2P0PA

Calcium binding protein in the free form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
molecule keywords Alr1010 protein
source organism Nostoc sp.
molecule tags Metal binding protein
total genus 40
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0pA02
2K2VA 3URGA 2P0PA 2P0QA
chains in the Genus database with same CATH superfamily
3TQ7P 1T0HA 2E5QA 1IREB 3JCMf 3O5ZA 2COYA 2VGNA 1MMGA 3FLGA 3LGFA 1KQ2A 5GAN7 2O9SA 2KT1A 3OYEA 1OPKA 2RQWA 1RADB 5GAMg 3L1AA 2NWMA 4M75F 4M7AE 4DBQA 2VASA 4ZNXA 4J9HA 4A53A 3SD4A 4PLIA 4JLGA 1VQMA 4OVAA 2EYZA 1A0NB 3MP8A 3SB2A 3BW1A 4J9EA 2YT6A 5C6SA 2VKNA 5GAN2 1VQMQ 3BY7A 1X6GA 4J9FA 2QDYB 4LD9K 3JRZA 3NTKA 4EMKB 5KE2A 1VQ9A 3OS2A 2DLPA 2RI5A 4J7IA 4JDSA 3ZEHA 2YWWA 4C8QE 1M90U 2LDMA 4QW2A 1EIFA 4M77A 3MKDA 5LJ3h 5IH2A 2ZCFB 3A8LB 3CCRT 1KIKA 3PTAA 5J26A 1UGQB 2X4YA 3OYMA 2G3RA 4Y91A 1MHNA 2FG0A 4RCCA 4DEYA 1LOJA 5LJ3j 1M1FA 4XTWA 5FRNA 1AZGB 2DVJA 2L3SA 3OYHA 3OYYA 4Z8AA 2LJ1A 2DXCA 4FCYA 5FLXE 1OI1A 4PJLA 2JNGA 3EFRA 1NPRA 4ME7A 2XICA 3PFSA 2KR3A 2KROA 5KYWB 3META 1ABQA 4ANJA 1AWWA 1YITT 2DM1A 4ZTJA 2XG8D 3OYKA 2LVMA 3LLRA 2QQSA 1PRLC 1W2BP 3I56T 3HRTA 3CD6A 4M7AD 2RJCA 2FO0A 2AZSA 1DJ7B 1NJIU 3CD6Q 3HP9A 1WXBA 3DB3A 5LJ5f 4JLIA 1Q81R 1PG5B 3RMQA 4A63B 2K2MA 1UEBA 3NTIA 3QKJA 1KD1C 5IT9E 4HCKA 3OB9A 3S3MA 4NL2A 1VQ7T 2X51A 4K11A 2GQVA 2ZPIB 3OBWA 4E2FB 2WSFE 4AMCA 2RN8A 1MNEA 3G6EA 1BU1A 4AT1B 1K73U 3CMAA 3EG1A 3G6EQ 4LUEA 3WVEB 5KCOA 3TVTA 3CXCP 2E65A 5GAN4 2VGMA 4DA4A 3CMAQ 1CSKA 2NUPB 3KBGA 3JCMd 3JB9F 1WZOA 3CBPA 1ABOA 1IGQA 2HCKA 3L2ZA 4FL6A 1I1JA 3QWXX 1I81A 2LTOA 2LCCA 2E6NA 4MZTA 2KGTA 3OW2P 4ESRA 5GAOn 1TTHB 4AFUC 4OMOA 1XOVA 5GAMf 1IRXA 1KJWA 2KK4A 3CCSA 1OV3A 3OYAA 2ED0A 3GF5A 4RKUE 1OU8A 3CCSQ 2R57A 5CKEA 1PKTA 4EMKA 2DFUA 5GMKe 1IXDA 4X9CA 2BE7D 4O6JA 1RAGB 4RTUA 3X20B 4M78G 1G3TA 3MEVA 2LQNA 1GBRA 1Q7YR 2EKOA 1M1KC 3R6NA 1Y07A 4M7DG 2DA9A 2A36A 4F7UA 5L8RE 4KT0E 4MDXA 1YJWT 4AG1C 2HKQB 2QGGA 1BK2A 4M77E 1N5ZA 3UWNA 4XTXA 2J06A 1KQSS 1PD0A 2CP7A 4IIOA 1WDXA 3VYGA 4PJOE 1IO6A 5KYXB 4A4FA 2D8HA 3H9NA 1K1ZA 1VQKA 2HAXA 2L89A 3E1SA 1K9MU 3GLXA 3L42A 1AT1B 3QBYA 5KYWA 4FYWB 2ED1A 1M5Q1 2BZYA 2COZA 2FPEA 5FRMA 2DJZA 1VQKQ 5DLQE 3V7SA 4C92E 2YRVA 4BI8B 4ZGEB 2JXBA 3FEOA 1KSWA 1NLPC 1JBMA 2QK0A 1TWBA 1Y96B 2PVDB 2O9VA 1VQ9T 4JRKA 2HZYA 1QP2A 1RLPC 4L59A 1HSQA 1TS9A 4F7UG 4J6WA 3J80E 2EQKA 3HL8A 5CKDA 4KH0B 4JJNK 2DE0X 3OW2A 3U23A 2RMOA 3QZ5B 2A37A 5LJ5d 3INZA 2HDAA 1VQPA 1V29B 4E7HA 1O9SA 1Y7XA 2KRMA 1Q86C 1F1BB 1QLYA 2O4XB 3FB9A 3EH1A 3TREA 1VQPQ 4F14A 3I9QA 3G4SA 2JMCA 3BE3A 3EG2A 1ZA1B 4E7JA 2JMAA 2JTMA 2RF0A 4XU1A 5GANd 3TU4K 1IHWA 3CCJA 3G4SQ 3CCLA 2RI3A 4JUVA 2GGRA 4M75D 3CCJQ 2CREA 2DILA 3A8GB 3CCLQ 1AEYA 3LGLA 5GAN3 2DL8A 4E47A 1JRIA 2RHUA 4P5NA 1E7OA 1BBZA 2LRQA 2NUPA 1EFNA 1M1GA 4B9WA 2A0FB 1MMNA 4XTVA 5DLOA 4N4IA 5M9OA 2Y4YA 1K9AA 1LVKA 3QYGB 2P0KA 2EBPA 2MIOA 1QCNA 2CUBA 2YHTA 2KRSA 2EYYA 2RK1A 3DLLA 4PJOD 2RJFA 3Q1JA 3TEEA 3SEMA 2KMTA 4L6V5 4CI0C 3EGXB 4GY5A 2H8HA 2ZPBB 1Y0MA 3X26B 4C92D 2L0AA 2EGAA 1U8RA 2O88A 2EYQA 4M7AF 3G6ET 3JB9I 1VUBA 2LMJA 3CMAT 1XNIA 2EVRA 2RJEA 2MOXA 4KUIA 3OSVA 4AFSC 2MAMA 1UGRB 2DPPB 2HKNA 2RK2A 2K4YA 4J83A 2OX7A 3LW5E 2H3EB 1QVGS 2AKKA 2XI9A 4FSXA 1PC0A 2K5LA 1X27A 2KY9A 2M16A 4ZN1A 4FYVB 2BIVA 4EDUA 1YJNA 4C8QF 1B07A 3RNJA 3M0PA 3MPUB 3G71A 3OYDA 2EWNA 2F2XA 1BI0A 5GAN5 3CCVA 2EKHA 1D0XA 3M0RA 4JZ3A 1YBYA 1M4ZA 3J81E 3E9GA 3G71Q 1KC8C 2QQRA 1AWXA 2R5MA 4NOYA 1WFWA 1Q82C 4IKFA 3EGUA 2KQWA 3CCST 3CCVQ 1MMAA 2CP5A 1K0SA 2QDLA 1N8RR 4J6YA 3I55A 4PFOA 3CMEA 4D6WA 1I0CA 3VRYA 4N4HA 4VUBA 5IN1A 1Y96A 1Y57A 2RM4A 3JCMb 3M58A 3I55Q 3CMEQ 4HCZA 1WNLA 3HPWA 2F69A 3PMTA 3BFMA 5C0MA 2M51A 3EFOA 3CC4A 4OB2B 3CCUA 1G83A 2KYBA 2DKGA 4QQ6A 2DIGA 3CC4Q 3CCUQ 1UE9A 2LC4A 2O4XA 5GMKi 3OA6A 1G5VA 2PVGB 5HK3A 1RLQC 5LJ3e 3BDUA 3CCEA 2K79A 4M78C 2R58A 4LDVA 5GAN6 4QKUA 1YWPA 1VYVA 3CCEQ 3NGPA 4J9BA 4XTUA 1VQKT 1D0YA 4M7DC 1JJ2P 3C94A 4KGXB 2O2OA 1K8AR 3OS5A 3A5ZB 5GANh 2JN0A 1WHKA 1Q7YC 4BD3A 1AZEA 1UHFA 2ROTA 1QKWA 2D0NA 1M3AA 3QZ9B 4BDZA 1OZ2A 2RHXA 3FC3A 2X35A 2CGHA 2BKDN 1IZ6A 4OMPA 2E6ZA 4GBQA 2RNAA 3M53A 1YCSB 1VYUA 5GANj 2EGEA 1M1KU 4A54A 1K0XA 3M57A 4OP0A 3G4ST 3H0IA 3MEAA 2EQJA 2GNCA 2DXUA 1S1NA 3CCJT 1J3TA 2NLUA 3PIPA 3CCLT 2YUQA 3EG9A 3LH0A 1KK7A 2SEMA 2KDSA 1D0ZA 2Z0WA 1WJRA 5HK0A 2COWA 1VA7A 5HCKA 2HBPA 4ELZC 3G7ZA 1LCKA 1I4K1 4M78B 3CC7A 1H3ZA 2ATCB 3A1PA 2QQBA 2JS2A 2L3RA 4FYYB 3V8JA 4M7DB 4LNPA 4NL3A 1SHGA 3CC7Q 1AHJB 2L3QA 2CP0A 1QCOA 4CC7A 4D8DA 5A0LA 1ACMB 2BZXA 2HL5C 4RCBA 5FWBA 4DBHA 2RH2A 5IXBA 2EQIA 5EC7A 3CC2A 3JCMQ 5KYUA 1T0JA 2QXFA 3M56A 4IUVA 4M77F 4EMHA 2A3LA 4ZN3A 2RHIA 1Q86U 3CC2Q 4LDXA 5DM7R 4RTXA 4KGVB 1WGSA 1GFCA 4XU2A 2HQXA 4II1A 1QCFA 2Y90A 3CPWS 1C6VX 4PJOF 3EH2A 3OYNA 4HVVA 1D1BA 2K3XA 4J8OA 2ZPGB 4XTYA 4XTZA 3G1JA 3L2VA 3RKXA 1B3QA 1S72A 4V2SA 4DOWA 2KNBB 2VXEA 4E7ZA 2M1HA 2QTVA 1S72Q 4F7UB 1C1AA 1M90R 4C92F 2GFAA 2RHYA 1JO8A 1U3OA 3I35A 5FW9A 4A4EA 4JRPA 4IURA 3H0FA 1JXOA 2D8JA 2MF2A 1QQJA 3CPWP 2P0QA 1YJNT 2O01E 3PMIA 4DQ2A 2DAQA 3LX7A 3QG1A 3OMGA 2XU8A 1X6BA 2KBTA 3G71T 8AT1B 4GLMA 4FIBA 3CCVT 2LNHB 2D6FA 3GNGA 2MYSA 1KHIA 2YLCA 2YUPA 4EIKA 2PQWA 2BTTA 4KH1B 3VS5A 4QQGA 3M4GA 4RMOA 3I55T 3CMET 3NFCA 4BUGA 4CC2A 1BCOA 4OMLA 5CQXA 2B8AA 2NUTB 2KRNA 1UB4A 4JRQA 1PRMC 5GMKl 4X9DA 1MMDA 2KAFA 1BYMA 5I2MA 4MDWA 5LJ3g 2XDBA 2VB6A 1M30A 4M75G 4WCIA 2A28A 2DBKA 2CZ6B 2X4WA 3CC4T 3S6WA 3UPUA 1N27A 1M3BA 3FJPA 5A0DA 1H3HA 3VV0A 1BIBA 1SG5A 1W4SA 4PLLA 2HQEA 3HKSA 4E7KA 1XQHA 5GAN8 4J9DA 2JUFA 1N8RC 2DD4A 2ECZA 3CQTA 3RDVA 5A2QE 1QKXA 4C8QD 2HD0A 2ESWA 3X28B 4PKCC 4ZGJB 1W1FA 1MNDA 2W0ZA 3KXTA 1E6GA 2X4JA 1AWJA 2KSSA 5LL6S 1KC8U 1OQKA 1Q82U 2QQ9A 4M78A 3UF4A 4C5EA 1MUZA 1VQOA 1WX6A 4XK8E 4M7DA 2GCXA 3LH5A 1RL2A 2L8DA 2HEQA 4M7AC 1VQOQ 1ZLMA 2E10A 3M9QA 2V8IA 3QDRB 2DF6A 1RAEB 1YJ9A 2V1RA 3OSSC 1YI2A 1QW1A 2DERA 1YJ9Q 3JV3A 4BY6C 3A98A 3MP6A 2BE9B 4JRIA 1YI2Q 5KCHA 4BE2A 3JCMW 2YUOA 3M0QA 1K8AC 1XTDA 3H8ZA 3RBBB 3TCJA 3VS0A 1VQNA 3H6ZA 2C0OA 1W2BA 2NYSA 2P0PA 4RTTA 2RHZA 2EQMA 1GCQA 1VQNQ 