2P0PA

Calcium binding protein in the free form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
source organism Nostoc sp.
molecule tags Metal binding protein
total genus 40
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0pA02
2P0PA 3URGA 2K2VA 2P0QA
chains in the Genus database with same CATH superfamily
3VYGA 2GGRA 4PNOA 2DL7A 3OYAA 3M4GA 3SHWA 5GAMe 2H3EB 1KQ2A 3CCRQ 2H8HA 3TU4K 2QTXA 2ABLA 1KJWA 3QDRB 5M9OA 1MV0B 2ZPFB 1WI7A 4X9DA 4Z88A 5KCOA 1UGVA 3VYHB 1GBQA 3RKXA 4PJMA 3UA7A 3Q1JA 1OX8A 4C92F 1VQ5T 2H3JA 4LDUA 1M1FA 4GLKA 2QA4A 1K9AA 1Q95G 3BY7A 2JOYA 2KSSA 3P8BB 1OV3A 3MPUB 4LUEA 3PGGA 2FO0A 2L8DA 1YJNA 2PUOB 4XQ3A 2XICA 3QG1A 3EHRA 5HY6A 3CMEQ 1WA7A 3I5SA 5GANh 1G3SA 4OGCA 3NGPA 3PT9A 4C5GA 1GCQC 2DL3A 3OQ5A 3EFSA 4A4GA 4QVZA 1RUWA 3REBB 2DF6A 2EBPA 1AZGB 3HFOA 4RCCA 1K8AR 4M78E 1VQNQ 2EFIA 1BB9A 2RI3A 1VA7A 3TEEA 2ZPGB 2QQSA 1V76A 2DEUA 4FU6A 2IVWA 2CREA 4F14A 4PLIA 3EAEA 3QJ6A 2C0IA 1TUDA 2VB6A 2J6FA 2V1QA 4QQ6A 5GAMd 1VQ8Q 4C8QD 4PL6A 1M9SA 5LL6S 4FSSA 2QA4T 2QQBA 5FROA 4M78G 1W2BA 1K9MC 1M1KU 1N8RR 2X4XA 1TSFA 3WVEB 2L3RA 1YJNT 4KH1B 1TTHB 3QUIA 1NM7A 2GNCA 2DA9A 1EFNA 3FEOA 5GJVB 3JCMe 3OW2S 2F2VA 4M77A 3OYYA 2BTTA 4E7ZA 3CPWP 4RTUA 2DL5A 3M59A 2E5QA 2O2OA 4F7UB 4FYVB 4LDYA 2DVEA 3G4SA 3EGDA 4OB1B 2O31A 1Q82U 5LJ5d 4IUVA 1V29B 2DIQA 4OB3B 1PKTA 4A4EA 5C6SA 1YCYA 2P4TA 5FU6B 3CPWS 5A0GA 1UUEA 3CBPA 1ABQA 2CSIA 3OYLA 1T0HA 2BZXA 3EFOB 3REAB 1SRLA 4QVDA 3MEAA 3JAME 1E6HA 1VQ7Q 3SD4A 4BDZA 3QWYA 3PNWC 2DTHA 1RADB 1VQ6Q 5KYUB 4J9FA 3I35A 1PHTA 1VQNT 1I07A 4RTYA 2DL8A 2HBWA 2RMOA 1X2KA 1OPLA 2EYXA 1ZSZA 1JJ2S 2VXEA 2DERA 2A08A 1LCKA 4MZTA 1C0MA 2C0TA 3G4ST 1RAFB 4OMMA 5LJ3h 2HBPA 3JCMd 1H641 1BK2A 3OYJA 3OMGA 1MNDA 2EVRA 2VASA 3KUFA 3VRZA 1T0JA 2OI3A 1VQ8T 2HDAA 1M90R 3FJ5A 5CKFA 2LDMA 2DZCA 5KYWB 3M0PA 3I55Q 3JRZA 5GANf 5AYFA 1KQ1A 1PKSA 4J83A 3EG9B 3JB9F 1RAEB 2OTJA 5IXBA 3OY9A 3PIOA 2RF0A 3M0SA 4M75D 4BI3A 2E6NA 4EMGA 2O9SA 4PJLA 4PJOA 1BU1A 3E1SA 2ZPIB 3QDFA 1TXQA 4C0GA 1NJIU 1Y0MA 2X3XD 3RUXA 4ZNXA 4M7AC 2FZKB 4DOVA 1E7OA 3SWNB 1MNEA 1PC0A 2EQMA 1TOVA 2CP3A 4OGEA 2ROTA 3CXCS 1WIEA 3P8HA 1M1KC 5GAOp 1I81A 2NWMA 1QWEA 4LN2A 3P8DA 4RCBA 2DJZA 3J80E 4HCBA 5GMKm 4JLIA 1YNZA 2RHIA 4HCKA 4FW1A 3EG2A 2JMCA 2DX1A 2L3PA 3FIFA 4M75B 3C12A 3QYGB 2Y90A 2V8IA 1KC8U 1JXOA 3HKSA 4PKCC 1Q82C 2COWA 2VYTA 1QCNA 2O01E 1D1AA 1AOJA 1KSWA 3CCSA 2L2PA 3T9NA 1EIFA 5GAN5 2SEMA 4XAXB 4J9EA 4ORZA 3V7SA 3E2UA 4WTOB 2YSQA 2E65A 4NL3A 2E41A 1VQPQ 5GAMj 1AWOA 1RI9A 2KNBB 3CQTA 4HA8A 5AT1B 2KAFA 1M1GA 2DKGA 2KROA 2COYA 3CMAQ 2K3XA 3MO8A 3CCEQ 2HSPA 4BI8B 3RESA 2JM9A 5KCHA 3I55T 1D3BA 3JSCA 2ECZA 1KHCA 2FPEA 3UATA 4C92G 4C92A 2KVQG 4JJDA 3MJXA 2MPXC 5GAOr 4IUQA 1UDLA 3OYCA 2CZ7B 2PVDB 2L0AA 1UFFA 2E4HA 2P0QA 2F69A 2ZPHB 1RAHB 5CO7A 2HQEA 2LZ6B 4B9WA 5GANe 5FW9A 2WSFE 1VQOA 2K5FA 3C4SA 4RTTA 2I0NA 5LJ5j 3G7ZA 1M3AA 2K2MA 5GAOl 2WACA 3CC7A 2WSCE 5CQXA 3VS0A 1OZ2A 3HPWA 3CCLQ 3CCUT 2DMOA 4KGVB 3A8LB 1UECA 2AK5A 2KRSA 3SDZA 2J7IA 3A1PA 1JO8A 2X35A 1PWTA 2OTLQ 3H9NA 2QEXA 1NJIC 1K76A 4MZMA 2LX7A 3OYIA 4F7UF 5HK0A 2CKKA 2RJEA 4M77C 1S72A 3TQ7P 3G1JA 1QVGP 4DQ2A 4DBRA 1Q86U 2MOXA 2EJFA 2O4XA 3PVQA 2O9VA 2QAZA 2NLUA 3C95A 1CSKA 1RI0A 2CT4A 1WHGA 4KGXB 4E7JA 4AFZC 1G3YA 2RJDA 5FU7C 2EGEA 1YCSB 4ATOA 2LCSA 3META 5KYXA 4AFUC 5I11A 4BE2A 2DBMA 1KC8C 2X4YA 3NHNA 4M7DA 3O8VA 3MP6A 4J6XA 1OYXA 4J8OA 2K2VA 3H8ZA 5I21A 2XD0A 3UPUA 4J9CA 3CMAT 3EGXA 2VUBA 1HYOA 3CCET 4OP0A 1GL5A 2QQ9A 3M0TA 1XJWB 2MWOA 1OU9A 1YP5A 3EH2A 2FL7A 3GLXA 4WF2A 1NG2A 1X6BA 4ZTJA 4C0DC 4AG2C 1IREB 1F1BB 1WHJA 2ZAEA 3X25B 2CH4W 3OSVA 2D8HA 2CSQA 1TS9A 4E6RA 1ZSZC 4BACA 1RAIB 4DEXA 2EKHA 4KH0B 3L2UA 3X28B 2YLCA 3ZEHA 1YHQA 1WXTA 1M2VB 1N27A 1MUZA 1PSEA 3CD6A 1QKWA 1X43A 2EQIA 1IXDA 3CCLT 2DXTA 5HCKA 4BDYA 4M7AD 2KI7A 3VS4A 1YITA 1Y96A 2FYKA 1PCXA 8AT1B 2BKDN 3QZ5B 1G3WA 3I56A 4PJOC 4JJBA 4EIKA 2LJ1A 1IGQA 2YT6A 1KHIA 3JB9G 1ZLMA 3RMSA 4P5NA 3RKWA 1Q81U 2NYSA 1OU8A 3M53A 2DE0X 1FYNA 1ARKA 3V7CA 1WQ7A 1W1FA 1VIFA 2KRNA 2NUTA 5ECAA 5CQYA 1I1JA 4J9BA 1B34A 1H3ZA 4EMKA 3L2ZA 1UB4A 5CAIA 2FPFA 2VVKA 2K6DA 1PM3A 4QVCA 4NL2A 2GQVA 2ZPBB 3J7AF 4J6YA 1U5SA 2QA4Q 3HSBA 1YWPA 2LRQA 4M7AB 1Q86C 5L8RE 4Y92A 1YJNQ 2RD1A 4BD3A 1GBRA 3GNFB 4D8DA 2Y4YA 1QCOA 1YITT 1LJOA 1WQWA 2YUQA 4ELZC 1WLPB 5IHKA 1QVFA 2PTKA 3PE0A 2E12A 2LQKA 3M54A 2LCLA 4HT9A 4PFZA 3FDRA 2COZA 1PSFA 2A0FB 3JCMX 2JJ9A 2K3BA 4GLMA 4J7IA 4QT7A 1NYGA 2J06A 4JRQA 2R5AA 2FVUA 1NEGA 1ZA2B 3MEWA 5D6YA 2EYZA 2QDLA 3CCQA 1I4K1 2DNUA 2GBQA 3UT1A 1IZ6A 3M55A 2I2LA 3GP8A 2P4RA 1NPRA 2HZYA 2G6FX 4C92C 3MP8A 3QXEB 5GMKl 8ATCB 1EX4A 1DJ7B 1RABB 1D1CA 4JPBW 2M02A 1GRIA 2X3WD 2YDLA 2AT1B 4E7SA 2MK5A 1KG1A 1BIAA 4EDUA 3E9FA 1LOJA 1RAAB 2YXYA 2NUPA 2V1RA 1TWBA 1FX7A 5GAN8 5CKEA 4ZTFA 4RKUE 4F17A 3IQLA 1J3TA 1KD1U 2DM1A 2K5LA 3G4SQ 4RG2A 1Y7XA 2K3YA 3BDLA 4LUDA 2QK0A 4AFSC 4DBHA 1GCPA 1ZBJA 3OW2P 3DKMA 4M77D 5GANg 2RA2A 2E3IA 2L3QA 4N4GA 2JXBA 4F7UE 1SEMA 2CZ6B 1UTIA 3RMQA 1Q82R 4M78A 1C6VX 1KQSP 3OYMA 1R8OB 2LC4A 1SSFA 2RHYA 3KXTA 4F16A 2EPDA 2DRKA 4JJNK 4C8QE 1Q81C 4L6V5 3L1AA 3VUBA 4EMHA 2ZPEB 2M9UA 3QYHB 4VUBA 4XTXA 2DAQA 4LD6A 1MMDA 2KEAA 4LD9K 4L59A 3BE3A 4NOYA 2KXDA 5I22A 1UE9A 1UJYA 4M4ZA 1OULA 3A8MB 1VYUA 1K8AU 2HL3A 3CPFA 1RLPC 4BE1A 1U1TA 2EQJA 3FRNA 1K4US 1PNJA 1KQSS 1VIEA 4J6WA 4ZN3A 3JB9I 3WXMB 4F7UG 4AMCA 2BE7D 2EYQA 3OYBA 4HVVA 3M56A 3GBQA 2RH2A 4C8QB 4JRPA 4M77B 5KYYB 4HCZA 3VRYA 2DBKA 2BZYA 4M7DC 3CBMA 2DVJA 2A28A 5KH6A 3EGDB 2RQUA 3U23A 2DK3A 3EFOA 3RDVA 5FU7B 2YRVA 1N8RU 2VXFA 2QGFB 2OTJQ 1JJ2P 5GJWB 3EFRA 4X9CA 1SHFA 3ER0A 1QWFA 1AZEA 2JUFA 3LWIA 4KULA 3VS6A 1GFCA 2E10A 1S1NA 1RLQC 1VQ9A 1NLPC 4J9HA 4XTUA 3OYKA 3WVDB 1X6OA 4JJCA 3G6EA 1MGQA 2ATCB 2JZ2A 4DBQA 1QLYA 2JT4A 1I5OB 2HL5C 2HQHA 1WX6A 3HTRA 1U1SA 5EG2A 2LX9A 3ME9A 4PJOD 4E7HA 2RQTA 2HCKA 4C0DB 2VC8A 3KBGA 2LJ0A 1G3TA 2CZ0B 4DBFA 5L23A 1TG0A 3OBYA 4OMNA 1FXXA 1XTDA 2KYBA 2VV5A 1ZSZB 2JTEA 3EG9A 3CCVA 1YBYA 1N5ZA 3CXCP 1KD1C 2RQWA 3CC4A 4N0AA 1JEGA 2XU8A 1AVZC 1SSHA 2HD0A 4IUUA 3NMZC 1JRIA 5LJ3g 2EKOA 3CCSQ 2E64A 2XKOC 3EG1A 