2P0XA

Solution structure of a non-biological atp-binding protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSFRVKPCVVCKVAPRDWRVKNRHLRIYNMCKTCFNNSIKSGDDTYHGHVDWLMYTDAKEFSST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords abiotic ATP-binding, folding optimized protein
publication title Structure and Evolutionary Analysis of a Non-biological ATP-binding Protein
pubmed doi rcsb
source organism Synthetic gene
molecule tags De novo protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p0xA01
3LT8A 3LTAA 3DGLA 3LTCA 3LTDA 1UW1A 2P0XA 2P05A 2P09A 3DGOA 3LT9A 3DGNA 3LTBA 3DGMA
chains in the Genus database with same CATH superfamily
3G16A 4AEQA 2QEX3 1IYYA 4QWTA 3MG2A 4K1VA 1TUHA 2XR8B 3UJMA 3RGRA 3SX1A 5IERA 3KZTA 3EBTA 5D82A 5IW9A 1F8NA 4I4KA 3D4AA 1Q42A 1BVIA 1JN5A 3EQQB 1I2GA 1QAFA 1ZX2A 1YNVX 1RN4A 4AKZA 4IPBA 3S29A 3CPW2 1W00A 2BMRB 3U97A 3UL5A 2OQEA 1B2ZA 1FGTA 3LZAA 1IVXA 1I8VA 3B4OA 2R4IA 1IV7A 3KFQC 1BNSA 1BGSA 3KE7A 3SOYA 4CCVA 3NV0B 1JKGB 3HX8A 4O8SA 1BAOA 1UGHI 4RBNA 5KP3A 1W7CA 2WO0A 1DYUA 1RN1A 2D1WA 5JBSA 1UI7A 1OH0A 1I0VA 1W02A 2CIUA 3X40A 1K734 1LXEA 3EHCA 1IU7A 2BNGA 2AAEA 3CME3 1BSAA 1TFKA 1CQSA 3DGNA 3HK4A 3SEDA 3CCU3 3K5TA 3G713 3A5EA 2FGTA 2Y73A 3HOHA 3LH4A 1OHSA 1L5GB 4FMBA 4HOHA 3RGAA 1RMSA 5HGRA 1Q814 3NHXA 5M19A 1SARA 2ZDJA 3AHSA 4GL6A 5EQLA 3EN1B 1JB2A 4HM5B 3I563 1RTUA 1KD14 4U13A 1FUWA 3WR2A 3F7SA 1E3VA 1BNJA 5CF2A 1OGXA 3MKIA 1IT8A 1TFOA 2CG1A 1IDPA 1UCIA 2P05A 4OUQA 3FG4A 4J8TA 5STDA 4TX4A 2CFDA 2A15A 3PXMA 4EV2A 3DGMA 4KFDA 2OOVC 3OW22 1QAKA 2BT3A 1MNLA 1BRGA 1BIRA 1YVBI 3QRDA 1YGWA 4R9KA 1DVCA 3UB1A 1JB4A 7STDA 1DVDA 5GSPA 2UX0A 4MMZB 3WMDA 1QMAA 3RDEA 1AV4A 2E2VA 1SIHA 4WYKA 4NREA 1U5OA 1GYBA 3DM8A 2CX1A 4X2OA 1VQL3 1YVSA 4GB5A 1LNHA 2STDA 2C4BA 2W56B 5LC6A 2MC8A 1EG9B 3Q90A 1V57A 1RNBA 1O7HB 1WMOA 3G0KA 1O7WB 3FCSB 2GU1A 6RNTA 1A2KA 1T5YA 3FH1A 2K3DA 3QK9A 5I97A 1NJI4 5IENA 3NQYA 2HMMB 1FGRA 3PYJA 1IQXA 1FUTA 1T2IA 1UI8A 1B2MA 2JDIH 1NU3A 4HVNA 1RGHA 1A2PA 1RGKA 1W6GA 4MJDA 3AGOA 5IG5A 3STDA 3X3YA 3DH2A 1VQM3 3AMOB 1LNIA 2CKFB 3VGNA 1LRAA 1J2BA 2CH9A 3SYUA 2OWPA 1WMNA 4LEHA 3GAXA 2JQ5A 3D9RA 2D42A 2Z76A 1QVF2 1S5AA 3ECFA 3F9SA 2HMOB 1RCLA 2QIYA 4IIAA 4KFFA 3CMA3 1ULIB 1I3FA 3IJEB 2F5MA 1OHPA 3J7Yd 1CH0A 2UGIA 6GSPA 2KF5A 2IA7A 2W03A 1I3IA 2XSHB 1G96A 3IPTA 3IMAB 4R9LA 1IQ8A 1BSEA 2CWUA 4N6MA 1EA2A 3KSPA 3NM2A 3F14A 4XDWA 2CFWA 1YIT3 5AYSC 2OTL3 1FYSA 4WWUC 3MPHA 1Q9EA 1BRNL 1D6UA 3DUKA 3V98A 2F56A 2P09A 2BMQB 1ZS7A 5HOHA 2Z7AA 4FR9A 3Q1CA 1E3RA 3DY5A 1UCLA 1IVUA 4H61A 1CEWI 2CWTA 3E99A 2RGQA 4BTWA 3KCHA 4ORLA 1HU9A 1VQ73 2CFKA 2YX9A 1I0XA 3FGYA 3NUVA 1STFI 3D5IA 5IEPA 1HZ1A 3ZG0A 5ELUA 1FGOA 3GRDA 2ZHXB 4FMDA 1FW7A 1BANA 3GWRA 1M904 1PY3A 1D6YA 1FZUA 3EJVA 2E2TA 1M1K4 3BLZA 1GMQA 3UNLA 1CYVA 3MG1A 3MYTA 5D83A 4ILFA 3MSOA 3SOAA 4K61A 3UL6A 3FG3A 4X2HA 2H0IA 3JUNA 1BRJA 2KRTA 5EEOA 1W2B2 5DRVA 5G1LA 1B20A 1YGEA 3WOEB 1RGCA 2UUGC 4CDLA 3WODG 4WP5A 1YJ93 5BVBA 2KCDA 1VQK3 1UCJA 3U1WA 1QALA 1DMNA 2Y74A 3CC73 4KFEA 2XFSA 5CF1A 1IK3A 1QJGA 3OWSA 5BU4A 3T8NA 1LQMB 3CNMA 1OUNA 5CK6A 3WOFB 1DE3A 1TU5A 3EBYA 3X3ZA 4RNYA 1OHOA 1OPYA 2RSXA 3F8XA 4HM4B 3SLUA 3CCL3 5CLKA 1SJWA 2W2CA 1Q7Y4 3BB9A 2QGUA 1ULJB 