4R0KA 2LJ0A 2EW3A 4J9CA 3CC7T 2I0NA 2DJQA 2H3JA 4KUDK 1JQQA 1Q7YU 3EHRA 9ATCB 1RAIB 3VS4A 1AOJA 4B9XA 4KRTA 1QMCA 4PJJA 3HFNA 2DK3A 3JCMc 1UJYA 5D7UA 1NEGA 3I5RA 1TUDA 4AFZC 4M7AB 2CT3A 1VQMT 1TH7A 3CXCA 2SRCA 1JEGA 3JB9G 1K9MR 4LUDA 2PUOB 2NUTA 4O5VA 3S3OA 2JM8A 1RACB 1KQSP 1UDLA 4IUQA 2D0QB 4IUUA 4BY6B 1WHHA 1KFZA 1MV0B 4PNOA 4PJNA 1WA7A 2HQHA 1WXUA 1VQ6A 1S72T 3MEUA 1NLOC 2FZKB 3V7CA 1OZ3A 1WHGA 2J7IA 3SFMA 3EFOB 1PCXA 2RO0A 1VQ6Q 4FW2A 5LJ3f 3OS0A 4LDWA 5IHKA 4RUGA 2PZ1A 2DVEA 4KULA 1X69A 1NM7A 3M55A 1YHQA 3WXMB 4Q5WA 2EYXA 2MPXC 5CIUA 2BUDA 3UDCA 1YHQQ 3HHTB 4X1VA 2DL4A 3H41A 4JS4A 5AT1B 3ULRB 2HL3A 1YIJA 1D09B 2X3XD 2EJFA 3A8OB 3EFSA 4FT4A 2RB6A 2X9HA 1UGVA 1YIJQ 3X24B 2C0IA 1M8MA 2IVWA 4C0DC 4QVDA 4M77D 1G8XA 2HSPA 2LNVA 3VS2A 4DBRA 2XDDA 2ZPFB 4CC4B 1VIFA 4M78E 2LT4A 1GXIE 2DEUA 5A0GA 3CD6T 4JPBW 5GANe 4ATOA 3JCMh 4M7DE 4OB3B 3L2QA 2QG9B 2EIFA 5GAOr 5GAMd 5J39A 1QVFS 3URGA 1BKBA 2CSIA 3PGGA 4C5GA 1UGSB 2M0OA 2CP2A 1YWOA 2E5KA 2LT1A 4C5HA 2GF7A 1KG1A 2DYBA 2AT1B 1QWFA 4A4KA 1H641 2ENMA 1WHMA 3EAEA 4M75C 1TUCA 2JS0A 2PU9B 3EG9B 2DRMA 2FZGB 4HCBA 2HSEB 2B86A 1OULA 1PM3A 2D1XA 2EPDA 4MZPA 2L5QA 3DLMA 4M4ZA 3F70A 1BI1A 1NE8A 4OGCA 1VQOT 3GOXA 2QASA 1UECA 1YN8A 5EG2A 1Q81C 1U5SA 2D9TA 2LCLA 3JCMg 4F7UE 4PJOC 2X3WD 3OYJA 1QVPA 3VJPA 4AG2C 2ZPEB 3OBYA 1YJ9T 4C0DB 4HT8A 4QVCA 4L5GA 1VQ8A 3T9NA 2MWPA 1YI2T 2V8JA 4M7AA 4BI3A 1VQ8Q 5KYUB 2BZ8A 4X34A 4E7SA 2XIDA 2E64A 1QVGP 2K9GA 1KD1U 1WIEA 2EGCA 3OYLA 1ZX6A 3FRNA 1I5OB 2WSCE 5IAYA 2CS7A 4Z89A 1VQNT 4OB0B 5CKFA 2RPNA 1N8RU 3JCMJ 2DXBA 3SWNA 1YITA 1TOVA 1X2QA 5GAOp 1VQ5A 5LJ3d 3TSZA 2GQIA 1Z9QA 4M75B 3QJ6A 2VWFA 3C12A 1BIAA 3KUFA 4Y92A 1YITQ 1VQ5Q 4J9IA 2DMOA 3RUXA 3REBB 2FVUA 3GP8A 1WJSA 1H8KA 4M7AG 5LJ5h 5GMKm 2CDTA 4XU0A 3UATA 4ZTFA 1X43A 2F5TX 4LDYA 4E6RA 2I2LA 3PT9A 3FIFA 4F04B 1T3LA 4NS5A 4PJOB 1WQWA 2J6FA 2P4RA 1BB9A 4RTZA 1VQ7A 2JT4A 2HMAA 3QYHB 1AD5A 3L2UA 4C0FA 5GJVB 2AHJB 3RR6A 1ZA2B 5LJ5j 1VQ7Q 1VQLA 1U1TA 4R55A 5KYNA 2A08A 2IG0A 2CKKA 1VQLQ 4C8QG 3RERA 5IHNA 1VQ6T 3OMCA 2F2WA 1WYXA 1UUEA 1BI2A 4BE1A 1SF9A 2PUKB 4KGZB 1FYNA 3M0SA 2KE9A 1VQPT 1LJOA 3AHUA 2DYIA 2JW4A 2JJ9A 2EAYA 1WHLA 3QPHA 2FHDA 1YHQT 2KXDA 1M1KR 1QVGA 5LJ5g 4PJMA 1VYTA 1GCQC 1TUGB 2JM9A 3ASKA 2V1QA 2C06A 2K57A 3ZL7C 2ZZDA 4B6MA 1B34B 4MZMA 4MMLA 1JXMA 2GTOA 5I2SA 5KYYB 1UGPB 2M0YA 5GANg 3MP1A 3NTHA 4IUTA 4WF2A 4HCCA 1OEBA 4CRIA 2YLBA 1PSFA 3ZFJA 3CCQA 5CCAA 2E4HA 2XKOC 5GAMj 1SRMA 2KXCA 1KQ1A 1TG0A 1YCYA 2QEXA 2OJ2A 3CCQQ 4Z88A 1WXTA 3QWYA 2QEXQ 3RIRA 2LJ3A 2FPFA 1YJWA 5GAOq 2YUNA 3P8BB 2CH4A 2MK5A 1JJ2A 1YJWQ 3SHWA 1VQ4A 4A4GA 1N9RA 4RG2A 1G3WA 2YSQA 3NMZC 4QQDA 1E6HA 2QAZA 5KE3A 3JAME 1T3SA 1VQ4Q 2LP5A 1Q86R 3VS3A 2DZCA 1FWZA 1RABB 4AFQC 3V8KA 4RTYA 4DEXA 4BACA 2QQAA 2AZVA 1QP3A 1LNXA 2Y4XA 2DETA 2YDLA 1JU5C 2DTHA 1EZZB 2KYMA 4M75A 1MGQA 1SHFA 2CT4A 2DX1A 2GBQA 4N4GA 2XK0A 1PSEA 2IPOB 5CR2A 1U1SA 2J05A 1I8FA 1ZBJA 2F5KA 1VQ9Q 1NBEB 3JB9J 3OY9A 4EMGA 1K76A 1BCMA 4JS5A 1VQ8T 2MWOA 2JOYA 3FJ5A 3V7RA 2DZ9A 1JB0E 5FU6C 4PJOA 1PD1A 3PIOA 3REAB 2WACA 4OF1A 5D6XA 1M3CA 2K5IA 1W2BS 3X25B 1SEMA 3BDLA 1WI7A 3HRSA 2E70A 2JTEA 3EGDB 2QTXA 2E3IA 3HTRA 3ZBDA 4C92A 2ROLA 1HYOA 1RAFB 2KI7A 3HRUA 4XQ3A 3N5BB 1CKAA 4TVRA 2DRKA 3C4SA 3GBQA 1WPYA 1YFNA 1VQ5T 5GAOl 3CCUT 4D8KA 1Z9ZA 2RQTA 2FEIA 2O31A 3PVLA 1G2BA 2K7AA 1OX8A 1V76A 4M77G 1I07A 1NJIR 2LCSA 1D1CA 2OI3A 2M02A 3GIBA 4M78F 1Q81U 3RMSA 4HXJA 2EFIA 3CCET 4OGEA 2F2VA 1B34A 1NEBA 4PJOG 3CXCS 3M0UA 4M7DF 4Y28E 2VC8A 2KT8A 2EQUA 4HA8A 5KYYA 4PFZA 2CP3A 3QXEB 2P84A 2QA4A 5FROA 4FM4B 3HFOA 4A4HA 2G6FX 1K73R 4EPCA 2QA4Q 3E9FA 2DTIA 4C92G 1HJDA 3QSUA 8ATCB 5GANf 2RQRA 1VQLT 1KC8R 3OW2S 5FU6B 1Q82R 2IIMA 2KVQG 2J6KA 2FRYA 3A8MB 4J7FA 1IHVA 3VUZA 2E12A 3CPWA 2GTJA 1VOMA 1ZHIA 2K6DA 1GBQA 3WVDB 1K4US 2DEQA 1M27C 2QI2A 1SSFA 3AT1B 3OYFA 4J6XA 1RI9A 4OB1B 4BI4A 2V8KA 1FXXA 2AIRB 1AWOA 1RAHB 1I5LA 5AYFA 3P8HA 1TU0B 4Z02A 1PKSA 4KBMB 2FRWA 3PVQA 2JZ2A 3QIIA 5FU7C 1NZ9A 4F7UF 4YTLA 2K2VA 4FT2A 3JCMe 1FMWA 3SWNC 3UA7A 1O75A 4ORZA 4C8QC 2CH4W 2K5FA 1X75C 2JTFA 4XAXB 3MHXA 4DOVA 3VYHB 2VVKA 5CVIA 1RI0A 1Y71A 3FDRA 2QGFB 4JJBA 5HKCA 1ZSZC 3CCQT 1CKBA 3OS1A 3R6OA 2VXFA 2F1LA 1ZQ1A 2CZ0B 2QEXT 2PNIA 1UFFA 3QDFA 3ME9A 4M75E 3M4YA 7AT1B 2DO3A 4J5YA 1IGUA 4OMMA 1FMKA 2VV5A 3E2UA 2DXTA 5I21A 1U06A 2VYTA 4OMQA 4R56A 3CC2T 5I22A 1NYFA 1G3SA 5CAIA 1ZUKA 3C0CA 3LWIA 1VQ4T 3H0HA 3UT1A 5KH6A 2FYKA 3OYGA 2LQ8A 3EGDA 3IQLA 4QVZA 3VU3C 3M5AA 3THKA 3OYIA 4F16A 2P4TA 2DL3A 1MV3A 4OMFB 3DB4A 4N0AC 4C0GA 2OTJA 3JCMV 2WSEE 5FU7B 3RESA 5J3BA 3S3NA 4HT9A 1UHCA 3OYCA 3SWNB 2OTJQ 4RTWA 2FL7A 1ARKA 3CCMA 3D7SB 3M59A 4C8QB 4BE0A 1ZUUA 3M54A 3MEWA 2MMPA 2PVOB 3CCMQ 5I11A 2E3HA 3MCAB 2CP6A 1XJWB 5CK9A 2CSQA 3CBOA 3CPFA 1TSFA 2E41A 2FZCB 2HNIA 1FMVA 1M2VB 2CZ7B 1ZSZB 2ZAEA 4F17A 4HKEA 1HD3A 1NG2A 3MJXA 2CZ1B 3PE0A 2OTLA 3JCMX 4FSSA 2OAWA 4J9GA 4FYXB 2FB7A 4RG8A 5FWCA 2OTLQ 2CUDA 4PFPA 5LJ5e 4GLKA 5CKHA 1UG1A 3NHNA 1KHCA 3L2WA 1IB8A 1M90C 2DNUA 3V8LA 5CO7A 1NPPA 2FPDA 3VRZA 4IUPA 2DTOA 2RI2A 1V1CA 4LD6A 3QUIA 4FW1A 2LX7A 4QT7A 3GPLA 1TXQA 3KFVA 1R0CB 1VIEA 1D3BB 1PNJA 4JJCA 3L2RA 2EJGA 5L23A 1UJ0A 1ZUYA 4C0ZA 2QYZA 1M9SA 4PL6A 4FU6A 1KQSA 3VS6A 2EJ9A 5GMKh 4DBFA 3C95A 1PHTA 2RD1A 3GNFB 4LDUA 5DY9A 1H92A 1X01A 1B7TA 3JSCA 1WQ7A 1C0MA 3EHQA 2QA4T 1OYXA 4JJDA 3QO3A 1RAAB 3TSWA 4M77C 1QVFP 2CYZB 3UA6A 5GAMe 1Q95G 4HVUA 4OMNA 4WTOB 5IHIA 2JVVA 5GMKj 5CKBA 2DL5A 2J6OA 1OPLA 1NJIC 6AT1B 2NUZA 4LE9A 3O8VA 1BI3A 3DKMA 3OQ5A 1SPKA 3CCRA 1W70A 3MO8A 1N9SA 3VKIA 4C92C 4C5IA 1W6XA 3VUBA 3NPFA 3J7AF 3LWHA 3RKYA 5CQYA 3CCRQ 2V26A 3RKWA 1YNZA 5KYXA 1K73C 1YJNQ 1M2OA 4M78D 1KD1R 2AK5A 1HXDA 2YRCA 3SDZA 1WLPB 4M7DD 4E7LA 4IIMA 4HVWA 4LXCA 1P92A 3HSBA 5D6WA 2X4XA 1WJQA 4C8QA 3QJYA 2AKLA 5ECAA 2MCNA 4JZ4A 3EG3A 5IXFA 4E7IA 1D1AA 3I56A 2ZPHB 1R0BG 1R77A 1G3YA 4BDYA 4XU3A 1JJ2S 4M77B 1M2VA 1GL5A 1ZSZA 3I56Q 1SRLA 2DL7A 2XDPA 2L2PA 2K3BA 3P8DA 1M8VA 3QHSA 3LYIA 2ZGWA 5D6YA 5GAOm 3CBMA 3JB9D 1X6OA 2RJDA 1PWTA 2YRDA 2RA2A 3VS7A 1QVFA 1SSHA 4ZGDB 2HBWA 1LPLA 1RUWA 3JCMP 2K3YA 1AVZC 1K8AU 4C92B 2YXYA 1UTIA 4PK4A 2OTJT 4MMKA 1R8OB 2LX9A 2XHCA 2PTKA 2RQVA 1EX4A 2VUBA 1WHJA 1GCPA 3CCMT 3E19A 2C0TA 2LZ6B 1D3BA 2A7YA 3I5SA 2W10A 4N0AA 5GJWB 4RTVA 2ABLA 4LN2A 1OU9A 3OYBA 1ZBXA 3M0TA 1FX7A 2LQWA 1OOTA 3VS1A 1SKUB 2OAUA 1X2KA 2L3PA 2R5AA 5GAMh 1GRIA 2DIQA 1K9MC 1OX9A 3EGXA 1NYGA 2LQKA 2KEAA 4EMKC 1GFDA 2OTLT 1YIJT 2EYWA 4CC3A 4BB7A 3EG0A 1QWEA 2XD0A 2E1HA 1YP5A 1ZSGA 1HK9A 4UC4A 2RQUA 3PNWC 2DBMA 3CEYA 2DD5A 5HY6A 1N6AA 2GFUA 2MI6A 3ER0A 3A8HB 3JB9H 2XMFA 4ELYC 2M9UA
