2XDP A;  4OF1 A;  5CKE A;  4A4F A;  3BY7 A;  4M77 D;  4M78 G;  2DD4 A;  3X28 B;  4N0A C;  3CCJ A;  4ME7 A;  5AYF A;  4ZN3 A;  4C5E A;  3LH0 A;  3LGL A;  3SWN C;  3QZ5 B;  3CMA T;  2KVQ G;  2RH2 A;  4QVZ A;  5GAN 3;  1VQP A;  4QVC A;  3BFM A;  4BY6 B;  5HY6 A;  2DIG A;  2E65 A;  1VQ5 A;  2HD0 A;  4FU6 A;  4J6W A;  2K3X A;  2RD1 A;  3SWN B;  3MP8 A;  3H8Z A;  4II1 A;  1UB4 A;  3L42 A;  4N4H A;  4C8Q C;  4F7U E;  4V2S A;  3V8L A;  4JLI A;  1YCY A;  1KG1 A;  3RKX A;  3JB9 G;  3HFN A;  2BUD A;  4LDW A;  3SWN A;  5A2Q E;  1KQS A;  1SSF A;  4C0G A;  3VUZ A;  3RMS A;  3RUX A;  4C92 E;  4R55 A;  3CCM A;  3QUI A;  5GAO n;  2FB7 A;  3FDR A;  3I55 A;  3QBY A;  3CC7 T;  2ZPI B;  1BIA A;  4HCZ A;  5FU6 C;  3JCM X;  1OI1 A;  5CKB A;  1JRI A;  1YBY A;  4NS5 A;  4F7U B;  5I21 A;  5DLO A;  4R56 A;  5KCO A;  5FRN A;  2E41 A;  3QO3 A;  3GLX A;  3GPL A;  3VYH B;  1U1T A;  5LJ5 d;  1M1G A;  1QVG A;  3M4Y A;  3P8B B;  1BKB A;  4Z02 A;  2KY9 A;  1M5Q 1;  1YJ9 T;  4F7U G;  3P8D A;  4M75 E;  2RK2 A;  3QSU A;  1BYM A;  3LX7 A;  4TVR A;  4ATO A;  3A8H B;  2CS7 A;  3PMI A;  3TCJ A;  2E6Z A;  4XTV A;  5FRO A;  1S72 A;  1K9M U;  1VIE A;  3M5A A;  3I55 T;  3UWN A;  4QQD A;  3CC7 A;  2DPP B;  3MP6 A;  2X4W A;  3HHT B;  2QI2 A;  5CQY A;  4M7A F;  4EMK B;  5GMK h;  5FLX E;  3CCQ T;  1JJ2 S;  1N27 A;  2DTI A;  2A3L A;  3HKS A;  3M54 A;  4C92 F;  2LCL A;  3M56 A;  2LT4 A;  2QA4 T;  2K5I A;  2VC8 A;  2E12 A;  2HQX A;  1YJ9 A;  5KH6 A;  4OMF B;  4E7J A;  4M75 D;  2VXE A;  4C0F A;  4J5Y A;  3OYD A;  2RHX A;  3JCM J;  3INZ A;  1U1S A;  3HP9 A;  2PVD B;  2XK0 A;  5LJ5 h;  4A53 A;  2XID A;  3DLM A;  2PU9 B;  4MZM A;  5KE2 A;  4C0D B;  3FB9 A;  3O8V A;  4XU2 A;  4BY6 C;  3GIB A;  5J39 A;  1H3Z A;  2E64 A;  5GAM d;  2DZ9 A;  4XTW A;  4IUP A;  5DY9 A;  4X9C A;  5J26 A;  4QQ6 A;  4A54 A;  2RO0 A;  1XNI A;  1UEB A;  2X4J A;  4C8Q B;  4RCC A;  1BI1 A;  3NTH A;  4PJO A;  4BI4 A;  1O9S A;  1YHQ A;  3DB3 A;  3MEV A;  2R5M A;  4M75 F;  1Q86 U;  