2MI6A 3MEVA 2EYYA 4GY5A 3OYGA 1KK7A 1ABOA 4M75E 1AHJB 2RHZA 3SWNA 1Q7YU 4M7AF 1NLOC 3JB9J 3G6ET 4PJOB 1VQKA 2KR3A 3CCJA 3CCUQ 4LXCA 3VJPA 1QVFP 4GBQA 3EH1A 3INZA 4E7LA 4J9GA 1M90U 4C0FA 1WJSA 1KFZA 1FMVA 1R77A 2LQWA 3URGA 3H0FA 3RR6A 5IAYA 1D0XA 1K8AC 5I2SA 1XOVA 2RNAA 4M75G 1PD0A 2HKQB 4MMKA 2OTJT 3BFMA 1N9RA 1TU0B 1QVFS 5GAMh 1ZUYA 3OYNA 2M51A 3NTHA 1HSQA 2XG8D 3CC2A 3QZ9B 4II1A 1N9SA 1Y57A 2EGAA 2HNIA 2YHTA 2JN0A 1VQOQ 1NPPA 4C92D 5GAN2 2KT8A 3HRTA 3QSUA 2CH4A 3M57A 2YUOA 2DXUA 5D7UA 1R0CB 1N8RC 2ROLA 5CK9A 2OAWA 1U8RA 5EC7A 1VQKT 5GMKh 3M0QA 2BUDA 3HHTB 4HKEA 1K73U 2YUNA 2RK2A 1WNLA 3R6NA 3VS3A 3FLGA 4HXJA 2DPPB 2QEXQ 3RIRA 1YI2A 1G5VA 4IIOA 5FRMA 5LJ5h 4IIMA 3VS7A 2IG0A 3L2QA 1OQKA 5KE3A 3CBOA 1W70A 1S72Q 1VQLA 1M2OA 1YJ9A 1G83A 3M58A 1QW1A 3THKA 2D9TA 3JCMP 2YUPA 1D3BB 1W2BP 4ELYC 2IPOB 1VYTA 3CCST 1E6GA 1U06A 5LJ3f 3ZBDA 1JQQA 2AKKA 3CC2T 2JTMA 1ZBXA 2AHJB 1WYXA 4D8KA 1VQ4A 1A0NB 1X27A 4M78C 2F2XA 1UGQB 3ZL7C 3NPFA 1Y71A 1IGUA 1W2BS 3OYDA 2QQAA 3EGUA 1PG5B 3JCMc 1TUCA 2KQWA 1SPKA 1JXMA 2DIGA 1Q7YC 2LQ8A 2BE9B 2KYMA 2E5KA 3JCMh 3GF5A 2LTOA 3OS2A 1BIBA 4C8QF 3GIBA 4M77F 4M7DD 1G2BA 2X9HA 1VQLT 2PNIA 4KGZB 4E47A 3TVTA 1M90C 2QG9B 4E7KA 1D0ZA 5CVIA 5FRNA 2PVOB 3R6OA 2DLPA 4MDWA 1VQOT 1C1AA 2BZ8A 2QXFA 1BYMA 5FU6C 2MAMA 1YHQQ 4QKUA 2VWFA 3CC7T 2CT3A 3OB9A 2P0PA 2RN8A 3G71A 2J6OA 3CCMA 1UGSB 3CD6Q 5GANd 1YJWA 1TH7A 1D1BA 4ZGEB 1UJ0A 1YITQ 2E1HA 3GNGA 4CRIA 2CP5A 2K5IA 4FW2A 5GAMf 2LMJA 3L2RA 2QEXT 4Z89A 5KYXB 4O6JA 3JB9H 4V2SA 5DM7R 3I56Q 2LNVA 3CPWA 2LT4A 4ME7A 2OTLA 4OMLA 2XK0A 1UG1A 3JV3A 1P92A 4M7DB 4A4FA 1S72T 1MMGA 3I5RA 1YIJA 3PMIA 2DRMA 2EJ9A 1VUBA 1HD3A 5IXFA 4BY6C 1IHWA 3OBWA 1K73C 1WZOA 5I2MA 1M4ZA 1IHVA 4BE0A 4XTYA 1WFWA 3LH0A 4X34A 1FWZA 2DJQA 1K9MR 1XNIA 3L42A 3LGLA 4PJNA 3UDCA 2PUKB 5FLXE 1UGRB 3ULRB 1W6XA 2HAXA 1I8FA 1M8MA 2QGGA 1WXBA 3FJPA 4XU1A 5LJ5f 4FYYB 4FT4A 3G71T 5DY9A 3CCMT 2L89A 3M0UA 5LJ3e 3LWHA 2W10A 1EZZB 3A8OB 5CKHA 4N0AC 4JDSA 1ZX6A 3V8LA 3NTKA 2DTIA 1FMKA 4M7AE 2JTFA 3OA6A 1BI3A 2MCNA 1AWJA 3SWNC 2B8AA 5IH2A 3LLRA 3VV0A 1QVPA 1ACMB 4C5HA 7AT1B 1QMCA 2K79A 2CYZB 4DOWA 4QQGA 2Z0WA 4LE9A 4JS4A 2VGNA 4KBMB 2DYIA 4M75F 4OMOA 4E2FB 2GCXA 3CCQQ 1M3BA 1AWWA 4M7AG 1YHQT 4A4HA 4JRIA 4F04B 1SHGA 2DTOA 2KXCA 2NUTB 3CD6T 1JU5C 1VQ5A 1B34B 4IUTA 3E19A 4XTVA 4YTLA 1OI1A 1K0XA 3DB3A 2HMAA 4HT8A 1AD5A 1BBZA 1H92A 2LQNA 3QHSA 3J81E 1LVKA 3H0HA 3M0RA 5GAN6 4CC2A 3LYIA 2EYWA 2HSEB 3I56T 1QP3A 5GAN4 1VQMA 4A4KA 5KYNA 5DLQE 2J05A 4JZ3A 4LDWA 4AG1C 1BCOA 2DZ9A 4A54A 5LJ3d 2FEIA 1SF9A 3H0IA 2VGMA 4NS5A 2DD5A 2C0OA 2FPDA 1O9SA 2K57A 2ESWA 3HRSA 1KD1R 5GAOm 3OS0A 3JCMQ 1ZHIA 1MV3A 1I5LA 2RHXA 5GMKe 2QYZA 2XI9A 1RAGB 2D8JA 3M4YA 2NUZA 2XIDA 2XHCA 5D6WA 1WJQA 2EJGA 1V1CA 2EW3A 4R0KA 1M1KR 4M78D 2MWPA 2DEQA 1UHFA 5LJ5e 5A0LA 1WXUA 1VQMT 1G8XA 4FL6A 3CCRA 5GAOn 2RK1A 3I9QA 3OSSC 5D6XA 2EAYA 2NUPB 1LPLA 4J9IA 3HP9A 4MMLA 1W4SA 2X51A 2ZCFB 4OMFB 2JNGA 1BI0A 2KDSA 4OF1A 2LVMA 2BIVA 2HQXA 2JS0A 2QI2A 3CCQT 2MF2A 5GANj 4ZN1A 2LT1A 2A3LA 2K4YA 2XDBA 3SFMA 3QWXX 4M77E 2YWWA 2DFUA 2QASA 3ZFJA 3PVLA 4UC4A 2F1LA 2LP5A 4PFOA 1OX9A 4BI4A 3PTAA 2ED0A 2RQVA 4M78B 3BW1A 2RJCA 1ZUUA 1T3SA 3ASKA 3CMEA 4JUVA 1VQ9Q 2C06A 2OX7A 1HJDA 2OJ2A 4XU3A 4F7UA 3G6EQ 3NTIA 3KFVA 2XDDA 2QDYB 1QQJA 1B7TA 2D0NA 1ZUKA 2QTVA 5CR2A 4C8QA 4C8QG 1VQNA 4M77G 3SEMA 3V8JA 5KYYA 4RMOA 5IN1A 3CCRT 2JM8A 3QJYA 4J7FA 1QCFA 4FYWB 1TUGB 3VS5A 4FIBA 2P84A 5FWBA 2RQRA 3VU3C 2GTOA 1WHLA 4M7DF 4Q5WA 4CC7A 1H8KA 5IHIA 3CCVQ 3JCMb 3JCMV 1VQ8A 4EPCA 4RTVA 1QVGA 4XTZA 3A5ZB 2EIFA 1WHKA 2E70A 3X26B 5CCAA 2KE9A 3CC4Q 3L2WA 2ED1A 2WSEE 1WJRA 4N4IA 5KYUA 2RI5A 4BUGA 3L2VA 2DL4A 1GXIE 4ZGJB 3AT1B 3CMET 2E3HA 4AT1B 4CI0C 4HCCA 2K7AA 2F5KA 1QP2A 3UA6A 3RBBB 1VQKQ 3VUZA 3H6ZA 3CCJQ 1NJIR 2CP6A 1GFDA 3OMCA 2R58A 5J3BA 3A8HB 3C0CA 2PZ1A 1WHHA 2GFAA 4FT2A 5KYWA 4A63B 4RUGA 3MHXA 1Q7YR 2F5TX 4ANJA 2AZVA 4IKFA 3MCAB 4BY6B 1PD1A 5FWCA 4OMPA 1BI2A 2KT1A 4PJOE 3DLMA 2CP2A 1D0YA 1WPYA 4BB7A 2GF7A 1BKBA 2AKLA 3O5ZA 4DEYA 5CKDA 1AWXA 2V8KA 2LNHB 3VKIA 3BDUA 3MKDA 4Z02A 2DXBA 2E6ZA 2K9GA 4QW2A 5GAOq 5CIUA 3CC2Q 2V8JA 1VQ9T 4B6MA 4ZGDB 1R0BG 2RO0A 1VQ7A 5LJ3j 4EMKC 1KC8R 1VYVA 2DETA 3TREA 4PJOG 4LDXA 1VQ6A 5DLOA 4MDXA 2PU9B 4KUDK 4FSXA 1SG5A 4FYXB 2FZGB 1YFNA 5GMKi 4JZ4A 2F2WA 1Y07A 2V26A 4RTXA 2OAUA 2DYBA 2PVGB 5HKCA 3JCMW 3LH5A 4WCIA 4FM4B 2DD4A 1YI2Q 4M75A 3CCVT 2CP0A 2A7YA 3HFNA 2CDTA 1K1ZA 4HVWA 2JVVA 3QKJA 1VOMA 3I55A 1K73R 1HK9A 4CC4B 1VQLQ 3CC4T 1YJ9Q 1M5Q1 4HVUA 3V8KA 4TVRA 3QBYA 4OMQA 1UHCA 2D1XA 2FG0A 3FC3A 3RKYA 2MIOA 5KE2A 3PIPA 4XU0A 5A2QE 3V7RA 1U3OA 3E9GA 1VQ7T 1NYFA 4OB0B 2MMPA 3CC7Q 3A8GB 1IB8A 4X1VA 2JW4A 2GQIA 2DO3A 1VQ6T 3CCJT 1VQ4Q 4C92E 5GAMg 1MMNA 5GAN3 3H41A 1NZ9A 2IIMA 2ZZDA 2M0OA 2JMAA 4R55A 4KT0E 3CCUA 4JRKA 3OS5A 3DB4A 5J39A 2RPNA 4D6WA 4C5EA 4ESRA 1YWOA 2FZCB 1X01A 2D6FA 4RTZA 1BI1A 1CKBA 3RERA 5J26A 4N4HA 4XTWA 2X4JA 2L5QA 4PLLA 1X2QA 4JLGA 3X24B 2O88A 3LX7A 2MYSA 3VS2A 4C92B 4QQDA 3N5BB 1PRLC 5GMKj 1Q86R 1GCQA 4KUIA 2ENMA 2VKNA 1CKAA 5LJ5g 3S6WA 4O5VA 6AT1B 4J9DA 2YRDA 3VS1A 1AEYA 1JBMA 1SKUB 2KGTA 3G71Q 3CCMQ 2KBTA 2KK4A 2RJFA 1T3LA 4M78F 1YJWQ 5C0MA 1M3CA 4Y28E 1VQPA 3S3NA 1O75A 1X69A 4IUPA 2EGCA 2CUDA 1YI2T 4OVAA 4PK4A 3MEUA 2RI2A 1QKXA 2QQRA 4J5YA 5CKBA 2CUBA 3CMAA 3CCEA 1YN8A 4KRTA 4MZPA 9ATCB 1OOTA 4IURA 1UGPB 2CGHA 3TSZA 1YJ9T 4LDVA 1YIJQ 1JB0E 4L5GA 1NEBA 3QIIA 3JCMJ 4C8QC 5GAN7 2YRCA 3OW2A 1N6AA 1LNXA 2EQKA 4B9XA 1UEBA 3TSWA 2KY9A 2M0YA 2O4XB 4M7DE 3HL8A 2EQUA 3QPHA 1KQSA 4DA4A 3TCJA 1I0CA 4C0ZA 3SB2A 1M30A 2HEQA 2AIRB 2CP7A 3JCMg 1ZQ1A 4LNPA 3F70A 2P0KA 1VQ4T 2L3SA 3LW5E 1SRMA 2A36A 2KRMA 1MMAA 2M1HA 3UWNA 3LGFA 2RHUA 3CCLA 4FCYA 1X75C 1QVGS 2A37A 2XDPA 1H3HA 2CZ1B 1VQPT 1K0SA 1XQHA 4E7IA 2R57A 2GFUA 4Z8AA 1NBEB 4A53A 4M7DG 1ZA1B 3MP1A 1ZSGA 3EGXB 2W0ZA 1B07A 1WHMA 1D09B 4R56A 1HXDA 3M5AA 1BCMA 1M27C 4AFQC 1Z9QA 2X4WA 2LCCA 1PRMC 4PFPA 3GPLA 1OPKA 1X6GA 2KMTA 3OYHA 3PMTA 3D7SB 3OYFA 1MHNA 3EHQA 4RTWA 1M2VA 2ZGWA 3JB9D 1Q81R 1WGSA 1KIKA 2FHDA 4OB2B 3S3MA 3DLLA 1JJ2A 4PJJA 2M16A 3CEYA 3S3OA 1OEBA 2FRYA 1VQ5Q 1YJWT 3NFCA 2AZSA 1WDXA 3EG0A 3M9QA 1AT1B 3GOXA 4C5IA 3C94A 4PJOF 3OS1A 1FMWA 1NE8A 2EWNA 2LJ3A 4K11A 1Y96B 3PFSA 3RNJA 5A0DA 1VQMQ 2OTLT 2FRWA 2RB6A 4RG8A 1YIJT 3A98A 2SRCA 3AHUA 4CC3A 1M8VA 1K9MU 2XMFA 2G3RA 3EG3A 2GTJA 2R5MA 2RM4A 2YLBA 5IT9E 3UF4A 2HKNA 4Y91A 2B86A 4M7AA 2D0QB 5IHNA 3FB9A 1Z9ZA 1IRXA 5HK3A 3CXCA 3QO3A 2J6KA 4JS5A 4M75C 1RL2A 3HRUA 4EMKB 1IO6A 2JS2A 3JCMf 1B3QA 2DXCA 3X20B 4XU2A 2CS7A 2FB7A 3OYEA 2Y4XA 1OZ3A 1RACB 2DILA 4XK8E 2PQWA