chains in the Genus database with same CATH topology
3QXEB 3E9GA 1KC8C 2QQRA 2QA4A 5FROA 2R5MA 2RO0A 4NOYA 2E5QA 4FM4B 3HFOA 2KQWA 4A4HA 3CCST 1Q82C 5LJ3f 3OS0A 1IREB 3JCMf 4LDWA 2VGNA 2DVEA 4EPCA 4KULA 3FLGA 4J6YA 3E9FA 2DTIA 3LGFA 4C92G 5GAN7 3I55A 3CMEA 4D6WA 1KQ2A 3M55A 1YHQA 3WXMB 3QSUA 5GANf 4N4HA 4VUBA 5IN1A 1Y96A 2RM4A 4Q5WA 3OYEA 1VQLT 3JCMb 3M58A 5GAMg 5FU6B 3L1AA 3OW2S 5CIUA 2BUDA 4M75F 2KVQG 4M7AE 3UDCA 3HHTB 3A8MB 4J7FA 4HCZA 3VUZA 1WNLA 2E12A 3CPWA 3HPWA 2F69A 3PMTA 4JS4A 3BFMA 5C0MA 1ZHIA 3WVDB 4A53A 3SD4A 3CC4A 2DEQA 4OB2B 2QI2A 1SSFA 4PLIA 3CCUA 1YIJA 3OYFA 4JLGA 2EJFA 3A8OB 4OVAA 1VQMA 4J6XA 4OB1B 3EFSA 3MP8A 3SB2A 3BW1A 4BI4A 2DKGA 4FT4A 2V8KA 5C6SA 4QQ6A 1FXXA 2RB6A 2DIGA 5GAN2 1I5LA 2LC4A 2O4XA 3BY7A 3X24B 5GMKi 5AYFA 3OA6A 2IVWA 3P8HA 4C0DC 1G5VA 4Z02A 4M77D 2PVGB 2QDYB 4QVDA 3JRZA 3NTKA 4KBMB 4LD9K 2JZ2A 3QIIA 5FU7C 1NZ9A 2LNVA 4EMKB 5KE2A 4F7UF 5HK3A 2XDDA 1VQ9A 4YTLA 3BDUA 2K2VA 2ZPFB 4FT2A 5LJ3e 3JCMe 3OS2A 3CCEA 2RI5A 4J7IA 1VIFA 4JDSA 4M78E 3SWNC 2LT4A 3ZEHA 1GXIE 4M78C 2R58A 4C8QE 1O75A 1M90U 5A0GA 4LDVA 4C8QC 3CD6T 2LDMA 4QW2A 1EIFA 5GAN6 4M77A 2K5FA 4XTUA 1VQKT 5LJ3h 5GANe 4ATOA 1X75C 2JTFA 3JCMh 4M7DE 4XAXB 4M7DC 3MHXA 4DOVA 3C94A 4OB3B 2ZCFB 3L2QA 2EIFA 5GAOr 3VYHB 5GAMd 3A8LB 5CVIA 3OS5A 5J39A 3CCRT 1QVFS 1RI0A 3A5ZB 5GANh 1Y71A 3FDRA 2JN0A 3URGA 3PTAA 1BKBA 1Q7YC 3PGGA 5HKCA 5J26A 3CCQT 4C5GA 4BD3A 1UGSB 2M0OA 3OS1A 1UGQB 3R6OA 2VXFA 2X4YA 3OYMA 2G3RA 1ZQ1A 2CZ0B 2LT1A 4C5HA 2GF7A 4Y91A 2QEXT 1KG1A 1MHNA 4RCCA 3QZ9B 4BDZA 1LOJA 1OZ2A 5LJ3j 4A4KA 1M1FA 2RHXA 3ME9A 4XTWA 1H641 4M75E 3M4YA 2X35A 3OYHA 3FC3A 2DO3A 2CGHA 3EAEA 3OYYA 4J5YA 4M75C 2DXCA 2BKDN 1IZ6A 5FLXE 2PU9B 1OI1A 2E6ZA 2JNGA 3EFRA 2VV5A 1NPRA 3M53A 2XICA 3PFSA 4ME7A 2DXTA 5I21A 4HCBA 5GANj 1M1KU 2VYTA 3META 4MZPA 2L5QA 4R56A 3CC2T 4A54A 3DLMA 1YITT 1G3SA 3F70A 3M57A 5CAIA 4ZTJA 1BI1A 1NE8A 4OP0A 4OGCA 1VQOT 2XG8D 3LWIA 3OYKA 2LVMA 3G4ST 1VQ4T 3GOXA 3LLRA 3MEAA 2EQJA 2QQSA 3UT1A 5KH6A 2FYKA 3OYGA 2LQ8A 5EG2A 1Q81C 3J81E 2DXUA 3I56T 3HRTA 3CCJT 4QVZA 2D9TA 3JCMg 2LCLA 2NLUA 3VU3C 4F7UE 3CD6A 3PIPA 2RJCA 3OYJA 1QVPA 3M5AA 3VJPA 3CCLT 3OYIA 2P4TA 3LH0A 2ZPEB 3OBYA 2KDSA 1YJ9T 4OMFB 1DJ7B 3DB4A 4N0AC 1WJRA 4C0DB 4C0GA 3JCMV 4L5GA 2WSEE 4QVCA 3HP9A 5HK0A 1NJIU 3T9NA 1VQ8A 5FU7B 3RESA 5J3BA 3DB3A 2MWPA 5LJ5f 3S3NA 1YI2T 4HT9A 2V8JA 4JLIA 4M7AA 3RMQA 2HBPA 3OYCA 4BI3A 3SWNB 1UEBA 3G7ZA 4ELZC 3NTIA 1I4K1 2FL7A 3QKJA 4M78B 3CCMA 1KD1C 3CC7A 1H3ZA 3M59A 4C8QB 5IT9E 4X34A 4BE0A 2QQBA 2XIDA 2E64A 3M54A 3OB9A 4NL2A 3S3MA 1KD1U 1VQ7T 3MEWA 2L3RA 3V8JA 4M7DB 2MMPA 2PVOB 4NL3A 2GQVA 2ZPIB 3MCAB 3OBWA 3OYLA 1AHJB 3FRNA 2WSCE 4PJOC 5IAYA 2CS7A 2WSFE 5CK9A 3G6EA 1VQNT 3CBOA 3CPFA 4OB0B 5CKFA 5A0LA 2E41A 1K73U 4RCBA 2HNIA 3CMAA 1N8RU 2CZ7B 3JCMJ 2RH2A 3WVEB 4HKEA 5KCOA 2DXBA 2E65A 5GAN4 2VGMA 2CZ1B 4DA4A 3CC2A 3SWNA 3JCMQ 1YITA 2OTLA 3KBGA 5GAOp 1VQ5A 3JCMX 2QXFA 3M56A 5LJ3d 4IUVA 3JCMd 4M77F 3JB9F 4EMHA 2A3LA 4M75B 3QJ6A 4ZN3A 2RHIA 3CBPA 1Q86U 4LDXA 3C12A 2FB7A 3L2ZA 5DM7R 1BIAA 3KUFA 4RG8A 4FL6A 5LJ5e 4GLKA 1WGSA 4XU2A 5CKHA 3RUXA 2HQXA 4II1A 2Y90A 3CPWS 1KHCA 2FVUA 3GP8A 1I81A 3L2WA 2LTOA 2LCCA 1WJSA 4PJOF 3OYNA 1M90C 2E6NA 3V8LA 5CO7A 2K3XA 4J8OA 2ZPGB 4XTYA 5LJ5h 4MZTA 5GMKm 4M7AG 4XU0A 1NPPA 4XTZA 4ZTFA 3L2VA 3RKXA 2F5TX 5GAOn 1S72A 4V2SA 4DOWA 4IUPA 2DTOA 4LDYA 1XOVA 2RI2A 4LD6A 3QUIA 5GAMf 2I2LA 3PT9A 3GPLA 3FIFA 2VXEA 2KK4A 2M1HA 4NS5A 4PJOB 1WQWA 4F7UB 3CCSA 4C92F 1VIEA 2GFAA 2RHYA 1VQ7A 1D3BB 3QYHB 4A4EA 3OYAA 4JRPA 3L2UA 3GF5A 4RKUE 4C0FA 4IURA 3L2RA 2AHJB 2R57A 2EJGA 5CKEA 2MF2A 5LJ5j 1VQLA 4EMKA 5GMKe 2P0QA 4C0ZA 2O01E 1U1TA 3PMIA 4X9CA 1YJNT 4R55A 4O6JA 3X20B 4DQ2A 1M9SA 2DAQA 3LX7A 3QG1A 3OMGA 2XU8A 4FU6A 2IG0A 4PL6A 4M78G 1KQSA 1G3TA 2CKKA 3MEVA 3G71T 4C8QG 3RERA 1VQ6T 2EJ9A 4FIBA 5GMKh 3CCVT 3OMCA 3C95A 2RD1A 3GNFB 2D6FA 4LDUA 5DY9A 2EKOA 3GNGA 1M1KC 1BI2A 1KHIA 1X01A 2YLCA 1Y07A 3JSCA 4BE1A 1WQ7A 4M7DG 4F7UA 2PUKB 4KT0E 5L8RE 1OYXA 2QA4T 4MDXA 1YJWT 2PQWA 3QO3A 1VQPT 1LJOA 3AHUA 4QQGA 4HT8A 4M77E 2EAYA 3M4GA 3QPHA 4M77C 3UWNA 4RMOA 2CYZB 4XTXA 3I55T 3NFCA 2FHDA 4BUGA 3CMET 1KQSS 1YHQT 5CQXA 5GAMe 2B8AA 1QVGA 5LJ5g 1UB4A 4JRQA 3VYGA 5GMKl 4X9DA 3ASKA 2JVVA 2C06A 2KAFA 2K57A 1BYMA 5GMKj 2ZZDA 5I2MA 5CKBA 4MDWA 4PJOE 5LJ3g 2XDBA 1B34B 4MZMA 4MMLA 4A4FA 4M75G 1NJIC 1VQKA 5I2SA 2HAXA 2L89A 2CZ6B 2X4WA 3E1SA 3CC4T 3GLXA 1K9MU 3L42A 1UGPB 3O8VA 1BI3A 3QBYA 3S6WA 5GANg 3UPUA 3DKMA 1N27A 3MP1A 3NTHA 4IUTA 3FJPA 1M5Q1 4WF2A 4HCCA 3OQ5A 5FRMA 2DJZA 5DLQE 3V7SA 5A0DA 3CCRA 3MO8A 1N9SA 3VV0A 4C92E 2YRVA 1BIBA 3VKIA 4C92C 4BI8B 4C5IA 4CRIA 1W4SA 3VUBA 2YLBA 1PSFA 3ZFJA 3RKYA 4ZGEB 3LWHA 3CCQA 3FEOA 3J7AF 4PLLA 1JBMA 5CQYA 2HQEA 5CCAA 1Y96B 2PVDB 3HKSA 2XKOC 4E7KA 5GAMj 1XQHA 1VQ9T 1KQ1A 1YCYA 4JRKA 2QEXA 5GAN8 1QP2A 3RKWA 4L59A 1K73C 2JUFA 4F7UG 4J6WA 1N8RC 2DD4A 5A2QE 4M78D 3J80E 2EQKA 3HL8A 5CKDA 4C8QD 2HD0A 4JJNK 3OW2A 3RIRA 1HXDA 3QZ5B 3X28B 3SDZA 4PKCC 5LJ5d 4ZGJB 1YJWA 5GAOq 4E7LA 4M7DD 3KXTA 3INZA 2X4JA 2KSSA 5LL6S 1V29B 4E7HA 1O9SA 1VQPA 1KC8U 1P92A 1Y7XA 3P8BB 1Q82U 5D6WA 3HSBA 2QQ9A 2X4XA 4M78A 1JJ2A 1Q86C 1WJQA 4C8QA 3QJYA 2O4XB 3FB9A 3TREA 4C5EA 1VQOA 1VQ4A 4A4GA 1N9RA 3G4SA 2OTJA 4XK8E 4RG2A 4M7DA 4E7JA 1G3WA 2GCXA 1RL2A 2L8DA 4QQDA 2JTMA 4E7IA 4M7AC 4XU1A 5KE3A 5GANd 3JAME 3TU4K 3I56A 3CCJA 2E10A 2ZPHB 3M9QA 3CCLA 2V8IA 2DZCA 3QDRB 1G3YA 2RI3A 4BDYA 4XU3A 1FWZA 4JUVA 1JJ2S 4M77B 4M75D 1YJ9A 3V8KA 2XDPA 3A8GB 3LGLA 5GAN3 3OSSC 1YI2A 4E47A 4BACA 1JRIA 2QQAA 2RHUA 1QP3A 1LNXA 1QW1A 2LRQA 2Y4XA 1M1GA 3P8DA 4P5NA 4B9WA 1M8VA 3QHSA 4BY6C 