2P0PA

Calcium binding protein in the free form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
source organism Nostoc sp.
molecule tags Metal binding protein
molecule keywords Alr1010 protein
total genus 40
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0pA02
2K2VA 2P0PA 3URGA 2P0QA
chains in the Genus database with same CATH superfamily
1OX8A 5I2SA 1H92A 3M57A 1B7TA 3L2VA 2KNBB 2DVEA 2HQXA 1Y96B 3OS5A 3PVQA 2D8JA 1QLYA 1WPYA 4DEYA 1XNIA 3A1PA 2DJQA 1S72T 1RLPC 1VQ7A 3TSZA 3X28B 2F69A 5FWBA 4M77F 2H3EB 4E6RA 2ROLA 4M75C 1HYOA 1UJ0A 4JPBW 3L2WA 3MEWA 3VUBA 4CC7A 1QW1A 4B6MA 3R6NA 2L3PA 4J8OA 2GFAA 2M16A 4M7DG 1K8AR 4NL2A 1JJ2P 2OTJT 4M4ZA 3CD6T 2CP3A 4PJOA 2KYMA 5CAIA 1VQMQ 1UUEA 3X26B 4ZTJA 2RHZA 3S6WA 5CQYA 4IUPA 5I21A 2M0YA 3FEOA 3QYHB 1FYNA 1SPKA 1VYVA 1I4K1 4OP0A 4B9XA 5KCHA 2LVMA 3DLMA 1BI0A 5LJ5j 5KYNA 3CD6A 2MMPA 2E5QA 1YHQA 4VUBA 2DXUA 2VXEA 1M3BA 5GANd 1CKBA 1ZA1B 1WJQA 2GF7A 3CXCP 2VUBA 3QXEB 4RTVA 2B8AA 4A53A 5LJ5d 2OTJQ 4M7DA 3RIRA 1JQQA 4EMKB 1X6BA 4JJDA 3ZL7C 4IUUA 3I5SA 4IUTA 3EG2A 1VQ9A 2AZVA 2DL8A 4KT0E 1PHTA 2D0NA 3CC2Q 1SKUB 5LJ3f 3JB9D 2K7AA 2FVUA 1NLPC 3SFMA 1K8AC 1V29B 2BZXA 1NJIC 2DVJA 4BDYA 3OYFA 2RI5A 2X4XA 3CCVQ 1IRXA 4J9DA 3QDRB 2K3YA 3RR6A 2B86A 2RHIA 2M51A 2XICA 3NHNA 3NPFA 2JN0A 5FROA 3OYLA 2D0QB 4C0GA 1AWXA 1H8KA 1Q95G 2A08A 2KRMA 3EFOB 1QVGA 1WXUA 6AT1B 3QO3A 4E2FB 4XTYA 1QP3A 1QCNA 3M4GA 3MJXA 4BACA 4IIOA 2BKDN 4OB0B 2NUTB 3OYNA 1VQNT 3CCQT 2C0OA 1HK9A 4CC4B 2JS0A 4ZGJB 2QEXA 1PKSA 1MUZA 3CCMQ 2A28A 1ABOA 4HVUA 4BI3A 5LJ3e 3G6ET 2DRKA 2YLBA 2KI7A 2LCCA 3VS2A 2E65A 4PFZA 3RUXA 4RCBA 1WHHA 2YUPA 3LH5A 2RQRA 5IXFA 4AT1B 5IN1A 2QAZA 2GQVA 3QJYA 2YUNA 2K79A 2HSEB 3UT1A 3OS2A 3VKIA 1TUCA 3TCJA 4J9IA 2LCLA 3HFOA 3CCQA 2MYSA 1Z9ZA 4KULA 1ZLMA 2X4YA 5KYXA 3CC7A 2XDDA 1WJSA 4M75A 2YRVA 1U1TA 5GMKm 5HKCA 1VQ8T 2CDTA 1AZGB 1HD3A 1GCQC 2DL3A 4J7FA 1Y71A 4OMQA 1YIJT 5HCKA 4M7AG 2DTIA 5HK3A 5HK0A 4QQGA 2JM8A 3H9NA 4RG2A 2KXCA 4M7AA 2RHYA 4ATOA 3KBGA 2RQTA 4C8QA 2LX7A 1VQNQ 4QQ6A 4X9DA 2QYZA 1Q7YC 1K0SA 3CCSQ 4KUDK 4BB7A 3FDRA 1S72A 2RI3A 4X1VA 5GAMe 4F17A 3ULRB 4LDYA 2HL5C 1Q81C 3RKYA 2FRYA 4XTXA 3R6OA 2SRCA 3VRZA 4Z8AA 1KJWA 4JDSA 4PFOA 1ZQ1A 1VIFA 4XTVA 4OMNA 4PKCC 2DMOA 2OI3A 1PKTA 4PK4A 5D7UA 4NL3A 2C0TA 4HT9A 1UHFA 3P8BB 1G2BA 2E6NA 1JJ2A 3CCUA 1R8OB 3H6ZA 3GOXA 2X51A 2HDAA 4J9CA 1EX4A 1RAEB 1BIAA 2GQIA 2XIDA 1VQ4Q 3JAME 1VQ6T 1BI3A 2JXBA 3LLRA 2KROA 1Q7YR 2HQHA 1D3BA 3FJ5A 3CXCS 3UF4A 4M7AD 3I55Q 2J6KA 1WHLA 3JCMg 2LZ6B 3QJ6A 4E47A 1Q82C 3NTHA 2EYWA 3OYGA 1X2QA 4FT2A 2QK0A 1U06A 2Y90A 1M1KC 2QDLA 1H3HA 2KDSA 5FU7C 2RK2A 1RUWA 4R0KA 5GANf 2K5IA 3UATA 4C92A 2O9SA 3MEUA 3A8OB 3GNGA 4F7UG 4Y91A 2VGMA 4A4KA 1O75A 3H0HA 4QW2A 4C92C 1S1NA 3JCMQ 2V8KA 2GNCA 3G7ZA 3EGDB 3QUIA 3EHQA 4DBFA 2LJ3A 3M0QA 1Y96A 1J3TA 5KH6A 4OGEA 5GAOn 4C5IA 3H0IA 2EFIA 4PJOC 1HXDA 1IB8A 2FG0A 1W2BP 2EW3A 5FU6B 1JRIA 1G3WA 1SHGA 1WQWA 4FM4B 2BE9B 4HVVA 1PCXA 2K5FA 1MMGA 2MF2A 2DXCA 1D3BB 1FX7A 2MWOA 2WSCE 4BUGA 2RB6A 4MMLA 1VQKA 4AFUC 3VS3A 4M75B 1LNXA 4PJLA 3FJPA 5GJVB 2J6FA 1HSQA 1W1FA 1NZ9A 1YJWT 2XD0A 7AT1B 1WX6A 3QSUA 2OX7A 3J80E 5GAOm 1O9SA 2PVDB 2EJ9A 3CPWS 2CH4A 2LT1A 1EFNA 5GAMg 4J9FA 3JB9J 2J6OA 4NOYA 4M7DD 4DQ2A 2EAYA 1VQ5A 1LJOA 1OPLA 5CCAA 3MO8A 2GBQA 2LCSA 1M9SA 3VS4A 4N0AC 1VYUA 2DE0X 4FYVB 3OY9A 4OMOA 2BUDA 1VQ9Q 1M90R 1WZOA 1FWZA 3G4ST 4X9CA 3HRSA 2IPOB 2CGHA 2CZ6B 1M1KU 2OTLA 1OOTA 3E9FA 4PJOG 1T3SA 2RI2A 3OYYA 1OPKA 1I1JA 1X27A 4KGXB 1LVKA 2GCXA 1BI2A 2RM4A 1U1SA 1D0XA 2CP0A 2X35A 5GAN6 1YITA 2EKHA 4M77E 4C0FA 1QCOA 2E5KA 1I8FA 1PC0A 1M2VA 3M0TA 3JB9F 1WNLA 3OW2P 3VYGA 3WVEB 5I2MA 1JU5C 1AT1B 5GAOr 1YI2Q 3RKWA 2DZCA 3QKJA 1NPPA 2VC8A 2RHUA 1VQ4T 4RG8A 1RAAB 4PLIA 3EG1A 3CCRQ 2LQNA 1K73U 2EGAA 3TQ7P 3VS6A 3G71A 1MGQA 3BDUA 3AHUA 2XK0A 1K9AA 2OTJA 2XG8D 3EFSA 1BYMA 2C0IA 1D0ZA 3CPWP 1PWTA 1TSFA 2KRNA 2QA4Q 4F7UA 3CC2T 2QQRA 1U5SA 1WHJA 2ZGWA 2VGNA 5A0GA 3MEAA 1GRIA 1YI2T 1M5Q1 3PGGA 3V8JA 1Q7YU 2JOYA 2AHJB 4C0ZA 1Z9QA 1M3AA 2F1LA 4LN2A 1VQ6Q 3J81E 1G8XA 2PU9B 4FW2A 1N6AA 4DEXA 3L2ZA 2JMCA 1IGUA 1SEMA 2BE7D 2DXTA 2HBWA 3VYHB 5GAN2 5FWCA 2EQJA 2XU8A 3GNFB 4GLKA 2CP2A 4DOWA 2DKGA 2KQWA 3QIIA 2OTLQ 2MCNA 4JS4A 1YJNT 1N8RC 1OI1A 3NTKA 2DZ9A 1LOJA 4FYXB 4HT8A 2GTOA 3META 4PJOE 1UGVA 2MAMA 3BW1A 1E6GA 3OYJA 1AWWA 1ZBJA 2JMAA 3A8LB 4L6V5 3OS1A 2E6ZA 4L5GA 1WJRA 4LUEA 1ABQA 2YRDA 1PRMC 4EMKC 4CC2A 2DETA 3DKMA 2VXFA 2AKLA 5D6YA 4A4FA 3CCJQ 4C92F 2FL7A 3G71T 3KXTA 1UGQB 3E1SA 1TG0A 2L3RA 3OS0A 3CMAT 4LD6A 4XTUA 4PJOD 3M0UA 3CCVT 4C8QC 1YJNA 5EC7A 4M78A 2JZ2A 2COZA 4RUGA 1PNJA 3LX7A 4FU6A 2L5QA 2KYBA 1UB4A 1TUGB 2BTTA 2ZPHB 2QXFA 3PMIA 4YTLA 4ZGDB 2O9VA 2O4XB 1YP5A 4OMPA 4NS5A 4ANJA 2PUOB 3CCQQ 4XQ3A 2Y4YA 2JTEA 4Z02A 1BB9A 2KMTA 1T0JA 3MKDA 3JB9G 1BKBA 1WYXA 2DA9A 3EHRA 3ER0A 4AFZC 4DBQA 5ECAA 2L89A 1Q86C 2DEQA 3PE0A 4WTOB 2NUPB 1OEBA 3SD4A 2FEIA 5CKDA 3PT9A 2CZ0B 4F04B 2PUKB 2MIOA 2DERA 4C5EA 3EAEA 4EIKA 2CH4W 4D8KA 1V76A 2XI9A 4BE1A 1AHJB 3PMTA 4RMOA 1W2BA 2YUQA 3I56A 2E4HA 1GFDA 3HKSA 4EPCA 2VV5A 4C5GA 1P92A 2QEXQ 1RADB 2FPFA 1VQ7Q 2CZ7B 2WSEE 1RLQC 1TS9A 2HL3A 1K73C 2LNVA 2DX1A 3PIPA 2HKQB 3TEEA 3M54A 1G83A 1GCQA 2D8HA 1VQ7T 4JZ4A 4F7UB 3RKXA 2K5LA 3M4YA 2NYSA 4PNOA 4CI0C 1VQ8Q 3X25B 4JLIA 3URGA 3C12A 4LUDA 1KD1U 4LE9A 3OYDA 1D09B 5I22A 3ZFJA 1QKXA 3QBYA 4EMHA 4LDVA 1JXOA 2MWPA 4J9GA 3C4SA 2FZCB 4AG2C 2EQMA 1MMNA 4MMKA 4N4IA 1G5VA 2M02A 1ZX6A 3M56A 1I07A 3HFNA 3MHXA 3A5ZB 5CKFA 4O6JA 2NUTA 4C92G 4XTWA 2AIRB 2LQ8A 1M2VB 2R57A 4QVZA 3CMEQ 4XK8E 1YJ9Q 2DTOA 2FZKB 4DA4A 3ME9A 2HBPA 2DYBA 3GF5A 1KC8R 3L2QA 1K9MR 4M78B 1MHNA 3CCMA 4M78C 2KGTA 1I0CA 2MPXC 4KBMB 4HCCA 4E7JA 3OYIA 2KSSA 3JCMJ 2QA4T 3L1AA 2KR3A 3QYGB 4PLLA 1T3LA 2JVVA 4LNPA 2HKNA 2FRWA 3QG1A 1QVGP 1OYXA 4WF2A 3AT1B 2ABLA 2EQUA 1ZSGA 2E3IA 1X43A 3VRYA 5GMKl 4BY6B 4BD3A 4JRIA 5GAN7 1NLOC 1C0MA 4RTZA 4DBHA 3LYIA 2D1XA 1M30A 2EGEA 4FCYA 1MMAA 3VS5A 2YT6A 4CRIA 2EQKA 5GANe 2ZPBB 2CUDA 4XAXB 1WHMA 1FMVA 4P5NA 4Z89A 2EJGA 3I56Q 4LDXA 4PJOB 4XU0A 5KYWA 4J9HA 1YJWQ 1JO8A 4F7UE 1OULA 5CIUA 5IHKA 1SF9A 2AZSA 2DL5A 2XDBA 4M77C 