chains in the Genus database with same CATH topology
1QVFS 5GAMh 4FIBA 4ATOA 3VYGA 4PNOA 3META 3VU3C 3OYNA 4M7DF 3OYAA 4BE2A 4Q5WA 3M4GA 5GAMe 3NTHA 2XG8D 3CC2A 3QZ9B 4II1A 1KC8C 1KQ2A 2X4YA 1N9SA 3JCMb 3TU4K 2HNIA 2YHTA 3JCMV 1VQ8A 2QTXA 2JN0A 4EPCA 1QVGA 4M7DA 3O8VA 1NPPA 3MP6A 3A5ZB 1OYXA 4J6XA 2K2VA 4J8OA 4XTZA 3H8ZA 3HRTA 4C92D 2EIFA 5I21A 2XD0A 3QSUA 3UPUA 3M57A 2E70A 3QDRB 3X26B 5CCAA 5M9OA 2ZPFB 2VUBA 2DXUA 3L2WA 3CMAT 1N9RA 2WSEE 3CCET 1WJRA 4OP0A 4X9DA 1N8RC 2QQ9A 4N4IA 5CK9A 5KCOA 1U8RA 2RI5A 2MWOA 4BUGA 3L2VA 3VYHB 2FL7A 5GMKh 1VQKT 3GLXA 4WF2A 4ZTJA 3RKXA 4C0DC 1IREB 2BUDA 3HHTB 4HKEA 1K73U 3Q1JA 1GXIE 3X25B 4ZGJB 4C92F 2RK2A 3CMET 3OSVA 1WNLA 2H3JA 4LDUA 1M1FA 1VQ5T 4GLKA 3FLGA 2QA4A 3BY7A 4CI0C 2JOYA 2KSSA 3P8BB 4HCCA 2DPPB 3RIRA 1YI2A 2F5KA 1QP2A 3PGGA 1G5VA 4BACA 3VUZA 2L8DA 3H6ZA 5LJ5h 1YJNA 5FRMA 2PUOB 3OMCA 4XQ3A 2R58A 2XICA 5J3BA 2IG0A 3L2QA 3A8HB 5KE3A 3QG1A 3CBOA 3L2UA 5HY6A 2GFAA 4FT2A 1VQLA 3X28B 1YJ9A 5GANh 1G3SA 3MHXA 4OGCA 3M58A 2YLCA 1QW1A 2F5TX 3ZEHA 3PT9A 1YHQA 2D9TA 4IKFA 3MCAB 4BY6B 4C5GA 3OQ5A 1N27A 1PSEA 1BI2A 3EFSA 4A4GA 3JCMP 3CD6A 1D3BB 4QVZA 3DLMA 4PJOE 4ELYC 3CCLT 1WPYA 3CCST 3HFOA 2DXTA 4RCCA 4BDYA 5LJ3f 4M7AD 4M78E 4BB7A 2EFIA 3ZBDA 1YITA 3CC2T 1Y96A 2RI3A 2GF7A 1BKBA 2JTMA 2FYKA 5CKDA 3TEEA 2V8KA 2ZPGB 2BKDN 2QQSA 3VKIA 1ZBXA 2AHJB 2IVWA 4FU6A 3BDUA 4Z02A 3QZ5B 1G3WA 4PLIA 3I56A 3EAEA 3QJ6A 4PJOC 2DXBA 2E6ZA 4QW2A 4QQ6A 1VQ4A 4M78C 5GAOq 5CIUA 1UGQB 2V8JA 5GAMd 4C8QD 1VQ9T 1KHIA 4PL6A 4ZGDB 1Y71A 2RO0A 5LJ3j 4EMKC 1M9SA 3JB9G 1W2BS 5LL6S 1VQ7A 3RMSA 3OYDA 4P5NA 2QQAA 3RKWA 1Q81U 3TREA 4PJOG 3M53A 4LDXA 1VQ6A 5DLOA 4MDXA 3JCMc 3V7CA 2KQWA 2PU9B 1WQ7A 2QQBA 4M78G 5FROA 2QA4T 4FSXA 1W2BA 1VIFA 1K9MC 1M1KU 4KUDK 2DIGA 1Q7YC 5CQYA 2LQ8A 1B34A 1H3ZA 2X4XA 4EMKA 3WVEB 3L2ZA 2L3RA 1YJNT 1UB4A 3GF5A 3JCMh 2LTOA 5CAIA 1BIBA 5GMKi 4C8QF 3OS2A 3GIBA 3QUIA 4M77F 4QVCA 1Y07A 2GQVA 2ZPBB 4NL2A 2OAUA 3J7AF 4M7DD 3FEOA 4J6YA 3JCMe 3OW2S 2PVGB 5HKCA 3JCMW 1VQLT 4FM4B 2DD4A 4E47A 3HSBA 4M7AB 2LRQA 1M90C 4M75A 4M77A 1Q86C 3OYYA 5L8RE 3CCVT 4E7KA 2A7YA 2RD1A 3HFNA 5CVIA 2PVOB 4BD3A 5FRNA 3R6OA 2JVVA 3QKJA 4MDWA 1VQOT 3GNFB 3M59A 2E5QA 3I55A 4F7UB 2Y4YA 1YITT 1HK9A 4LDYA 2DVEA 3G4SA 1LJOA 2QXFA 4OB1B 3CC4T 5FU6C 1WQWA 1Q82U 2MAMA 5LJ5d 1BYMA 1M5Q1 4ELZC 1V29B 4IUVA 3CC7T 3OB9A 1QVFA 3V8KA 2E12A 2LQKA 2P0PA 4TVRA 3M54A 2LCLA 3QBYA 3G71A 3CCMA 1UGSB 2DIQA 3FDRA 3S3MA 4HT9A 4OB3B 4A4EA 5GANd 1YJWA 1PSFA 5C6SA 3FC3A 1TH7A 3RKYA 4ZGEB 1YCYA 3JCMX 2P4TA 2E1HA 3GNGA 5FU6B 4CRIA 5A0GA 4XU0A 5KE2A 3PIPA 3CPWS 3CBPA 5A2QE 2K5IA 5GAMf 3V7RA 3E9GA 1VQ7T 4J7IA 4OB0B 3L2RA 2MMPA 2QEXT 3OYLA 3A8GB 4O6JA 3JB9H 4V2SA 5DM7R 4JRQA 2R5AA 2LNVA 2DO3A 3CPWA 2LT4A 4ME7A 3CCJT 1VQ6T 2FVUA 2OTLA 3MEWA 4C92E 2XK0A 5D6YA 4QVDA 5GAMg 1P92A 4M7DB 3MEAA 3JAME 4A4FA 5GAN3 1S72T 1NZ9A 2ZZDA 3CCQA 1I4K1 3PMIA 2M0OA 1YIJA 3SD4A 4R55A 4KT0E 3CCUA 4BDZA 4JRKA 2EJ9A 1IZ6A 1VUBA 3DB4A 3M55A 3OS5A 3UT1A 3PNWC 5J39A 4BY6C 2I2LA 3GP8A 2DTHA 1NPRA 4D6WA 3OBWA 1K73C 5I2MA 4C5EA 1M4ZA 4BE0A 4C92C 3MP8A 3QXEB 4XTYA 5GMKl 1DJ7B 3LH0A 4X34A 1VQNT 1FWZA 1XNIA 3L42A 1X01A 2D6FA 3LGLA 1BI1A 3RERA 5J26A 3UDCA 4N4HA 1KG1A 1JJ2S 1BIAA 2VXEA 4EDUA 4XTWA 3E9FA 4MZTA 1LOJA 2X4JA 2L5QA 2PUKB 4PLLA 5FLXE 4JLGA 4XK8E 1UGRB 3X24B 2HAXA 3LX7A 3G4ST 1I8FA 4C92B 5LJ3h 2HBPA 3FJPA 1H641 4XU1A 4QQDA 3JCMd 1FX7A 3OYJA 3OMGA 5LJ5f 3KUFA 5GAN8 4FT4A 1VQ8T 5CKEA 4ZTFA 4RKUE 3N5BB 3G71T 5DY9A 3CCMT 2L89A 5GMKj 5LJ3e 5CKFA 2LDMA 2DZCA 1KD1U 4KUIA 3LWHA 3A8OB 3JRZA 5CKHA 5GANf 4N0AC 2K5LA 1KQ1A 4JDSA 5AYFA 4J83A 4RG2A 1Y7XA 2K3YA 3BDLA 4O5VA 3NTKA 3S6WA 3V8LA 5LJ5g 3JB9F 2DTIA 2OTJA 4M7AE 1JBMA 2JTFA 3OY9A 3PIOA 3OA6A 2KK4A 1BI3A 2RJFA 3DKMA 4M75D 4M77D 4BI3A 5GANg 2RA2A 4M78F 2E6NA 4EMGA 4N4GA 5C0MA 3SWNC 4Y28E 1VQPA 4PJOA 2B8AA 3S3NA 3E1SA 1O75A 2ZPIB 3LLRA 1QVPA 3VV0A 4C5HA 2CZ6B 3RMQA 4F7UE 4IUPA 1NJIU 4M78A 4C0GA 3OYMA 1R8OB 2LC4A 2CYZB 3RUXA 1SSFA 2RHYA 1YI2T 4DOWA 4QQGA 4OVAA 3KXTA 4M7AC 3MEUA 4DOVA 2RI2A 4JS4A 2VGNA 4JJNK 4C8QE 2QQRA 4J5YA 5CKBA 4L6V5 3L1AA 3VUBA 1Q81C 3CMAA 4EMHA 2ZPEB 2M9UA 3QYHB 4KBMB 4VUBA 3SWNB 4MZPA 3CCEA 4M75F 4XTXA 2EQMA 4OGEA 2DAQA 4IURA 3CXCS 3P8HA 1UGPB 1M1KC 2GCXA 4LD6A 2CGHA 5GAOp 4LD9K 1YJ9T 4L59A 1I81A 4LDVA 1JB0E 4NOYA 4L5GA 4M7AG 1YHQT 4A4HA 3A8MB 4JRIA 3QIIA 3P8DA 4RCBA 3JCMJ 1K8AU 3CPFA 2DTOA 4C8QC 5GAN7 4BE1A 3CD6T 1U1TA 2DJZA 2EQJA 3FRNA 3OW2A 1VQ5A 1B34B 4IUTA 3J80E 1N6AA 3E19A 1VIEA 4J6WA 4ZN3A 1KQSS 4HCBA 1LNXA 2EQKA 4B9XA 1UEBA 5GMKm 4XTVA 3WXMB 3JB9I 4F7UG 3OYBA 4JLIA 2EYQA 1OI1A 4YTLA 2KY9A 3DB3A 2RHIA 2O4XB 4M7DE 4HT8A 3M56A 3HL8A 2EQUA 3QPHA 3QHSA 2RH2A 1KQSA 3J81E 4DA4A 3TCJA 4C0ZA 4C8QB 5GAN6 4JRPA 3FIFA 3LYIA 3SB2A 4M75B 3I56T 3C12A 4M77B 3QYGB 2Y90A 3JCMg 1QP3A 4HCZA 1ZQ1A 5GAN4 2V8IA 1VQMA 1KC8U 3F70A 4A4KA 2P0KA 3HKSA 4PKCC 5DLQE 1VQ4T 1Q82C 2VYTA 3LW5E 4LDWA 4M7DC 3CBMA 2M1HA 2O01E 3UWNA 3LGFA 5KH6A 2RHUA 2DZ9A 3CCLA 4A54A 1X75C 5LJ3d 2XDPA 3CCSA 1QVGS 2CZ1B 2DK3A 1VQPT 1XQHA 3T9NA 2R57A 1EIFA 5GAN5 4E7IA 4XAXB 2YRVA 5FU7B 1N8RU 2VXFA 2VGMA 2GFUA 4NS5A 2DD5A 3EFRA 4A53A 4M7DG 4X9CA 3V7SA 1O9SA 3ER0A 2E65A 3MP1A 2K57A 4NL3A 3HRSA 2JUFA 2E41A 3LWIA 4KULA 5GAOm 5GAMj 2E10A 3OS0A 3JCMQ 4R56A 1VQ9A 1HXDA 3M5AA 4HA8A 1ZHIA 2KAFA 4XTUA 3OYKA 1M1GA 2X4WA 1X6OA 2LCCA 3WVDB 3GPLA 3G6EA 1MGQA 2KMTA 2DKGA 2JZ2A 3PMTA 3OYHA 1I5LA 2RHXA 5GAN2 3OYFA 5GMKe 1MHNA 2K3XA 3MO8A 2XI9A 3M4YA 2ZGWA 3RESA 2XIDA 4BI8B 1WGSA 3JB9D 5KCHA 3I55T 5EG2A 1U1SA 1D3BA 2FHDA 2LX9A 2XHCA 3JSCA 1WJQA 1KHCA 2EJGA 4OB2B 5D6WA 3ME9A 4C92G 4C92A 3DLLA 4E7HA 2KVQG 4PJOD 4C0DB 