1G02A 3JUPA 4JF8A 3F7XA 4RZMA 4HM7B 3LTBA 3F8HA 5ELJA 1BUJA 1VQ83 1JB5A 1BNFA 2BMOB 3DMCA 3CC43 2F86B 4PEJA 4R80A 4IT7A 1GY6A 4FCZA 3URPA 4L8PA 2WGQA 4LMIA 1FGMA 1W2ZA 2GBWB 4FMAA 4BIRA 3LT8A 1LOXA 2ZL8A 1ASKA 1N9JA 4BL3A 1AY7A 1JBRA 4XM4A 3ROBA 4CJNA 1N5HA 2XEPA 4JRFA 2RNTA 3AHWA 4J5KA 4K90B 2M7OA 4N6LA 3GZYB 3V99A 1MWSA 1FA3A 1OF5A 1KSIA 1ZO2A 3GZRA 3CCS3 4EC6A 3T0UA 2XF3A 2LYXA 1Q40B 4RNZA 3B8LA 4EW5A 4GSPA 1RKYA 3RNTA 3CD63 3KN4A 1GOVA 1EEJA 3EX9A 5D81A 2BU4A 5G2GA 3DGYA 4MMXB 1KWIA 3FF0A 4LSOA 4XDVA 2OOVA 3S67A 1CYUA 1WMPA 2IMJA 1U8CB 2Q07A 9RNTA 1C7HA 2KF4A 1YJW3 4N6UA 3NV0A 1JKGA 3LTAA 3MWZA 2K54A 3H3HA 2IUJA 2SBLA 2C11A 1GY5A 3FG1A 4BTXA 3EF8A 2CFGA 3N9HA 4O3VA 3LYGA 2WGOA 2P38A 3ZG5A 1W4NA 1N8R4 1EUIC 2CK3H 2W9QA 3CCQ3 3B7CA 3VF1A 5AIIA 1NB3I 3DXOA 3FKAA 3HIIA 3CCR3 1UUWB 4O02B 1BUQA 2ML6A 1JBSA 3PCRA 2C10A 1LOYA 3BU4A 1EKMA 3NBRA 2YFLB 3K9MC 1RGGA 1B27A 6STDA 4L7KA 1TRQA 2I9WA 4HJLB 1TJDA 2RCDA 1V74A 1MWUA 1GS3A 3JUMA 1O7GB 3CNXA 1BSCA 1X1WA 1W01A 3DGOA 3WDGB 3WA2X 2PNCA 2SARA 3DZLA 3SXXA 4NHFA 1B2XA 1JN5B 1FGQA 1W6YA 3K7CA 1O7MB 2GEYA 1AR0A 2W9PA 4XBYA 1MGRA 2F4YA 2BHMA 1VQ43 2KAAA 4FCMA 1K8A4 2O3OA 3BNEA 3HZPA 2RFRA 5A0OB 1B21A 1A67A 2F5WA 3FF2A 2CFLA 4DKIA 1GY7A 1OGZA 3D3LA 1VQN3 1LVNA 8RNTA 1JZOA 1C54A 1K9M4 4N3VA 1RGLA 1Y4KA 3CPOA 5AIGA 1YIJ3 1MGWA 3LOYA 3V92A 2W56A 1M9GA 3CCV3 1Q7HA 2R41A 2GBXB 1DMMA 2OCTA 3BNDA 3NBJA 3ER7A 2BO9B 4I5QA 1QVG2 1N9EA 1X1XA 1BOXA 1D6ZA 1ZGXA 2H0GA 1V58A 4HM1B 1GD3A 1W5ZA 2GSPA 4HM3B 1PYLA 3CU3A 1RHLA 1AVKA 1I70A 1GOUA 1TP6A 3OX9A 2FNQA 4AKYA 5IG3A 1RGAA 1YI23 4Q53A 1I2FA 3FLJA 3EE1A 4HZ9B 3LT9A 4G1MB 2HMLB 1AVLA 1Q864 3FZWA 1BU4A 4L8OA 3S5CA 3AMOA 2K0MA 1MWTA 2LQVA 1B2UA 1M1XB 1ROAA 3A76A 3H51A 2L1SA 3LXUX 3EN8A 2Z6BA 1NWWA 3D5GA 1NNVA 2OQEC 1BNIA 1OCVA 4CPKA 3JUOA 5JPPA 1BNGA 2XGNA 4K1UA 5KP1A 3CCJ3 4MEIA 3BIRA 3HI7A 5TGNA 4LGQA 1UW1A 4HAAA 2IUKA 3VSYA 1GMPA 2F99A 3M8CA 1O7NB 4EYCA 2L4VA 2FXTA 4WYKB 4KVHA 2KF6A 4EV5A 1K28A 1I2EA 2WOHA 1VQ53 3OV4A 2CG0A 3WA3A 4H3UA 1WTHA 5M1AA 4N6V0 1KC84 1A90A 5BXQA 3TDGA 5RNTA 2F98A 4WFOA 1SQWA 1GMRA 1PFPA 1W6CA 2IYJA 4HM2B 3T8UA 1BNEA 3GSPA 5AIHA 7GSPA 2CW9A 5KP4A 1BRIA 1TRPA 2ML5A 1LOVA 1RDSA 3OWYA 1SPUA 1RJOA 1TTOA 4R4KA 1IV9A 2GU3A 5FGOA 2W0QA 1ROVA 1X1UA 3LTCA 1PU4A 1HKXA 1UDII 3HIGA 5AI1A 4KZ1A 3PS8A 2WOFA 1N5PA 1OF5B 1WNHA 1A2VA 3N54B 4HKVB 3I0YA 3CC23 4WHAA 1RLSA 1VQQA 1BSBA 1NB5I 2PZVA 4XBTA 5LC7A 5G1KA 4HYZA 2B1XB 2YFIB 1TIJA 3PCSA 3X41A 5FW5A 3GZXB 2HMNB 3OWUA 4OVMA 1GSPA 2O9UX 1BRKA 1G0TA 5CXOA 3X42A 4EBGA 1VQ93 1YJN3 1T2HA 3CCE3 3I553 2OTJ3 4NPBA 1JBTA 1MOLA 4OK0A 2BIRA 1GOYA 3K0ZA 1BRSA 2MF7A 1B2SA 2V1LA 3OXAA 3ZFZA 1JJ22 1UGIA 2XSOB 4XBXA 8CHOA 3G6E3 3WHOA 3JVCA 5IG4A 3G8ZA 1JV2B 4BL2A 1YHQ3 1X1YA 1N8QA 3CCM3 2CWVA 4HZBB 1STDA 1UUVB 5DREA 2RBIA 1B3SA 3NXJA 5AYRB 1AQZA 2HMJB 2E2UA 2J8XB 1JZDA 3GZBA 1OACA 3SVAA 2QA43 1BSDA 4HM8B 2ZA4A 1BNRA 1RGEA 4HBRA 4HM6B 3N8BA 3BNBA 3DGLA 3X3XA 1K41A 3F40A 1Q824 3NBBA 1HYFA 3NM7A 3FSDA 1GD4A 4EXRA 4MMYB 5IG0A 2INXA 2B24B 1RCKA 1SIIA 2Z77A 4XB5A 1LQGC 3KIIA 1IT7A 1DETA 3CXC2 1VQO3 3PZWA 1BRHA 2P0XA 1VZZA 4N6OB 1EQKA 1ISKA 3O8YA 1WQLB 1Z1SA 1DMQA 5EVHA 3MG3A 3EB8A 1UCKA 2XFTA 4N6NB 1RN7A 1VQP3 2XRXB 1MWRA 4ZM8A 