3HP9A 5KYYA 1TXQA 4M7DC 2F5KA 3CCLT 2G3RA 3JCMe 5LJ3j 2PVGB 2EYXA 1VQ5Q 2DLPA 3CBPA 3CCJT 3JCMW 3JB9I 3G71Q 3P8HA 2ROTA 2COWA 2QQBA 1D0YA 4PJMA 2NWMA 2CYZB 3GPLA 1KHIA 3CC4T 3DB4A 3CCEQ 5DY9A 1GXIE 1KIKA 2LDMA 3CC7T 2CT3A 3CCLQ 3DB3A 2RH2A 4M7AB 2ZPIB 2QGGA 2P0KA 1VQ8A 1YHQQ 3KUFA 4BY6C 3L2RA 1U8RA 1WHKA 4M78G 4AMCA 4IKFA 2K2MA 2K2VA 5LJ5h 2AKKA 1KQSA 4RTUA 1MV3A 1BIBA 1Y0MA 3JCMd 2P84A 4IIMA 5FLXE 1XTDA 2RPNA 3UPUA 3G4SA 5A2QE 2AT1B 2QTXA 2CP6A 1NYFA 4N0AA 1FMKA 2D6FA 4N4HA 3BDLA 3WVDB 4BDZA 2VVKA 4C92B 4FYWB 1AEYA 2NUZA 4R56A 2X4WA 4M77D 2VB6A 2EJFA 3SWNC 3JCMc 2SEMA 1NJIR 3ZBDA 1EIFA 1JXMA 3I55A 2VASA 2KAFA 4O5VA 5CK9A 2RJFA 3V7SA 1JB0E 1LCKA 2F2XA 3CCRA 1RL2A 3CCJA 3O5ZA 2LNHB 3FLGA 2EGCA 1KSWA 2PZ1A 3HHTB 2V8JA 5GAN3 2V1RA 4QKUA 4M75E 1KD1C 2MK5A 4R55A 2O4XA 1E6HA 2A0FB 2CT4A 2CKKA 1RAHB 2W10A 4AFSC 3M5AA 4F14A 3EFRA 3HRTA 3OYKA 1PD0A 2A7YA 4J9BA 3EG0A 2X9HA 2JUFA 1VQMA 1G3YA 1N27A 3J7AF 3QZ9B 2GTJA 1M4ZA 2L8DA 2PTKA 1AVZC 2V1QA 1K4US 1K9MU 1QVPA 1IZ6A 1RI9A 3V8LA 3G6EQ 1NG2A 4FT4A 4J6XA 2CZ1B 3EGUA 4Q5WA 5L8RE 1GL5A 5J39A 1RI0A 4J83A 1QVFS 4OB3B 4PJJA 1T0HA 2XKOC 3LGLA 4EMKA 1H3ZA 5GMKe 1K0XA 1Y57A 3C0CA 1NEGA 1NPRA 3E2UA 2PVOB 2YDLA 5GAMj 4EMGA 4RTYA 3V7RA 5FRMA 3OSVA 3LGFA 3X20B 2ZPGB 1IHWA 3CCEA 2CUBA 1A0NB 1HJDA 3RESA 1QP2A 4C92E 1BCMA 1AOJA 2K4YA 2K3XA 3SDZA 4JRPA 4MZTA 1OU9A 1X69A 5IH2A 1ZUUA 2MOXA 1AWOA 4C92D 5EG2A 2X4JA 1ACMB 1KFZA 4JJCA 1IO6A 4FYYB 4M77B 1YN8A 1UE9A 2KY9A 5C0MA 4DBRA 1YITQ 2RN8A 3OQ5A 2YXYA 3UWNA 2OAUA 2L3SA 2DFUA 2KT1A 1H641 2Y4XA 5IAYA 1KQ1A 3OYHA 2EKOA 1KD1R 1FMWA 2I0NA 1YNZA 1IREB 1RAGB 1K73R 1M90C 2HZYA 3M0RA 4IUVA 4ME7A 2M1HA 4KGVB 1YHQT 1XQHA 4RKUE 2QEXT 2EPDA 3JCMh 5M9OA 1VQ5T 2DNUA 1VQMT 1WI7A 1M1GA 1UHCA 3CMEA 4JUVA 4OMMA 1YI2A 1VQNA 5GAN5 4K11A 4OGCA 4RCCA 2X3XD 1D1CA 5GAOl 2O88A 4KH1B 3EH1A 2RO0A 3CCSA 3A98A 2LT4A 5FW9A 2DYIA 1QVGS 3SB2A 5AT1B 1X75C 2ESWA 1BK2A 2DJZA 3SHWA 3I56T 3CCET 4M78E 2YWWA 3C95A 1B34B 2DF6A 3THKA 1NEBA 5GANj 5LJ3g 3FB9A 3TREA 1ZSZC 3VJPA 1YITT 2KT8A 5KYUA 3EG9B 4XU1A 1JEGA 4X34A 1Q81R 3D7SB 1XOVA 2F5TX 1AD5A 4M7DE 2QQSA 1NJIU 1UGSB 2D9TA 1M8MA 2BZ8A 2QASA 2JW4A 3NFCA 5GAMh 4OVAA 3CCUQ 3S3NA 2G6FX 2R5MA 4Y28E 3JCMP 1PRLC 1X6GA 3SEMA 3A8HB 4PL6A 2X3WD 2RJEA 3G6EA 4BE2A 2VWFA 3HSBA 1WXBA 8AT1B 2LQKA 1KK7A 2I2LA 2EWNA 4HKEA 1QWEA 2ED1A 4M75F 2NLUA 3RMQA 2BIVA 2W0ZA 4HXJA 5IHIA 2DAQA 1VYTA 2HQEA 2QTVA 4M78D 1D1BA 1SSHA 2YLCA 3Q1JA 4M75G 3SWNB 5D6XA 2KEAA 4UC4A 4LD9K 1Q81U 4M7AF 4QT7A 1SRMA 2VYTA 2LP5A 3OBWA 2WSFE 1QVFA 4JZ3A 1YCYA 2HCKA 1YJ9T 3MCAB 2BZYA 5GJWB 2KK4A 1VQ6A 1RABB 1Q82R 4FSXA 4B9WA 1E7OA 4KUIA 1Q82U 3PNWC 5FU6C 2ZPEB 3H8ZA 3UA6A 3RERA 1WLPB 3OYMA 3U23A 2DL4A 2NUPA 1ZUYA 1KQSS 1MNEA 2GFUA 1VA7A 2LJ0A 4C8QG 1WIEA 1SG5A 5GANg 1SSFA 1ZHIA 4ESRA 2E41A 4QVDA 3FRNA 2L2PA 2OJ2A 1N9RA 2VKNA 5KYYB 4C8QF 3HL8A 1M8VA 1UGPB 2OTLT 2V8IA 3E19A 4FL6A 2COYA 4QQDA 2LQWA 1QQJA 2RNAA 3LW5E 5J26A 1IHVA 1WQ7A 4ZTFA 3OYCA 2OAWA 3QHSA 2DBKA 1UEBA 4GLMA 1AWJA 2KVQG 3OSSC 4LDUA 4MZMA 2EIFA 1C6VX 4Z88A 4QVCA 1BBZA 4HCKA 1RAFB 4LDWA 3EG9A 2PQWA 1PD1A 5GAOp 1UDLA 2EYZA 5DLOA 2R58A 4OF1A 4C8QE 1UGRB 3S3OA 2IIMA 5D6WA 4KRTA 3BE3A 4GBQA 1OX9A 2DTHA 3M53A 3NMZC 3REAB 3CC4A 2LX9A 3CBOA 4FSSA 3IQLA 2QQ9A 3JCMf 2ZAEA 3G4SQ 2F2WA 4MDWA 1G3SA 4C0DC 2E64A 3TU4K 4HA8A 2M9UA 4JS5A 1UJYA 4RTXA 1X01A 3KFVA 3MP1A 2GGRA 4FIBA 2J05A 5GAOq 5KE2A 2YSQA 4LXCA 1X2KA 1MNDA 4IURA 2IG0A 2RMOA 2V26A 3GBQA 1K76A 1M90U 2J7IA 1PM3A 4BE0A 2RQUA 1VQLT 1WFWA 2QG9B 2RHXA 1R0CB 3EGXA 3TVTA 4E7ZA 3M0SA 2ZCFB 5A0DA 1VQOT 3N5BB 5KE3A 1C1AA 1BU1A 2O2OA 4M7AC 1S72Q 3VS7A 1GCPA 1D1AA 3CEYA 1SHFA 5GMKh 4M7DB 5CQXA 2H8HA 3NGPA 2DPPB 2XDPA 3CPFA 1VQOQ 2DBMA 1VOMA 2XHCA 3HRUA 3PFSA 3CXCA 2FO0A 4A4EA 1RAIB 4DOVA 2CSQA 4IUQA 4MZPA 1N8RR 3BFMA 1QVFP 4M7AE 2DD4A 2QA4A 1WXTA 1YWOA 4M77A 4JRKA 4A63B 3CCVA 3V8KA 2HAXA 1ZBXA 2DIQA 1VQPT 5GMKj 2RJDA 2H3JA 1XJWB 1NBEB 4N4GA 2QQAA 1KQSP 3EH2A 4XTZA 1KC8C 1KG1A 5DLQE 3LWIA 2E1HA 2JT4A 3S3MA 1M2OA 1YFNA 2FB7A 1TTHB 5IT9E 1U3OA 5KYUB 5DM7R 2QI2A 1QMCA 3I9QA 4A4HA 3OW2S 3A8MB 2HD0A 5IHNA 2FPDA 1IGQA 5LJ5f 2RQVA 3CPWA 2RJCA 3CD6Q 1YIJQ 3PIOA 2E12A 5CKHA 1VQ4A 1YCSB 4ZN1A 3HTRA 2CSIA 3T9NA 4E7KA 1DJ7B 1CSKA 1PG5B 4WCIA 3I5RA 1PSEA 3M58A 3CQTA 2LRQA 3P8DA 3PTAA 2E70A 5FU7B 3RBBB 3C94A 1W2BS 1G3TA 3WXMB 1M27C 3H41A 2R5AA 1FXXA 2DEUA 2RA2A 3PVLA 3OYAA 1YJNQ 5CVIA 1UTIA 3EG3A 4E7IA 1TWBA 1TU0B 4F7UF 3INZA 5CKEA 4KH0B 3VV0A 2ED0A 2LC4A 1BI1A 1PSFA 2F2VA 2K3BA 1TOVA 2HMAA 4L59A 2HSPA 4ZN3A 3RNJA 2K9GA 1N9SA 2ENMA 1WGSA 5LJ5e 5L23A 3JV3A 1Y07A 1NM7A 2P0QA 1YJ9A 4E7SA 1Y7XA 4BI8B 3GLXA 3I55T 5LL6S 3OBYA 1QKWA 1YWPA 3EFOA 5HY6A 3L42A 2KBTA 2EVRA 4PFPA 1F1BB 2DK3A 1YBYA 3O8VA 3QWYA 3E9GA 3DLLA 5I11A 2FYKA 1MV0B 3M59A 3UDCA 4JJNK 1VQKQ 2ZPFB 4M78F 2DD5A 1SRLA 1VQLQ 5AYFA 4C8QD 3JCMb 3CCMT 1VUBA 5C6SA 2HEQA 4XU3A 4PJNA 4KGZB 5IXBA 2YRCA 4E7HA 2L0AA 1KQ2A 2LJ1A 2DILA 2CREA 1WHGA 5GANh 2O31A 1YIJA 3V7CA 1Q86U 1OU8A 4RTWA 3M9QA 1KC8U 3FC3A 1M3CA 1ZSZA 1OQKA 1K9MC 5LJ3d 4EDUA 4C8QB 3CCRT 5CR2A 3F70A 4ELYC 2O01E 4PJOF 4ELZC 2CS7A 2QGFB 4JLGA 4BI4A 3ZEHA 3JCMX 2JS2A 2YUOA 2CP7A 3X24B 1VQOA 4HCBA 3TSWA 1R77A 1W70A 1GFCA 2FHDA 1IXDA 1KHCA 1M1FA 1MMDA 1R0BG 1UFFA 2DO3A 3CMET 3CBMA 2E10A 2A3LA 3CCLA 1AZEA 4HVWA 4RTTA 1B3QA 4F16A 9ATCB 2A37A 2K6DA 1OZ3A 1X6OA 2ECZA 4A54A 1CKAA 4FW1A 2RD1A 2DM1A 2K57A 1QWFA 2YHTA 2JTFA 4OMLA 3OYEA 3M0PA 3ASKA 4V2SA 3QWXX 3MP6A 1LPLA 3OMGA 3EGDA 1N8RU 1M1KR 5FRNA 1TH7A 4HCZA 1I81A 1I5OB 3VS0A 4C0DB 1ZSZB 4OB2B 1WA7A 2HNIA 2L3QA 4M77G 3HPWA 2DXBA 4GY5A 8ATCB 1NE8A 4C5HA 2XMFA 5LJ3h 2P0PA 3M55A 1RACB 2M0OA 2JTMA 1UECA 4AG1C 5A0LA 4M7DF 3GP8A 2WACA 4J5YA 2ATCB 2IVWA 3EGXB 3LWHA 3BY7A 1VQPQ 3OW2A 2EYYA 4MDXA 2EBPA 5CKBA 2PNIA 2C06A 4JJBA 1K8AU 1OV3A 1OZ2A 1V1CA 3QDFA 5GAN8 2P4RA 4D8DA 3G1JA 1W4SA 5GAMf 3OB9A 3MP8A 3RDVA 4M75D 1UG1A 3GIBA 3FIFA 3CC7Q 1W6XA 3CC4Q 3QPHA 1GBQA 1EZZB 2FZGB 1JJ2S 1WDXA 2KXDA 1BCOA 3CMAQ 3CC2A 1TUDA 2DL7A 4JRQA 1N5ZA 3I35A 1ARKA 2E3HA 2RQWA 3VS1A 5GMKi 4ZNXA 3CMAA 3JB9H 2LMJA 1B34A 3JRZA 2MI6A 2QDYB 2RF0A 1B07A 1K1ZA 3LH0A 2P4TA 1VQKT 1ZUKA 2FPEA 2LTOA 1YJWA 1NYGA 3H0FA 3JSCA 2EYQA 3JCMV 5J3BA 4TVRA 4AFQC 2AK5A 4E7LA 5KYXB 3MEVA 5KYWB 3MPUB 2A36A 2EQIA 3UA7A 3VUZA 3L2UA 2CP5A 2RK1A 4XU2A 3OYBA 2KE9A 5GAMd 1VQPA 2JJ9A 3SWNA 1JBMA 4D6WA 4II1A 4J6YA 1VQLA 4CC3A 4J6WA 3CCST 3RMSA 5LJ5g 2DIGA 1I5LA 1VIEA 3QZ5B 2DRMA 4A4GA 1GBRA 2ZZDA 1QCFA 3NTIA 3CCUT 3REBB 2J06A 4J7IA 2Z0WA 4J9EA 4Y92A 2KRSA 5CO7A 3OA6A 4OMFB 2JNGA 3A8GB 3VU3C 5KCOA 2JM9A 1Q86R 4ORZA 1ZA2B 1VQ9T 5GAN4 4OB1B 4ZGEB 3OMCA