2VC8A 1JJ2A 3KBGA 2M16A 3CEYA 1G3TA 4M78D 5GAOr 3S3OA 2CZ0B 4IUQA 3OYCA 2MWPA 2DEQA 3OBYA 5LJ5e 1YJWT 2CZ7B 5A0LA 2PVDB 3NFCA 1VQMT 1FXXA 1XTDA 2VV5A 2P0QA 2F69A 3M9QA 4FL6A 2ZPHB 3CCRA 3CCVA 5GAOn 1YBYA 2RK1A 5CO7A 2HQEA 3OSSC 5D6XA 2EAYA 4B9WA 4C5IA 5GANe 3GOXA 2WSFE 1VQOA 3C94A 4PJOF 3OS1A 2K5FA 3C4SA 3HP9A 1NE8A 2EWNA 1KD1C 4MMLA 1Y96B 5LJ5j 1W4SA 3G7ZA 3PFSA 3CC4A 5A0DA 2OTLT 4N0AA 2ZCFB 4OMFB 5GAOl 2XU8A 2JNGA 1BI0A 2KDSA 2WACA 2LVMA 2BIVA 2HQXA 4OF1A 3CC7A 2HD0A 4IUUA 2RB6A 2WSCE 2QI2A 4RG8A 5CQXA 1JRIA 2MF2A 3CCQT 5GANj 1YIJT 5LJ3g 1OZ2A 3HPWA 2EKOA 3CCUT 2E64A 2LT1A 4ZN1A 2XKOC 2A3LA 3A8LB 2K4YA 2MI6A 3SDZA 3MEVA 3AHUA 4GY5A 2XDBA 3OYGA 3SFMA 1M8VA 1K9MU 2X35A 1AHJB 4M75E 4M77E 2RHZA 2G3RA 3SWNA 1Q7YU 4M7AF 2R5MA 2RM4A 2YLBA 5IT9E 2QEXA 3JB9J 3ZFJA 1NJIC 3G6ET 4UC4A 4PJOB 4MZMA 1VQKA 4Y91A 3CCJA 4M7AA 2D0QB 4BI4A 3OYIA 3VJPA 3FB9A 4F7UF 4M78B 3PTAA 5HK0A 2CKKA 3BW1A 5HK3A 2RJCA 3ASKA 3CXCA 2RJEA 3QO3A 4JUVA 3INZA 3CMEA 4JS5A 4M75C 4E7LA 1RL2A 4M77C 3HRUA 1S72A 1M90U 2C06A 4C0FA 4EMKB 1WJSA 4DQ2A 1Q86U 4XU3A 2EJFA 4F7UA 3JCMf 3NTIA 2O4XA 2DXCA 3URGA 3X20B 2XDDA 2QDYB 4XU2A 2CS7A 5IAYA 1K8AC 2NLUA 3C95A 5I2SA 2FB7A 3OYEA 1RI0A 2Y4XA 5CR2A 4C8QA 1XOVA 4C8QG 4M75G 1VQNA 4M77G 3V8JA 4E7JA 4RMOA 1G3YA 1OZ3A 4MMKA 2RJDA 5IN1A 5FU7C 3CCRT 3QJYA 4J7FA 2OTJT 3BFMA 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0P A;  3URG A;  2K2V A;  2P0Q A; 
#chains in the Genus database with same CATH topology
 3VYG A;  2GGR A;  4PNO A;  2DL7 A;  3OYA A;  3M4G A;  3SHW A;  5GAM e;  2H3E B;  1KQ2 A;  3CCR Q;  2H8H A;  3TU4 K;  2QTX A;  2ABL A;  1KJW A;  3QDR B;  5M9O A;  1MV0 B;  2ZPF B;  1WI7 A;  4X9D A;  4Z88 A;  5KCO A;  1UGV A;  3VYH B;  1GBQ A;  3RKX A;  4PJM A;  3UA7 A;  3Q1J A;  1OX8 A;  4C92 F;  1VQ5 T;  2H3J A;  4LDU A;  1M1F A;  4GLK A;  2QA4 A;  1K9A A;  1Q95 G;  3BY7 A;  2JOY A;  2KSS A;  3P8B B;  1OV3 A;  3MPU B;  4LUE A;  3PGG A;  2FO0 A;  2L8D A;  1YJN A;  2PUO B;  4XQ3 A;  2XIC A;  3QG1 A;  3EHR A;  5HY6 A;  3CME Q;  1WA7 A;  3I5S A;  5GAN h;  1G3S A;  4OGC A;  3NGP A;  3PT9 A;  4C5G A;  1GCQ C;  2DL3 A;  3OQ5 A;  3EFS A;  4A4G A;  4QVZ A;  1RUW A;  3REB B;  2DF6 A;  2EBP A;  1AZG B;  3HFO A;  4RCC A;  1K8A R;  4M78 E;  1VQN Q;  2EFI A;  1BB9 A;  2RI3 A;  1VA7 A;  3TEE A;  2ZPG B;  2QQS A;  1V76 A;  2DEU A;  4FU6 A;  2IVW A;  2CRE A;  4F14 A;  4PLI A;  3EAE A;  3QJ6 A;  2C0I A;  1TUD A;  2VB6 A;  2J6F A;  2V1Q A;  4QQ6 A;  5GAM d;  1VQ8 Q;  4C8Q D;  4PL6 A;  1M9S A;  5LL6 S;  4FSS A;  2QA4 T;  2QQB A;  5FRO A;  4M78 G;  1W2B A;  1K9M C;  1M1K U;  1N8R R;  2X4X A;  1TSF A;  3WVE B;  2L3R A;  1YJN T;  4KH1 B;  1TTH B;  3QUI A;  1NM7 A;  2GNC A;  2DA9 A;  1EFN A;  3FEO A;  5GJV B;  3JCM e;  3OW2 S;  2F2V A;  4M77 A;  3OYY A;  2BTT A;  4E7Z A;  3CPW P;  4RTU A;  2DL5 A;  3M59 A;  2E5Q A;  2O2O A;  4F7U B;  4FYV B;  4LDY A;  2DVE A;  3G4S A;  3EGD A;  4OB1 B;  2O31 A;  1Q82 U;  5LJ5 d;  4IUV A;  1V29 B;  2DIQ A;  4OB3 B;  1PKT A;  4A4E A;  5C6S A;  1YCY A;  2P4T A;  5FU6 B;  3CPW S;  5A0G A;  1UUE A;  3CBP A;  1ABQ A;  2CSI A;  3OYL A;  1T0H A;  2BZX A;  3EFO B;  3REA B;  1SRL A;  4QVD A;  3MEA A;  3JAM E;  1E6H A;  1VQ7 Q;  3SD4 A;  4BDZ A;  3QWY A;  3PNW C;  2DTH A;  1RAD B;  1VQ6 Q;  5KYU B;  4J9F A;  3I35 A;  1PHT A;  1VQN T;  1I07 A;  4RTY A;  2DL8 A;  2HBW A;  2RMO A;  1X2K A;  1OPL A;  2EYX A;  1ZSZ A;  1JJ2 S;  2VXE A;  2DER A;  2A08 A;  1LCK A;  4MZT A;  1C0M A;  2C0T A;  3G4S T;  1RAF B;  4OMM A;  5LJ3 h;  2HBP A;  3JCM d;  1H64 1;  1BK2 A;  3OYJ A;  3OMG A;  1MND A;  2EVR A;  2VAS A;  3KUF A;  3VRZ A;  1T0J A;  2OI3 A;  1VQ8 T;  2HDA A;  1M90 R;  3FJ5 A;  5CKF A;  2LDM A;  2DZC A;  5KYW B;  3M0P A;  3I55 Q;  3JRZ A;  5GAN f;  5AYF A;  1KQ1 A;  1PKS A;  4J83 A;  3EG9 B;  3JB9 F;  1RAE B;  2OTJ A;  5IXB A;  3OY9 A;  3PIO A;  2RF0 A;  3M0S A;  4M75 D;  4BI3 A;  2E6N A;  4EMG A;  2O9S A;  4PJL A;  4PJO A;  1BU1 A;  3E1S A;  2ZPI B;  3QDF A;  1TXQ A;  4C0G A;  1NJI U;  1Y0M A;  2X3X D;  3RUX A;  4ZNX A;  4M7A C;  2FZK B;  4DOV A;  1E7O A;  3SWN B;  1MNE A;  1PC0 A;  2EQM A;  1TOV A;  2CP3 A;  4OGE A;  2ROT A;  3CXC S;  1WIE A;  3P8H A;  1M1K C;  5GAO p;  1I81 A;  2NWM A;  1QWE A;  4LN2 A;  3P8D A;  4RCB A;  2DJZ A;  3J80 E;  4HCB A;  5GMK m;  4JLI A;  1YNZ A;  2RHI A;  4HCK A;  4FW1 A;  3EG2 A;  2JMC A;  2DX1 A;  2L3P A;  3FIF A;  4M75 B;  3C12 A;  3QYG B;  2Y90 A;  2V8I A;  1KC8 U;  1JXO A;  3HKS A;  4PKC C;  1Q82 C;  2COW A;  2VYT A;  1QCN A;  2O01 E;  1D1A A;  1AOJ A;  1KSW A;  3CCS A;  2L2P A;  3T9N A;  1EIF A;  5GAN 5;  2SEM A;  4XAX B;  4J9E A;  4ORZ A;  3V7S A;  3E2U A;  4WTO B;  2YSQ A;  2E65 A;  4NL3 A;  2E41 A;  1VQP Q;  5GAM j;  1AWO A;  1RI9 A;  2KNB B;  3CQT A;  4HA8 A;  5AT1 B;  2KAF A;  1M1G A;  2DKG A;  2KRO A;  2COY A;  3CMA Q;  2K3X A;  3MO8 A;  3CCE Q;  2HSP A;  4BI8 B;  3RES A;  2JM9 A;  5KCH A;  3I55 T;  1D3B A;  3JSC A;  2ECZ A;  1KHC A;  2FPE A;  3UAT A;  4C92 G;  4C92 A;  2KVQ G;  4JJD A;  3MJX A;  2MPX C;  5GAO r;  4IUQ A;  1UDL A;  3OYC A;  2CZ7 B;  2PVD B;  2L0A A;  1UFF A;  2E4H A;  2P0Q A;  2F69 A;  2ZPH B;  1RAH B;  5CO7 A;  2HQE A;  2LZ6 B;  4B9W A;  5GAN e;  5FW9 A;  2WSF E;  1VQO A;  2K5F A;  3C4S A;  4RTT A;  2I0N A;  5LJ5 j;  3G7Z A;  1M3A A;  2K2M A;  5GAO l;  2WAC A;  3CC7 A;  2WSC E;  5CQX A;  3VS0 A;  1OZ2 A;  3HPW A;  3CCL Q;  3CCU T;  2DMO A;  4KGV B;  3A8L B;  1UEC A;  2AK5 A;  2KRS A;  3SDZ A;  2J7I A;  3A1P A;  1JO8 A;  2X35 A;  1PWT A;  2OTL Q;  3H9N A;  2QEX A;  1NJI C;  1K76 A;  4MZM A;  2LX7 A;  3OYI A;  4F7U F;  5HK0 A;  2CKK A;  2RJE A;  4M77 C;  1S72 A;  3TQ7 P;  3G1J A;  1QVG P;  4DQ2 A;  4DBR A;  1Q86 U;  2MOX A;  2EJF A;  2O4X A;  3PVQ A;  2O9V A;  2QAZ A;  2NLU A;  3C95 A;  1CSK A;  1RI0 A;  2CT4 A;  1WHG A;  4KGX B;  4E7J A;  4AFZ C;  1G3Y A;  2RJD A;  5FU7 C;  2EGE A;  1YCS B;  4ATO A;  2LCS A;  3MET A;  5KYX A;  4AFU C;  5I11 A;  4BE2 A;  2DBM A;  1KC8 C;  2X4Y A;  3NHN A;  4M7D A;  3O8V A;  3MP6 A;  4J6X A;  1OYX A;  4J8O