1WGS A;  1VQN A;  2LDM A;  1W4S A;  1UGQ B;  3QDR B;  4JS4 A;  4M75 B;  1OZ3 A;  1I8F A;  4C92 D;  4N4I A;  1N9S A;  3E1S A;  4ZN1 A;  2QTX A;  2V8J A;  5FU6 B;  2DXC A;  1N8R C;  3CC2 T;  4M7A D;  3MEU A;  1VQ5 T;  5D6Y A;  1QVF A;  1ZBX A;  3SD4 A;  2P0P A;  2V8K A;  4IUU A;  4EMH A;  3LLR A;  3RIR A;  1I81 A;  3V8K A;  4A4K A;  2EKO A;  2XDB A;  4LD9 K;  3UT1 A;  2EIF A;  5GAM h;  2GFA A;  5GAN 6;  4QVD A;  2XU8 A;  3ZEH A;  3HRT A;  3GF5 A;  1BI2 A;  2QQS A;  2RI5 A;  3J80 E;  3OYM A;  4A4G A;  1M9S A;  3S3N A;  2ZPG B;  3OYJ A;  2EJ9 A;  2X4Y A;  2LTO A;  4IUV A;  1I4K 1;  3JCM e;  1Y96 A;  3CBO A;  4MMK A;  2K5L A;  4XAX B;  1K9M C;  5CKD A;  2HAX A;  3HSB A;  2C06 A;  1OYX A;  5A0D A;  2EWN A;  3FIF A;  4PJO E;  5GAM f;  3NTK A;  2I2L A;  2QQB A;  3JRZ A;  1VQ8 A;  4C92 G;  4XTX A;  1Q81 C;  4MDW A;  3CCJ T;  2ZGW A;  3JCM f;  4RMO A;  2JNG A;  3MEA A;  2K57 A;  5GAM g;  3GP8 A;  2GQV A;  2IVW A;  4KBM B;  4C0D C;  3TU4 K;  1VQP T;  2EQM A;  1WJQ A;  3HL8 A;  3M57 A;  1AHJ B;  3M58 A;  3KBG A;  4PKC C;  3PT9 A;  2KK4 A;  4DOV A;  1GXI E;  2WSF E;  4LDY A;  3E9G A;  3OS1 A;  4IUQ A;  4E7K A;  2E5Q A;  1S72 T;  2CZ0 B;  1P92 A;  2RJE A;  2KMT A;  2RJF A;  2FHD A;  1QP2 A;  2O01 E;  1M90 U;  1HK9 A;  1JBM A;  2DO3 A;  2E1H A;  3VV0 A;  3S3O A;  5C0M A;  3JCM V;  4M77 F;  3CCU A;  4M78 B;  1M1K C;  2EQJ A;  2QXF A;  1QVG S;  3HRU A;  2MWP A;  3G71 T;  2R58 A;  3X24 B;  3L2Q A;  1OZ2 A;  2M1H A;  4M75 A;  2EQK A;  5GAN j;  5A0L A;  4BI3 A;  3LWI A;  5LJ3 g;  2XG8 D;  3CMA A;  2K2V A;  4MZT A;  5GAN f;  4BE0 A;  2OTL T;  3JB9 F;  4J83 A;  3CCL A;  1VQK A;  4HKE A;  1VQ6 T;  1KQ1 A;  1VQL A;  2NLU A;  3WXM B;  3CXC A;  3L2W A;  3CBP A;  1R8O B;  2E6N A;  1VQM T;  1G5V A;  4D6W A;  4J6Y A;  1LOJ A;  3EFR A;  5HK0 A;  5IN1 A;  2EJG A;  4M7D G;  5LJ3 d;  2V8I A;  2WSE E;  4C8Q E;  4C8Q F;  2X4X A;  4XK8 E;  4KT0 E;  4RCB A;  2FVU A;  2RA2 A;  1YHQ T;  4NOY A;  3M53 A;  4LDX A;  1QW1 A;  2WAC