2P0TA

Structural genomics, the crystal structure of a conserved putative protein from pseudomonas syringae pv. tomato str. dc3000
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
148
structure length
148
Chain Sequence
LHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHTANIARKRHILFIGKLMRDQDQEAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQAQHEVARNKPPATSRKIFKYIRELDELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0307 protein PSPTO_4464
publication title The crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 62
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04751 DUF615 Protein of unknown function (DUF615)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.30 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 PSPTO4464-like domains 2p0tA01
1.10.60.30 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 PSPTO4464-like domains 2p0tA02
2P0TA
chains in the Genus database with same CATH superfamily
3GLXA 5FLXR 1BI3A 1BI1A 3R61A 4O5VA 3JAMR 1G3SA 1BI2A 2EV0A 1FX7A 1XCVA 3J81R 3A52A 4HV6A 2F5CA 2QQAA 2ISZA 1C0WA 1G3WA 2F5FA 4HX8A 2F5EA 1BI0A 1U8RA 2QQBA 2TDXA 2QQ9A 4HX7A 1RQ6A 4HV5A 1F5TA 1DPRA 5IT9R 1ON1A 2EV6A 3J80R 2F5DA 2MVTA 1G3YA 1P92A 2M35A 2P0TA 2X98A 1G3TA 2DTRA 2H09A 1FWZA 3R60A 4O6JA 3J7AW 1ON2A 5A2QR 1B1BA 2HYFA 2MUNA 2HYGD 4HX4A 1DDNA 2MZ4A 2EV5A
chains in the Genus database with same CATH topology
2P0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0T A; 
#chains in the Genus database with same CATH topology
 3GLX A;  5FLX R;  1BI3 A;  1BI1 A;  3R61 A;  4O5V A;  3JAM R;  1G3S A;  1BI2 A;  2EV0 A;  1FX7 A;  1XCV A;  3J81 R;  3A52 A;  4HV6 A;  2F5C A;  2QQA A;  2ISZ A;  1C0W A;  1G3W A;  2F5F A;  4HX8 A;  2F5E A;  1BI0 A;  1U8R A;  2QQB A;  2TDX A;  2QQ9 A;  4HX7 A;  1RQ6 A;  4HV5 A;  1F5T A;  1DPR A;  5IT9 R;  1ON1 A;  2EV6 A;  3J80 R;  2F5D A;  2MVT A;  1G3Y A;  1P92 A;  2M35 A;  2P0T A;  2X98 A;  1G3T A;  2DTR A;  2H09 A;  1FWZ A;  3R60 A;  4O6J A;  3J7A W;  1ON2 A;  5A2Q R;  1B1B A;  2HYF A;  2MUN A;  2HYG D;  4HX4 A;  1DDN A;  2MZ4 A;  2EV5 A; 
#chains in the Genus database with same CATH homology
 2P0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...