A;  2K2V A;  3H8Z A;  5I21 A;  2XD0 A;  3UPU A;  4J9C A;  3CMA T;  3EGX A;  2VUB A;  1HYO A;  3CCE T;  4OP0 A;  1GL5 A;  2QQ9 A;  3M0T A;  1XJW B;  2MWO A;  1OU9 A;  1YP5 A;  3EH2 A;  2FL7 A;  3GLX A;  4WF2 A;  1NG2 A;  1X6B A;  4ZTJ A;  4C0D C;  4AG2 C;  1IRE B;  1F1B B;  1WHJ A;  2ZAE A;  3X25 B;  2CH4 W;  3OSV A;  2D8H A;  2CSQ A;  1TS9 A;  4E6R A;  1ZSZ C;  4BAC A;  1RAI B;  4DEX A;  2EKH A;  4KH0 B;  3L2U A;  3X28 B;  2YLC A;  3ZEH A;  1YHQ A;  1WXT A;  1M2V B;  1N27 A;  1MUZ A;  1PSE A;  3CD6 A;  1QKW A;  1X43 A;  2EQI A;  1IXD A;  3CCL T;  2DXT A;  5HCK A;  4BDY A;  4M7A D;  2KI7 A;  3VS4 A;  1YIT A;  1Y96 A;  2FYK A;  1PCX A;  8AT1 B;  2BKD N;  3QZ5 B;  1G3W A;  3I56 A;  4PJO C;  4JJB A;  4EIK A;  2LJ1 A;  1IGQ A;  2YT6 A;  1KHI A;  3JB9 G;  1ZLM A;  3RMS A;  4P5N A;  3RKW A;  1Q81 U;  2NYS A;  1OU8 A;  3M53 A;  2DE0 X;  1FYN A;  1ARK A;  3V7C A;  1WQ7 A;  1W1F A;  1VIF A;  2KRN A;  2NUT A;  5ECA A;  5CQY A;  1I1J A;  4J9B A;  1B34 A;  1H3Z A;  4EMK A;  3L2Z A;  1UB4 A;  5CAI A;  2FPF A;  2VVK A;  2K6D A;  1PM3 A;  4QVC A;  4NL2 A;  2GQV A;  2ZPB B;  3J7A F;  4J6Y A;  1U5S A;  2QA4 Q;  3HSB A;  1YWP A;  2LRQ A;  4M7A B;  1Q86 C;  5L8R E;  4Y92 A;  1YJN Q;  2RD1 A;  4BD3 A;  1GBR A;  3GNF B;  4D8D A;  2Y4Y A;  1QCO A;  1YIT T;  1LJO A;  1WQW A;  2YUQ A;  4ELZ C;  1WLP B;  5IHK A;  1QVF A;  2PTK A;  3PE0 A;  2E12 A;  2LQK A;  3M54 A;  2LCL A;  4HT9 A;  4PFZ A;  3FDR A;  2COZ A;  1PSF A;  2A0F B;  3JCM X;  2JJ9 A;  2K3B A;  4GLM A;  4J7I A;  4QT7 A;  1NYG A;  2J06 A;  4JRQ A;  2R5A A;  2FVU A;  1NEG A;  1ZA2 B;  3MEW A;  5D6Y A;  2EYZ A;  2QDL A;  3CCQ A;  1I4K 1;  2DNU A;  2GBQ A;  3UT1 A;  1IZ6 A;  3M55 A;  2I2L A;  3GP8 A;  2P4R A;  1NPR A;  2HZY A;  2G6F X;  4C92 C;  3MP8 A;  3QXE B;  5GMK l;  8ATC B;  1EX4 A;  1DJ7 B;  1RAB B;  1D1C A;  4JPB W;  2M02 A;  1GRI A;  2X3W D;  2YDL A;  2AT1 B;  4E7S A;  2MK5 A;  1KG1 A;  1BIA A;  4EDU A;  3E9F A;  1LOJ A;  1RAA B;  2YXY A;  2NUP A;  2V1R A;  1TWB A;  1FX7 A;  5GAN 8;  5CKE A;  4ZTF A;  4RKU E;  4F17 A;  3IQL A;  1J3T A;  1KD1 U;  2DM1 A;  2K5L A;  3G4S Q;  4RG2 A;  1Y7X A;  2K3Y A;  3BDL A;  4LUD A;  2QK0 A;  4AFS C;  4DBH A;  1GCP A;  1ZBJ A;  3OW2 P;  3DKM A;  4M77 D;  5GAN g;  2RA2 A;  2E3I A;  2L3Q A;  4N4G A;  2JXB A;  4F7U E;  1SEM A;  2CZ6 B;  1UTI A;  3RMQ A;  1Q82 R;  4M78 A;  1C6V X;  1KQS P;  3OYM A;  1R8O B;  2LC4 A;  1SSF A;  2RHY A;  3KXT A;  4F16 A;  2EPD A;  2DRK A;  4JJN K;  4C8Q E;  1Q81 C;  4L6V 5;  3L1A A;  3VUB A;  4EMH A;  2ZPE B;  2M9U A;  3QYH B;  4VUB A;  4XTX A;  2DAQ A;  4LD6 A;  1MMD A;  2KEA A;  4LD9 K;  4L59 A;  3BE3 A;  4NOY A;  2KXD A;  5I22 A;  1UE9 A;  1UJY A;  4M4Z A;  1OUL A;  3A8M B;  1VYU A;  1K8A U;  2HL3 A;  3CPF A;  1RLP C;  4BE1 A;  1U1T A;  2EQJ A;  3FRN A;  1K4U S;  1PNJ A;  1KQS S;  1VIE A;  4J6W A;  4ZN3 A;  3JB9 I;  3WXM B;  4F7U G;  4AMC A;  2BE7 D;  2EYQ A;  3OYB A;  4HVV A;  3M56 A;  3GBQ A;  2RH2 A;  4C8Q B;  4JRP A;  4M77 B;  5KYY B;  4HCZ A;  3VRY A;  2DBK A;  2BZY A;  4M7D C;  3CBM A;  2DVJ A;  2A28 A;  5KH6 A;  3EGD B;  2RQU A;  3U23 A;  2DK3 A;  3EFO A;  3RDV A;  5FU7 B;  2YRV A;  1N8R U;  2VXF A;  2QGF B;  2OTJ Q;  1JJ2 P;  5GJW B;  3EFR A;  4X9C A;  1SHF A;  3ER0 A;  1QWF A;  1AZE A;  2JUF A;  3LWI A;  4KUL A;  3VS6 A;  1GFC A;  2E10 A;  1S1N A;  1RLQ C;  1VQ9 A;  1NLP C;  4J9H A;  4XTU A;  3OYK A;  3WVD B;  1X6O A;  4JJC A;  3G6E A;  1MGQ A;  2ATC B;  2JZ2 A;  4DBQ A;  1QLY A;  2JT4 A;  1I5O B;  2HL5 C;  2HQH A;  1WX6 A;  3HTR A;  1U1S A;  5EG2 A;  2LX9 A;  3ME9 A;  4PJO D;  4E7H A;  2RQT A;  2HCK A;  4C0D B;  2VC8 A;  3KBG A;  2LJ0 A;  1G3T A;  2CZ0 B;  4DBF A;  5L23 A;  1TG0 A;  3OBY A;  4OMN A;  1FXX A;  1XTD A;  2KYB A;  2VV5 A;  1ZSZ B;  2JTE A;  3EG9 A;  3CCV A;  1YBY A;  1N5Z A;  3CXC P;  1KD1 C;  2RQW A;  3CC4 A;  4N0A A;  1JEG A;  2XU8 A;  1AVZ C;  1SSH A;  2HD0 A;  4IUU A;  3NMZ C;  1JRI A;  5LJ3 g;  2EKO A;  3CCS Q;  2E64 A;  2XKO C;  3EG1 A;  2MI6 A;  3MEV A;  2EYY A;  4GY5 A;  3OYG A;  1KK7 A;  1ABO A;  4M75 E;  1AHJ B;  2RHZ A;  3SWN A;  1Q7Y U;  4M7A F;  1NLO C;  3JB9 J;  3G6E T;  4PJO B;  1VQK A;  2KR3 A;  3CCJ A;  3CCU Q;  4LXC A;  3VJP A;  1QVF P;  4GBQ A;  3EH1 A;  3INZ A;  4E7L A;  4J9G A;  1M90 U;  4C0F A;  1WJS A;  1KFZ A;  1FMV A;  1R77 A;  2LQW A;  3URG A;  3H0F A;  3RR6 A;  5IAY A;  1D0X A;  1K8A C;  5I2S A;  1XOV A;  2RNA A;  4M75 G;  1PD0 A;  2HKQ B;  4MMK A;  2OTJ T;  3BFM A;  1N9R A;  1TU0 B;  1QVF S;  5GAM h;  1ZUY A;  3OYN A;  2M51 A;  3NTH A;  1HSQ A;  2XG8 D;  3CC2 A;  3QZ9 B;  4II1 A;  1N9S A;  1Y57 A;  2EGA A;  2HNI A;  2YHT A;  2JN0 A;  1VQO Q;  1NPP A;  4C92 D;  5GAN 2;  2KT8 A;  3HRT A;  3QSU A;  2CH4 A;  3M57 A;  2YUO A;  2DXU A;  5D7U A;  1R0C B;  1N8R C;  2ROL A;  5CK9 A;  2OAW A;  1U8R A;  5EC7 A;  1VQK T;  5GMK h;  3M0Q A;  2BUD A;  3HHT B;  4HKE A;  1K73 U;  2YUN A;  2RK2 A;  1WNL A;  3R6N A;  3VS3 A;  3FLG A;  4HXJ A;  2DPP B;  2QEX Q;  3RIR A;  1YI2 A;  1G5V A;  4IIO A;  5FRM A;  5LJ5 h;  4IIM A;  3VS7 A;  2IG0 A;  3L2Q A;  1OQK A;  5KE3 A;  3CBO A;  1W70 A;  1S72 Q;  1VQL A;  1M2O A;  1YJ9 A;  1G83 A;  3M58 A;  1QW1 A;  3THK A;  2D9T A;  3JCM P;  2YUP A;  1D3B B;  1W2B P;  4ELY C;  2IPO B;  1VYT A;  3CCS T;  1E6G A;  1U06 A;  5LJ3 f;  3ZBD A;  1JQQ A;  2AKK A;  3CC2 T;  2JTM A;  1ZBX A;  2AHJ B;  1WYX A;  4D8K A;  1VQ4 A;  1A0N B;  1X27 A;  4M78 C;  2F2X A;  1UGQ B;  3ZL7 C;  3NPF A;  1Y71 A;  1IGU A;  1W2B S;  3OYD A;  2QQA A;  3EGU A;  1PG5 B;  3JCM c;  1TUC A;  2KQW A;  1SPK A;  1JXM A;  2DIG A;  1Q7Y C;  2LQ8 A;  2BE9 B;  2KYM A;  2E5K A;  3JCM h;  3GF5 A;  2LTO A;  3OS2 A;  1BIB A;  4C8Q F;  3GIB A;  4M77 F;  4M7D D;  1G2B A;  2X9H A;  1VQL T;  2PNI A;  4KGZ B;  4E47 A;  3TVT A;  1M90 C;  2QG9 B;  4E7K A;  1D0Z A;  5CVI A;  5FRN A;  2PVO B;  3R6O A;  2DLP A;  4MDW A;  1VQO T;  1C1A A;  2BZ8 A;  2QXF A;  1BYM A;  5FU6 C;  2MAM A;  1YHQ Q;  4QKU A;  2VWF A;  3CC7 T;  2CT3 A;  3OB9 A;  2P0P A;  2RN8 A;  3G71 A;  2J6O A;  