chains in the Genus database with same CATH topology
5KE3A 5I2SA 2GCXA 4M7AC 1BI2A 3M57A 4N0AA 2RM4A 2D6FA 4N4HA 3L2VA 3CEYA 3BDLA 1U1SA 3WVDB 5GMKh 5CQXA 2X35A 2DVEA 2HQXA 1Y96B 2DPPB 3OS5A 2XDPA 3CPFA 4C92B 5GAN6 1YITA 4M77E 1WPYA 4C0FA 4R56A 2X4WA 1XNIA 2XHCA 3HRUA 4M77D 3PFSA 3CXCA 1S72T 1I8FA 4A4EA 2EJFA 4DOVA 3SWNC 1VQ7A 3X28B 2F69A 3JCMc 4IUQA 4MZPA 3ZBDA 1EIFA 1WNLA 3JB9F 4M77F 3VYGA 3I55A 3BFMA 3WVEB 5I2MA 4M75C 2KAFA 4M7AE 2DD4A 4O5VA 2QA4A 3RKWA 5CK9A 2RJFA 3V7SA 5GAOr 1JB0E 2DZCA 4M77A 3QKJA 1RL2A 3CCRA 4JRKA 1NPPA 3CCJA 3CCVA 2VC8A 2RHUA 3L2WA 1VQ4T 3MEWA 4RG8A 3FLGA 3VUBA 3V8KA 2HAXA 1ZBXA 1QW1A 2DIQA 4PLIA 1VQPT 5GMKj 2RJDA 2H3JA 4J8OA 1K73U 2GFAA 2M16A 3HHTB 2V8JA 4N4GA 4M7DG 2QQAA 4NL2A 3G71A 1MGQA 3BDUA 4XTZA 2OTJT 3CD6T 5GAN3 3AHUA 2XK0A 4PJOA 1KC8C 5CAIA 2OTJA 5DLQE 3LWIA 1KG1A 2E1HA 2XG8D 3EFSA 3X26B 4M75E 1BYMA 4ZTJA 2RHZA 3S3MA 3S6WA 5CQYA 1KD1C 4IUPA 4R55A 5I21A 2O4XA 2FB7A 3FEOA 5IT9E 2CKKA 3QYHB 4F7UA 3CC2T 2QQRA 5DM7R 2QI2A 3M5AA 4BDZA 3EFRA 3HRTA 2ZGWA 1I4K1 4OP0A 4B9XA 5KCHA 2VGNA 4A4HA 3OW2S 3A8MB 2LVMA 3DLMA 2HD0A 1BI0A 5A0GA 3MEAA 5LJ5j 1YI2T 1M5Q1 3OYKA 3CD6A 2MMPA 2E5QA 3PGGA 5LJ5f 1YHQA 3V8JA 4VUBA 2DXUA 3CPWA 2A7YA 2VXEA 1Q7YU 2JOYA 2AHJB 2RJCA 4C0ZA 5GANd 3PIOA 2JUFA 1VQMA 2E12A 1G3YA 5CKHA 1WJQA 2GF7A 1VQ4A 1N27A 2VUBA 3QXEB 3QZ9B 3J7AF 2B8AA 1M4ZA 2L8DA 4A53A 5LJ5d 4M7DA 3J81E 3RIRA 4ZN1A 2PU9B 1QVPA 1K9MU 3T9NA 1IZ6A 1N6AA 4EMKB 3V8LA 4E7KA 3L2ZA 1DJ7B 2DXTA 1PSEA 3M58A 4IUUA 2LRQA 3P8DA 3VYHB 4IUTA 5GAN2 4FT4A 3PTAA 4J6XA 2E70A 2CZ1B 1VQOT 1VQ9A 5FU7B 4KT0E 4Q5WA 2EQJA 2XU8A 3C94A 5L8RE 3GNFB 5LJ3f 5J39A 4GLKA 1RI0A 4DOWA 2FVUA 3SFMA 4J83A 3JB9D 1W2BS 1K8AC 1V29B 1G3TA 2DKGA 2KQWA 3QIIA 3WXMB 1NJIC 1QVFS 4OB3B 4JS4A 4BDYA 1YJNT 1N8RC 3OYFA 2RI5A 2X4XA 1OI1A 1FXXA 2DZ9A 2R5AA 1LOJA 3NTKA 2XKOC 4HT8A 3LGLA 4EMKA 1H3ZA 5GMKe 3META 4PJOE 3QDRB 2RA2A 2MAMA 2K3YA 3OYAA 3BW1A 2RHIA 3OYJA 1NPRA 5CVIA 2XICA 3A8LB 4L6V5 3OS1A 4E7IA 2PVOB 2E6ZA 4F7UF 3INZA 4L5GA 5CKEA 4EMGA 5GAMj 3VV0A 1WJRA 3V7RA 2LC4A 1BI1A 5FRMA 1PSFA 4EMKC 2JN0A 3OSVA 3LGFA 3X20B 2ZPGB 3DKMA 4L59A 5FROA 3OYLA 2VXFA 3CCEA 4ZN3A 2D0QB 5D6YA 4A4FA 3RESA 1QP2A 4C92E 1N9SA 4C0GA 2K4YA 4C92F 2K3XA 3SDZA 2FL7A 3G71T 3KXTA 1UGQB 3E1SA 4JRPA 1QVGA 4MZTA 2L3RA 3OS0A 3CMAT 1WGSA 5LJ5e 4LD6A 5EG2A 4C92D 3QO3A 1Y07A 2X4JA 4XTUA 4XTYA 4PJOD 4M77B 1QP3A 3CCVT 4C8QC 1YJNA 2KY9A 4M78A 2JZ2A 2P0QA 3M4GA 5C0MA 3LX7A 4BACA 4FU6A 1YJ9A 2BKDN 1Y7XA 4OB0B 4BI8B 3OYNA 1VQNT 3CCQT 2L5QA 3GLXA 3OQ5A 5LL6S 3I55T 1UB4A 3OBYA 3UWNA 2ZPHB 2QXFA 2OAUA 1HK9A 3PMIA 4YTLA 5HY6A 4ZGDB 2O4XB 1H641 3L42A 2Y4XA 4ZGJB 5IAYA 2QEXA 4NS5A 2DK3A 1KQ1A 1YBYA 2PUOB 3OYHA 4XQ3A 2Y4YA 4BI3A 4Z02A 3O8VA 5LJ3e 2EKOA 3G6ET 1IREB 2YLBA 3E9GA 3DLLA 2KMTA 2LCCA 3JB9G 1M90C 1BKBA 2E65A 2FYKA 3RUXA 4IUVA 3M59A 3ER0A 4ME7A 4RCBA 3UDCA 4JJNK 2M1HA 1YHQT 2ZPFB 1XQHA 4M78F 4RKUE 2L89A 2DD5A 5IN1A 2GQVA 2QEXT 2DEQA 1Q86C 3JCMh 5M9OA 3QJYA 1VQ5T 1VQMT 3UT1A 3OS2A 5AYFA 3VKIA 4C8QD 1M1GA 3JCMb 3CCMT 3CMEA 1VUBA 5C6SA 4JUVA 1YI2A 3TCJA 3SD4A 5GAN5 2LCLA 3HFOA 4OGCA 4RCCA 3CCQA 4XU3A 1VQNA 5GAOl 5CKDA 4KULA 2X4YA 2CZ0B 3PT9A 3CC7A 2PUKB 2RO0A 4E7HA 3CCSA 1KQ2A 2XDDA 1WJSA 2LT4A 1QVGS 4C5EA 4M75A 2YRVA 1U1TA 3EAEA 3SB2A 5GMKm 1X75C 5GANh 5HKCA 2XI9A 1VQ8T 4BE1A 1AHJB 2DJZA 3PMTA 4RMOA 3I56T 1W2BA 1YIJA 4J7FA 3I56A 1Y71A 3V7CA 1Q86U 1YIJT 3CCET 4M78E 3HKSA 4EPCA 4M7AG 2DTIA 2VV5A 5HK3A 4C5GA 3M9QA 3C95A 1KC8U 1P92A 1B34B 5HK0A 4QQGA 3FC3A 5GANj 1K9MC 4RG2A 5LJ3d 4M7AA 4EDUA 2RHYA 4C8QB 2CZ7B 2WSEE 3FB9A 5LJ3g 1K73C 4ATOA 3CCRT 2LNVA 3TREA 3KBGA 4C8QA 3VJPA 3PIPA 1YITT 5CR2A 4QQ6A 3F70A 3TEEA 4X9DA 4XU1A 2O01E 4PJOF 4ELYC 1Q7YC 4X34A 4ELZC 3M54A 2CS7A 4JLGA 4BI4A 1XOVA 3ZEHA 2F5TX 3JCMX 1VQ7T 4M7DE 4KUDK 4BB7A 4F7UB 3FDRA 1S72A 2QQSA 1NJIU 2RI3A 3RKXA 2K5LA 1UGSB 5GAMe 3M4YA 2D9TA 4PNOA 3X24B 3NFCA 5GAMh 4OVAA 4LDYA 1VQOA 4HCBA 4CI0C 3S3NA 3X25B 1Q81C 3RKYA 4JLIA 2R5MA 4Y28E 3C12A 4XTXA 3URGA 1KD1U 3JCMP 3R6OA 3A8HB 3OYDA 2FHDA 4PL6A 3ZFJA 3G6EA 2RJEA 4BE2A 1KHCA 1M1FA 3QBYA 4JDSA 4EMHA 3HSBA 2DO3A 4LDVA 3CMET 2MWPA 3CBMA 2E10A 1ZQ1A 1VIFA 2A3LA 2LQKA 3C4SA 4XTVA 3CCLA 2I2LA 2EWNA 4HKEA 4PKCC 4M75F 2NLUA 3RMQA 2BIVA 2EQMA 2DAQA 4MMKA 4N4IA 1G5VA 4NL3A 2HQEA 4HT9A 3P8BB 1OZ3A 2E6NA 3M56A 4M78D 1JJ2A 1X6OA 4A54A 3CCUA 1R8OB 3HFNA 3MHXA 2RD1A 3H6ZA 3GOXA 2K57A 2YLCA 2YHTA 3Q1JA 3A5ZB 4M75G 3SWNB 2JTFA 5CKFA 4O6JA 1BIAA 5D6XA 2XIDA 4C92G 4UC4A 4XTWA 2LQ8A 3OYEA 3JAME 4LD9K 3ASKA 1Q81U 4M7AF 1VQ6T 4V2SA 1BI3A 2R57A 4QVZA 4XK8E 3LLRA 3MP6A 1D3BA 3CXCS 4M7AD 3OMGA 2DTOA 2VYTA 3JCMg 3QJ6A 4DA4A 4E47A 3OBWA 1Q82C 3ME9A 2WSFE 3NTHA 1N8RU 1QVFA 1YCYA 2HBPA 3GF5A 5FRNA 3L2QA 1YJ9T 3OYGA 4M78B 1MHNA 4FT2A 1TH7A 3MCAB 4M78C 3CCMA 4HCZA 4KBMB 1I81A 4HCCA 2KK4A 2Y90A 4E7JA 4C0DB 1M1KC 3OYIA 4OB2B 1VQ6A 4FSXA 2KDSA 5FU7C 4B9WA 2HNIA 2KSSA 4M77G 3JCMJ 3HPWA 2DXBA 4GY5A 4KUIA 1Q82U 2QA4T 3L1AA 2RK2A 3PNWC 1NE8A 2ZPEB 3H8ZA 2K5IA 5FU6C 3QYGB 4PLLA 4C5HA 5GANf 3RERA 2JVVA 5LJ3h 3OYMA 4C92A 3MEUA 2P0PA 3A8OB 3M55A 3QG1A 3GNGA 2M0OA 1OYXA 2JTMA 4WF2A 4F7UG 4Y91A 2VGMA 4A4KA 1KQSS 1O75A 2EQUA 4QW2A 4C92C 2GFUA 5A0LA 4M7DF 5GMKl 4BY6B 3GP8A 2WACA 4J5YA 4BD3A 2IVWA 4JRIA 4C8QG 3JCMQ 5GAN7 3LWHA 2V8KA 3BY7A 3G7ZA 3QUIA 3LYIA 3OW2A 4MDXA 5CKBA 5GANg 1SSFA 1ZHIA 2E41A 2C06A 4QVDA 3FRNA 1K8AU 1OZ2A 4CRIA 1N9RA 1Y96A 2EQKA 5KH6A 5GANe 4OGEA 5GAOn 4C5IA 4C8QF 5GAN8 2ZPBB 4XAXB 3HL8A 1M8VA 2EFIA 4M7DB 1UGPB 2OTLT 4P5NA 4PJOC 2V8IA 1W4SA 2EJGA 1HXDA 4LDXA 3E19A 3OB9A 3MP8A 4FL6A 5GAMf 4QQDA 4XU0A 4PJOB 4M75D 5FU6B 1JRIA 1G3WA 