3LYIA 3MP6A 4XTVA 5DLOA 2DTHA 2ZGWA 4M75A 1MGQA 4JRIA 5D6YA 4M7AD 5KCHA 3CBMA 4N4IA 5GAOm 4BE2A 3JB9D 4N4GA 5M9OA 1X6OA 2RJDA 2Y4YA 3QYGB 2RA2A 2XK0A 1PSEA 3JCMW 2P0KA 1QVFA 4ZGDB 1K8AC 1XTDA 3H8ZA 4IKFA 3TCJA 3JCMP 2YHTA 2K3YA 1U1SA 5CR2A 1VQNA 3H6ZA 1I8FA 2F5KA 2RK1A 3DLLA 1K8AU 4PJOD 3JB9J 2RJFA 4C92B 3OY9A 1W2BA 2P0PA 4EMGA 3Q1JA 2RHZA 2EQMA 3TEEA 2OTJT 4MMKA 4JS5A 1VQ8T 2KMTA 2MWOA 1R8OB 2JOYA 2LX9A 2XHCA 4L6V5 3V7RA 4CI0C 4GY5A 2ZPBB 2VUBA 2DZ9A 1JB0E 5FU6C 4PJOA 3CCMT 3PIOA 3CC7T 3E19A 2WACA 4OF1A 3X26B 5D6XA 2H3JA 4C92D 1D3BA 2A7YA 4KUDK 1Q7YU 4N0AA 2K5IA 1W2BS 3X25B 3BDLA 1U8RA 3HRSA 2E70A 3OYBA 2EYQA 2QTXA 1ZBXA 4M7AF 1FX7A 4B9XA 3G6ET 3JB9I 3ZBDA 3HFNA 1VUBA 2DK3A 4C92A 2OAUA 3JCMc 3CMAT 1XNIA 3HRUA 2R5AA 4XQ3A 3N5BB 5GAMh 2DIQA 2RJEA 4TVRA 1K9MC 4KUIA 3OSVA 5FRNA 3C4SA 1WPYA 2LQKA 2MAMA 1UGRB 2DPPB 4M7AB 4EMKC 2OTLT 2RK2A 2K4YA 1YIJT 5GAOl 4J83A 3CCUT 1VQ5T 3LW5E 1VQMT 1TH7A 1QVGS 3CXCA 4BB7A 2XI9A 4FSXA 4M77G 2K5LA 2KY9A 2M16A 4ZN1A 3JB9G 2PUOB 2XD0A 4O5VA 2E1HA 3S3OA 2BIVA 4EDUA 4M78F 3GIBA 1HK9A 4IUQA 4UC4A 1YJNA 2D0QB 4IUUA 4BY6B 4C8QF 1Q81U 3RMSA 2EFIA 3CCET 4PNOA 3PNWC 4OGEA 1B34A 3G71A 3CEYA 2DD5A 4PJOG 3OYDA 2EWNA 3CXCS 4M7DF 4Y28E 2VC8A 1BI0A 5HY6A 5GAN5 1S72T 1N6AA 1VQ6A 2GFUA 3MEUA 3V7CA 2MI6A 2EQUA 3ER0A 1OZ3A 4HA8A 3A8HB 3CCVA 3JB9H 4ELYC 3SFMA 2M9UA 1YBYA 1M4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2V A;  3URG A;  2P0P A;  2P0Q A; 
#chains in the Genus database with same CATH topology
 3TQ7 P;  1T0H A;  2E5Q A;  1IRE B;  3JCM f;  3O5Z A;  2COY A;  2VGN A;  1MMG A;  3FLG A;  3LGF A;  1KQ2 A;  5GAN 7;  2O9S A;  2KT1 A;  3OYE A;  1OPK A;  2RQW A;  1RAD B;  5GAM g;  3L1A A;  2NWM A;  4M75 F;  4M7A E;  4DBQ A;  2VAS A;  4ZNX A;  4J9H A;  4A53 A;  3SD4 A;  4PLI A;  4JLG A;  1VQM A;  4OVA A;  2EYZ A;  1A0N B;  3MP8 A;  3SB2 A;  3BW1 A;  4J9E A;  2YT6 A;  5C6S A;  2VKN A;  5GAN 2;  1VQM Q;  3BY7 A;  1X6G A;  4J9F A;  2QDY B;  4LD9 K;  3JRZ A;  3NTK A;  4EMK B;  5KE2 A;  1VQ9 A;  3OS2 A;  2DLP A;  2RI5 A;  4J7I A;  4JDS A;  3ZEH A;  2YWW A;  4C8Q E;  1M90 U;  2LDM A;  4QW2 A;  1EIF A;  4M77 A;  3MKD A;  5LJ3 h;  5IH2 A;  2ZCF B;  3A8L B;  3CCR T;  1KIK A;  3PTA A;  5J26 A;  1UGQ B;  2X4Y A;  3OYM A;  2G3R A;  4Y91 A;  1MHN A;  2FG0 A;  4RCC A;  4DEY A;  1LOJ A;  5LJ3 j;  1M1F A;  4XTW A;  5FRN A;  1AZG B;  2DVJ A;  2L3S A;  3OYH A;  3OYY A;  4Z8A A;  2LJ1 A;  2DXC A;  4FCY A;  5FLX E;  1OI1 A;  4PJL A;  2JNG A;  3EFR A;  1NPR A;  4ME7 A;  2XIC A;  3PFS A;  2KR3 A;  2KRO A;  5KYW B;  3MET A;  1ABQ A;  4ANJ A;  1AWW A;  1YIT T;  2DM1 A;  4ZTJ A;  2XG8 D;  3OYK A;  2LVM A;  3LLR A;  2QQS A;  1PRL C;  1W2B P;  3I56 T;  3HRT A;  3CD6 A;  4M7A D;  2RJC A;  2FO0 A;  2AZS A;  1DJ7 B;  1NJI U;  3CD6 Q;  3HP9 A;  1WXB A;  3DB3 A;  5LJ5 f;  4JLI A;  1Q81 R;  1PG5 B;  3RMQ A;  4A63 B;  2K2M A;  1UEB A;  3NTI A;  3QKJ A;  1KD1 C;  5IT9 E;  4HCK A;  3OB9 A;  3S3M A;  4NL2 A;  1VQ7 T;  2X51 A;  4K11 A;  2GQV A;  2ZPI B;  3OBW A;  4E2F B;  2WSF E;  4AMC A;  2RN8 A;  1MNE A;  3G6E A;  1BU1 A;  4AT1 B;  1K73 U;  3CMA A;  3EG1 A;  3G6E Q;  4LUE A;  3WVE B;  5KCO A;  3TVT A;  3CXC P;  2E65 A;  5GAN 4;  2VGM A;  4DA4 A;  3CMA Q;  1CSK A;  2NUP B;  3KBG A;  3JCM d;  3JB9 F;  1WZO A;  3CBP A;  1ABO A;  1IGQ A;  2HCK A;  3L2Z A;  4FL6 A;  1I1J A;  3QWX X;  1I81 A;  2LTO A;  2LCC A;  2E6N A;  4MZT A;  2KGT A;  3OW2 P;  4ESR A;  5GAO n;  1TTH B;  4AFU C;  4OMO A;  1XOV A;  5GAM f;  1IRX A;  1KJW A;  2KK4 A;  3CCS A;  1OV3 A;  3OYA A;  2ED0 A;  3GF5 A;  4RKU E;  1OU8 A;  3CCS Q;  2R57 A;  5CKE A;  1PKT A;  4EMK A;  2DFU A;  5GMK e;  1IXD A;  4X9C A;  2BE7 D;  4O6J A;  1RAG B;  4RTU A;  3X20 B;  4M78 G;  1G3T A;  3MEV A;  2LQN A;  1GBR A;  1Q7Y R;  2EKO A;  1M1K C;  3R6N A;  1Y07 A;  4M7D G;  2DA9 A;  2A36 A;  4F7U A;  5L8R E;  4KT0 E;  4MDX A;  1YJW T;  4AG1 C;  2HKQ B;  2QGG A;  1BK2 A;  4M77 E;  1N5Z A;  3UWN A;  4XTX A;  2J06 A;  1KQS S;  1PD0 A;  2CP7 A;  4IIO A;  1WDX A;  3VYG A;  4PJO E;  1IO6 A;  5KYX B;  4A4F A;  2D8H A;  3H9N A;  1K1Z A;  1VQK A;  2HAX A;  2L89 A;  3E1S A;  1K9M U;  3GLX A;  3L42 A;  1AT1 B;  3QBY A;  5KYW A;  4FYW B;  2ED1 A;  1M5Q 1;  2BZY A;  2COZ A;  2FPE A;  5FRM A;  2DJZ A;  1VQK Q;  5DLQ E;  3V7S A;  4C92 E;  2YRV A;  4BI8 B;  4ZGE B;  2JXB A;  3FEO A;  1KSW A;  1NLP C;  1JBM A;  2QK0 A;  1TWB A;  1Y96 B;  2PVD B;  2O9V A;  1VQ9 T;  4JRK A;  2HZY A;  1QP2 A;  1RLP C;  4L59 A;  1HSQ A;  1TS9 A;  4F7U G;  4J6W A;  3J80 E;  2EQK A;  3HL8 A;  5CKD A;  4KH0 B;  4JJN K;  2DE0 X;  3OW2 A;  3U23 A;  2RMO A;  3QZ5 B;  2A37 A;  5LJ5 d;  3INZ A;  2HDA A;  1VQP A;  1V29 B;  4E7H A;  1O9S A;  1Y7X A;  2KRM A;  1Q86 C;  1F1B B;  1QLY A;  2O4X B;  3FB9 A;  3EH1 A;  3TRE A;  1VQP Q;  4F14 A;  3I9Q A;  3G4S A;  2JMC A;  3BE3 A;  3EG2 A;  1ZA1 B;  4E7J A;  2JMA A;  2JTM A;  2RF0 A;  4XU1 A;  5GAN d;  3TU4 K;  1IHW A;  3CCJ A;  3G4S Q;  3CCL A;  2RI3 A;  4JUV A;  2GGR A;  4M75 D;  3CCJ Q;  2CRE A;  2DIL A;  3A8G B;  3CCL Q;  1AEY A;  3LGL A;  5GAN 3;  2DL8 A;  4E47 A;  1JRI A;  2RHU A;  4P5N A;  1E7O A;  1BBZ A;  2LRQ A;  2NUP A;  1EFN A;  1M1G A;  4B9W A;  2A0F B;  1MMN A;  4XTV A;  5DLO A;  4N4I A;  5M9O A;  2Y4Y A;  1K9A A;  1LVK A;  3QYG B;  2P0K A;  2EBP A;  2MIO A;  1QCN A;  2CUB A;  2YHT A;  2KRS A;  2EYY A;  2RK1 A;  3DLL A;  4PJO D;  2RJF A;  3Q1J A;  3TEE A;  3SEM A;  2KMT A;  4L6V 5;  4CI0 C;  3EGX B;  4GY5 A;  2H8H A;  2ZPB B;  1Y0M A;  3X26 B;  4C92 D;  2L0A A;  2EGA A;  1U8R A;  2O88 A;  2EYQ A;  4M7A F;  3G6E T;  3JB9 I;  1VUB A;  2LMJ A;  3CMA T;  1XNI A;  2EVR A;  2RJE A;  2MOX A;  4KUI A;  3OSV A;  4AFS C;  2MAM A;  1UGR B;  2DPP B;  2HKN A;  2RK2 A;  2K4Y A;  4J83 A;  2OX7 A;  3LW5 E;  2H3E B;  1QVG S;  2AKK A;  2XI9 A;  4FSX A;  1PC0 A;  2K5L A;  1X27 A;  2KY9 A;  2M16 A;  4ZN1 A;  4FYV B;  2BIV A;  4EDU A;  1YJN A;  4C8Q F;  1B07 A;  3RNJ A;  3M0P A;  3MPU B;  3G71 A;  3OYD A;  2EWN A;  2F2X A;  1BI0 A;  5GAN 5;  3CCV A;  2EKH A;  1D0X A;  3M0R A;  4JZ3 