3CCM A;  1UGS B;  3CD6 Q;  5GAN d;  1YJW A;  1TH7 A;  1D1B A;  4ZGE B;  1UJ0 A;  1YIT Q;  2E1H A;  3GNG A;  4CRI A;  2CP5 A;  2K5I A;  4FW2 A;  5GAM f;  2LMJ A;  3L2R A;  2QEX T;  4Z89 A;  5KYX B;  4O6J A;  3JB9 H;  4V2S A;  5DM7 R;  3I56 Q;  2LNV A;  3CPW A;  2LT4 A;  4ME7 A;  2OTL A;  4OML A;  2XK0 A;  1UG1 A;  3JV3 A;  1P92 A;  4M7D B;  4A4F A;  1S72 T;  1MMG A;  3I5R A;  1YIJ A;  3PMI A;  2DRM A;  2EJ9 A;  1VUB A;  1HD3 A;  5IXF A;  4BY6 C;  1IHW A;  3OBW A;  1K73 C;  1WZO A;  5I2M A;  1M4Z A;  1IHV A;  4BE0 A;  4XTY A;  1WFW A;  3LH0 A;  4X34 A;  1FWZ A;  2DJQ A;  1K9M R;  1XNI A;  3L42 A;  3LGL A;  4PJN A;  3UDC A;  2PUK B;  5FLX E;  1UGR B;  3ULR B;  1W6X A;  2HAX A;  1I8F A;  1M8M A;  2QGG A;  1WXB A;  3FJP A;  4XU1 A;  5LJ5 f;  4FYY B;  4FT4 A;  3G71 T;  5DY9 A;  3CCM T;  2L89 A;  3M0U A;  5LJ3 e;  3LWH A;  2W10 A;  1EZZ B;  3A8O B;  5CKH A;  4N0A C;  4JDS A;  1ZX6 A;  3V8L A;  3NTK A;  2DTI A;  1FMK A;  4M7A E;  2JTF A;  3OA6 A;  1BI3 A;  2MCN A;  1AWJ A;  3SWN C;  2B8A A;  5IH2 A;  3LLR A;  3VV0 A;  1QVP A;  1ACM B;  4C5H A;  7AT1 B;  1QMC A;  2K79 A;  2CYZ B;  4DOW A;  4QQG A;  2Z0W A;  4LE9 A;  4JS4 A;  2VGN A;  4KBM B;  2DYI A;  4M75 F;  4OMO A;  4E2F B;  2GCX A;  3CCQ Q;  1M3B A;  1AWW A;  4M7A G;  1YHQ T;  4A4H A;  4JRI A;  4F04 B;  1SHG A;  2DTO A;  2KXC A;  2NUT B;  3CD6 T;  1JU5 C;  1VQ5 A;  1B34 B;  4IUT A;  3E19 A;  4XTV A;  4YTL A;  1OI1 A;  1K0X A;  3DB3 A;  2HMA A;  4HT8 A;  1AD5 A;  1BBZ A;  1H92 A;  2LQN A;  3QHS A;  3J81 E;  1LVK A;  3H0H A;  3M0R A;  5GAN 6;  4CC2 A;  3LYI A;  2EYW A;  2HSE B;  3I56 T;  1QP3 A;  5GAN 4;  1VQM A;  4A4K A;  5KYN A;  5DLQ E;  2J05 A;  4JZ3 A;  4LDW A;  4AG1 C;  1BCO A;  2DZ9 A;  4A54 A;  5LJ3 d;  2FEI A;  1SF9 A;  3H0I A;  2VGM A;  4NS5 A;  2DD5 A;  2C0O A;  2FPD A;  1O9S A;  2K57 A;  2ESW A;  3HRS A;  1KD1 R;  5GAO m;  3OS0 A;  3JCM Q;  1ZHI A;  1MV3 A;  1I5L A;  2RHX A;  5GMK e;  2QYZ A;  2XI9 A;  1RAG B;  2D8J A;  3M4Y A;  2NUZ A;  2XID A;  2XHC A;  5D6W A;  1WJQ A;  2EJG A;  1V1C A;  2EW3 A;  4R0K A;  1M1K R;  4M78 D;  2MWP A;  2DEQ A;  1UHF A;  5LJ5 e;  5A0L A;  1WXU A;  1VQM T;  1G8X A;  4FL6 A;  3CCR A;  5GAO n;  2RK1 A;  3I9Q A;  3OSS C;  5D6X A;  2EAY A;  2NUP B;  1LPL A;  4J9I A;  3HP9 A;  4MML A;  1W4S A;  2X51 A;  2ZCF B;  4OMF B;  2JNG A;  1BI0 A;  2KDS A;  4OF1 A;  2LVM A;  2BIV A;  2HQX A;  2JS0 A;  2QI2 A;  3CCQ T;  2MF2 A;  5GAN j;  4ZN1 A;  2LT1 A;  2A3L A;  2K4Y A;  2XDB A;  3SFM A;  3QWX X;  4M77 E;  2YWW A;  2DFU A;  2QAS A;  3ZFJ A;  3PVL A;  4UC4 A;  2F1L A;  2LP5 A;  4PFO A;  1OX9 A;  4BI4 A;  3PTA A;  2ED0 A;  2RQV A;  4M78 B;  3BW1 A;  2RJC A;  1ZUU A;  1T3S A;  3ASK A;  3CME A;  4JUV A;  1VQ9 Q;  2C06 A;  2OX7 A;  1HJD A;  2OJ2 A;  4XU3 A;  4F7U A;  3G6E Q;  3NTI A;  3KFV A;  2XDD A;  2QDY B;  1QQJ A;  1B7T A;  2D0N A;  1ZUK A;  2QTV A;  5CR2 A;  4C8Q A;  4C8Q G;  1VQN A;  4M77 G;  3SEM A;  3V8J A;  5KYY A;  4RMO A;  5IN1 A;  3CCR T;  2JM8 A;  3QJY A;  4J7F A;  1QCF A;  4FYW B;  1TUG B;  3VS5 A;  4FIB A;  2P84 A;  5FWB A;  2RQR A;  3VU3 C;  2GTO A;  1WHL A;  4M7D F;  4Q5W A;  4CC7 A;  1H8K A;  5IHI A;  3CCV Q;  3JCM b;  3JCM V;  1VQ8 A;  4EPC A;  4RTV A;  1QVG A;  4XTZ A;  3A5Z B;  2EIF A;  1WHK A;  2E70 A;  3X26 B;  5CCA A;  2KE9 A;  3CC4 Q;  3L2W A;  2ED1 A;  2WSE E;  1WJR A;  4N4I A;  5KYU A;  2RI5 A;  4BUG A;  3L2V A;  2DL4 A;  1GXI E;  4ZGJ B;  3AT1 B;  3CME T;  2E3H A;  4AT1 B;  4CI0 C;  4HCC A;  2K7A A;  2F5K A;  1QP2 A;  3UA6 A;  3RBB B;  1VQK Q;  3VUZ A;  3H6Z A;  3CCJ Q;  1NJI R;  2CP6 A;  1GFD A;  3OMC A;  2R58 A;  5J3B A;  3A8H B;  3C0C A;  2PZ1 A;  1WHH A;  2GFA A;  4FT2 A;  5KYW A;  4A63 B;  4RUG A;  3MHX A;  1Q7Y R;  2F5T X;  4ANJ A;  2AZV A;  4IKF A;  3MCA B;  4BY6 B;  1PD1 A;  5FWC A;  4OMP A;  1BI2 A;  2KT1 A;  4PJO E;  3DLM A;  2CP2 A;  1D0Y A;  1WPY A;  4BB7 A;  2GF7 A;  1BKB A;  2AKL A;  3O5Z A;  4DEY A;  5CKD A;  1AWX A;  2V8K A;  2LNH B;  3VKI A;  3BDU A;  3MKD A;  4Z02 A;  2DXB A;  2E6Z A;  2K9G A;  4QW2 A;  5GAO q;  5CIU A;  3CC2 Q;  2V8J A;  1VQ9 T;  4B6M A;  4ZGD B;  1R0B G;  2RO0 A;  1VQ7 A;  5LJ3 j;  4EMK C;  1KC8 R;  1VYV A;  2DET A;  3TRE A;  4PJO G;  4LDX A;  1VQ6 A;  5DLO A;  4MDX A;  2PU9 B;  4KUD K;  4FSX A;  1SG5 A;  4FYX B;  2FZG B;  1YFN A;  5GMK i;  4JZ4 A;  2F2W A;  1Y07 A;  2V26 A;  4RTX A;  2OAU A;  2DYB A;  2PVG B;  5HKC A;  3JCM W;  3LH5 A;  4WCI A;  4FM4 B;  2DD4 A;  1YI2 Q;  4M75 A;  3CCV T;  2CP0 A;  2A7Y A;  3HFN A;  2CDT A;  1K1Z A;  4HVW A;  2JVV A;  3QKJ A;  1VOM A;  3I55 A;  1K73 R;  1HK9 A;  4CC4 B;  1VQL Q;  3CC4 T;  1YJ9 Q;  1M5Q 1;  4HVU A;  3V8K A;  4TVR A;  3QBY A;  4OMQ A;  1UHC A;  2D1X A;  2FG0 A;  3FC3 A;  3RKY A;  2MIO A;  5KE2 A;  3PIP A;  4XU0 A;  5A2Q E;  3V7R A;  1U3O A;  3E9G A;  1VQ7 T;  1NYF A;  4OB0 B;  2MMP A;  3CC7 Q;  3A8G B;  1IB8 A;  4X1V A;  2JW4 A;  2GQI A;  2DO3 A;  1VQ6 T;  3CCJ T;  1VQ4 Q;  4C92 E;  5GAM g;  1MMN A;  5GAN 3;  3H41 A;  1NZ9 A;  2IIM A;  2ZZD A;  2M0O A;  2JMA A;  4R55 A;  4KT0 E;  3CCU A;  4JRK A;  3OS5 A;  3DB4 A;  5J39 A;  2RPN A;  4D6W A;  4C5E A;  4ESR A;  1YWO A;  2FZC B;  1X01 A;  2D6F A;  4RTZ A;  1BI1 A;  1CKB A;  3RER A;  5J26 A;  4N4H A;  4XTW A;  2X4J A;  2L5Q A;  4PLL A;  1X2Q A;  4JLG A;  3X24 B;  2O88 A;  3LX7 A;  2MYS A;  3VS2 A;  4C92 B;  4QQD A;  3N5B B;  1PRL C;  5GMK j;  1Q86 R;  1GCQ A;  4KUI A;  2ENM A;  2VKN A;  1CKA A;  5LJ5 g;  3S6W A;  4O5V A;  6AT1 B;  4J9D A;  2YRD A;  3VS1 A;  1AEY A;  1JBM A;  1SKU B;  2KGT A;  3G71 Q;  3CCM Q;  2KBT A;  2KK4 A;  2RJF A;  1T3L A;  4M78 F;  1YJW Q;  5C0M A;  1M3C A;  4Y28 E;  1VQP A;  3S3N A;  1O75 A;  1X69 A;  4IUP A;  2EGC A;  2CUD A;  1YI2 T;  4OVA A;  4PK4 A;  3MEU A;  2RI2 A;  1QKX A;  2QQR A;  4J5Y A;  5CKB A;  2CUB A;  3CMA A;  3CCE A;  1YN8 A;  4KRT A;  4MZP A;  9ATC B;  1OOT A;  4IUR A;  1UGP B;  2CGH A;  3TSZ A;  1YJ9 T;  4LDV A;  1YIJ Q;  1JB0 E;  4L5G A;  1NEB A;  3QII A;  3JCM J;  4C8Q C;  5GAN 7;  2YRC A;  3OW2 A;  1N6A A;  1LNX