A;  4EDU A;  2R5A A;  1KHI A;  5LJ5 e;  2LRQ A;  2OTL A;  4M78 F;  4BB7 A;  3P8H A;  3QHS A;  3OMC A;  2JZ2 A;  4BD3 A;  5A0G A;  1YJN A;  5KE3 A;  3CPW A;  4EMK A;  4IUT A;  2QEX T;  4M7D D;  3R6O A;  5GAO p;  1BI3 A;  2LQ8 A;  1VQO T;  4O5V A;  4PLL A;  4ZTJ A;  2MMP A;  2DIQ A;  1JB0 E;  3FEO A;  2FL7 A;  4J8O A;  3JCM g;  1Q7Y C;  1Q81 U;  1HXD A;  3T9N A;  3HPW A;  3OY9 A;  4M78 A;  1VIF A;  4DOW A;  3OS0 A;  5KCH A;  3CBM A;  4XTY A;  4N4G A;  3OYY A;  1IRE B;  1FX7 A;  2A7Y A;  4KUL A;  2PUK B;  2L5Q A;  3C4S A;  2DZC A;  4KUD K;  4EPC A;  1VUB A;  2E70 A;  4FL6 A;  3OYB A;  3DLL A;  5FU7 B;  1ZQ1 A;  2LT1 A;  4F7U F;  2QDY B;  2RK1 A;  4MZP A;  3OYK A;  4ZGD B;  2MF2 A;  1M90 C;  1VQ8 T;  4WF2 A;  1LNX A;  3QKJ A;  5CKF A;  4M7D C;  5GMK j;  4L6V 5;  3CC2 A;  1QP3 A;  2PVG B;  3CPW S;  4QW2 A;  4C5I A;  3JCM b;  1O75 A;  4JRK A;  5LL6 S;  5CK9 A;  5I2M A;  1KC8 C;  2M0O A;  3LGF A;  4BE2 A;  1XOV A;  2FYK A;  3GOX A;  3OSS C;  3RKW A;  3UPU A;  3JSC A;  5M9O A;  2CZ6 B;  2PVO B;  1YI2 T;  1NZ9 A;  5CVI A;  3JCM W;  1QVP A;  1VQ9 T;  2R57 A;  1Y71 A;  3ASK A;  3CEY A;  4OB1 B;  5GAN 5;  2QEX A;  1KQ2 A;  2E10 A;  4M78 E;  4VUB A;  2CGH A;  5CCA A;  1VQO A;  2OTJ A;  3JAM E;  2F5K A;  3I56 A;  2JTF A;  2GCX A;  5LJ5 g;  2LX9 A;  2D0Q B;  3CCL T;  3SDZ A;  3HFO A;  1MHN A;  2DJZ A;  2PUO B;  3L2R A;  3A5Z B;  1XTD A;  2X35 A;  1XQH A;  4FT4 A;  2F69 A;  2RHY A;  1PSE A;  4BUG A;  4DQ2 A;  2K3Y A;  3CPF A;  2XKO C;  4OP0 A;  4X34 A;  2VUB A;  3LW5 E;  2ZPB B;  1Q82 U;  3GNF B;  2GFU A;  2MI6 A;  5GMK m;  3CCR T;  2ZCF B;  2DVE A;  4FM4 B;  4OGE A;  5LJ3 e;  1X01 A;  5LJ3 h;  3V7R A;  1NPR A;  1VQM A;  3DKM A;  4MML A;  3WVD B;  1VQ4 A;  4JRP A;  3OBW A;  2VV5 A;  4BI8 B;  1W2B A;  5HKC A;  2YLB A;  1NE8 A;  4C0Z A;  4NL2 A;  2JUF A;  1Y07 A;  3NFC A;  5GAN 2;  3G4S A;  1WJS A;  1Q7Y U;  4M7D E;  4PJO B;  4RKU E;  1WJR A;  1YIJ A;  3E19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...