3GIBA 3LW5E 5J26A 4F7UE 5CIUA 1WQWA 1WQ7A 4FM4B 4ZTFA 3OYCA 3QHSA 3FIFA 3QPHA 1UEBA 2XDBA 2KVQG 4M77C 3OSSC 3HP9A 4LDUA 1JJ2S 2K5FA 4M7DC 3CC2A 4JRQA 4MZMA 2F5KA 3CCLT 2G3RA 2EIFA 5GMKi 3JCMe 5LJ3j 3CMAA 3JB9H 4QVCA 2PVGB 1B34A 3JRZA 2MF2A 2MI6A 2QDYB 3CBPA 2DXCA 4LDWA 1FX7A 1D3BB 3CCJT 2MWOA 3JCMW 2PQWA 2WSCE 5GAOp 4BUGA 3JB9I 3P8HA 2RB6A 4MMLA 1VQKA 2QQBA 3LH0A 5DLOA 2R58A 2P4TA 4M75B 4OF1A 1LNXA 1UGRB 4C8QE 3S3OA 1VQKT 2CYZB 2LTOA 5D6WA 3GPLA 3FJPA 1KHIA 1YJWA 3JCMV 3JSCA 2EYQA 1NZ9A 1YJWT 2XD0A 3CC4T 3M53A 2DTHA 3DB4A 5J3BA 3QSUA 3J80E 4TVRA 3CC4A 2LX9A 1O9SA 5GAOm 2PVDB 3CBOA 5DY9A 4E7LA 2EJ9A 3CPWS 1GXIE 2LT1A 2QQ9A 2LDMA 3MEVA 5GAMg 3CC7T 3DB3A 3JB9J 3JCMf 2RH2A 3VUZA 3L2UA 4NOYA 4M7DD 4MDWA 1G3SA 2RK1A 2ZPIB 4M7AB 4DQ2A 2EAYA 4XU2A 4C0DC 2E64A 3OYBA 5GAMd 1VQ5A 1VQPA 1LJOA 3TU4K 3SWNA 1JBMA 2P0KA 4HA8A 1VQ8A 2M9UA 3KUFA 4BY6C 4D6WA 3L2RA 4JS5A 1U8RA 5CCAA 3MO8A 4II1A 4J6YA 1X01A 4M78G 4IKFA 1VQLA 3MP1A 1M9SA 4FIBA 2K2VA 4J6WA 3CCST 3RMSA 5KE2A 2DIGA 5LJ5g 5LJ5h 1VIEA 3QZ5B 4A4GA 5GAOq 4IURA 1I5LA 1KQSA 4N0AC 2ZZDA 2IG0A 3OY9A 1BIBA 3JCMd 3NTIA 3CCUT 2BUDA 4J7IA 5FLXE 1XTDA 1FWZA 1M90U 5CO7A 3OA6A 3G4ST 4BE0A 3UPUA 4X9CA 2JNGA 4OMFB 3HRSA 3A8GB 2RHXA 3VU3C 5KCOA 3G4SA 2CGHA 2CZ6B 1M1KU 1VQLT 2OTLA 5A2QE 4PJOG 3E9FA 1VQ9T 2QTXA 2RI2A 2ZCFB 3OYYA 4OB1B 4ZGEB 5A0DA 5GAN4 3OMCA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2V A;  2P0P A;  3URG A;  2P0Q A; 
#chains in the Genus database with same CATH topology
 1OX8 A;  5I2S A;  1H92 A;  3M57 A;  1B7T A;  3L2V A;  2KNB B;  2DVE A;  2HQX A;  1Y96 B;  3OS5 A;  3PVQ A;  2D8J A;  1QLY A;  1WPY A;  4DEY A;  1XNI A;  3A1P A;  2DJQ A;  1S72 T;  1RLP C;  1VQ7 A;  3TSZ A;  3X28 B;  2F69 A;  5FWB A;  4M77 F;  2H3E B;  4E6R A;  2ROL A;  4M75 C;  1HYO A;  1UJ0 A;  4JPB W;  3L2W A;  3MEW A;  3VUB A;  4CC7 A;  1QW1 A;  4B6M A;  3R6N A;  2L3P A;  4J8O A;  2GFA A;  2M16 A;  4M7D G;  1K8A R;  4NL2 A;  1JJ2 P;  2OTJ T;  4M4Z A;  3CD6 T;  2CP3 A;  4PJO A;  2KYM A;  5CAI A;  1VQM Q;  1UUE A;  3X26 B;  4ZTJ A;  2RHZ A;  3S6W A;  5CQY A;  4IUP A;  5I21 A;  2M0Y A;  3FEO A;  3QYH B;  1FYN A;  1SPK A;  1VYV A;  1I4K 1;  4OP0 A;  4B9X A;  5KCH A;  2LVM A;  3DLM A;  1BI0 A;  5LJ5 j;  5KYN A;  3CD6 A;  2MMP A;  2E5Q A;  1YHQ A;  4VUB A;  2DXU A;  2VXE A;  1M3B A;  5GAN d;  1CKB A;  1ZA1 B;  1WJQ A;  2GF7 A;  3CXC P;  2VUB A;  3QXE B;  4RTV A;  2B8A A;  4A53 A;  5LJ5 d;  2OTJ Q;  4M7D A;  3RIR A;  1JQQ A;  4EMK B;  1X6B A;  4JJD A;  3ZL7 C;  4IUU A;  3I5S A;  4IUT A;  3EG2 A;  1VQ9 A;  2AZV A;  2DL8 A;  4KT0 E;  1PHT A;  2D0N A;  3CC2 Q;  1SKU B;  5LJ3 f;  3JB9 D;  2K7A A;  2FVU A;  1NLP C;  3SFM A;  1K8A C;  1V29 B;  2BZX A;  1NJI C;  2DVJ A;  4BDY A;  3OYF A;  2RI5 A;  2X4X A;  3CCV Q;  1IRX A;  4J9D A;  3QDR B;  2K3Y A;  3RR6 A;  2B86 A;  2RHI A;  2M51 A;  2XIC A;  3NHN A;  3NPF A;  2JN0 A;  5FRO A;  3OYL A;  2D0Q B;  4C0G A;  1AWX A;  1H8K A;  1Q95 G;  2A08 A;  2KRM A;  3EFO B;  1QVG A;  1WXU A;  6AT1 B;  3QO3 A;  4E2F B;  4XTY A;  1QP3 A;  1QCN A;  3M4G A;  3MJX A;  4BAC A;  4IIO A;  2BKD N;  4OB0 B;  2NUT B;  3OYN A;  1VQN T;  3CCQ T;  2C0O A;  1HK9 A;  4CC4 B;  2JS0 A;  4ZGJ B;  2QEX A;  1PKS A;  1MUZ A;  3CCM Q;  2A28 A;  1ABO A;  4HVU A;  4BI3 A;  5LJ3 e;  3G6E T;  2DRK A;  2YLB A;  2KI7 A;  2LCC A;  3VS2 A;  2E65 A;  4PFZ A;  3RUX A;  4RCB A;  1WHH A;  2YUP A;  3LH5 A;  2RQR A;  5IXF A;  4AT1 B;  5IN1 A;  2QAZ A;  2GQV A;  3QJY A;  2YUN A;  2K79 A;  2HSE B;  3UT1 A;  3OS2 A;  3VKI A;  1TUC A;  3TCJ A;  4J9I A;  2LCL A;  3HFO A;  3CCQ A;  2MYS A;  1Z9Z A;  4KUL A;  1ZLM A;  2X4Y A;  5KYX A;  3CC7 A;  2XDD A;  1WJS A;  4M75 A;  2YRV A;  1U1T A;  5GMK m;  5HKC A;  1VQ8 T;  2CDT A;  1AZG B;  1HD3 A;  1GCQ C;  2DL3 A;  4J7F A;  1Y71 A;  4OMQ A;  1YIJ T;  5HCK A;  4M7A G;  2DTI A;  5HK3 A;  5HK0 A;  4QQG A;  2JM8 A;  3H9N A;  4RG2 A;  2KXC A;  4M7A A;  2RHY A;  4ATO A;  3KBG A;  2RQT A;  4C8Q A;  2LX7 A;  1VQN Q;  4QQ6 A;  4X9D A;  2QYZ A;  1Q7Y C;  1K0S A;  3CCS Q;  4KUD K;  4BB7 A;  3FDR A;  1S72 A;  2RI3 A;  4X1V A;  5GAM e;  4F17 A;  3ULR B;  4LDY A;  2HL5 C;  1Q81 C;  3RKY A;  2FRY A;  4XTX A;  3R6O A;  2SRC A;  3VRZ A;  4Z8A A;  1KJW A;  4JDS A;  4PFO A;  1ZQ1 A;  1VIF A;  4XTV A;  4OMN A;  4PKC C;  2DMO A;  2OI3 A;  1PKT A;  4PK4 A;  5D7U A;  4NL3 A;  2C0T A;  4HT9 A;  1UHF A;  3P8B B;  1G2B A;  2E6N A;  1JJ2 A;  3CCU A;  1R8O B;  3H6Z A;  3GOX A;  2X51 A;  2HDA A;  4J9C A;  1EX4 A;  1RAE B;  1BIA A;  2GQI A;  2XID A;  1VQ4 Q;  3JAM E;  1VQ6 T;  1BI3 A;  2JXB A;  3LLR A;  2KRO A;  1Q7Y R;  2HQH A;  1D3B A;  3FJ5 A;  3CXC S;  3UF4 A;  4M7A D;  3I55 Q;  2J6K A;  1WHL A;  3JCM g;  2LZ6 B;  3QJ6 A;  4E47 A;  1Q82 C;  3NTH A;  2EYW A;  3OYG A;  1X2Q A;  4FT2 A;  2QK0 A;  1U06 A;  2Y90 A;  1M1K C;  2QDL A;  1H3H A;  2KDS A;  5FU7 C;  2RK2 A;  1RUW A;  4R0K A;  5GAN f;  2K5I A;  3UAT A;  4C92 A;  2O9S A;  3MEU A;  3A8O B;  3GNG A;  4F7U G;  4Y91 A;  2VGM A;  4A4K A;  1O75 A;  3H0H A;  4QW2 A;  4C92 C;  1S1N A;  3JCM Q;  2V8K A;  2GNC A;  3G7Z A;  3EGD B;  3QUI A;  3EHQ A;  4DBF A;  2LJ3 A;  3M0Q A;  1Y96 A;  1J3T A;  5KH6 A;  4OGE A;  5GAO n;  4C5I A;  3H0I A;  2EFI A;  4PJO C;  1HXD A;  1IB8 A;  2FG0 A;  1W2B P;  2EW3 A;  5FU6 B;  1JRI A;  1G3W A;  1SHG A;  1WQW A;  4FM4 B;  2BE9 B;  4HVV A;  1PCX A;  2K5F A;  1MMG A;  2MF2 A;  2DXC A;  1D3B B;  1FX7 A;  2MWO A;  2WSC E;  4BUG A;  2RB6 A;  4MML A;  1VQK A;  4AFU C;  3VS3 A;  4M75 B;  1LNX A;  4PJL A;  3FJP A;  5GJV B;  2J6F A;  1HSQ A;  1W1F A;  1NZ9 A;  1YJW T;  2XD0 A;  7AT1 B;  1WX6 A;  3QSU A;  2OX7 A;  3J80 E;  5GAO m;  1O9S A;  2PVD B;  2EJ9 A;  3CPW S;  2CH4 A;  2LT1 A;  1EFN A;  5GAM g;  4J9F A;  3JB9 J;  2J6O A;  4NOY A;  4M7D D;  4DQ2 A;  2EAY A;  1VQ5 A;  1LJO A;  1OPL A;  5CCA A;  3MO8 A;  2GBQ A;  2LCS A;  1M9S A;  3VS4 A;  4N0A C;  1VYU A;  2DE0 X;  4FYV B;  3OY9 A;  4OMO A;  2BUD A;  1VQ9 Q;  1M90 R;  1WZO A;  1FWZ A;  3G4S T;  4X9C A;  3HRS A;  2IPO B;  2CGH A;  2CZ6 B;  1M1K U;  2OTL