3PGBA 3L0RA 3KSED 4LYLB 3EC9A 4BTYA 2CX0A 3LTDA 1T3BA 3ALAA 4J9AA 1O7PB 1Q40A 5IEOA 5M18A 1NDOB 4J5GA 3MHEA 3NQZA 7RNTA 3Q2PA 1E97A 3AGNA 2XGLA 1JRQA 5AIFA 1RSNA 2HMKB 2CHCA 2W04A 1UUGB 1RRLA 2AADA 4HM0B 2H0HA 3BNCA 5AEUB 3JUQA 3LMLA 5IF6A 1RRHA 1LOWA 2P0MA 3KKGA 3NX0A 3Q3FA 4N6TA 4LZIA 3K63A 5JPUA 2IY2A 3D79A 1R4YA 2W6JH 2HOHA 3B4PA 3S28A 4RNTA 4BU4A 1IVVA 1US1A 4GHOA 1JNQA 4KT3B 1KQS2 1FUSA 2CC3A 1R4CA 2KXGA 1IVWA 4O2HA 4STDA 4R1KA 3S27A 2GEXA 4FMCA 1IQYA 5AEWB 3G4S3 2XH9A 1RGFA 4FCJA 1S723 2YFJB 2KF3A 1VQ63 1NO3A 1RNTA 2GXFA 5BIRA
chains in the Genus database with same CATH topology
3G16A 4AEQA 2QEX3 4QWTA 3MG2A 4K1VA 1TUHA 2XR8B 3UJMA 3RGRA 3SX1A 5IERA 3KZTA 3EBTA 5D82A 5IW9A 1F8NA 4I4KA 1Q42A 1JN5A 3EQQB 1ZX2A 1QAFA 4AKZA 4IPBA 3S29A 3CPW2 1W00A 2BMRB 3U97A 3UL5A 2OQEA 1FGTA 3LZAA 1IVXA 3B4OA 3KFQC 2R4IA 1IV7A 3KE7A 3SOYA 4CCVA 3NV0B 1JKGB 3HX8A 4O8SA 4RBNA 5KP3A 1W7CA 2WO0A 1DYUA 2D1WA 5JBSA 1UI7A 1OH0A 1W02A 2CIUA 3X40A 1K734 1LXEA 3EHCA 1IU7A 2BNGA 3CME3 1TFKA 1CQSA 3DGNA 3HK4A 3SEDA 3CCU3 3K5TA 3G713 2FGTA 2Y73A 3LH4A 1OHSA 1L5GB 4FMBA 3RGAA 5HGRA 1Q814 3NHXA 2ZDJA 4GL6A 5EQLA 3EN1B 1JB2A 4HM5B 3I563 1KD14 4U13A 1FUWA 3F7SA 1E3VA 5CF2A 1OGXA 3MKIA 1IT8A 1TFOA 2CG1A 1IDPA 4OUQA 2P05A 3FG4A 4J8TA 5STDA 4TX4A 2CFDA 2A15A 3PXMA 4EV2A 3DGMA 4KFDA 2OOVC 3OW22 1QAKA 2BT3A 1MNLA 3QRDA 1YVBI 4R9KA 1DVCA 3UB1A 1JB4A 7STDA 1DVDA 2UX0A 4MMZB 3WMDA 1QMAA 3RDEA 1AV4A 2E2VA 1SIHA 4WYKA 4NREA 1U5OA 1GYBA 3DM8A 4X2OA 1VQL3 4GB5A 2W56B 1LNHA 2STDA 5LC6A 2MC8A 1EG9B 3Q90A 1O7HB 1WMOA 3G0KA 1O7WB 3FCSB 2GU1A 1A2KA 1T5YA 3FH1A 3QK9A 5I97A 1NJI4 5IENA 3NQYA 2HMMB 1FGRA 3PYJA 1IQXA 1UI8A 2JDIH 1NU3A 4HVNA 1W6GA 4MJDA 5IG5A 3STDA 3X3YA 1VQM3 3AMOB 3VGNA 2CKFB 1J2BA 2CH9A 2OWPA 1WMNA 4LEHA 3GAXA 2JQ5A 3D9RA 2D42A 2Z76A 1QVF2 1S5AA 3ECFA 3F9SA 2HMOB 2QIYA 4KFFA 4IIAA 3CMA3 1ULIB 3IJEB 1OHPA 3J7Yd 2IA7A 2W03A 2XSHB 3IPTA 1G96A 3IMAB 4R9LA 1IQ8A 2CWUA 4N6MA 1EA2A 3KSPA 3NM2A 3F14A 4XDWA 2CFWA 1YIT3 5AYSC 2OTL3 4WWUC 3MPHA 1D6UA 3DUKA 3V98A 2P09A 2BMQB 2Z7AA 4FR9A 3Q1CA 1E3RA 3DY5A 1IVUA 4H61A 1CEWI 2CWTA 3E99A 2RGQA 4BTWA 4ORLA 1HU9A 1VQ73 2CFKA 2YX9A 3FGYA 3NUVA 1STFI 5IEPA 5ELUA 1FGOA 3GRDA 4FMDA 3GWRA 1M904 1D6YA 3EJVA 2E2TA 1M1K4 3BLZA 3UNLA 1CYVA 3MG1A 3MYTA 5D83A 3MSOA 3SOAA 4K61A 3UL6A 3FG3A 4X2HA 3JUNA 2KRTA 5EEOA 1W2B2 5DRVA 1YGEA 3WOEB 4CDLA 3WODG 4WP5A 1YJ93 5BVBA 2KCDA 1VQK3 3U1WA 1QALA 1DMNA 2Y74A 3CC73 4KFEA 2XFSA 5CF1A 1IK3A 1QJGA 3OWSA 3T8NA 3CNMA 1OUNA 5CK6A 3WOFB 1TU5A 3EBYA 3X3ZA 4RNYA 1OHOA 1OPYA 2RSXA 3F8XA 4HM4B 3SLUA 3CCL3 5CLKA 1SJWA 2W2CA 1Q7Y4 3BB9A 2QGUA 1ULJB 3JUPA 4JF8A 4RZMA 3F7XA 5ELJA 4HM7B 3LTBA 3F8HA 1VQ83 1JB5A 3DMCA 2BMOB 3CC43 2F86B 4PEJA 4R80A 4IT7A 1GY6A 4FCZA 4L8PA 2WGQA 4LMIA 1FGMA 1W2ZA 2GBWB 4FMAA 3LT8A 1LOXA 2ZL8A 1ASKA 1N9JA 4XM4A 3ROBA 1N5HA 2XEPA 4JRFA 4K90B 4N6LA 2M7OA 3GZYB 3V99A 1FA3A 1OF5A 1KSIA 1ZO2A 3GZRA 3CCS3 4EC6A 3T0UA 2XF3A 2LYXA 1Q40B 4RNZA 3B8LA 1RKYA 3CD63 3KN4A 3EX9A 5D81A 5G2GA 4MMXB 1KWIA 3FF0A 4LSOA 4XDVA 2OOVA 3S67A 1CYUA 1WMPA 2IMJA 1U8CB 2Q07A 1C7HA 1YJW3 4N6UA 3NV0A 1JKGA 3LTAA 3MWZA 2K54A 3H3HA 2IUJA 2SBLA 2C11A 1GY5A 3FG1A 4BTXA 3EF8A 2CFGA 3N9HA 4O3VA 3LYGA 2WGOA 2P38A 1N8R4 1W4NA 