A;  1YBY A;  1M4Z A;  3J81 E;  3E9G A;  3G71 Q;  1KC8 C;  2QQR A;  1AWX A;  2R5M A;  4NOY A;  1WFW A;  1Q82 C;  4IKF A;  3EGU A;  2KQW A;  3CCS T;  3CCV Q;  1MMA A;  2CP5 A;  1K0S A;  2QDL A;  1N8R R;  4J6Y A;  3I55 A;  4PFO A;  3CME A;  4D6W A;  1I0C A;  3VRY A;  4N4H A;  4VUB A;  5IN1 A;  1Y96 A;  1Y57 A;  2RM4 A;  3JCM b;  3M58 A;  3I55 Q;  3CME Q;  4HCZ A;  1WNL A;  3HPW A;  2F69 A;  3PMT A;  3BFM A;  5C0M A;  2M51 A;  3EFO A;  3CC4 A;  4OB2 B;  3CCU A;  1G83 A;  2KYB A;  2DKG A;  4QQ6 A;  2DIG A;  3CC4 Q;  3CCU Q;  1UE9 A;  2LC4 A;  2O4X A;  5GMK i;  3OA6 A;  1G5V A;  2PVG B;  5HK3 A;  1RLQ C;  5LJ3 e;  3BDU A;  3CCE A;  2K79 A;  4M78 C;  2R58 A;  4LDV A;  5GAN 6;  4QKU A;  1YWP A;  1VYV A;  3CCE Q;  3NGP A;  4J9B A;  4XTU A;  1VQK T;  1D0Y A;  4M7D C;  1JJ2 P;  3C94 A;  4KGX B;  2O2O A;  1K8A R;  3OS5 A;  3A5Z B;  5GAN h;  2JN0 A;  1WHK A;  1Q7Y C;  4BD3 A;  1AZE A;  1UHF A;  2ROT A;  1QKW A;  2D0N A;  1M3A A;  3QZ9 B;  4BDZ A;  1OZ2 A;  2RHX A;  3FC3 A;  2X35 A;  2CGH A;  2BKD N;  1IZ6 A;  4OMP A;  2E6Z A;  4GBQ A;  2RNA A;  3M53 A;  1YCS B;  1VYU A;  5GAN j;  2EGE A;  1M1K U;  4A54 A;  1K0X A;  3M57 A;  4OP0 A;  3G4S T;  3H0I A;  3MEA A;  2EQJ A;  2GNC A;  2DXU A;  1S1N A;  3CCJ T;  1J3T A;  2NLU A;  3PIP A;  3CCL T;  2YUQ A;  3EG9 A;  3LH0 A;  1KK7 A;  2SEM A;  2KDS A;  1D0Z A;  2Z0W A;  1WJR A;  5HK0 A;  2COW A;  1VA7 A;  5HCK A;  2HBP A;  4ELZ C;  3G7Z A;  1LCK A;  1I4K 1;  4M78 B;  3CC7 A;  1H3Z A;  2ATC B;  3A1P A;  2QQB A;  2JS2 A;  2L3R A;  4FYY B;  3V8J A;  4M7D B;  4LNP A;  4NL3 A;  1SHG A;  3CC7 Q;  1AHJ B;  2L3Q A;  2CP0 A;  1QCO A;  4CC7 A;  4D8D A;  5A0L A;  1ACM B;  2BZX A;  2HL5 C;  4RCB A;  5FWB A;  4DBH A;  2RH2 A;  5IXB A;  2EQI A;  5EC7 A;  3CC2 A;  3JCM Q;  5KYU A;  1T0J A;  2QXF A;  3M56 A;  4IUV A;  4M77 F;  4EMH A;  2A3L A;  4ZN3 A;  2RHI A;  1Q86 U;  3CC2 Q;  4LDX A;  5DM7 R;  4RTX A;  4KGV B;  1WGS A;  1GFC A;  4XU2 A;  2HQX A;  4II1 A;  1QCF A;  2Y90 A;  3CPW S;  1C6V X;  4PJO F;  3EH2 A;  3OYN A;  4HVV A;  1D1B A;  2K3X A;  4J8O A;  2ZPG B;  4XTY A;  4XTZ A;  3G1J A;  3L2V A;  3RKX A;  1B3Q A;  1S72 A;  4V2S A;  4DOW A;  2KNB B;  2VXE A;  4E7Z A;  2M1H A;  2QTV A;  1S72 Q;  4F7U B;  1C1A A;  1M90 R;  4C92 F;  2GFA A;  2RHY A;  1JO8 A;  1U3O A;  3I35 A;  5FW9 A;  4A4E A;  4JRP A;  4IUR A;  3H0F A;  1JXO A;  2D8J A;  2MF2 A;  1QQJ A;  3CPW P;  2P0Q A;  1YJN T;  2O01 E;  3PMI A;  4DQ2 A;  2DAQ A;  3LX7 A;  3QG1 A;  3OMG A;  2XU8 A;  1X6B A;  2KBT A;  3G71 T;  8AT1 B;  4GLM A;  4FIB A;  3CCV T;  2LNH B;  2D6F A;  3GNG A;  2MYS A;  1KHI A;  2YLC A;  2YUP A;  4EIK A;  2PQW A;  2BTT A;  4KH1 B;  3VS5 A;  4QQG A;  3M4G A;  4RMO A;  3I55 T;  3CME T;  3NFC A;  4BUG A;  4CC2 A;  1BCO A;  4OML A;  5CQX A;  2B8A A;  2NUT B;  2KRN A;  1UB4 A;  4JRQ A;  1PRM C;  5GMK l;  4X9D A;  1MMD A;  2KAF A;  1BYM A;  5I2M A;  4MDW A;  5LJ3 g;  2XDB A;  2VB6 A;  1M30 A;  4M75 G;  4WCI A;  2A28 A;  2DBK A;  2CZ6 B;  2X4W A;  3CC4 T;  3S6W A;  3UPU A;  1N27 A;  1M3B A;  3FJP A;  5A0D A;  1H3H A;  3VV0 A;  1BIB A;  1SG5 A;  1W4S A;  4PLL A;  2HQE A;  3HKS A;  4E7K A;  1XQH A;  5GAN 8;  4J9D A;  2JUF A;  1N8R C;  2DD4 A;  2ECZ A;  3CQT A;  3RDV A;  5A2Q E;  1QKX A;  4C8Q D;  2HD0 A;  2ESW A;  3X28 B;  4PKC C;  4ZGJ B;  1W1F A;  1MND A;  2W0Z A;  3KXT A;  1E6G A;  2X4J A;  1AWJ A;  2KSS A;  5LL6 S;  1KC8 U;  1OQK A;  1Q82 U;  2QQ9 A;  4M78 A;  3UF4 A;  4C5E A;  1MUZ A;  1VQO A;  1WX6 A;  4XK8 E;  4M7D A;  2GCX A;  3LH5 A;  1RL2 A;  2L8D A;  2HEQ A;  4M7A C;  1VQO Q;  1ZLM A;  2E10 A;  3M9Q A;  2V8I A;  3QDR B;  2DF6 A;  1RAE B;  1YJ9 A;  2V1R A;  3OSS C;  1YI2 A;  1QW1 A;  2DER A;  1YJ9 Q;  3JV3 A;  4BY6 C;  3A98 A;  3MP6 A;  2BE9 B;  4JRI A;  1YI2 Q;  5KCH A;  4BE2 A;  3JCM W;  2YUO A;  3M0Q A;  1K8A C;  1XTD A;  3H8Z A;  3RBB B;  3TCJ A;  3VS0 A;  1VQN A;  3H6Z A;  2C0O A;  1W2B A;  2NYS A;  2P0P A;  4RTT A;  2RHZ A;  2EQM A;  1GCQ A;  1VQN Q;  4R0K A;  2LJ0 A;  2EW3 A;  4J9C A;  3CC7 T;  2I0N A;  2DJQ A;  2H3J A;  4KUD K;  1JQQ A;  1Q7Y U;  3EHR A;  9ATC B;  1RAI B;  3VS4 A;  1AOJ A;  4B9X A;  4KRT A;  1QMC A;  4PJJ A;  3HFN A;  2DK3 A;  3JCM c;  1UJY A;  5D7U A;  1NEG A;  3I5R A;  1TUD A;  4AFZ C;  4M7A B;  2CT3 A;  1VQM T;  1TH7 A;  3CXC A;  2SRC A;  1JEG A;  3JB9 G;  1K9M R;  4LUD A;  2PUO B;  2NUT A;  4O5V A;  3S3O A;  2JM8 A;  1RAC B;  1KQS P;  1UDL A;  4IUQ A;  2D0Q B;  4IUU A;  4BY6 B;  1WHH A;  1KFZ A;  1MV0 B;  4PNO A;  4PJN A;  1WA7 A;  2HQH A;  1WXU A;  1VQ6 A;  1S72 T;  3MEU A;  1NLO C;  2FZK B;  3V7C A;  1OZ3 A;  1WHG A;  2J7I A;  3SFM A;  3EFO B;  1PCX A;  2RO0 A;  1VQ6 Q;  4FW2 A;  5LJ3 f;  3OS0 A;  4LDW A;  5IHK A;  4RUG A;  2PZ1 A;  2DVE A;  4KUL A;  1X69 A;  1NM7 A;  3M55 A;  1YHQ A;  3WXM B;  4Q5W A;  2EYX A;  2MPX C;  5CIU A;  2BUD A;  3UDC A;  1YHQ Q;  3HHT B;  4X1V A;  2DL4 A;  3H41 A;  4JS4 A;  5AT1 B;  3ULR B;  2HL3 A;  1YIJ A;  1D09 B;  2X3X D;  2EJF A;  3A8O B;  3EFS A;  4FT4 A;  2RB6 A;  2X9H A;  1UGV A;  1YIJ Q;  3X24 B;  2C0I A;  1M8M A;  2IVW A;  4C0D C;  4QVD A;  4M77 D;  1G8X A;  2HSP A;  2LNV A;  3VS2 A;  4DBR A;  2XDD A;  2ZPF B;  4CC4 B;  1VIF A;  4M78 E;  2LT4 A;  1GXI E;  2DEU A;  5A0G A;  3CD6 T;  4JPB W;  5GAN e;  4ATO A;  3JCM h;  4M7D E;  4OB3 B;  3L2Q A;  2QG9 B;  2EIF A;  5GAO r;  5GAM d;  5J39 A;  1QVF S;  3URG A;  1BKB A;  2CSI A;  3PGG A;  4C5G A;  1UGS B;  2M0O A;  2CP2 A;  1YWO A;  2E5K A;  2LT1 A;  4C5H A;  2GF7 A;  1KG1 A;  2DYB A;  2AT1 B;  1QWF A;  4A4K A;  1H64 1;  2ENM A;  1WHM A;  3EAE A;  4M75 C;  1TUC A;  2JS0 A;  2PU9 B;  3EG9 B;  2DRM A;  2FZG B;  4HCB A;  2HSE B;  2B86 A;  1OUL A;  1PM3 A;  2D1X A;  2EPD A;  4MZP A;  2L5Q A;  3DLM A;  4M4Z A;  3F70 A;  1BI1 A;  1NE8 A;  4OGC A;  1VQO T;  3GOX A;  2QAS A;  1UEC A;  1YN8 A;  5EG2 A;  1Q81 C;  1U5S A;  2D9T A;  2LCL A;  3JCM g;  4F7U E;  4PJO C;  2X3W D;  3OYJ A;  1QVP A;  3VJP A;  4AG2 C;  2ZPE B;  3OBY A;  1YJ9 T;  4C0D B;  4HT8 A;  4QVC A;  4L5G A;  1VQ8 A;  3T9N A;  2MWP A;  