A;  1OOT A;  3E9F A;  4PJO G;  1T3S A;  2RI2 A;  3OYY A;  1OPK A;  1I1J A;  1X27 A;  4KGX B;  1LVK A;  2GCX A;  1BI2 A;  2RM4 A;  1U1S A;  1D0X A;  2CP0 A;  2X35 A;  5GAN 6;  1YIT A;  2EKH A;  4M77 E;  4C0F A;  1QCO A;  2E5K A;  1I8F A;  1PC0 A;  1M2V A;  3M0T A;  3JB9 F;  1WNL A;  3OW2 P;  3VYG A;  3WVE B;  5I2M A;  1JU5 C;  1AT1 B;  5GAO r;  1YI2 Q;  3RKW A;  2DZC A;  3QKJ A;  1NPP A;  2VC8 A;  2RHU A;  1VQ4 T;  4RG8 A;  1RAA B;  4PLI A;  3EG1 A;  3CCR Q;  2LQN A;  1K73 U;  2EGA A;  3TQ7 P;  3VS6 A;  3G71 A;  1MGQ A;  3BDU A;  3AHU A;  2XK0 A;  1K9A A;  2OTJ A;  2XG8 D;  3EFS A;  1BYM A;  2C0I A;  1D0Z A;  3CPW P;  1PWT A;  1TSF A;  2KRN A;  2QA4 Q;  4F7U A;  3CC2 T;  2QQR A;  1U5S A;  1WHJ A;  2ZGW A;  2VGN A;  5A0G A;  3MEA A;  1GRI A;  1YI2 T;  1M5Q 1;  3PGG A;  3V8J A;  1Q7Y U;  2JOY A;  2AHJ B;  4C0Z A;  1Z9Q A;  1M3A A;  2F1L A;  4LN2 A;  1VQ6 Q;  3J81 E;  1G8X A;  2PU9 B;  4FW2 A;  1N6A A;  4DEX A;  3L2Z A;  2JMC A;  1IGU A;  1SEM A;  2BE7 D;  2DXT A;  2HBW A;  3VYH B;  5GAN 2;  5FWC A;  2EQJ A;  2XU8 A;  3GNF B;  4GLK A;  2CP2 A;  4DOW A;  2DKG A;  2KQW A;  3QII A;  2OTL Q;  2MCN A;  4JS4 A;  1YJN T;  1N8R C;  1OI1 A;  3NTK A;  2DZ9 A;  1LOJ A;  4FYX B;  4HT8 A;  2GTO A;  3MET A;  4PJO E;  1UGV A;  2MAM A;  3BW1 A;  1E6G A;  3OYJ A;  1AWW A;  1ZBJ A;  2JMA A;  3A8L B;  4L6V 5;  3OS1 A;  2E6Z A;  4L5G A;  1WJR A;  4LUE A;  1ABQ A;  2YRD A;  1PRM C;  4EMK C;  4CC2 A;  2DET A;  3DKM A;  2VXF A;  2AKL A;  5D6Y A;  4A4F A;  3CCJ Q;  4C92 F;  2FL7 A;  3G71 T;  3KXT A;  1UGQ B;  3E1S A;  1TG0 A;  2L3R A;  3OS0 A;  3CMA T;  4LD6 A;  4XTU A;  4PJO D;  3M0U A;  3CCV T;  4C8Q C;  1YJN A;  5EC7 A;  4M78 A;  2JZ2 A;  2COZ A;  4RUG A;  1PNJ A;  3LX7 A;  4FU6 A;  2L5Q A;  2KYB A;  1UB4 A;  1TUG B;  2BTT A;  2ZPH B;  2QXF A;  3PMI A;  4YTL A;  4ZGD B;  2O9V A;  2O4X B;  1YP5 A;  4OMP A;  4NS5 A;  4ANJ A;  2PUO B;  3CCQ Q;  4XQ3 A;  2Y4Y A;  2JTE A;  4Z02 A;  1BB9 A;  2KMT A;  1T0J A;  3MKD A;  3JB9 G;  1BKB A;  1WYX A;  2DA9 A;  3EHR A;  3ER0 A;  4AFZ C;  4DBQ A;  5ECA A;  2L89 A;  1Q86 C;  2DEQ A;  3PE0 A;  4WTO B;  2NUP B;  1OEB A;  3SD4 A;  2FEI A;  5CKD A;  3PT9 A;  2CZ0 B;  4F04 B;  2PUK B;  2MIO A;  2DER A;  4C5E A;  3EAE A;  4EIK A;  2CH4 W;  4D8K A;  1V76 A;  2XI9 A;  4BE1 A;  1AHJ B;  3PMT A;  4RMO A;  1W2B A;  2YUQ A;  3I56 A;  2E4H A;  1GFD A;  3HKS A;  4EPC A;  2VV5 A;  4C5G A;  1P92 A;  2QEX Q;  1RAD B;  2FPF A;  1VQ7 Q;  2CZ7 B;  2WSE E;  1RLQ C;  1TS9 A;  2HL3 A;  1K73 C;  2LNV A;  2DX1 A;  3PIP A;  2HKQ B;  3TEE A;  3M54 A;  1G83 A;  1GCQ A;  2D8H A;  1VQ7 T;  4JZ4 A;  4F7U B;  3RKX A;  2K5L A;  3M4Y A;  2NYS A;  4PNO A;  4CI0 C;  1VQ8 Q;  3X25 B;  4JLI A;  3URG A;  3C12 A;  4LUD A;  1KD1 U;  4LE9 A;  3OYD A;  1D09 B;  5I22 A;  3ZFJ A;  1QKX A;  3QBY A;  4EMH A;  4LDV A;  1JXO A;  2MWP A;  4J9G A;  3C4S A;  2FZC B;  4AG2 C;  2EQM A;  1MMN A;  4MMK A;  4N4I A;  1G5V A;  2M02 A;  1ZX6 A;  3M56 A;  1I07 A;  3HFN A;  3MHX A;  3A5Z B;  5CKF A;  4O6J A;  2NUT A;  4C92 G;  4XTW A;  2AIR B;  2LQ8 A;  1M2V B;  2R57 A;  4QVZ A;  3CME Q;  4XK8 E;  1YJ9 Q;  2DTO A;  2FZK B;  4DA4 A;  3ME9 A;  2HBP A;  2DYB A;  3GF5 A;  1KC8 R;  3L2Q A;  1K9M R;  4M78 B;  1MHN A;  3CCM A;  4M78 C;  2KGT A;  1I0C A;  2MPX C;  4KBM B;  4HCC A;  4E7J A;  3OYI A;  2KSS A;  3JCM J;  2QA4 T;  3L1A A;  2KR3 A;  3QYG B;  4PLL A;  1T3L A;  2JVV A;  4LNP A;  2HKN A;  2FRW A;  3QG1 A;  1QVG P;  1OYX A;  4WF2 A;  3AT1 B;  2ABL A;  2EQU A;  1ZSG A;  2E3I A;  1X43 A;  3VRY A;  5GMK l;  4BY6 B;  4BD3 A;  4JRI A;  5GAN 7;  1NLO C;  1C0M A;  4RTZ A;  4DBH A;  3LYI A;  2D1X A;  1M30 A;  2EGE A;  4FCY A;  1MMA A;  3VS5 A;  2YT6 A;  4CRI A;  2EQK A;  5GAN e;  2ZPB B;  2CUD A;  4XAX B;  1WHM A;  1FMV A;  4P5N A;  4Z89 A;  2EJG A;  3I56 Q;  4LDX A;  4PJO B;  4XU0 A;  5KYW A;  4J9H A;  1YJW Q;  1JO8 A;  4F7U E;  1OUL A;  5CIU A;  5IHK A;  1SF9 A;  2AZS A;  2DL5 A;  2XDB A;  4M77 C;  3HP9 A;  5KYY A;  1TXQ A;  4M7D C;  2F5K A;  3CCL T;  2G3R A;  3JCM e;  5LJ3 j;  2PVG B;  2EYX A;  1VQ5 Q;  2DLP A;  3CBP A;  3CCJ T;  3JCM W;  3JB9 I;  3G71 Q;  3P8H A;  2ROT A;  2COW A;  2QQB A;  1D0Y A;  4PJM A;  2NWM A;  2CYZ B;  3GPL A;  1KHI A;  3CC4 T;  3DB4 A;  3CCE Q;  5DY9 A;  1GXI E;  1KIK A;  2LDM A;  3CC7 T;  2CT3 A;  3CCL Q;  3DB3 A;  2RH2 A;  4M7A B;  2ZPI B;  2QGG A;  2P0K A;  1VQ8 A;  1YHQ Q;  3KUF A;  4BY6 C;  3L2R A;  1U8R A;  1WHK A;  4M78 G;  4AMC A;  4IKF A;  2K2M A;  2K2V A;  5LJ5 h;  2AKK A;  1KQS A;  4RTU A;  1MV3 A;  1BIB A;  1Y0M A;  3JCM d;  2P84 A;  4IIM A;  5FLX E;  1XTD A;  2RPN A;  3UPU A;  3G4S A;  5A2Q E;  2AT1 B;  2QTX A;  2CP6 A;  1NYF A;  4N0A A;  1FMK A;  2D6F A;  4N4H A;  3BDL A;  3WVD B;  4BDZ A;  2VVK A;  4C92 B;  4FYW B;  1AEY A;  2NUZ A;  4R56 A;  2X4W A;  4M77 D;  2VB6 A;  2EJF A;  3SWN C;  3JCM c;  2SEM A;  1NJI R;  3ZBD A;  1EIF A;  1JXM A;  3I55 A;  2VAS A;  2KAF A;  4O5V A;  5CK9 A;  2RJF A;  3V7S A;  1JB0 E;  1LCK A;  2F2X A;  3CCR A;  1RL2 A;  3CCJ A;  3O5Z A;  2LNH B;  3FLG A;  2EGC A;  1KSW A;  2PZ1 A;  3HHT B;  2V8J A;  5GAN 3;  2V1R A;  4QKU A;  4M75 E;  1KD1 C;  2MK5 A;  4R55 A;  2O4X A;  1E6H A;  2A0F B;  2CT4 A;  2CKK A;  1RAH B;  2W10 A;  4AFS C;  3M5A A;  4F14 A;  3EFR A;  3HRT A;  3OYK A;  1PD0 A;  2A7Y A;  4J9B A;  3EG0 A;  2X9H A;  2JUF A;  1VQM A;  1G3Y A;  1N27 A;  3J7A F;  3QZ9 B;  2GTJ A;  1M4Z A;  2L8D A;  2PTK A;  1AVZ C;  2V1Q A;  1K4U S;  1K9M U;  1QVP A;  1IZ6 A;  1RI9 A;  3V8L A;  3G6E Q;  1NG2 A;  4FT4 A;  4J6X A;  2CZ1 B;  3EGU A;  4Q5W A;  5L8R E;  1GL5 A;  5J39 A;  1RI0 A;  4J83 A;  1QVF S;  4OB3 B;  4PJJ A;  1T0H A;  2XKO C;  3LGL A;  4EMK A;  1H3Z A;  5GMK e;  1K0X A;  1Y57 A;  3C0C A;  1NEG A;  1NPR A;  3E2U A;  2PVO B;  2YDL A;  5GAM j;  4EMG A;  4RTY A;  3V7R A;  5FRM A;  3OSV A;  3LGF A;  3X20 B;  2ZPG B;  1IHW A;  3CCE A;  2CUB A;  1A0N B;  1HJD A;  3RES A;  1QP2 A;  4C92 E;  1BCM A;  1AOJ A;  2K4Y A;  2K3X A;  3SDZ A;  4JRP A;  4MZT A;  1OU9 A;  1X69 A;  5IH2 A;  1ZUU