2CK3H 2W9QA 3CCQ3 3B7CA 3VF1A 5AIIA 1NB3I 3DXOA 3FKAA 3HIIA 3CCR3 1UUWB 4O02B 1BUQA 2ML6A 3PCRA 2C10A 1EKMA 3NBRA 2YFLB 3K9MC 6STDA 4L7KA 2I9WA 4HJLB 2RCDA 1V74A 1GS3A 3JUMA 1O7GB 3CNXA 1W01A 3DGOA 3WDGB 3WA2X 2PNCA 3DZLA 3SXXA 4NHFA 1JN5B 1FGQA 1W6YA 3K7CA 1O7MB 2GEYA 1AR0A 2W9PA 4XBYA 2BHMA 1VQ43 4FCMA 1K8A4 2O3OA 3BNEA 3HZPA 2RFRA 5A0OB 1A67A 3FF2A 2CFLA 1GY7A 1OGZA 3D3LA 1VQN3 1LVNA 1K9M4 4N3VA 1Y4KA 3CPOA 5AIGA 1YIJ3 3LOYA 3V92A 2W56A 1M9GA 3CCV3 2GBXB 1DMMA 2OCTA 3BNDA 3NBJA 3ER7A 2BO9B 1QVG2 1N9EA 1D6ZA 4HM1B 1GD3A 1W5ZA 4HM3B 3CU3A 3OX9A 1AVKA 1TP6A 5IG3A 1YI23 4AKYA 4Q53A 4HZ9B 3FLJA 3EE1A 3LT9A 4G1MB 2HMLB 1AVLA 1Q864 3FZWA 4L8OA 3S5CA 3AMOA 3A76A 2K0MA 2LQVA 3LXUX 1M1XB 1ROAA 3H51A 3EN8A 2Z6BA 1NWWA 2OQEC 1OCVA 3JUOA 5JPPA 2XGNA 5KP1A 4K1UA 3CCJ3 4MEIA 3HI7A 5TGNA 4LGQA 1UW1A 2IUKA 3VSYA 2F99A 3M8CA 4EYCA 1O7NB 2L4VA 2FXTA 4WYKB 4KVHA 4EV5A 1K28A 1VQ53 2WOHA 3OV4A 2CG0A 3WA3A 4H3UA 1WTHA 1A90A 4N6V0 1KC84 5BXQA 3TDGA 2F98A 4WFOA 1SQWA 1PFPA 1W6CA 4HM2B 3T8UA 5AIHA 5KP4A 2CW9A 2ML5A 3OWYA 1SPUA 1RJOA 4R4KA 2GU3A 1IV9A 5FGOA 2W0QA 1ROVA 3LTCA 1PU4A 1HKXA 3HIGA 5AI1A 4KZ1A 3PS8A 2WOFA 1N5PA 1OF5B 1WNHA 1A2VA 3N54B 4HKVB 3I0YA 3CC23 4WHAA 1NB5I 2PZVA 4XBTA 5LC7A 4HYZA 2B1XB 2YFIB 1TIJA 3PCSA 3X41A 5FW5A 3GZXB 2HMNB 3OWUA 4OVMA 2O9UX 5CXOA 3X42A 4EBGA 1VQ93 1YJN3 3CCE3 3I553 2OTJ3 1MOLA 4OK0A 3K0ZA 2MF7A 2V1LA 3OXAA 1JJ22 2XSOB 4XBXA 8CHOA 3G6E3 3JVCA 5IG4A 3G8ZA 1JV2B 1YHQ3 1N8QA 3CCM3 2CWVA 4HZBB 1STDA 1UUVB 5DREA 3NXJA 5AYRB 2HMJB 2E2UA 3GZBA 1OACA 3SVAA 2QA43 4HM8B 4HBRA 4HM6B 3N8BA 3BNBA 3DGLA 3X3XA 1K41A 3F40A 1Q824 3NBBA 3NM7A 3FSDA 1GD4A 4EXRA 4MMYB 5IG0A 2INXA 2B24B 1SIIA 2Z77A 4XB5A 3KIIA 1IT7A 3CXC2 1VQO3 3PZWA 2P0XA 1VZZA 4N6OB 1EQKA 1ISKA 3O8YA 1WQLB 1Z1SA 1DMQA 5EVHA 3MG3A 3EB8A 2XFTA 4N6NB 1RN7A 1VQP3 2XRXB 4ZM8A 3PGBA 3L0RA 3KSED 3EC9A 4BTYA 3LTDA 3ALAA 4J9AA 1O7PB 1Q40A 5IEOA 1NDOB 3MHEA 3NQZA 3Q2PA 1E97A 2XGLA 1JRQA 5AIFA 2HMKB 2CHCA 2W04A 1RRLA 5AEUB 4HM0B 3BNCA 3JUQA 3LMLA 5IF6A 1RRHA 2P0MA 3KKGA 3NX0A 4N6TA 4LZIA 3K63A 5JPUA 2W6JH 3B4PA 3S28A 1IVVA 1US1A 1KQS2 1JNQA 2CC3A 1R4CA 2KXGA 1IVWA 4O2HA 4STDA 4R1KA 3S27A 2GEXA 4FMCA 1IQYA 5AEWB 3G4S3 2XH9A 4FCJA 1S723 1VQ63 2YFJB 1NO3A 2FNQA 2GXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT8 A;  3LTA A;  3DGL A;  3LTC A;  3LTD A;  1UW1 A;  2P0X A;  2P05 A;  2P09 A;  3DGO A;  3LT9 A;  3DGN A;  3LTB A;  3DGM A; 
#chains in the Genus database with same CATH topology
 3G16 A;  4AEQ A;  2QEX 3;  1IYY A;  4QWT A;  3MG2 A;  4K1V A;  1TUH A;  2XR8 B;  3UJM A;  3RGR A;  3SX1 A;  5IER A;  3KZT A;  3EBT A;  5D82 A;  5IW9 A;  1F8N A;  4I4K A;  3D4A A;  1Q42 A;  1BVI A;  1JN5 A;  3EQQ B;  1I2G A;  1QAF A;  1ZX2 A;  1YNV X;  1RN4 A;  4AKZ A;  4IPB A;  3S29 A;  3CPW 2;  1W00 A;  2BMR B;  3U97 A;  3UL5 A;  2OQE A;  1B2Z A;  1FGT A;  3LZA A;  1IVX A;  1I8V A;  3B4O A;  2R4I A;  1IV7 A;  3KFQ C;  1BNS A;  1BGS A;  3KE7 A;  3SOY A;  4CCV A;  3NV0 B;  1JKG B;  3HX8 A;  4O8S A;  1BAO A;  1UGH I;  4RBN A;  5KP3 A;  1W7C A;  2WO0 A;  1DYU A;  1RN1 A;  2D1W A;  5JBS A;  1UI7 A;  1OH0 A;  1I0V A;  1W02 A;  2CIU A;  3X40 A;  1K73 4;  1LXE A;  3EHC A;  1IU7 A;  2BNG A;  2AAE A;  3CME 3;  