1YI2 T;  2V8J A;  4M7A A;  4BI3 A;  1VQ8 Q;  5KYU B;  2BZ8 A;  4X34 A;  4E7S A;  2XID A;  2E64 A;  1QVG P;  2K9G A;  1KD1 U;  1WIE A;  2EGC A;  3OYL A;  1ZX6 A;  3FRN A;  1I5O B;  2WSC E;  5IAY A;  2CS7 A;  4Z89 A;  1VQN T;  4OB0 B;  5CKF A;  2RPN A;  1N8R U;  3JCM J;  2DXB A;  3SWN A;  1YIT A;  1TOV A;  1X2Q A;  5GAO p;  1VQ5 A;  5LJ3 d;  3TSZ A;  2GQI A;  1Z9Q A;  4M75 B;  3QJ6 A;  2VWF A;  3C12 A;  1BIA A;  3KUF A;  4Y92 A;  1YIT Q;  1VQ5 Q;  4J9I A;  2DMO A;  3RUX A;  3REB B;  2FVU A;  3GP8 A;  1WJS A;  1H8K A;  4M7A G;  5LJ5 h;  5GMK m;  2CDT A;  4XU0 A;  3UAT A;  4ZTF A;  1X43 A;  2F5T X;  4LDY A;  4E6R A;  2I2L A;  3PT9 A;  3FIF A;  4F04 B;  1T3L A;  4NS5 A;  4PJO B;  1WQW A;  2J6F A;  2P4R A;  1BB9 A;  4RTZ A;  1VQ7 A;  2JT4 A;  2HMA A;  3QYH B;  1AD5 A;  3L2U A;  4C0F A;  5GJV B;  2AHJ B;  3RR6 A;  1ZA2 B;  5LJ5 j;  1VQ7 Q;  1VQL A;  1U1T A;  4R55 A;  5KYN A;  2A08 A;  2IG0 A;  2CKK A;  1VQL Q;  4C8Q G;  3RER A;  5IHN A;  1VQ6 T;  3OMC A;  2F2W A;  1WYX A;  1UUE A;  1BI2 A;  4BE1 A;  1SF9 A;  2PUK B;  4KGZ B;  1FYN A;  3M0S A;  2KE9 A;  1VQP T;  1LJO A;  3AHU A;  2DYI A;  2JW4 A;  2JJ9 A;  2EAY A;  1WHL A;  3QPH A;  2FHD A;  1YHQ T;  2KXD A;  1M1K R;  1QVG A;  5LJ5 g;  4PJM A;  1VYT A;  1GCQ C;  1TUG B;  2JM9 A;  3ASK A;  2V1Q A;  2C06 A;  2K57 A;  3ZL7 C;  2ZZD A;  4B6M A;  1B34 B;  4MZM A;  4MML A;  1JXM A;  2GTO A;  5I2S A;  5KYY B;  1UGP B;  2M0Y A;  5GAN g;  3MP1 A;  3NTH A;  4IUT A;  4WF2 A;  4HCC A;  1OEB A;  4CRI A;  2YLB A;  1PSF A;  3ZFJ A;  3CCQ A;  5CCA A;  2E4H A;  2XKO C;  5GAM j;  1SRM A;  2KXC A;  1KQ1 A;  1TG0 A;  1YCY A;  2QEX A;  2OJ2 A;  3CCQ Q;  4Z88 A;  1WXT A;  3QWY A;  2QEX Q;  3RIR A;  2LJ3 A;  2FPF A;  1YJW A;  5GAO q;  2YUN A;  3P8B B;  2CH4 A;  2MK5 A;  1JJ2 A;  1YJW Q;  3SHW A;  1VQ4 A;  4A4G A;  1N9R A;  4RG2 A;  1G3W A;  2YSQ A;  3NMZ C;  4QQD A;  1E6H A;  2QAZ A;  5KE3 A;  3JAM E;  1T3S A;  1VQ4 Q;  2LP5 A;  1Q86 R;  3VS3 A;  2DZC A;  1FWZ A;  1RAB B;  4AFQ C;  3V8K A;  4RTY A;  4DEX A;  4BAC A;  2QQA A;  2AZV A;  1QP3 A;  1LNX A;  2Y4X A;  2DET A;  2YDL A;  1JU5 C;  2DTH A;  1EZZ B;  2KYM A;  4M75 A;  1MGQ A;  1SHF A;  2CT4 A;  2DX1 A;  2GBQ A;  4N4G A;  2XK0 A;  1PSE A;  2IPO B;  5CR2 A;  1U1S A;  2J05 A;  1I8F A;  1ZBJ A;  2F5K A;  1VQ9 Q;  1NBE B;  3JB9 J;  3OY9 A;  4EMG A;  1K76 A;  1BCM A;  4JS5 A;  1VQ8 T;  2MWO A;  2JOY A;  3FJ5 A;  3V7R A;  2DZ9 A;  1JB0 E;  5FU6 C;  4PJO A;  1PD1 A;  3PIO A;  3REA B;  2WAC A;  4OF1 A;  5D6X A;  1M3C A;  2K5I A;  1W2B S;  3X25 B;  1SEM A;  3BDL A;  1WI7 A;  3HRS A;  2E70 A;  2JTE A;  3EGD B;  2QTX A;  2E3I A;  3HTR A;  3ZBD A;  4C92 A;  2ROL A;  1HYO A;  1RAF B;  2KI7 A;  3HRU A;  4XQ3 A;  3N5B B;  1CKA A;  4TVR A;  2DRK A;  3C4S A;  3GBQ A;  1WPY A;  1YFN A;  1VQ5 T;  5GAO l;  3CCU T;  4D8K A;  1Z9Z A;  2RQT A;  2FEI A;  2O31 A;  3PVL A;  1G2B A;  2K7A A;  1OX8 A;  1V76 A;  4M77 G;  1I07 A;  1NJI R;  2LCS A;  1D1C A;  2OI3 A;  2M02 A;  3GIB A;  4M78 F;  1Q81 U;  3RMS A;  4HXJ A;  2EFI A;  3CCE T;  4OGE A;  2F2V A;  1B34 A;  1NEB A;  4PJO G;  3CXC S;  3M0U A;  4M7D F;  4Y28 E;  2VC8 A;  2KT8 A;  2EQU A;  4HA8 A;  5KYY A;  4PFZ A;  2CP3 A;  3QXE B;  2P84 A;  2QA4 A;  5FRO A;  4FM4 B;  3HFO A;  4A4H A;  2G6F X;  1K73 R;  4EPC A;  2QA4 Q;  3E9F A;  2DTI A;  4C92 G;  1HJD A;  3QSU A;  8ATC B;  5GAN f;  2RQR A;  1VQL T;  1KC8 R;  3OW2 S;  5FU6 B;  1Q82 R;  2IIM A;  2KVQ G;  2J6K A;  2FRY A;  3A8M B;  4J7F A;  1IHV A;  3VUZ A;  2E12 A;  3CPW A;  2GTJ A;  1VOM A;  1ZHI A;  2K6D A;  1GBQ A;  3WVD B;  1K4U S;  2DEQ A;  1M27 C;  2QI2 A;  1SSF A;  3AT1 B;  3OYF A;  4J6X A;  1RI9 A;  4OB1 B;  4BI4 A;  2V8K A;  1FXX A;  2AIR B;  1AWO A;  1RAH B;  1I5L A;  5AYF A;  3P8H A;  1TU0 B;  4Z02 A;  1PKS A;  4KBM B;  2FRW A;  3PVQ A;  2JZ2 A;  3QII A;  5FU7 C;  1NZ9 A;  4F7U F;  4YTL A;  2K2V A;  4FT2 A;  3JCM e;  1FMW A;  3SWN C;  3UA7 A;  1O75 A;  4ORZ A;  4C8Q C;  2CH4 W;  2K5F A;  1X75 C;  2JTF A;  4XAX B;  3MHX A;  4DOV A;  3VYH B;  2VVK A;  5CVI A;  1RI0 A;  1Y71 A;  3FDR A;  2QGF B;  4JJB A;  5HKC A;  1ZSZ C;  3CCQ T;  1CKB A;  3OS1 A;  3R6O A;  2VXF A;  2F1L A;  1ZQ1 A;  2CZ0 B;  2QEX T;  2PNI A;  1UFF A;  3QDF A;  3ME9 A;  4M75 E;  3M4Y A;  7AT1 B;  2DO3 A;  4J5Y A;  1IGU A;  4OMM A;  1FMK A;  2VV5 A;  3E2U A;  2DXT A;  5I21 A;  1U06 A;  2VYT A;  4OMQ A;  4R56 A;  3CC2 T;  5I22 A;  1NYF A;  1G3S A;  5CAI A;  1ZUK A;  3C0C A;  3LWI A;  1VQ4 T;  3H0H A;  3UT1 A;  5KH6 A;  2FYK A;  3OYG A;  2LQ8 A;  3EGD A;  3IQL A;  4QVZ A;  3VU3 C;  3M5A A;  3THK A;  3OYI A;  4F16 A;  2P4T A;  2DL3 A;  1MV3 A;  4OMF B;  3DB4 A;  4N0A C;  4C0G A;  2OTJ A;  3JCM V;  2WSE E;  5FU7 B;  3RES A;  5J3B A;  3S3N A;  4HT9 A;  1UHC A;  3OYC A;  3SWN B;  2OTJ Q;  4RTW A;  2FL7 A;  1ARK A;  3CCM A;  3D7S B;  3M59 A;  4C8Q B;  4BE0 A;  1ZUU A;  3M54 A;  3MEW A;  2MMP A;  2PVO B;  3CCM Q;  5I11 A;  2E3H A;  3MCA B;  2CP6 A;  1XJW B;  5CK9 A;  2CSQ A;  3CBO A;  3CPF A;  1TSF A;  2E41 A;  2FZC B;  2HNI A;  1FMV A;  1M2V B;  2CZ7 B;  1ZSZ B;  2ZAE A;  4F17 A;  4HKE A;  1HD3 A;  1NG2 A;  3MJX A;  2CZ1 B;  3PE0 A;  2OTL A;  3JCM X;  4FSS A;  2OAW A;  4J9G A;  4FYX B;  2FB7 A;  4RG8 A;  5FWC A;  2OTL Q;  2CUD A;  4PFP A;  5LJ5 e;  4GLK A;  5CKH A;  1UG1 A;  3NHN A;  1KHC A;  3L2W A;  1IB8 A;  1M90 C;  2DNU A;  3V8L A;  5CO7 A;  1NPP A;  2FPD A;  3VRZ A;  4IUP A;  2DTO A;  2RI2 A;  1V1C A;  4LD6 A;  3QUI A;  4FW1 A;  2LX7 A;  4QT7 A;  3GPL A;  1TXQ A;  3KFV A;  1R0C B;  1VIE A;  1D3B B;  1PNJ A;  4JJC A;  3L2R A;  2EJG A;  5L23 A;  1UJ0 A;  1ZUY A;  4C0Z A;  2QYZ A;  1M9S A;  4PL6 A;  4FU6 A;  1KQS A;  3VS6 A;  2EJ9 A;  5GMK h;  4DBF A;  3C95 A;  1PHT A;  2RD1 A;  3GNF B;  4LDU A;  5DY9 A;  1H92 A;  1X01 A;  1B7T A;  3JSC A;  1WQ7 A;  1C0M A;  3EHQ A;  2QA4 T;  1OYX A;  4JJD A;  3QO3 A;  1RAA B;  3TSW A;  4M77 C;  1QVF P;  2CYZ B;  3UA6 A;  5GAM e;  1Q95 G;  4HVU A;  4OMN A;  4WTO B;  5IHI A;  2JVV A;  5GMK j;  5CKB A;  2DL5 A;  2J6O A;  1OPL A;  1NJI C;  