A;  2MOX A;  1AWO A;  4C92 D;  5EG2 A;  2X4J A;  1ACM B;  1KFZ A;  4JJC A;  1IO6 A;  4FYY B;  4M77 B;  1YN8 A;  1UE9 A;  2KY9 A;  5C0M A;  4DBR A;  1YIT Q;  2RN8 A;  3OQ5 A;  2YXY A;  3UWN A;  2OAU A;  2L3S A;  2DFU A;  2KT1 A;  1H64 1;  2Y4X A;  5IAY A;  1KQ1 A;  3OYH A;  2EKO A;  1KD1 R;  1FMW A;  2I0N A;  1YNZ A;  1IRE B;  1RAG B;  1K73 R;  1M90 C;  2HZY A;  3M0R A;  4IUV A;  4ME7 A;  2M1H A;  4KGV B;  1YHQ T;  1XQH A;  4RKU E;  2QEX T;  2EPD A;  3JCM h;  5M9O A;  1VQ5 T;  2DNU A;  1VQM T;  1WI7 A;  1M1G A;  1UHC A;  3CME A;  4JUV A;  4OMM A;  1YI2 A;  1VQN A;  5GAN 5;  4K11 A;  4OGC A;  4RCC A;  2X3X D;  1D1C A;  5GAO l;  2O88 A;  4KH1 B;  3EH1 A;  2RO0 A;  3CCS A;  3A98 A;  2LT4 A;  5FW9 A;  2DYI A;  1QVG S;  3SB2 A;  5AT1 B;  1X75 C;  2ESW A;  1BK2 A;  2DJZ A;  3SHW A;  3I56 T;  3CCE T;  4M78 E;  2YWW A;  3C95 A;  1B34 B;  2DF6 A;  3THK A;  1NEB A;  5GAN j;  5LJ3 g;  3FB9 A;  3TRE A;  1ZSZ C;  3VJP A;  1YIT T;  2KT8 A;  5KYU A;  3EG9 B;  4XU1 A;  1JEG A;  4X34 A;  1Q81 R;  3D7S B;  1XOV A;  2F5T X;  1AD5 A;  4M7D E;  2QQS A;  1NJI U;  1UGS B;  2D9T A;  1M8M A;  2BZ8 A;  2QAS A;  2JW4 A;  3NFC A;  5GAM h;  4OVA A;  3CCU Q;  3S3N A;  2G6F X;  2R5M A;  4Y28 E;  3JCM P;  1PRL C;  1X6G A;  3SEM A;  3A8H B;  4PL6 A;  2X3W D;  2RJE A;  3G6E A;  4BE2 A;  2VWF A;  3HSB A;  1WXB A;  8AT1 B;  2LQK A;  1KK7 A;  2I2L A;  2EWN A;  4HKE A;  1QWE A;  2ED1 A;  4M75 F;  2NLU A;  3RMQ A;  2BIV A;  2W0Z A;  4HXJ A;  5IHI A;  2DAQ A;  1VYT A;  2HQE A;  2QTV A;  4M78 D;  1D1B A;  1SSH A;  2YLC A;  3Q1J A;  4M75 G;  3SWN B;  5D6X A;  2KEA A;  4UC4 A;  4LD9 K;  1Q81 U;  4M7A F;  4QT7 A;  1SRM A;  2VYT A;  2LP5 A;  3OBW A;  2WSF E;  1QVF A;  4JZ3 A;  1YCY A;  2HCK A;  1YJ9 T;  3MCA B;  2BZY A;  5GJW B;  2KK4 A;  1VQ6 A;  1RAB B;  1Q82 R;  4FSX A;  4B9W A;  1E7O A;  4KUI A;  1Q82 U;  3PNW C;  5FU6 C;  2ZPE B;  3H8Z A;  3UA6 A;  3RER A;  1WLP B;  3OYM A;  3U23 A;  2DL4 A;  2NUP A;  1ZUY A;  1KQS S;  1MNE A;  2GFU A;  1VA7 A;  2LJ0 A;  4C8Q G;  1WIE A;  1SG5 A;  5GAN g;  1SSF A;  1ZHI A;  4ESR A;  2E41 A;  4QVD A;  3FRN A;  2L2P A;  2OJ2 A;  1N9R A;  2VKN A;  5KYY B;  4C8Q F;  3HL8 A;  1M8V A;  1UGP B;  2OTL T;  2V8I A;  3E19 A;  4FL6 A;  2COY A;  4QQD A;  2LQW A;  1QQJ A;  2RNA A;  3LW5 E;  5J26 A;  1IHV A;  1WQ7 A;  4ZTF A;  3OYC A;  2OAW A;  3QHS A;  2DBK A;  1UEB A;  4GLM A;  1AWJ A;  2KVQ G;  3OSS C;  4LDU A;  4MZM A;  2EIF A;  1C6V X;  4Z88 A;  4QVC A;  1BBZ A;  4HCK A;  1RAF B;  4LDW A;  3EG9 A;  2PQW A;  1PD1 A;  5GAO p;  1UDL A;  2EYZ A;  5DLO A;  2R58 A;  4OF1 A;  4C8Q E;  1UGR B;  3S3O A;  2IIM A;  5D6W A;  4KRT A;  3BE3 A;  4GBQ A;  1OX9 A;  2DTH A;  3M53 A;  3NMZ C;  3REA B;  3CC4 A;  2LX9 A;  3CBO A;  4FSS A;  3IQL A;  2QQ9 A;  3JCM f;  2ZAE A;  3G4S Q;  2F2W A;  4MDW A;  1G3S A;  4C0D C;  2E64 A;  3TU4 K;  4HA8 A;  2M9U A;  4JS5 A;  1UJY A;  4RTX A;  1X01 A;  3KFV A;  3MP1 A;  2GGR A;  4FIB A;  2J05 A;  5GAO q;  5KE2 A;  2YSQ A;  4LXC A;  1X2K A;  1MND A;  4IUR A;  2IG0 A;  2RMO A;  2V26 A;  3GBQ A;  1K76 A;  1M90 U;  2J7I A;  1PM3 A;  4BE0 A;  2RQU A;  1VQL T;  1WFW A;  2QG9 B;  2RHX A;  1R0C B;  3EGX A;  3TVT A;  4E7Z A;  3M0S A;  2ZCF B;  5A0D A;  1VQO T;  3N5B B;  5KE3 A;  1C1A A;  1BU1 A;  2O2O A;  4M7A C;  1S72 Q;  3VS7 A;  1GCP A;  1D1A A;  3CEY A;  1SHF A;  5GMK h;  4M7D B;  5CQX A;  2H8H A;  3NGP A;  2DPP B;  2XDP A;  3CPF A;  1VQO Q;  2DBM A;  1VOM A;  2XHC A;  3HRU A;  3PFS A;  3CXC A;  2FO0 A;  4A4E A;  1RAI B;  4DOV A;  2CSQ A;  4IUQ A;  4MZP A;  1N8R R;  3BFM A;  1QVF P;  4M7A E;  2DD4 A;  2QA4 A;  1WXT A;  1YWO A;  4M77 A;  4JRK A;  4A63 B;  3CCV A;  3V8K A;  2HAX A;  1ZBX A;  2DIQ A;  1VQP T;  5GMK j;  2RJD A;  2H3J A;  1XJW B;  1NBE B;  4N4G A;  2QQA A;  1KQS P;  3EH2 A;  4XTZ A;  1KC8 C;  1KG1 A;  5DLQ E;  3LWI A;  2E1H A;  2JT4 A;  3S3M A;  1M2O A;  1YFN A;  2FB7 A;  1TTH B;  5IT9 E;  1U3O A;  5KYU B;  5DM7 R;  2QI2 A;  1QMC A;  3I9Q A;  4A4H A;  3OW2 S;  3A8M B;  2HD0 A;  5IHN A;  2FPD A;  1IGQ A;  5LJ5 f;  2RQV A;  3CPW A;  2RJC A;  3CD6 Q;  1YIJ Q;  3PIO A;  2E12 A;  5CKH A;  1VQ4 A;  1YCS B;  4ZN1 A;  3HTR A;  2CSI A;  3T9N A;  4E7K A;  1DJ7 B;  1CSK A;  1PG5 B;  4WCI A;  3I5R A;  1PSE A;  3M58 A;  3CQT A;  2LRQ A;  3P8D A;  3PTA A;  2E70 A;  5FU7 B;  3RBB B;  3C94 A;  1W2B S;  1G3T A;  3WXM B;  1M27 C;  3H41 A;  2R5A A;  1FXX A;  2DEU A;  2RA2 A;  3PVL A;  3OYA A;  1YJN Q;  5CVI A;  1UTI A;  3EG3 A;  4E7I A;  1TWB A;  1TU0 B;  4F7U F;  3INZ A;  5CKE A;  4KH0 B;  3VV0 A;  2ED0 A;  2LC4 A;  1BI1 A;  1PSF A;  2F2V A;  2K3B A;  1TOV A;  2HMA A;  4L59 A;  2HSP A;  4ZN3 A;  3RNJ A;  2K9G A;  1N9S A;  2ENM A;  1WGS A;  5LJ5 e;  5L23 A;  3JV3 A;  1Y07 A;  1NM7 A;  2P0Q A;  1YJ9 A;  4E7S A;  1Y7X A;  4BI8 B;  3GLX A;  3I55 T;  5LL6 S;  3OBY A;  1QKW A;  1YWP A;  3EFO A;  5HY6 A;  3L42 A;  2KBT A;  2EVR A;  4PFP A;  1F1B B;  2DK3 A;  1YBY A;  3O8V A;  3QWY A;  3E9G A;  3DLL A;  5I11 A;  2FYK A;  1MV0 B;  3M59 A;  3UDC A;  4JJN K;  1VQK Q;  2ZPF B;  4M78 F;  2DD5 A;  1SRL A;  1VQL Q;  5AYF A;  4C8Q D;  3JCM b;  3CCM T;  1VUB A;  5C6S A;  2HEQ A;  4XU3 A;  4PJN A;  4KGZ B;  5IXB A;  2YRC A;  4E7H A;  2L0A A;  1KQ2 A;  2LJ1 A;  2DIL A;  2CRE A;  1WHG A;  5GAN h;  2O31 A;  1YIJ A;  3V7C A;  1Q86 U;  1OU8 A;  4RTW A;  3M9Q A;  1KC8 U;  3FC3 A;  1M3C A;  1ZSZ A;  1OQK A;  1K9M C;  5LJ3 d;  4EDU A;  4C8Q B;  3CCR T;  5CR2 A;  3F70 A;  4ELY C;  2O01 E;  4PJO F;  4ELZ C;  2CS7 A;  2QGF B;  4JLG A;  4BI4 A;  3ZEH A;  3JCM X;  2JS2 A;  2YUO A;  2CP7 A;  3X24 B;  1VQO A;  4HCB A;  3TSW A;  1R77 A;  1W70 A;  1GFC A;  2FHD A;  1IXD A;  1KHC A;  1M1F A;  1MMD A;  1R0B G;  1UFF A;  2DO3 A;  3CME T;  3CBM A;  2E10 A;  2A3L A;  3CCL A;  1AZE A;  4HVW A;  4RTT A;  1B3Q A;  4F16 A;  9ATC B;  2A37 A;  2K6D A;  1OZ3 A;  1X6O A;  2ECZ A;  4A54 A;  1CKA A;  4FW1 A;  2RD1 A;  2DM1 A;  2K57 A;  1QWF A;  2YHT A;  2JTF A;  4OML A;  3OYE A;  3M0P A;  3ASK A;  4V2S A;  3QWX X;  3MP6 A;  1LPL A;  3OMG A;  3EGD A;  