A;  2EQK A;  4B9X A;  1UEB A;  3TSW A;  2KY9 A;  2M0Y A;  2O4X B;  4M7D E;  3HL8 A;  2EQU A;  3QPH A;  1KQS A;  4DA4 A;  3TCJ A;  1I0C A;  4C0Z A;  3SB2 A;  1M30 A;  2HEQ A;  2AIR B;  2CP7 A;  3JCM g;  1ZQ1 A;  4LNP A;  3F70 A;  2P0K A;  1VQ4 T;  2L3S A;  3LW5 E;  1SRM A;  2A36 A;  2KRM A;  1MMA A;  2M1H A;  3UWN A;  3LGF A;  2RHU A;  3CCL A;  4FCY A;  1X75 C;  1QVG S;  2A37 A;  2XDP A;  1H3H A;  2CZ1 B;  1VQP T;  1K0S A;  1XQH A;  4E7I A;  2R57 A;  2GFU A;  4Z8A A;  1NBE B;  4A53 A;  4M7D G;  1ZA1 B;  3MP1 A;  1ZSG A;  3EGX B;  2W0Z A;  1B07 A;  1WHM A;  1D09 B;  4R56 A;  1HXD A;  3M5A A;  1BCM A;  1M27 C;  4AFQ C;  1Z9Q A;  2X4W A;  2LCC A;  1PRM C;  4PFP A;  3GPL A;  1OPK A;  1X6G A;  2KMT A;  3OYH A;  3PMT A;  3D7S B;  3OYF A;  1MHN A;  3EHQ A;  4RTW A;  1M2V A;  2ZGW A;  3JB9 D;  1Q81 R;  1WGS A;  1KIK A;  2FHD A;  4OB2 B;  3S3M A;  3DLL A;  1JJ2 A;  4PJJ A;  2M16 A;  3CEY A;  3S3O A;  1OEB A;  2FRY A;  1VQ5 Q;  1YJW T;  3NFC A;  2AZS A;  1WDX A;  3EG0 A;  3M9Q A;  1AT1 B;  3GOX A;  4C5I A;  3C94 A;  4PJO F;  3OS1 A;  1FMW A;  1NE8 A;  2EWN A;  2LJ3 A;  4K11 A;  1Y96 B;  3PFS A;  3RNJ A;  5A0D A;  1VQM Q;  2OTL T;  2FRW A;  2RB6 A;  4RG8 A;  1YIJ T;  3A98 A;  2SRC A;  3AHU A;  4CC3 A;  1M8V A;  1K9M U;  2XMF A;  2G3R A;  3EG3 A;  2GTJ A;  2R5M A;  2RM4 A;  2YLB A;  5IT9 E;  3UF4 A;  2HKN A;  4Y91 A;  2B86 A;  4M7A A;  2D0Q B;  5IHN A;  3FB9 A;  1Z9Z A;  1IRX A;  5HK3 A;  3CXC A;  3QO3 A;  2J6K A;  4JS5 A;  4M75 C;  1RL2 A;  3HRU A;  4EMK B;  1IO6 A;  2JS2 A;  3JCM f;  1B3Q A;  2DXC A;  3X20 B;  4XU2 A;  2CS7 A;  2FB7 A;  3OYE A;  2Y4X A;  1OZ3 A;  1RAC B;  2DIL A;  4XK8 E;  2PQW A; 
#chains in the Genus database with same CATH homology
 1QVF S;  5GAM h;  4FIB A;  4ATO A;  3VYG A;  4PNO A;  3MET A;  3VU3 C;  3OYN A;  4M7D F;  3OYA A;  4BE2 A;  4Q5W A;  3M4G A;  5GAM e;  3NTH A;  2XG8 D;  3CC2 A;  3QZ9 B;  4II1 A;  1KC8 C;  1KQ2 A;  2X4Y A;  1N9S A;  3JCM b;  3TU4 K;  2HNI A;  2YHT A;  3JCM V;  1VQ8 A;  2QTX A;  2JN0 A;  4EPC A;  1QVG A;  4M7D A;  3O8V A;  1NPP A;  3MP6 A;  3A5Z B;  1OYX A;  4J6X A;  2K2V A;  4J8O A;  4XTZ A;  3H8Z A;  3HRT A;  4C92 D;  2EIF A;  5I21 A;  2XD0 A;  3QSU A;  3UPU A;  3M57 A;  2E70 A;  3QDR B;  3X26 B;  5CCA A;  5M9O A;  2ZPF B;  2VUB A;  2DXU A;  3L2W A;  3CMA T;  1N9R A;  2WSE E;  3CCE T;  1WJR A;  4OP0 A;  4X9D A;  1N8R C;  2QQ9 A;  4N4I A;  5CK9 A;  5KCO A;  1U8R A;  2RI5 A;  2MWO A;  4BUG A;  3L2V A;  3VYH B;  2FL7 A;  5GMK h;  1VQK T;  3GLX A;  4WF2 A;  4ZTJ A;  3RKX A;  4C0D C;  1IRE B;  2BUD A;  3HHT B;  4HKE A;  1K73 U;  3Q1J A;  1GXI E;  3X25 B;  4ZGJ B;  4C92 F;  2RK2 A;  3CME T;  3OSV A;  1WNL A;  2H3J A;  4LDU A;  1M1F A;  1VQ5 T;  4GLK A;  3FLG A;  2QA4 A;  3BY7 A;  4CI0 C;  2JOY A;  2KSS A;  3P8B B;  4HCC A;  2DPP B;  3RIR A;  1YI2 A;  2F5K A;  1QP2 A;  3PGG A;  1G5V A;  4BAC A;  3VUZ A;  2L8D A;  3H6Z A;  5LJ5 h;  1YJN A;  5FRM A;  2PUO B;  3OMC A;  4XQ3 A;  2R58 A;  2XIC A;  5J3B A;  2IG0 A;  3L2Q A;  3A8H B;  5KE3 A;  3QG1 A;  3CBO A;  3L2U A;  5HY6 A;  2GFA A;  4FT2 A;  1VQL A;  3X28 B;  1YJ9 A;  5GAN h;  1G3S A;  3MHX A;  4OGC A;  3M58 A;  2YLC A;  1QW1 A;  2F5T X;  3ZEH A;  3PT9 A;  1YHQ A;  2D9T A;  4IKF A;  3MCA B;  4BY6 B;  4C5G A;  3OQ5 A;  1N27 A;  1PSE A;  1BI2 A;  3EFS A;  4A4G A;  3JCM P;  3CD6 A;  1D3B B;  4QVZ A;  3DLM A;  4PJO E;  4ELY C;  3CCL T;  1WPY A;  3CCS T;  3HFO A;  2DXT A;  4RCC A;  4BDY A;  5LJ3 f;  4M7A D;  4M78 E;  4BB7 A;  2EFI A;  3ZBD A;  1YIT A;  3CC2 T;  1Y96 A;  2RI3 A;  2GF7 A;  1BKB A;  2JTM A;  2FYK A;  5CKD A;  3TEE A;  2V8K A;  2ZPG B;  2BKD N;  2QQS A;  3VKI A;  1ZBX A;  2AHJ B;  2IVW A;  4FU6 A;  3BDU A;  4Z02 A;  3QZ5 B;  1G3W A;  4PLI A;  3I56 A;  3EAE A;  3QJ6 A;  4PJO C;  2DXB A;  2E6Z A;  4QW2 A;  4QQ6 A;  1VQ4 A;  4M78 C;  5GAO q;  5CIU A;  1UGQ B;  2V8J A;  5GAM d;  4C8Q D;  1VQ9 T;  1KHI A;  4PL6 A;  4ZGD B;  1Y71 A;  2RO0 A;  5LJ3 j;  4EMK C;  1M9S A;  3JB9 G;  1W2B S;  5LL6 S;  1VQ7 A;  3RMS A;  3OYD A;  4P5N A;  2QQA A;  3RKW A;  1Q81 U;  3TRE A;  4PJO G;  3M53 A;  4LDX A;  1VQ6 A;  5DLO A;  4MDX A;  3JCM c;  3V7C A;  2KQW A;  2PU9 B;  1WQ7 A;  2QQB A;  4M78 G;  5FRO A;  2QA4 T;  4FSX A;  1W2B A;  1VIF A;  1K9M C;  1M1K U;  4KUD K;  2DIG A;  1Q7Y C;  5CQY A;  2LQ8 A;  1B34 A;  1H3Z A;  2X4X A;  4EMK A;  3WVE B;  3L2Z A;  2L3R A;  1YJN T;  1UB4 A;  3GF5 A;  3JCM h;  2LTO A;  5CAI A;  1BIB A;  5GMK i;  4C8Q F;  3OS2 A;  3GIB A;  3QUI A;  4M77 F;  4QVC A;  1Y07 A;  2GQV A;  2ZPB B;  4NL2 A;  2OAU A;  3J7A F;  4M7D D;  3FEO A;  4J6Y A;  3JCM e;  3OW2 S;  2PVG B;  5HKC A;  3JCM W;  1VQL T;  4FM4 B;  2DD4 A;  4E47 A;  3HSB A;  4M7A B;  2LRQ A;  1M90 C;  4M75 A;  4M77 A;  1Q86 C;  3OYY A;  5L8R E;  3CCV T;  4E7K A;  2A7Y A;  2RD1 A;  3HFN A;  5CVI A;  2PVO B;  4BD3 A;  5FRN A;  3R6O A;  2JVV A;  3QKJ A;  4MDW A;  1VQO T;  3GNF B;  3M59 A;  2E5Q A;  3I55 A;  4F7U B;  2Y4Y A;  1YIT T;  1HK9 A;  4LDY A;  2DVE A;  3G4S A;  1LJO A;  2QXF A;  4OB1 B;  3CC4 T;  5FU6 C;  1WQW A;  1Q82 U;  2MAM A;  5LJ5 d;  1BYM A;  1M5Q 1;  4ELZ C;  1V29 B;  4IUV A;  3CC7 T;  3OB9 A;  1QVF A;  3V8K A;  2E12 A;  2LQK A;  2P0P A;  4TVR A;  3M54 A;  2LCL A;  3QBY A;  3G71 A;  3CCM A;  1UGS B;  2DIQ A;  3FDR A;  3S3M A;  4HT9 A;  4OB3 B;  4A4E A;  5GAN d;  1YJW A;  1PSF A;  5C6S A;  3FC3 A;  1TH7 A;  3RKY A;  4ZGE B;  1YCY A;  3JCM X;  2P4T A;  2E1H A;  3GNG A;  5FU6 B;  4CRI A;  5A0G A;  4XU0 A;  5KE2 A;  3PIP A;  3CPW S;  3CBP A;  5A2Q E;  2K5I A;  5GAM f;  3V7R A;  3E9G A;  1VQ7 T;  4J7I A;  4OB0 B;  3L2R A;  2MMP A;  2QEX T;  3OYL A;  3A8G B;  4O6J A;  3JB9 H;  4V2S A;  5DM7 R;  4JRQ A;  2R5A A;  2LNV A;  2DO3 A;  3CPW A;  2LT4 A;  4ME7 A;  3CCJ T;  1VQ6 T;  2FVU A;  2OTL A;  3MEW A;  4C92 E;  2XK0 A;  5D6Y A;  4QVD A;  5GAM g;  1P92 A;  4M7D B;  3MEA A;  3JAM E;  4A4F A;  5GAN 3;  1S72 T;  1NZ9 A;  2ZZD A;  3CCQ A;  1I4K 1;  3PMI A;  2M0O A;  1YIJ A;  3SD4 A;  4R55 A;  4KT0 E;  3CCU A;  4BDZ A;  4JRK A;  2EJ9 A;  