6AT1 B;  2NUZ A;  4LE9 A;  3O8V A;  1BI3 A;  3DKM A;  3OQ5 A;  1SPK A;  3CCR A;  1W70 A;  3MO8 A;  1N9S A;  3VKI A;  4C92 C;  4C5I A;  1W6X A;  3VUB A;  3NPF A;  3J7A F;  3LWH A;  3RKY A;  5CQY A;  3CCR Q;  2V26 A;  3RKW A;  1YNZ A;  5KYX A;  1K73 C;  1YJN Q;  1M2O A;  4M78 D;  1KD1 R;  2AK5 A;  1HXD A;  2YRC A;  3SDZ A;  1WLP B;  4M7D D;  4E7L A;  4IIM A;  4HVW A;  4LXC A;  1P92 A;  3HSB A;  5D6W A;  2X4X A;  1WJQ A;  4C8Q A;  3QJY A;  2AKL A;  5ECA A;  2MCN A;  4JZ4 A;  3EG3 A;  5IXF A;  4E7I A;  1D1A A;  3I56 A;  2ZPH B;  1R0B G;  1R77 A;  1G3Y A;  4BDY A;  4XU3 A;  1JJ2 S;  4M77 B;  1M2V A;  1GL5 A;  1ZSZ A;  3I56 Q;  1SRL A;  2DL7 A;  2XDP A;  2L2P A;  2K3B A;  3P8D A;  1M8V A;  3QHS A;  3LYI A;  2ZGW A;  5D6Y A;  5GAO m;  3CBM A;  3JB9 D;  1X6O A;  2RJD A;  1PWT A;  2YRD A;  2RA2 A;  3VS7 A;  1QVF A;  1SSH A;  4ZGD B;  2HBW A;  1LPL A;  1RUW A;  3JCM P;  2K3Y A;  1AVZ C;  1K8A U;  4C92 B;  2YXY A;  1UTI A;  4PK4 A;  2OTJ T;  4MMK A;  1R8O B;  2LX9 A;  2XHC A;  2PTK A;  2RQV A;  1EX4 A;  2VUB A;  1WHJ A;  1GCP A;  3CCM T;  3E19 A;  2C0T A;  2LZ6 B;  1D3B A;  2A7Y A;  3I5S A;  2W10 A;  4N0A A;  5GJW B;  4RTV A;  2ABL A;  4LN2 A;  1OU9 A;  3OYB A;  1ZBX A;  3M0T A;  1FX7 A;  2LQW A;  1OOT A;  3VS1 A;  1SKU B;  2OAU A;  1X2K A;  2L3P A;  2R5A A;  5GAM h;  1GRI A;  2DIQ A;  1K9M C;  1OX9 A;  3EGX A;  1NYG A;  2LQK A;  2KEA A;  4EMK C;  1GFD A;  2OTL T;  1YIJ T;  2EYW A;  4CC3 A;  4BB7 A;  3EG0 A;  1QWE A;  2XD0 A;  2E1H A;  1YP5 A;  1ZSG A;  1HK9 A;  4UC4 A;  2RQU A;  3PNW C;  2DBM A;  3CEY A;  2DD5 A;  5HY6 A;  1N6A A;  2GFU A;  2MI6 A;  3ER0 A;  3A8H B;  3JB9 H;  2XMF A;  4ELY C;  2M9U A; 
#chains in the Genus database with same CATH homology
 3QXE B;  3E9G A;  1KC8 C;  2QQR A;  2QA4 A;  5FRO A;  2R5M A;  2RO0 A;  4NOY A;  2E5Q A;  4FM4 B;  3HFO A;  2KQW A;  4A4H A;  3CCS T;  1Q82 C;  5LJ3 f;  3OS0 A;  1IRE B;  3JCM f;  4LDW A;  2VGN A;  2DVE A;  4EPC A;  4KUL A;  3FLG A;  4J6Y A;  3E9F A;  2DTI A;  3LGF A;  4C92 G;  5GAN 7;  3I55 A;  3CME A;  4D6W A;  1KQ2 A;  3M55 A;  1YHQ A;  3WXM B;  3QSU A;  5GAN f;  4N4H A;  4VUB A;  5IN1 A;  1Y96 A;  2RM4 A;  4Q5W A;  3OYE A;  1VQL T;  3JCM b;  3M58 A;  5GAM g;  5FU6 B;  3L1A A;  3OW2 S;  5CIU A;  2BUD A;  4M75 F;  2KVQ G;  4M7A E;  3UDC A;  3HHT B;  3A8M B;  4J7F A;  4HCZ A;  3VUZ A;  1WNL A;  2E12 A;  3CPW A;  3HPW A;  2F69 A;  3PMT A;  4JS4 A;  3BFM A;  5C0M A;  1ZHI A;  3WVD B;  4A53 A;  3SD4 A;  3CC4 A;  2DEQ A;  4OB2 B;  2QI2 A;  1SSF A;  4PLI A;  3CCU A;  1YIJ A;  3OYF A;  4JLG A;  2EJF A;  3A8O B;  4OVA A;  1VQM A;  4J6X A;  4OB1 B;  3EFS A;  3MP8 A;  3SB2 A;  3BW1 A;  4BI4 A;  2DKG A;  4FT4 A;  2V8K A;  5C6S A;  4QQ6 A;  1FXX A;  2RB6 A;  2DIG A;  5GAN 2;  1I5L A;  2LC4 A;  2O4X A;  3BY7 A;  3X24 B;  5GMK i;  5AYF A;  3OA6 A;  2IVW A;  3P8H A;  4C0D C;  1G5V A;  4Z02 A;  4M77 D;  2PVG B;  2QDY B;  4QVD A;  3JRZ A;  3NTK A;  4KBM B;  4LD9 K;  2JZ2 A;  3QII A;  5FU7 C;  1NZ9 A;  2LNV A;  4EMK B;  5KE2 A;  4F7U F;  5HK3 A;  2XDD A;  1VQ9 A;  4YTL A;  3BDU A;  2K2V A;  2ZPF B;  4FT2 A;  5LJ3 e;  3JCM e;  3OS2 A;  3CCE A;  2RI5 A;  4J7I A;  1VIF A;  4JDS A;  4M78 E;  3SWN C;  2LT4 A;  3ZEH A;  1GXI E;  4M78 C;  2R58 A;  4C8Q E;  1O75 A;  1M90 U;  5A0G A;  4LDV A;  4C8Q C;  3CD6 T;  2LDM A;  4QW2 A;  1EIF A;  5GAN 6;  4M77 A;  2K5F A;  4XTU A;  1VQK T;  5LJ3 h;  5GAN e;  4ATO A;  1X75 C;  2JTF A;  3JCM h;  4M7D E;  4XAX B;  4M7D C;  3MHX A;  4DOV A;  3C94 A;  4OB3 B;  2ZCF B;  3L2Q A;  2EIF A;  5GAO r;  3VYH B;  5GAM d;  3A8L B;  5CVI A;  3OS5 A;  5J39 A;  3CCR T;  1QVF S;  1RI0 A;  3A5Z B;  5GAN h;  1Y71 A;  3FDR A;  2JN0 A;  3URG A;  3PTA A;  1BKB A;  1Q7Y C;  3PGG A;  5HKC A;  5J26 A;  3CCQ T;  4C5G A;  4BD3 A;  1UGS B;  2M0O A;  3OS1 A;  1UGQ B;  3R6O A;  2VXF A;  2X4Y A;  3OYM A;  2G3R A;  1ZQ1 A;  2CZ0 B;  2LT1 A;  4C5H A;  2GF7 A;  4Y91 A;  2QEX T;  1KG1 A;  1MHN A;  4RCC A;  3QZ9 B;  4BDZ A;  1LOJ A;  1OZ2 A;  5LJ3 j;  4A4K A;  1M1F A;  2RHX A;  3ME9 A;  4XTW A;  1H64 1;  4M75 E;  3M4Y A;  2X35 A;  3OYH A;  3FC3 A;  2DO3 A;  2CGH A;  3EAE A;  3OYY A;  4J5Y A;  4M75 C;  2DXC A;  2BKD N;  1IZ6 A;  5FLX E;  2PU9 B;  1OI1 A;  2E6Z A;  2JNG A;  3EFR A;  2VV5 A;  1NPR A;  3M53 A;  2XIC A;  3PFS A;  4ME7 A;  2DXT A;  5I21 A;  4HCB A;  5GAN j;  1M1K U;  2VYT A;  3MET A;  4MZP A;  2L5Q A;  4R56 A;  3CC2 T;  4A54 A;  3DLM A;  1YIT T;  1G3S A;  3F70 A;  3M57 A;  5CAI A;  4ZTJ A;  1BI1 A;  1NE8 A;  4OP0 A;  4OGC A;  1VQO T;  2XG8 D;  3LWI A;  3OYK A;  2LVM A;  3G4S T;  1VQ4 T;  3GOX A;  3LLR A;  3MEA A;  2EQJ A;  2QQS A;  3UT1 A;  5KH6 A;  2FYK A;  3OYG A;  2LQ8 A;  5EG2 A;  1Q81 C;  3J81 E;  2DXU A;  3I56 T;  3HRT A;  3CCJ T;  4QVZ A;  2D9T A;  3JCM g;  2LCL A;  2NLU A;  3VU3 C;  4F7U E;  3CD6 A;  3PIP A;  2RJC A;  3OYJ A;  1QVP A;  3M5A A;  3VJP A;  3CCL T;  3OYI A;  2P4T A;  3LH0 A;  2ZPE B;  3OBY A;  2KDS A;  1YJ9 T;  4OMF B;  1DJ7 B;  3DB4 A;  4N0A C;  1WJR A;  4C0D B;  4C0G A;  3JCM V;  4L5G A;  2WSE E;  4QVC A;  3HP9 A;  5HK0 A;  1NJI U;  3T9N A;  1VQ8 A;  5FU7 B;  3RES A;  5J3B A;  3DB3 A;  2MWP A;  5LJ5 f;  3S3N A;  1YI2 T;  4HT9 A;  2V8J A;  4JLI A;  4M7A A;  3RMQ A;  2HBP A;  3OYC A;  4BI3 A;  3SWN B;  1UEB A;  3G7Z A;  4ELZ C;  3NTI A;  1I4K 1;  2FL7 A;  3QKJ A;  4M78 B;  3CCM A;  1KD1 C;  3CC7 A;  1H3Z A;  3M59 A;  4C8Q B;  5IT9 E;  4X34 A;  4BE0 A;  2QQB A;  2XID A;  2E64 A;  3M54 A;  3OB9 A;  4NL2 A;  3S3M A;  1KD1 U;  1VQ7 T;  3MEW A;  2L3R A;  3V8J A;  4M7D B;  2MMP A;  2PVO B;  4NL3 A;  2GQV A;  2ZPI B;  3MCA B;  3OBW A;  3OYL A;  1AHJ B;  3FRN A;  2WSC E;  4PJO C;  5IAY A;  2CS7 A;  2WSF E;  5CK9 A;  3G6E A;  1VQN T;  3CBO A;  3CPF A;  4OB0 B;  5CKF A;  5A0L A;  2E41 A;  1K73 U;  4RCB A;  2HNI A;  3CMA A;  1N8R U;  2CZ7 B;  3JCM J;  2RH2 A;  3WVE B;  4HKE A;  5KCO A;  2DXB A;  2E65 A;  5GAN 4;  2VGM A;  2CZ1 B;  4DA4 A;  3CC2 A;  3SWN A;  3JCM Q;  1YIT A;  2OTL A;  3KBG A;  5GAO p;  1VQ5 A;  3JCM X;  2QXF A;  3M56 A;  5LJ3 d;  4IUV