1N8R U;  1M1K R;  5FRN A;  1TH7 A;  4HCZ A;  1I81 A;  1I5O B;  3VS0 A;  4C0D B;  1ZSZ B;  4OB2 B;  1WA7 A;  2HNI A;  2L3Q A;  4M77 G;  3HPW A;  2DXB A;  4GY5 A;  8ATC B;  1NE8 A;  4C5H A;  2XMF A;  5LJ3 h;  2P0P A;  3M55 A;  1RAC B;  2M0O A;  2JTM A;  1UEC A;  4AG1 C;  5A0L A;  4M7D F;  3GP8 A;  2WAC A;  4J5Y A;  2ATC B;  2IVW A;  3EGX B;  3LWH A;  3BY7 A;  1VQP Q;  3OW2 A;  2EYY A;  4MDX A;  2EBP A;  5CKB A;  2PNI A;  2C06 A;  4JJB A;  1K8A U;  1OV3 A;  1OZ2 A;  1V1C A;  3QDF A;  5GAN 8;  2P4R A;  4D8D A;  3G1J A;  1W4S A;  5GAM f;  3OB9 A;  3MP8 A;  3RDV A;  4M75 D;  1UG1 A;  3GIB A;  3FIF A;  3CC7 Q;  1W6X A;  3CC4 Q;  3QPH A;  1GBQ A;  1EZZ B;  2FZG B;  1JJ2 S;  1WDX A;  2KXD A;  1BCO A;  3CMA Q;  3CC2 A;  1TUD A;  2DL7 A;  4JRQ A;  1N5Z A;  3I35 A;  1ARK A;  2E3H A;  2RQW A;  3VS1 A;  5GMK i;  4ZNX A;  3CMA A;  3JB9 H;  2LMJ A;  1B34 A;  3JRZ A;  2MI6 A;  2QDY B;  2RF0 A;  1B07 A;  1K1Z A;  3LH0 A;  2P4T A;  1VQK T;  1ZUK A;  2FPE A;  2LTO A;  1YJW A;  1NYG A;  3H0F A;  3JSC A;  2EYQ A;  3JCM V;  5J3B A;  4TVR A;  4AFQ C;  2AK5 A;  4E7L A;  5KYX B;  3MEV A;  5KYW B;  3MPU B;  2A36 A;  2EQI A;  3UA7 A;  3VUZ A;  3L2U A;  2CP5 A;  2RK1 A;  4XU2 A;  3OYB A;  2KE9 A;  5GAM d;  1VQP A;  2JJ9 A;  3SWN A;  1JBM A;  4D6W A;  4II1 A;  4J6Y A;  1VQL A;  4CC3 A;  4J6W A;  3CCS T;  3RMS A;  5LJ5 g;  2DIG A;  1I5L A;  1VIE A;  3QZ5 B;  2DRM A;  4A4G A;  1GBR A;  2ZZD A;  1QCF A;  3NTI A;  3CCU T;  3REB B;  2J06 A;  4J7I A;  2Z0W A;  4J9E A;  4Y92 A;  2KRS A;  5CO7 A;  3OA6 A;  4OMF B;  2JNG A;  3A8G B;  3VU3 C;  5KCO A;  2JM9 A;  1Q86 R;  4ORZ A;  1ZA2 B;  1VQ9 T;  5GAN 4;  4OB1 B;  4ZGE B;  3OMC A; 
#chains in the Genus database with same CATH homology
 5KE3 A;  5I2S A;  2GCX A;  4M7A C;  1BI2 A;  3M57 A;  4N0A A;  2RM4 A;  2D6F A;  4N4H A;  3L2V A;  3CEY A;  3BDL A;  1U1S A;  3WVD B;  5GMK h;  5CQX A;  2X35 A;  2DVE A;  2HQX A;  1Y96 B;  2DPP B;  3OS5 A;  2XDP A;  3CPF A;  4C92 B;  5GAN 6;  1YIT A;  4M77 E;  1WPY A;  4C0F A;  4R56 A;  2X4W A;  1XNI A;  2XHC A;  3HRU A;  4M77 D;  3PFS A;  3CXC A;  1S72 T;  1I8F A;  4A4E A;  2EJF A;  4DOV A;  3SWN C;  1VQ7 A;  3X28 B;  2F69 A;  3JCM c;  4IUQ A;  4MZP A;  3ZBD A;  1EIF A;  1WNL A;  3JB9 F;  4M77 F;  3VYG A;  3I55 A;  3BFM A;  3WVE B;  5I2M A;  4M75 C;  2KAF A;  4M7A E;  2DD4 A;  4O5V A;  2QA4 A;  3RKW A;  5CK9 A;  2RJF A;  3V7S A;  5GAO r;  1JB0 E;  2DZC A;  4M77 A;  3QKJ A;  1RL2 A;  3CCR A;  4JRK A;  1NPP A;  3CCJ A;  3CCV A;  2VC8 A;  2RHU A;  3L2W A;  1VQ4 T;  3MEW A;  4RG8 A;  3FLG A;  3VUB A;  3V8K A;  2HAX A;  1ZBX A;  1QW1 A;  2DIQ A;  4PLI A;  1VQP T;  5GMK j;  2RJD A;  2H3J A;  4J8O A;  1K73 U;  2GFA A;  2M16 A;  3HHT B;  2V8J A;  4N4G A;  4M7D G;  2QQA A;  4NL2 A;  3G71 A;  1MGQ A;  3BDU A;  4XTZ A;  2OTJ T;  3CD6 T;  5GAN 3;  3AHU A;  2XK0 A;  4PJO A;  1KC8 C;  5CAI A;  2OTJ A;  5DLQ E;  3LWI A;  1KG1 A;  2E1H A;  2XG8 D;  3EFS A;  3X26 B;  4M75 E;  1BYM A;  4ZTJ A;  2RHZ A;  3S3M A;  3S6W A;  5CQY A;  1KD1 C;  4IUP A;  4R55 A;  5I21 A;  2O4X A;  2FB7 A;  3FEO A;  5IT9 E;  2CKK A;  3QYH B;  4F7U A;  3CC2 T;  2QQR A;  5DM7 R;  2QI2 A;  3M5A A;  4BDZ A;  3EFR A;  3HRT A;  2ZGW A;  1I4K 1;  4OP0 A;  4B9X A;  5KCH A;  2VGN A;  4A4H A;  3OW2 S;  3A8M B;  2LVM A;  3DLM A;  2HD0 A;  1BI0 A;  5A0G A;  3MEA A;  5LJ5 j;  1YI2 T;  1M5Q 1;  3OYK A;  3CD6 A;  2MMP A;  2E5Q A;  3PGG A;  5LJ5 f;  1YHQ A;  3V8J A;  4VUB A;  2DXU A;  3CPW A;  2A7Y A;  2VXE A;  1Q7Y U;  2JOY A;  2AHJ B;  2RJC A;  4C0Z A;  5GAN d;  3PIO A;  2JUF A;  1VQM A;  2E12 A;  1G3Y A;  5CKH A;  1WJQ A;  2GF7 A;  1VQ4 A;  1N27 A;  2VUB A;  3QXE B;  3QZ9 B;  3J7A F;  2B8A A;  1M4Z A;  2L8D A;  4A53 A;  5LJ5 d;  4M7D A;  3J81 E;  3RIR A;  4ZN1 A;  2PU9 B;  1QVP A;  1K9M U;  3T9N A;  1IZ6 A;  1N6A A;  4EMK B;  3V8L A;  4E7K A;  3L2Z A;  1DJ7 B;  2DXT A;  1PSE A;  3M58 A;  4IUU A;  2LRQ A;  3P8D A;  3VYH B;  4IUT A;  5GAN 2;  4FT4 A;  3PTA A;  4J6X A;  2E70 A;  2CZ1 B;  1VQO T;  1VQ9 A;  5FU7 B;  4KT0 E;  4Q5W A;  2EQJ A;  2XU8 A;  3C94 A;  5L8R E;  3GNF B;  5LJ3 f;  5J39 A;  4GLK A;  1RI0 A;  4DOW A;  2FVU A;  3SFM A;  4J83 A;  3JB9 D;  1W2B S;  1K8A C;  1V29 B;  1G3T A;  2DKG A;  2KQW A;  3QII A;  3WXM B;  1NJI C;  1QVF S;  4OB3 B;  4JS4 A;  4BDY A;  1YJN T;  1N8R C;  3OYF A;  2RI5 A;  2X4X A;  1OI1 A;  1FXX A;  2DZ9 A;  2R5A A;  1LOJ A;  3NTK A;  2XKO C;  4HT8 A;  3LGL A;  4EMK A;  1H3Z A;  5GMK e;  3MET A;  4PJO E;  3QDR B;  2RA2 A;  2MAM A;  2K3Y A;  3OYA A;  3BW1 A;  2RHI A;  3OYJ A;  1NPR A;  5CVI A;  2XIC A;  3A8L B;  4L6V 5;  3OS1 A;  4E7I A;  2PVO B;  2E6Z A;  4F7U F;  3INZ A;  4L5G A;  5CKE A;  4EMG A;  5GAM j;  3VV0 A;  1WJR A;  3V7R A;  2LC4 A;  1BI1 A;  5FRM A;  1PSF A;  4EMK C;  2JN0 A;  3OSV A;  3LGF A;  3X20 B;  2ZPG B;  3DKM A;  4L59 A;  5FRO A;  3OYL A;  2VXF A;  3CCE A;  4ZN3 A;  2D0Q B;  5D6Y A;  4A4F A;  3RES A;  1QP2 A;  4C92 E;  1N9S A;  4C0G A;  2K4Y A;  4C92 F;  2K3X A;  3SDZ A;  2FL7 A;  3G71 T;  3KXT A;  1UGQ B;  3E1S A;  4JRP A;  1QVG A;  4MZT A;  2L3R A;  3OS0 A;  3CMA T;  1WGS A;  5LJ5 e;  4LD6 A;  5EG2 A;  4C92 D;  3QO3 A;  1Y07 A;  2X4J A;  4XTU A;  4XTY A;  4PJO D;  4M77 B;  1QP3 A;  3CCV T;  4C8Q C;  1YJN A;  2KY9 A;  4M78 A;  2JZ2 A;  2P0Q A;  3M4G A;  5C0M A;  3LX7 A;  4BAC A;  4FU6 A;  1YJ9 A;  2BKD N;  1Y7X A;  4OB0 B;  4BI8 B;  3OYN A;  1VQN T;  3CCQ T;  2L5Q A;  3GLX A;  3OQ5 A;  5LL6 S;  3I55 T;  1UB4 A;  3OBY A;  3UWN A;  2ZPH B;  2QXF A;  2OAU A;  1HK9 A;  3PMI A;  4YTL A;  5HY6 A;  4ZGD B;  2O4X B;  1H64 1;  3L42 A;  2Y4X A;  4ZGJ B;  5IAY A;  2QEX A;  4NS5 A;  2DK3 A;  1KQ1 A;  1YBY A;  2PUO B;  3OYH A;  4XQ3 A;  2Y4Y A;  4BI3 A;  4Z02 A;  3O8V A;  5LJ3 e;  2EKO A;  3G6E T;  1IRE B;  2YLB A;  3E9G A;  3DLL A;  2KMT A;  2LCC A;  3JB9 G;  1M90 C;  1BKB A;  2E65 A;  2FYK A;  3RUX A;  4IUV A;  3M59 A;  3ER0 A;  4ME7 A;  4RCB A;  3UDC A;  4JJN K;  2M1H A;  1YHQ T;  2ZPF B;  1XQH A;  4M78 F;  4RKU E;  2L89 A;  2DD5 A;  5IN1 A;  2GQV A;  2QEX T;  