1BSA A;  1TFK A;  1CQS A;  3DGN A;  3HK4 A;  3SED A;  3CCU 3;  3K5T A;  3G71 3;  3A5E A;  2FGT A;  2Y73 A;  3HOH A;  3LH4 A;  1OHS A;  1L5G B;  4FMB A;  4HOH A;  3RGA A;  1RMS A;  5HGR A;  1Q81 4;  3NHX A;  5M19 A;  1SAR A;  2ZDJ A;  3AHS A;  4GL6 A;  5EQL A;  3EN1 B;  1JB2 A;  4HM5 B;  3I56 3;  1RTU A;  1KD1 4;  4U13 A;  1FUW A;  3WR2 A;  3F7S A;  1E3V A;  1BNJ A;  5CF2 A;  1OGX A;  3MKI A;  1IT8 A;  1TFO A;  2CG1 A;  1IDP A;  1UCI A;  2P05 A;  4OUQ A;  3FG4 A;  4J8T A;  5STD A;  4TX4 A;  2CFD A;  2A15 A;  3PXM A;  4EV2 A;  3DGM A;  4KFD A;  2OOV C;  3OW2 2;  1QAK A;  2BT3 A;  1MNL A;  1BRG A;  1BIR A;  1YVB I;  3QRD A;  1YGW A;  4R9K A;  1DVC A;  3UB1 A;  1JB4 A;  7STD A;  1DVD A;  5GSP A;  2UX0 A;  4MMZ B;  3WMD A;  1QMA A;  3RDE A;  1AV4 A;  2E2V A;  1SIH A;  4WYK A;  4NRE A;  1U5O A;  1GYB A;  3DM8 A;  2CX1 A;  4X2O A;  1VQL 3;  1YVS A;  4GB5 A;  1LNH A;  2STD A;  2C4B A;  2W56 B;  5LC6 A;  2MC8 A;  1EG9 B;  3Q90 A;  1V57 A;  1RNB A;  1O7H B;  1WMO A;  3G0K A;  1O7W B;  3FCS B;  2GU1 A;  6RNT A;  1A2K A;  1T5Y A;  3FH1 A;  2K3D A;  3QK9 A;  5I97 A;  1NJI 4;  5IEN A;  3NQY A;  2HMM B;  1FGR A;  3PYJ A;  1IQX A;  1FUT A;  1T2I A;  1UI8 A;  1B2M A;  2JDI H;  1NU3 A;  4HVN A;  1RGH A;  1A2P A;  1RGK A;  1W6G A;  4MJD A;  3AGO A;  5IG5 A;  3STD A;  3X3Y A;  3DH2 A;  1VQM 3;  3AMO B;  1LNI A;  2CKF B;  3VGN A;  1LRA A;  1J2B A;  2CH9 A;  3SYU A;  2OWP A;  1WMN A;  4LEH A;  3GAX A;  2JQ5 A;  3D9R A;  2D42 A;  2Z76 A;  1QVF 2;  1S5A A;  3ECF A;  3F9S A;  2HMO B;  1RCL A;  2QIY A;  4IIA A;  4KFF A;  3CMA 3;  1ULI B;  1I3F A;  3IJE B;  2F5M A;  1OHP A;  3J7Y d;  1CH0 A;  2UGI A;  6GSP A;  2KF5 A;  2IA7 A;  2W03 A;  1I3I A;  2XSH B;  1G96 A;  3IPT A;  3IMA B;  4R9L A;  1IQ8 A;  1BSE A;  2CWU A;  4N6M A;  1EA2 A;  3KSP A;  3NM2 A;  3F14 A;  4XDW A;  2CFW A;  1YIT 3;  5AYS C;  2OTL 3;  1FYS A;  4WWU C;  3MPH A;  1Q9E A;  1BRN L;  1D6U A;  3DUK A;  3V98 A;  2F56 A;  2P09 A;  2BMQ B;  1ZS7 A;  5HOH A;  2Z7A A;  4FR9 A;  3Q1C A;  1E3R A;  3DY5 A;  1UCL A;  1IVU A;  4H61 A;  1CEW I;  2CWT A;  3E99 A;  2RGQ A;  4BTW A;  3KCH A;  4ORL A;  1HU9 A;  1VQ7 3;  2CFK A;  2YX9 A;  1I0X A;  3FGY A;  3NUV A;  1STF I;  3D5I A;  5IEP A;  1HZ1 A;  3ZG0 A;  5ELU A;  1FGO A;  3GRD A;  2ZHX B;  4FMD A;  1FW7 A;  1BAN A;  3GWR A;  1M90 4;  1PY3 A;  1D6Y A;  1FZU A;  3EJV A;  2E2T A;  1M1K 4;  3BLZ A;  1GMQ A;  3UNL A;  1CYV A;  3MG1 A;  3MYT A;  5D83 A;  4ILF A;  3MSO A;  3SOA A;  4K61 A;  3UL6 A;  3FG3 A;  4X2H A;  2H0I A;  3JUN A;  1BRJ A;  2KRT A;  5EEO A;  1W2B 2;  5DRV A;  5G1L A;  1B20 A;  1YGE A;  3WOE B;  1RGC A;  2UUG C;  4CDL A;  3WOD G;  4WP5 A;  1YJ9 3;  5BVB A;  2KCD A;  1VQK 3;  1UCJ A;  3U1W A;  1QAL A;  1DMN A;  2Y74 A;  3CC7 3;  4KFE A;  2XFS A;  5CF1 A;  1IK3 A;  1QJG A;  3OWS A;  5BU4 A;  3T8N A;  1LQM B;  3CNM A;  1OUN A;  5CK6 A;  3WOF B;  1DE3 A;  1TU5 A;  3EBY A;  3X3Z A;  4RNY A;  1OHO A;  1OPY A;  2RSX A;  3F8X A;  4HM4 B;  3SLU A;  3CCL 3;  5CLK A;  1SJW A;  2W2C A;  1Q7Y 4;  3BB9 A;  2QGU A;  1ULJ B;  1G02 A;  3JUP A;  4JF8 A;  3F7X A;  4RZM A;  4HM7 B;  3LTB A;  3F8H A;  5ELJ A;  1BUJ A;  1VQ8 3;  1JB5 A;  1BNF A;  2BMO B;  3DMC A;  3CC4 