1IZ6 A;  1VUB A;  3DB4 A;  3M55 A;  3OS5 A;  3UT1 A;  3PNW C;  5J39 A;  4BY6 C;  2I2L A;  3GP8 A;  2DTH A;  1NPR A;  4D6W A;  3OBW A;  1K73 C;  5I2M A;  4C5E A;  1M4Z A;  4BE0 A;  4C92 C;  3MP8 A;  3QXE B;  4XTY A;  5GMK l;  1DJ7 B;  3LH0 A;  4X34 A;  1VQN T;  1FWZ A;  1XNI A;  3L42 A;  1X01 A;  2D6F A;  3LGL A;  1BI1 A;  3RER A;  5J26 A;  3UDC A;  4N4H A;  1KG1 A;  1JJ2 S;  1BIA A;  2VXE A;  4EDU A;  4XTW A;  3E9F A;  4MZT A;  1LOJ A;  2X4J A;  2L5Q A;  2PUK B;  4PLL A;  5FLX E;  4JLG A;  4XK8 E;  1UGR B;  3X24 B;  2HAX A;  3LX7 A;  3G4S T;  1I8F A;  4C92 B;  5LJ3 h;  2HBP A;  3FJP A;  1H64 1;  4XU1 A;  4QQD A;  3JCM d;  1FX7 A;  3OYJ A;  3OMG A;  5LJ5 f;  3KUF A;  5GAN 8;  4FT4 A;  1VQ8 T;  5CKE A;  4ZTF A;  4RKU E;  3N5B B;  3G71 T;  5DY9 A;  3CCM T;  2L89 A;  5GMK j;  5LJ3 e;  5CKF A;  2LDM A;  2DZC A;  1KD1 U;  4KUI A;  3LWH A;  3A8O B;  3JRZ A;  5CKH A;  5GAN f;  4N0A C;  2K5L A;  1KQ1 A;  4JDS A;  5AYF A;  4J83 A;  4RG2 A;  1Y7X A;  2K3Y A;  3BDL A;  4O5V A;  3NTK A;  3S6W A;  3V8L A;  5LJ5 g;  3JB9 F;  2DTI A;  2OTJ A;  4M7A E;  1JBM A;  2JTF A;  3OY9 A;  3PIO A;  3OA6 A;  2KK4 A;  1BI3 A;  2RJF A;  3DKM A;  4M75 D;  4M77 D;  4BI3 A;  5GAN g;  2RA2 A;  4M78 F;  2E6N A;  4EMG A;  4N4G A;  5C0M A;  3SWN C;  4Y28 E;  1VQP A;  4PJO A;  2B8A A;  3S3N A;  3E1S A;  1O75 A;  2ZPI B;  3LLR A;  1QVP A;  3VV0 A;  4C5H A;  2CZ6 B;  3RMQ A;  4F7U E;  4IUP A;  1NJI U;  4M78 A;  4C0G A;  3OYM A;  1R8O B;  2LC4 A;  2CYZ B;  3RUX A;  1SSF A;  2RHY A;  1YI2 T;  4DOW A;  4QQG A;  4OVA A;  3KXT A;  4M7A C;  3MEU A;  4DOV A;  2RI2 A;  4JS4 A;  2VGN A;  4JJN K;  4C8Q E;  2QQR A;  4J5Y A;  5CKB A;  4L6V 5;  3L1A A;  3VUB A;  1Q81 C;  3CMA A;  4EMH A;  2ZPE B;  2M9U A;  3QYH B;  4KBM B;  4VUB A;  3SWN B;  4MZP A;  3CCE A;  4M75 F;  4XTX A;  2EQM A;  4OGE A;  2DAQ A;  4IUR A;  3CXC S;  3P8H A;  1UGP B;  1M1K C;  2GCX A;  4LD6 A;  2CGH A;  5GAO p;  4LD9 K;  1YJ9 T;  4L59 A;  1I81 A;  4LDV A;  1JB0 E;  4NOY A;  4L5G A;  4M7A G;  1YHQ T;  4A4H A;  3A8M B;  4JRI A;  3QII A;  3P8D A;  4RCB A;  3JCM J;  1K8A U;  3CPF A;  2DTO A;  4C8Q C;  5GAN 7;  4BE1 A;  3CD6 T;  1U1T A;  2DJZ A;  2EQJ A;  3FRN A;  3OW2 A;  1VQ5 A;  1B34 B;  4IUT A;  3J80 E;  1N6A A;  3E19 A;  1VIE A;  4J6W A;  4ZN3 A;  1KQS S;  4HCB A;  1LNX A;  2EQK A;  4B9X A;  1UEB A;  5GMK m;  4XTV A;  3WXM B;  3JB9 I;  4F7U G;  3OYB A;  4JLI A;  2EYQ A;  1OI1 A;  4YTL A;  2KY9 A;  3DB3 A;  2RHI A;  2O4X B;  4M7D E;  4HT8 A;  3M56 A;  3HL8 A;  2EQU A;  3QPH A;  3QHS A;  2RH2 A;  1KQS A;  3J81 E;  4DA4 A;  3TCJ A;  4C0Z A;  4C8Q B;  5GAN 6;  4JRP A;  3FIF A;  3LYI A;  3SB2 A;  4M75 B;  3I56 T;  3C12 A;  4M77 B;  3QYG B;  2Y90 A;  3JCM g;  1QP3 A;  4HCZ A;  1ZQ1 A;  5GAN 4;  2V8I A;  1VQM A;  1KC8 U;  3F70 A;  4A4K A;  2P0K A;  3HKS A;  4PKC C;  5DLQ E;  1VQ4 T;  1Q82 C;  2VYT A;  3LW5 E;  4LDW A;  4M7D C;  3CBM A;  2M1H A;  2O01 E;  3UWN A;  3LGF A;  5KH6 A;  2RHU A;  2DZ9 A;  3CCL A;  4A54 A;  1X75 C;  5LJ3 d;  2XDP A;  3CCS A;  1QVG S;  2CZ1 B;  2DK3 A;  1VQP T;  1XQH A;  3T9N A;  2R57 A;  1EIF A;  5GAN 5;  4E7I A;  4XAX B;  2YRV A;  5FU7 B;  1N8R U;  2VXF A;  2VGM A;  2GFU A;  4NS5 A;  2DD5 A;  3EFR A;  4A53 A;  4M7D G;  4X9C A;  3V7S A;  1O9S A;  3ER0 A;  2E65 A;  3MP1 A;  2K57 A;  4NL3 A;  3HRS A;  2JUF A;  2E41 A;  3LWI A;  4KUL A;  5GAO m;  5GAM j;  2E10 A;  3OS0 A;  3JCM Q;  4R56 A;  1VQ9 A;  1HXD A;  3M5A A;  4HA8 A;  1ZHI A;  2KAF A;  4XTU A;  3OYK A;  1M1G A;  2X4W A;  1X6O A;  2LCC A;  3WVD B;  3GPL A;  3G6E A;  1MGQ A;  2KMT A;  2DKG A;  2JZ2 A;  3PMT A;  3OYH A;  1I5L A;  2RHX A;  5GAN 2;  3OYF A;  5GMK e;  1MHN A;  2K3X A;  3MO8 A;  2XI9 A;  3M4Y A;  2ZGW A;  3RES A;  2XID A;  4BI8 B;  1WGS A;  3JB9 D;  5KCH A;  3I55 T;  5EG2 A;  1U1S A;  1D3B A;  2FHD A;  2LX9 A;  2XHC A;  3JSC A;  1WJQ A;  1KHC A;  2EJG A;  4OB2 B;  5D6W A;  3ME9 A;  4C92 G;  4C92 A;  3DLL A;  4E7H A;  2KVQ G;  4PJO D;  4C0D B;  2VC8 A;  1JJ2 A;  3KBG A;  2M16 A;  3CEY A;  1G3T A;  4M78 D;  5GAO r;  3S3O A;  2CZ0 B;  4IUQ A;  3OYC A;  2MWP A;  2DEQ A;  3OBY A;  5LJ5 e;  1YJW T;  2CZ7 B;  5A0L A;  2PVD B;  3NFC A;  1VQM T;  1FXX A;  1XTD A;  2VV5 A;  2P0Q A;  2F69 A;  3M9Q A;  4FL6 A;  2ZPH B;  3CCR A;  3CCV A;  5GAO n;  1YBY A;  2RK1 A;  5CO7 A;  2HQE A;  3OSS C;  5D6X A;  2EAY A;  4B9W A;  4C5I A;  5GAN e;  3GOX A;  2WSF E;  1VQO A;  3C94 A;  4PJO F;  3OS1 A;  2K5F A;  3C4S A;  3HP9 A;  1NE8 A;  2EWN A;  1KD1 C;  4MML A;  1Y96 B;  5LJ5 j;  1W4S A;  3G7Z A;  3PFS A;  3CC4 A;  5A0D A;  2OTL T;  4N0A A;  2ZCF B;  4OMF B;  5GAO l;  2XU8 A;  2JNG A;  1BI0 A;  2KDS A;  2WAC A;  2LVM A;  2BIV A;  2HQX A;  4OF1 A;  3CC7 A;  2HD0 A;  4IUU A;  2RB6 A;  2WSC E;  2QI2 A;  4RG8 A;  5CQX A;  1JRI A;  2MF2 A;  3CCQ T;  5GAN j;  1YIJ T;  5LJ3 g;  1OZ2 A;  3HPW A;  2EKO A;  3CCU T;  2E64 A;  2LT1 A;  4ZN1 A;  2XKO C;  2A3L A;  3A8L B;  2K4Y A;  2MI6 A;  3SDZ A;  3MEV A;  3AHU A;  4GY5 A;  2XDB A;  3OYG A;  3SFM A;  1M8V A;  1K9M U;  2X35 A;  1AHJ B;  4M75 E;  4M77 E;  2RHZ A;  2G3R A;  3SWN A;  1Q7Y U;  4M7A F;  2R5M A;  2RM4 A;  2YLB A;  5IT9 E;  2QEX A;  3JB9 J;  3ZFJ A;  1NJI C;  3G6E T;  4UC4 A;  4PJO B;  4MZM A;  1VQK A;  4Y91 A;  3CCJ A;  4M7A A;  2D0Q B;  4BI4 A;  3OYI A;  3VJP A;  3FB9 A;  4F7U F;  4M78 B;  3PTA A;  5HK0 A;  2CKK A;  3BW1 A;  5HK3 A;  2RJC A;  3ASK A;  3CXC A;  2RJE A;  3QO3 A;  4JUV A;  3INZ A;  3CME A;  4JS5 A;  4M75 C;  4E7L A;  1RL2 A;  4M77 C;  3HRU A;  1S72 A;  1M90 U;  2C06 A;  4C0F A;  4EMK B;  1WJS A;  4DQ2 A;  1Q86 U;  4XU3 A;  2EJF A;  4F7U A;  3JCM f;  3NTI A;  2O4X A;  2DXC A;  3URG A;  3X20 B;  2XDD A;  2QDY B;  4XU2 A;  2CS7 A;  5IAY A;  1K8A C;  2NLU A;  3C95 A;  5I2S A;  2FB7 A;  3OYE A;  1RI0 A;  2Y4X A;  5CR2 A;  4C8Q A;  1XOV A;  4C8Q G;  4M75 G;  1VQN A;  4M77 G;  3V8J A;  4E7J A;  4RMO A;  1G3Y A;  1OZ3 A;  4MMK A;  2RJD A;  5IN1 A;  5FU7 C;  3CCR T;  3QJY A;  4J7F A;  2OTJ T;  3BFM A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...