2DEQ A;  1Q86 C;  3JCM h;  5M9O A;  3QJY A;  1VQ5 T;  1VQM T;  3UT1 A;  3OS2 A;  5AYF A;  3VKI A;  4C8Q D;  1M1G A;  3JCM b;  3CCM T;  3CME A;  1VUB A;  5C6S A;  4JUV A;  1YI2 A;  3TCJ A;  3SD4 A;  5GAN 5;  2LCL A;  3HFO A;  4OGC A;  4RCC A;  3CCQ A;  4XU3 A;  1VQN A;  5GAO l;  5CKD A;  4KUL A;  2X4Y A;  2CZ0 B;  3PT9 A;  3CC7 A;  2PUK B;  2RO0 A;  4E7H A;  3CCS A;  1KQ2 A;  2XDD A;  1WJS A;  2LT4 A;  1QVG S;  4C5E A;  4M75 A;  2YRV A;  1U1T A;  3EAE A;  3SB2 A;  5GMK m;  1X75 C;  5GAN h;  5HKC A;  2XI9 A;  1VQ8 T;  4BE1 A;  1AHJ B;  2DJZ A;  3PMT A;  4RMO A;  3I56 T;  1W2B A;  1YIJ A;  4J7F A;  3I56 A;  1Y71 A;  3V7C A;  1Q86 U;  1YIJ T;  3CCE T;  4M78 E;  3HKS A;  4EPC A;  4M7A G;  2DTI A;  2VV5 A;  5HK3 A;  4C5G A;  3M9Q A;  3C95 A;  1KC8 U;  1P92 A;  1B34 B;  5HK0 A;  4QQG A;  3FC3 A;  5GAN j;  1K9M C;  4RG2 A;  5LJ3 d;  4M7A A;  4EDU A;  2RHY A;  4C8Q B;  2CZ7 B;  2WSE E;  3FB9 A;  5LJ3 g;  1K73 C;  4ATO A;  3CCR T;  2LNV A;  3TRE A;  3KBG A;  4C8Q A;  3VJP A;  3PIP A;  1YIT T;  5CR2 A;  4QQ6 A;  3F70 A;  3TEE A;  4X9D A;  4XU1 A;  2O01 E;  4PJO F;  4ELY C;  1Q7Y C;  4X34 A;  4ELZ C;  3M54 A;  2CS7 A;  4JLG A;  4BI4 A;  1XOV A;  3ZEH A;  2F5T X;  3JCM X;  1VQ7 T;  4M7D E;  4KUD K;  4BB7 A;  4F7U B;  3FDR A;  1S72 A;  2QQS A;  1NJI U;  2RI3 A;  3RKX A;  2K5L A;  1UGS B;  5GAM e;  3M4Y A;  2D9T A;  4PNO A;  3X24 B;  3NFC A;  5GAM h;  4OVA A;  4LDY A;  1VQO A;  4HCB A;  4CI0 C;  3S3N A;  3X25 B;  1Q81 C;  3RKY A;  4JLI A;  2R5M A;  4Y28 E;  3C12 A;  4XTX A;  3URG A;  1KD1 U;  3JCM P;  3R6O A;  3A8H B;  3OYD A;  2FHD A;  4PL6 A;  3ZFJ A;  3G6E A;  2RJE A;  4BE2 A;  1KHC A;  1M1F A;  3QBY A;  4JDS A;  4EMH A;  3HSB A;  2DO3 A;  4LDV A;  3CME T;  2MWP A;  3CBM A;  2E10 A;  1ZQ1 A;  1VIF A;  2A3L A;  2LQK A;  3C4S A;  4XTV A;  3CCL A;  2I2L A;  2EWN A;  4HKE A;  4PKC C;  4M75 F;  2NLU A;  3RMQ A;  2BIV A;  2EQM A;  2DAQ A;  4MMK A;  4N4I A;  1G5V A;  4NL3 A;  2HQE A;  4HT9 A;  3P8B B;  1OZ3 A;  2E6N A;  3M56 A;  4M78 D;  1JJ2 A;  1X6O A;  4A54 A;  3CCU A;  1R8O B;  3HFN A;  3MHX A;  2RD1 A;  3H6Z A;  3GOX A;  2K57 A;  2YLC A;  2YHT A;  3Q1J A;  3A5Z B;  4M75 G;  3SWN B;  2JTF A;  5CKF A;  4O6J A;  1BIA A;  5D6X A;  2XID A;  4C92 G;  4UC4 A;  4XTW A;  2LQ8 A;  3OYE A;  3JAM E;  4LD9 K;  3ASK A;  1Q81 U;  4M7A F;  1VQ6 T;  4V2S A;  1BI3 A;  2R57 A;  4QVZ A;  4XK8 E;  3LLR A;  3MP6 A;  1D3B A;  3CXC S;  4M7A D;  3OMG A;  2DTO A;  2VYT A;  3JCM g;  3QJ6 A;  4DA4 A;  4E47 A;  3OBW A;  1Q82 C;  3ME9 A;  2WSF E;  3NTH A;  1N8R U;  1QVF A;  1YCY A;  2HBP A;  3GF5 A;  5FRN A;  3L2Q A;  1YJ9 T;  3OYG A;  4M78 B;  1MHN A;  4FT2 A;  1TH7 A;  3MCA B;  4M78 C;  3CCM A;  4HCZ A;  4KBM B;  1I81 A;  4HCC A;  2KK4 A;  2Y90 A;  4E7J A;  4C0D B;  1M1K C;  3OYI A;  4OB2 B;  1VQ6 A;  4FSX A;  2KDS A;  5FU7 C;  4B9W A;  2HNI A;  2KSS A;  4M77 G;  3JCM J;  3HPW A;  2DXB A;  4GY5 A;  4KUI A;  1Q82 U;  2QA4 T;  3L1A A;  2RK2 A;  3PNW C;  1NE8 A;  2ZPE B;  3H8Z A;  2K5I A;  5FU6 C;  3QYG B;  4PLL A;  4C5H A;  5GAN f;  3RER A;  2JVV A;  5LJ3 h;  3OYM A;  4C92 A;  3MEU A;  2P0P A;  3A8O B;  3M55 A;  3QG1 A;  3GNG A;  2M0O A;  1OYX A;  2JTM A;  4WF2 A;  4F7U G;  4Y91 A;  2VGM A;  4A4K A;  1KQS S;  1O75 A;  2EQU A;  4QW2 A;  4C92 C;  2GFU A;  5A0L A;  4M7D F;  5GMK l;  4BY6 B;  3GP8 A;  2WAC A;  4J5Y A;  4BD3 A;  2IVW A;  4JRI A;  4C8Q G;  3JCM Q;  5GAN 7;  3LWH A;  2V8K A;  3BY7 A;  3G7Z A;  3QUI A;  3LYI A;  3OW2 A;  4MDX A;  5CKB A;  5GAN g;  1SSF A;  1ZHI A;  2E41 A;  2C06 A;  4QVD A;  3FRN A;  1K8A U;  1OZ2 A;  4CRI A;  1N9R A;  1Y96 A;  2EQK A;  5KH6 A;  5GAN e;  4OGE A;  5GAO n;  4C5I A;  4C8Q F;  5GAN 8;  2ZPB B;  4XAX B;  3HL8 A;  1M8V A;  2EFI A;  4M7D B;  1UGP B;  2OTL T;  4P5N A;  4PJO C;  2V8I A;  1W4S A;  2EJG A;  1HXD A;  4LDX A;  3E19 A;  3OB9 A;  3MP8 A;  4FL6 A;  5GAM f;  4QQD A;  4XU0 A;  4PJO B;  4M75 D;  5FU6 B;  1JRI A;  1G3W A;  3GIB A;  3LW5 E;  5J26 A;  4F7U E;  5CIU A;  1WQW A;  1WQ7 A;  4FM4 B;  4ZTF A;  3OYC A;  3QHS A;  3FIF A;  3QPH A;  1UEB A;  2XDB A;  2KVQ G;  4M77 C;  3OSS C;  3HP9 A;  4LDU A;  1JJ2 S;  2K5F A;  4M7D C;  3CC2 A;  4JRQ A;  4MZM A;  2F5K A;  3CCL T;  2G3R A;  2EIF A;  5GMK i;  3JCM e;  5LJ3 j;  3CMA A;  3JB9 H;  4QVC A;  2PVG B;  1B34 A;  3JRZ A;  2MF2 A;  2MI6 A;  2QDY B;  3CBP A;  2DXC A;  4LDW A;  1FX7 A;  1D3B B;  3CCJ T;  2MWO A;  3JCM W;  2PQW A;  2WSC E;  5GAO p;  4BUG A;  3JB9 I;  3P8H A;  2RB6 A;  4MML A;  1VQK A;  2QQB A;  3LH0 A;  5DLO A;  2R58 A;  2P4T A;  4M75 B;  4OF1 A;  1LNX A;  1UGR B;  4C8Q E;  3S3O A;  1VQK T;  2CYZ B;  2LTO A;  5D6W A;  3GPL A;  3FJP A;  1KHI A;  1YJW A;  3JCM V;  3JSC A;  2EYQ A;  1NZ9 A;  1YJW T;  2XD0 A;  3CC4 T;  3M53 A;  2DTH A;  3DB4 A;  5J3B A;  3QSU A;  3J80 E;  4TVR A;  3CC4 A;  2LX9 A;  1O9S A;  5GAO m;  2PVD B;  3CBO A;  5DY9 A;  4E7L A;  2EJ9 A;  3CPW S;  1GXI E;  2LT1 A;  2QQ9 A;  2LDM A;  3MEV A;  5GAM g;  3CC7 T;  3DB3 A;  3JB9 J;  3JCM f;  2RH2 A;  3VUZ A;  3L2U A;  4NOY A;  4M7D D;  4MDW A;  1G3S A;  2RK1 A;  2ZPI B;  4M7A B;  4DQ2 A;  2EAY A;  4XU2 A;  4C0D C;  2E64 A;  3OYB A;  5GAM d;  1VQ5 A;  1VQP A;  1LJO A;  3TU4 K;  3SWN A;  1JBM A;  2P0K A;  4HA8 A;  1VQ8 A;  2M9U A;  3KUF A;  4BY6 C;  4D6W A;  3L2R A;  4JS5 A;  1U8R A;  5CCA A;  3MO8 A;  4II1 A;  4J6Y A;  1X01 A;  4M78 G;  4IKF A;  1VQL A;  3MP1 A;  1M9S A;  4FIB A;  2K2V A;  4J6W A;  3CCS T;  3RMS A;  5KE2 A;  2DIG A;  5LJ5 g;  5LJ5 h;  1VIE A;  3QZ5 B;  4A4G A;  5GAO q;  4IUR A;  1I5L A;  1KQS A;  4N0A C;  2ZZD A;  2IG0 A;  3OY9 A;  1BIB A;  3JCM d;  3NTI A;  3CCU T;  2BUD A;  4J7I A;  5FLX E;  1XTD A;  1FWZ A;  1M90 U;  5CO7 A;  3OA6 A;  3G4S T;  4BE0 A;  3UPU A;  4X9C A;  2JNG A;  4OMF B;  3HRS A;  3A8G B;  2RHX A;  3VU3 C;  5KCO A;  3G4S A;  2CGH A;  2CZ6 B;  1M1K U;  1VQL T;  2OTL A;  5A2Q E;  4PJO G;  3E9F A;  1VQ9 T;  2QTX A;  2RI2 A;  2ZCF B;  3OYY A;  4OB1 B;  4ZGE B;  5A0D A;  5GAN 4;  3OMC A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...