3;  2F86 B;  4PEJ A;  4R80 A;  4IT7 A;  1GY6 A;  4FCZ A;  3URP A;  4L8P A;  2WGQ A;  4LMI A;  1FGM A;  1W2Z A;  2GBW B;  4FMA A;  4BIR A;  3LT8 A;  1LOX A;  2ZL8 A;  1ASK A;  1N9J A;  4BL3 A;  1AY7 A;  1JBR A;  4XM4 A;  3ROB A;  4CJN A;  1N5H A;  2XEP A;  4JRF A;  2RNT A;  3AHW A;  4J5K A;  4K90 B;  2M7O A;  4N6L A;  3GZY B;  3V99 A;  1MWS A;  1FA3 A;  1OF5 A;  1KSI A;  1ZO2 A;  3GZR A;  3CCS 3;  4EC6 A;  3T0U A;  2XF3 A;  2LYX A;  1Q40 B;  4RNZ A;  3B8L A;  4EW5 A;  4GSP A;  1RKY A;  3RNT A;  3CD6 3;  3KN4 A;  1GOV A;  1EEJ A;  3EX9 A;  5D81 A;  2BU4 A;  5G2G A;  3DGY A;  4MMX B;  1KWI A;  3FF0 A;  4LSO A;  4XDV A;  2OOV A;  3S67 A;  1CYU A;  1WMP A;  2IMJ A;  1U8C B;  2Q07 A;  9RNT A;  1C7H A;  2KF4 A;  1YJW 3;  4N6U A;  3NV0 A;  1JKG A;  3LTA A;  3MWZ A;  2K54 A;  3H3H A;  2IUJ A;  2SBL A;  2C11 A;  1GY5 A;  3FG1 A;  4BTX A;  3EF8 A;  2CFG A;  3N9H A;  4O3V A;  3LYG A;  2WGO A;  2P38 A;  3ZG5 A;  1W4N A;  1N8R 4;  1EUI C;  2CK3 H;  2W9Q A;  3CCQ 3;  3B7C A;  3VF1 A;  5AII A;  1NB3 I;  3DXO A;  3FKA A;  3HII A;  3CCR 3;  1UUW B;  4O02 B;  1BUQ A;  2ML6 A;  1JBS A;  3PCR A;  2C10 A;  1LOY A;  3BU4 A;  1EKM A;  3NBR A;  2YFL B;  3K9M C;  1RGG A;  1B27 A;  6STD A;  4L7K A;  1TRQ A;  2I9W A;  4HJL B;  1TJD A;  2RCD A;  1V74 A;  1MWU A;  1GS3 A;  3JUM A;  1O7G B;  3CNX A;  1BSC A;  1X1W A;  1W01 A;  3DGO A;  3WDG B;  3WA2 X;  2PNC A;  2SAR A;  3DZL A;  3SXX A;  4NHF A;  1B2X A;  1JN5 B;  1FGQ A;  1W6Y A;  3K7C A;  1O7M B;  2GEY A;  1AR0 A;  2W9P A;  4XBY A;  1MGR A;  2F4Y A;  2BHM A;  1VQ4 3;  2KAA A;  4FCM A;  1K8A 4;  2O3O A;  3BNE A;  3HZP A;  2RFR A;  5A0O B;  1B21 A;  1A67 A;  2F5W A;  3FF2 A;  2CFL A;  4DKI A;  1GY7 A;  1OGZ A;  3D3L A;  1VQN 3;  1LVN A;  8RNT A;  1JZO A;  1C54 A;  1K9M 4;  4N3V A;  1RGL A;  1Y4K A;  3CPO A;  5AIG A;  1YIJ 3;  1MGW A;  3LOY A;  3V92 A;  2W56 A;  1M9G A;  3CCV 3;  1Q7H A;  2R41 A;  2GBX B;  1DMM A;  2OCT A;  3BND A;  3NBJ A;  3ER7 A;  2BO9 B;  4I5Q A;  1QVG 2;  1N9E A;  1X1X A;  1BOX A;  1D6Z A;  1ZGX A;  2H0G A;  1V58 A;  4HM1 B;  1GD3 A;  1W5Z A;  2GSP A;  4HM3 B;  1PYL A;  3CU3 A;  1RHL A;  1AVK A;  1I70 A;  1GOU A;  1TP6 A;  3OX9 A;  2FNQ A;  4AKY A;  5IG3 A;  1RGA A;  1YI2 3;  4Q53 A;  1I2F A;  3FLJ A;  3EE1 A;  4HZ9 B;  3LT9 A;  4G1M B;  2HML B;  1AVL A;  1Q86 4;  3FZW A;  1BU4 A;  4L8O A;  3S5C A;  3AMO A;  2K0M A;  1MWT A;  2LQV A;  1B2U A;  1M1X B;  1ROA A;  3A76 A;  3H51 A;  2L1S A;  3LXU X;  3EN8 A;  2Z6B A;  1NWW A;  3D5G A;  1NNV A;  2OQE C;  1BNI A;  1OCV A;  4CPK A;  3JUO A;  5JPP A;  1BNG A;  2XGN A;  4K1U A;  5KP1 A;  3CCJ 3;  4MEI A;  3BIR A;  3HI7 A;  5TGN A;  4LGQ A;  1UW1 A;  4HAA A;  2IUK A;  3VSY A;  1GMP A;  2F99 A;  3M8C A;  1O7N B;  4EYC A;  2L4V A;  2FXT A;  4WYK B;  4KVH A;  2KF6 A;  4EV5 A;  1K28 A;  1I2E A;  2WOH A;  1VQ5 3;  3OV4 A;  2CG0 A;  3WA3 A;  4H3U A;  1WTH A;  5M1A A;  4N6V 0;  1KC8 4;  1A90 A;  5BXQ A;  3TDG A;  5RNT A;  2F98 A;  4WFO A;  1SQW A;  1GMR A;  1PFP A;  1W6C A;  2IYJ A;  4HM2 B;  3T8U A;  1BNE A;  3GSP A;  5AIH A;  7GSP A;  2CW9 A;  5KP4 A;  1BRI A;  1TRP A;  2ML5 A;  1LOV A;  1RDS A;  3OWY A;  1SPU A;  1RJO A;  1TTO A;  4R4K A;  1IV9 A;  2GU3 A;  5FGO