A;  3JCM d;  4M77 F;  3JB9 F;  4EMH A;  2A3L A;  4M75 B;  3QJ6 A;  4ZN3 A;  2RHI A;  3CBP A;  1Q86 U;  4LDX A;  3C12 A;  2FB7 A;  3L2Z A;  5DM7 R;  1BIA A;  3KUF A;  4RG8 A;  4FL6 A;  5LJ5 e;  4GLK A;  1WGS A;  4XU2 A;  5CKH A;  3RUX A;  2HQX A;  4II1 A;  2Y90 A;  3CPW S;  1KHC A;  2FVU A;  3GP8 A;  1I81 A;  3L2W A;  2LTO A;  2LCC A;  1WJS A;  4PJO F;  3OYN A;  1M90 C;  2E6N A;  3V8L A;  5CO7 A;  2K3X A;  4J8O A;  2ZPG B;  4XTY A;  5LJ5 h;  4MZT A;  5GMK m;  4M7A G;  4XU0 A;  1NPP A;  4XTZ A;  4ZTF A;  3L2V A;  3RKX A;  2F5T X;  5GAO n;  1S72 A;  4V2S A;  4DOW A;  4IUP A;  2DTO A;  4LDY A;  1XOV A;  2RI2 A;  4LD6 A;  3QUI A;  5GAM f;  2I2L A;  3PT9 A;  3GPL A;  3FIF A;  2VXE A;  2KK4 A;  2M1H A;  4NS5 A;  4PJO B;  1WQW A;  4F7U B;  3CCS A;  4C92 F;  1VIE A;  2GFA A;  2RHY A;  1VQ7 A;  1D3B B;  3QYH B;  4A4E A;  3OYA A;  4JRP A;  3L2U A;  3GF5 A;  4RKU E;  4C0F A;  4IUR A;  3L2R A;  2AHJ B;  2R57 A;  2EJG A;  5CKE A;  2MF2 A;  5LJ5 j;  1VQL A;  4EMK A;  5GMK e;  2P0Q A;  4C0Z A;  2O01 E;  1U1T A;  3PMI A;  4X9C A;  1YJN T;  4R55 A;  4O6J A;  3X20 B;  4DQ2 A;  1M9S A;  2DAQ A;  3LX7 A;  3QG1 A;  3OMG A;  2XU8 A;  4FU6 A;  2IG0 A;  4PL6 A;  4M78 G;  1KQS A;  1G3T A;  2CKK A;  3MEV A;  3G71 T;  4C8Q G;  3RER A;  1VQ6 T;  2EJ9 A;  4FIB A;  5GMK h;  3CCV T;  3OMC A;  3C95 A;  2RD1 A;  3GNF B;  2D6F A;  4LDU A;  5DY9 A;  2EKO A;  3GNG A;  1M1K C;  1BI2 A;  1KHI A;  1X01 A;  2YLC A;  1Y07 A;  3JSC A;  4BE1 A;  1WQ7 A;  4M7D G;  4F7U A;  2PUK B;  4KT0 E;  5L8R E;  1OYX A;  2QA4 T;  4MDX A;  1YJW T;  2PQW A;  3QO3 A;  1VQP T;  1LJO A;  3AHU A;  4QQG A;  4HT8 A;  4M77 E;  2EAY A;  3M4G A;  3QPH A;  4M77 C;  3UWN A;  4RMO A;  2CYZ B;  4XTX A;  3I55 T;  3NFC A;  2FHD A;  4BUG A;  3CME T;  1KQS S;  1YHQ T;  5CQX A;  5GAM e;  2B8A A;  1QVG A;  5LJ5 g;  1UB4 A;  4JRQ A;  3VYG A;  5GMK l;  4X9D A;  3ASK A;  2JVV A;  2C06 A;  2KAF A;  2K57 A;  1BYM A;  5GMK j;  2ZZD A;  5I2M A;  5CKB A;  4MDW A;  4PJO E;  5LJ3 g;  2XDB A;  1B34 B;  4MZM A;  4MML A;  4A4F A;  4M75 G;  1NJI C;  1VQK A;  5I2S A;  2HAX A;  2L89 A;  2CZ6 B;  2X4W A;  3E1S A;  3CC4 T;  3GLX A;  1K9M U;  3L42 A;  1UGP B;  3O8V A;  1BI3 A;  3QBY A;  3S6W A;  5GAN g;  3UPU A;  3DKM A;  1N27 A;  3MP1 A;  3NTH A;  4IUT A;  3FJP A;  1M5Q 1;  4WF2 A;  4HCC A;  3OQ5 A;  5FRM A;  2DJZ A;  5DLQ E;  3V7S A;  5A0D A;  3CCR A;  3MO8 A;  1N9S A;  3VV0 A;  4C92 E;  2YRV A;  1BIB A;  3VKI A;  4C92 C;  4BI8 B;  4C5I A;  4CRI A;  1W4S A;  3VUB A;  2YLB A;  1PSF A;  3ZFJ A;  3RKY A;  4ZGE B;  3LWH A;  3CCQ A;  3FEO A;  3J7A F;  4PLL A;  1JBM A;  5CQY A;  2HQE A;  5CCA A;  1Y96 B;  2PVD B;  3HKS A;  2XKO C;  4E7K A;  5GAM j;  1XQH A;  1VQ9 T;  1KQ1 A;  1YCY A;  4JRK A;  2QEX A;  5GAN 8;  1QP2 A;  3RKW A;  4L59 A;  1K73 C;  2JUF A;  4F7U G;  4J6W A;  1N8R C;  2DD4 A;  5A2Q E;  4M78 D;  3J80 E;  2EQK A;  3HL8 A;  5CKD A;  4C8Q D;  2HD0 A;  4JJN K;  3OW2 A;  3RIR A;  1HXD A;  3QZ5 B;  3X28 B;  3SDZ A;  4PKC C;  5LJ5 d;  4ZGJ B;  1YJW A;  5GAO q;  4E7L A;  4M7D D;  3KXT A;  3INZ A;  2X4J A;  2KSS A;  5LL6 S;  1V29 B;  4E7H A;  1O9S A;  1VQP A;  1KC8 U;  1P92 A;  1Y7X A;  3P8B B;  1Q82 U;  5D6W A;  3HSB A;  2QQ9 A;  2X4X A;  4M78 A;  1JJ2 A;  1Q86 C;  1WJQ A;  4C8Q A;  3QJY A;  2O4X B;  3FB9 A;  3TRE A;  4C5E A;  1VQO A;  1VQ4 A;  4A4G A;  1N9R A;  3G4S A;  2OTJ A;  4XK8 E;  4RG2 A;  4M7D A;  4E7J A;  1G3W A;  2GCX A;  1RL2 A;  2L8D A;  4QQD A;  2JTM A;  4E7I A;  4M7A C;  4XU1 A;  5KE3 A;  5GAN d;  3JAM E;  3TU4 K;  3I56 A;  3CCJ A;  2E10 A;  2ZPH B;  3M9Q A;  3CCL A;  2V8I A;  2DZC A;  3QDR B;  1G3Y A;  2RI3 A;  4BDY A;  4XU3 A;  1FWZ A;  4JUV A;  1JJ2 S;  4M77 B;  4M75 D;  1YJ9 A;  3V8K A;  2XDP A;  3A8G B;  3LGL A;  5GAN 3;  3OSS C;  1YI2 A;  4E47 A;  4BAC A;  1JRI A;  2QQA A;  2RHU A;  1QP3 A;  1LNX A;  1QW1 A;  2LRQ A;  2Y4X A;  1M1G A;  3P8D A;  4P5N A;  4B9W A;  1M8V A;  3QHS A;  4BY6 C;  3LYI A;  3MP6 A;  4XTV A;  5DLO A;  2DTH A;  2ZGW A;  4M75 A;  1MGQ A;  4JRI A;  5D6Y A;  4M7A D;  5KCH A;  3CBM A;  4N4I A;  5GAO m;  4BE2 A;  3JB9 D;  4N4G A;  5M9O A;  1X6O A;  2RJD A;  2Y4Y A;  3QYG B;  2RA2 A;  2XK0 A;  1PSE A;  3JCM W;  2P0K A;  1QVF A;  4ZGD B;  1K8A C;  1XTD A;  3H8Z A;  4IKF A;  3TCJ A;  3JCM P;  2YHT A;  2K3Y A;  1U1S A;  5CR2 A;  1VQN A;  3H6Z A;  1I8F A;  2F5K A;  2RK1 A;  3DLL A;  1K8A U;  4PJO D;  3JB9 J;  2RJF A;  4C92 B;  3OY9 A;  1W2B A;  2P0P A;  4EMG A;  3Q1J A;  2RHZ A;  2EQM A;  3TEE A;  2OTJ T;  4MMK A;  4JS5 A;  1VQ8 T;  2KMT A;  2MWO A;  1R8O B;  2JOY A;  2LX9 A;  2XHC A;  4L6V 5;  3V7R A;  4CI0 C;  4GY5 A;  2ZPB B;  2VUB A;  2DZ9 A;  1JB0 E;  5FU6 C;  4PJO A;  3CCM T;  3PIO A;  3CC7 T;  3E19 A;  2WAC A;  4OF1 A;  3X26 B;  5D6X A;  2H3J A;  4C92 D;  1D3B A;  2A7Y A;  4KUD K;  1Q7Y U;  4N0A A;  2K5I A;  1W2B S;  3X25 B;  3BDL A;  1U8R A;  3HRS A;  2E70 A;  3OYB A;  2EYQ A;  2QTX A;  1ZBX A;  4M7A F;  1FX7 A;  4B9X A;  3G6E T;  3JB9 I;  3ZBD A;  3HFN A;  1VUB A;  2DK3 A;  4C92 A;  2OAU A;  3JCM c;  3CMA T;  1XNI A;  3HRU A;  2R5A A;  4XQ3 A;  3N5B B;  5GAM h;  2DIQ A;  2RJE A;  4TVR A;  1K9M C;  4KUI A;  3OSV A;  5FRN A;  3C4S A;  1WPY A;  2LQK A;  2MAM A;  1UGR B;  2DPP B;  4M7A B;  4EMK C;  2OTL T;  2RK2 A;  2K4Y A;  1YIJ T;  5GAO l;  4J83 A;  3CCU T;  1VQ5 T;  3LW5 E;  1VQM T;  1TH7 A;  1QVG S;  3CXC A;  4BB7 A;  2XI9 A;  4FSX A;  4M77 G;  2K5L A;  2KY9 A;  2M16 A;  4ZN1 A;  3JB9 G;  2PUO B;  2XD0 A;  4O5V A;  2E1H A;  3S3O A;  2BIV A;  4EDU A;  4M78 F;  3GIB A;  1HK9 A;  4IUQ A;  4UC4 A;  1YJN A;  2D0Q B;  4IUU A;  4BY6 B;  4C8Q F;  1Q81 U;  3RMS A;  2EFI A;  3CCE T;  4PNO A;  3PNW C;  4OGE A;  1B34 A;  3G71 A;  3CEY A;  2DD5 A;  4PJO G;  3OYD A;  2EWN A;  3CXC S;  4M7D F;  4Y28 E;  2VC8 A;  1BI0 A;  5HY6 A;  5GAN 5;  1S72 T;  1N6A A;  1VQ6 A;  2GFU A;  3MEU A;  3V7C A;  2MI6 A;  2EQU A;  3ER0 A;  1OZ3 A;  4HA8 A;  3A8H B;  3CCV A;  3JB9 H;  4ELY C;  3SFM A;  2M9U A;  1YBY A;  1M4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...