2P0TA

Structural genomics, the crystal structure of a conserved putative protein from pseudomonas syringae pv. tomato str. dc3000
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
148
structure length
148
Chain Sequence
LHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHTANIARKRHILFIGKLMRDQDQEAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQAQHEVARNKPPATSRKIFKYIRELDELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
molecule keywords UPF0307 protein PSPTO_4464
total genus 62
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04751 DUF615 Protein of unknown function (DUF615)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.30 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 PSPTO4464-like domains 2p0tA01
1.10.60.30 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 PSPTO4464-like domains 2p0tA02
2P0TA
chains in the Genus database with same CATH superfamily
5IT9R 3A52A 1RQ6A 1G3YA 2EV5A 5FLXR 2QQBA 2HYFA 1BI3A 4O6JA 1C0WA 5A2QR 1BI0A 1G3TA 2F5DA 2H09A 3GLXA 4O5VA 1DDNA 2F5FA 3JAMR 2TDXA 1P92A 4HV5A 1FWZA 3J80R 1B1BA 2MUNA 4HX7A 2EV0A 1ON1A 2F5EA 4HX8A 1U8RA 3J81R 2ISZA 2EV6A 4HX4A 4HV6A 2P0TA 2X98A 3R60A 2F5CA 1DPRA 3R61A 2MVTA 2QQ9A 3J7AW 2DTRA 1BI2A 1G3WA 2MZ4A 1BI1A 1ON2A 2HYGD 1F5TA 1FX7A 2M35A 2QQAA 1G3SA 1XCVA
chains in the Genus database with same CATH topology
2P0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0T A; 
#chains in the Genus database with same CATH topology
 5IT9 R;  3A52 A;  1RQ6 A;  1G3Y A;  2EV5 A;  5FLX R;  2QQB A;  2HYF A;  1BI3 A;  4O6J A;  1C0W A;  5A2Q R;  1BI0 A;  1G3T A;  2F5D A;  2H09 A;  3GLX A;  4O5V A;  1DDN A;  2F5F A;  3JAM R;  2TDX A;  1P92 A;  4HV5 A;  1FWZ A;  3J80 R;  1B1B A;  2MUN A;  4HX7 A;  2EV0 A;  1ON1 A;  2F5E A;  4HX8 A;  1U8R A;  3J81 R;  2ISZ A;  2EV6 A;  4HX4 A;  4HV6 A;  2P0T A;  2X98 A;  3R60 A;  2F5C A;  1DPR A;  3R61 A;  2MVT A;  2QQ9 A;  3J7A W;  2DTR A;  1BI2 A;  1G3W A;  2MZ4 A;  1BI1 A;  1ON2 A;  2HYG D;  1F5T A;  1FX7 A;  2M35 A;  2QQA A;  1G3S A;  1XCV A; 
#chains in the Genus database with same CATH homology
 2P0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...