A;  2W0Q A;  1ROV A;  1X1U A;  3LTC A;  1PU4 A;  1HKX A;  1UDI I;  3HIG A;  5AI1 A;  4KZ1 A;  3PS8 A;  2WOF A;  1N5P A;  1OF5 B;  1WNH A;  1A2V A;  3N54 B;  4HKV B;  3I0Y A;  3CC2 3;  4WHA A;  1RLS A;  1VQQ A;  1BSB A;  1NB5 I;  2PZV A;  4XBT A;  5LC7 A;  5G1K A;  4HYZ A;  2B1X B;  2YFI B;  1TIJ A;  3PCS A;  3X41 A;  5FW5 A;  3GZX B;  2HMN B;  3OWU A;  4OVM A;  1GSP A;  2O9U X;  1BRK A;  1G0T A;  5CXO A;  3X42 A;  4EBG A;  1VQ9 3;  1YJN 3;  1T2H A;  3CCE 3;  3I55 3;  2OTJ 3;  4NPB A;  1JBT A;  1MOL A;  4OK0 A;  2BIR A;  1GOY A;  3K0Z A;  1BRS A;  2MF7 A;  1B2S A;  2V1L A;  3OXA A;  3ZFZ A;  1JJ2 2;  1UGI A;  2XSO B;  4XBX A;  8CHO A;  3G6E 3;  3WHO A;  3JVC A;  5IG4 A;  3G8Z A;  1JV2 B;  4BL2 A;  1YHQ 3;  1X1Y A;  1N8Q A;  3CCM 3;  2CWV A;  4HZB B;  1STD A;  1UUV B;  5DRE A;  2RBI A;  1B3S A;  3NXJ A;  5AYR B;  1AQZ A;  2HMJ B;  2E2U A;  2J8X B;  1JZD A;  3GZB A;  1OAC A;  3SVA A;  2QA4 3;  1BSD A;  4HM8 B;  2ZA4 A;  1BNR A;  1RGE A;  4HBR A;  4HM6 B;  3N8B A;  3BNB A;  3DGL A;  3X3X A;  1K41 A;  3F40 A;  1Q82 4;  3NBB A;  1HYF A;  3NM7 A;  3FSD A;  1GD4 A;  4EXR A;  4MMY B;  5IG0 A;  2INX A;  2B24 B;  1RCK A;  1SII A;  2Z77 A;  4XB5 A;  1LQG C;  3KII A;  1IT7 A;  1DET A;  3CXC 2;  1VQO 3;  3PZW A;  1BRH A;  2P0X A;  1VZZ A;  4N6O B;  1EQK A;  1ISK A;  3O8Y A;  1WQL B;  1Z1S A;  1DMQ A;  5EVH A;  3MG3 A;  3EB8 A;  1UCK A;  2XFT A;  4N6N B;  1RN7 A;  1VQP 3;  2XRX B;  1MWR A;  4ZM8 A;  3PGB A;  3L0R A;  3KSE D;  4LYL B;  3EC9 A;  4BTY A;  2CX0 A;  3LTD A;  1T3B A;  3ALA A;  4J9A A;  1O7P B;  1Q40 A;  5IEO A;  5M18 A;  1NDO B;  4J5G A;  3MHE A;  3NQZ A;  7RNT A;  3Q2P A;  1E97 A;  3AGN A;  2XGL A;  1JRQ A;  5AIF A;  1RSN A;  2HMK B;  2CHC A;  2W04 A;  1UUG B;  1RRL A;  2AAD A;  4HM0 B;  2H0H A;  3BNC A;  5AEU B;  3JUQ A;  3LML A;  5IF6 A;  1RRH A;  1LOW A;  2P0M A;  3KKG A;  3NX0 A;  3Q3F A;  4N6T A;  4LZI A;  3K63 A;  5JPU A;  2IY2 A;  3D79 A;  1R4Y A;  2W6J H;  2HOH A;  3B4P A;  3S28 A;  4RNT A;  4BU4 A;  1IVV A;  1US1 A;  4GHO A;  1JNQ A;  4KT3 B;  1KQS 2;  1FUS A;  2CC3 A;  1R4C A;  2KXG A;  1IVW A;  4O2H A;  4STD A;  4R1K A;  3S27 A;  2GEX A;  4FMC A;  1IQY A;  5AEW B;  3G4S 3;  2XH9 A;  1RGF A;  4FCJ A;  1S72 3;  2YFJ B;  2KF3 A;  1VQ6 3;  1NO3 A;  1RNT A;  2GXF A;  5BIR A; 
#chains in the Genus database with same CATH homology
 3G16 A;  4AEQ A;  2QEX 3;  4QWT A;  3MG2 A;  4K1V A;  1TUH A;  2XR8 B;  3UJM A;  3RGR A;  3SX1 A;  5IER A;  3KZT A;  3EBT A;  5D82 A;  5IW9 A;  1F8N A;  4I4K A;  1Q42 A;  1JN5 A;  3EQQ B;  1ZX2 A;  1QAF A;  4AKZ A;  4IPB A;  3S29 A;  3CPW 2;  1W00 A;  2BMR B;  3U97 A;  3UL5 A;  2OQE A;  1FGT A;  3LZA A;  1IVX A;  3B4O A;  3KFQ C;  2R4I A;  1IV7 A;  3KE7 A;  3SOY A;  4CCV A;  3NV0 B;  1JKG B;  3HX8 A;  4O8S A;  4RBN A;  5KP3 A;  1W7C A;  2WO0 A;  1DYU A;  2D1W A;  5JBS A;  1UI7 A;  1OH0 A;  1W02 A;  2CIU A;  3X40 A;  1K73 4;  1LXE A;  3EHC A;  1IU7 A;  2BNG A;  3CME 3;  1TFK A;  1CQS A;  3DGN A;  3HK4 A;  3SED A;  3CCU 3;  3K5T A;  3G71 3;  2FGT A;  2Y73 A;  3LH4 A;  1OHS A;  1L5G B;  4FMB A;  3RGA A;  5HGR A;  1Q81 4;  3NHX A;  2ZDJ A;  4GL6 A;  5EQL A;  3EN1 B;  1JB2 A;  4HM5 B;  3I56 3;  1KD1 4;  4U13 A;  1FUW A;  3F7S A;  1E3V A;  5CF2 A;  1OGX A;  3MKI A;  1IT8 A;  1TFO A;  2CG1 A;  1IDP A;  4OUQ A;  2P05 A;  3FG4 A;  4J8T A;  5STD A;  4TX4 A;  2CFD A;  2A15 A;  3PXM A;  4EV2 A;  3DGM A;  4KFD A;  2OOV C;  3OW2 2;  1QAK A;  2BT3 A;  1MNL A;  3QRD A;  1YVB I;  4R9K A;  1DVC A;  3UB1 A;  1JB4 A;  7STD A;  1DVD A;  2UX0 A;  4MMZ B;  3WMD A;  1QMA A;  3RDE A;  1AV4 A;  2E2V A;  1SIH A;  4WYK A;  4NRE A;  1U5O A;  1GYB A;  3DM8 A;  4X2O A;  1VQL 3;  4GB5 A;  2W56 B;  1LNH A;  2STD A;  5LC6 A;  2MC8 A;  1EG9 B;  3Q90 A;  1O7H B;  1WMO A;  3G0K A;  1O7W B;  3FCS B;  2GU1 A;  1A2K A;  1T5Y A;  3FH1 A;  3QK9 A;  5I97 A;  1NJI 4;  5IEN A;  3NQY A;  2HMM B;  1FGR A;  3PYJ A;  1IQX A;  1UI8 A;  2JDI H;  1NU3 A;  4HVN A;  1W6G A;  4MJD A;  5IG5 A;  3STD A;  3X3Y A;  1VQM 3;  3AMO B;  3VGN A;  2CKF B;  1J2B A;  2CH9 A;  2OWP A;  1WMN A;  4LEH A;  3GAX A;  2JQ5 A;  3D9R A;  2D42 A;  2Z76 A;  1QVF 2;  1S5A A;  3ECF A;  3F9S A;  2HMO B;  2QIY A;  4KFF A;  4IIA A;  3CMA 3;  1ULI B;  3IJE B;  1OHP A;  3J7Y d;  2IA7 A;  2W03 A;  2XSH B;  3IPT A;  1G96 A;  3IMA B;  4R9L A;  1IQ8 A;  2CWU A;  4N6M A;  1EA2 A;  3KSP A;  3NM2 A;  3F14 A;  4XDW A;  2CFW A;  1YIT 3;  5AYS C;  2OTL 3;  4WWU C;  3MPH A;  1D6U A;  3DUK A;  3V98 A;  2P09 A;  2BMQ B;  2Z7A A;  4FR9 A;  3Q1C A;  1E3R A;  3DY5 A;  1IVU A;  4H61 A;  1CEW I;  2CWT A;  3E99 A;  2RGQ A;  4BTW A;  4ORL A;  1HU9 A;  1VQ7 3;  2CFK A;  2YX9 A;  3FGY A;  3NUV A;  1STF I;  5IEP A;  5ELU A;  1FGO A;  3GRD A;  4FMD A;  3GWR A;  1M90 4;  1D6Y A;  3EJV A;  2E2T A;  1M1K 4;  3BLZ A;  3UNL A;  1CYV A;  3MG1 A;  3MYT A;  5D83 A;  3MSO A;  3SOA A;  4K61 A;  3UL6 A;  3FG3 A;  4X2H A;  3JUN A;  2KRT A;  5EEO A;  1W2B 2;  5DRV A;  1YGE A;  3WOE B;  4CDL A;  3WOD G;  4WP5 A;  1YJ9 3;  5BVB A;  2KCD A;  1VQK 3;  3U1W A;  1QAL A;  1DMN A;  2Y74 A;  3CC7 3;  4KFE A;  2XFS A;  5CF1 A;  1IK3 A;  1QJG A;  3OWS A;  3T8N A;  3CNM A;  1OUN A;  5CK6 A;  3WOF B;  1TU5 A;  3EBY A;  3X3Z A;  4RNY A;  1OHO A;  1OPY A;  2RSX A;  3F8X A;  4HM4 B;  3SLU A;  3CCL 3;  5CLK A;  1SJW A;  2W2C A;  1Q7Y 4;  3BB9 A;  2QGU A;  1ULJ B;  3JUP A;  4JF8 A;  4RZM A;  3F7X A;  5ELJ A;  4HM7 B;  3LTB A;  3F8H A;  1VQ8 3;  1JB5 A;  3DMC A;  2BMO B;  3CC4 3;  2F86 B;  4PEJ A;  4R80 A;  4IT7 A;  1GY6 A;  4FCZ A;  4L8P A;  2WGQ A;  4LMI A;  1FGM A;  1W2Z A;  2GBW B;  4FMA A;  3LT8 A;  1LOX A;  2ZL8 A;  1ASK A;  1N9J A;  4XM4 A;  3ROB A;  1N5H A;  2XEP A;  4JRF A;  4K90 B;  4N6L A;  2M7O A;  3GZY B;  3V99 A;  1FA3 A;  1OF5 A;  1KSI A;  1ZO2 A;  3GZR A;  3CCS 3;  4EC6 A;  3T0U A;  2XF3 A;  2LYX A;  1Q40 B;  4RNZ A;  3B8L A;  1RKY A;  3CD6 3;  3KN4 A;  3EX9 A;  5D81 A;  5G2G A;  4MMX B;  1KWI A;  3FF0 A;  4LSO A;  4XDV A;  2OOV A;  3S67 A;  1CYU A;  1WMP A;  2IMJ A;  1U8C B;  2Q07 A;  1C7H A;  1YJW 3;  4N6U A;  3NV0 A;  1JKG A;  3LTA A;  3MWZ A;  2K54 A;  3H3H A;  2IUJ A;  2SBL A;  2C11 A;  1GY5 A;  3FG1 A;  4BTX A;  3EF8 A;  2CFG A;  3N9H A;  4O3V A;  3LYG A;  2WGO A;  2P38 A;  1N8R 4;  1W4N A;  2CK3 H;  2W9Q A;  3CCQ 3;  3B7C A;  3VF1 A;  5AII A;  1NB3 I;  3DXO A;  3FKA A;  3HII A;  3CCR 3;  1UUW B;  4O02 B;  1BUQ A;  2ML6 A;  3PCR A;  2C10 A;  1EKM A;  3NBR A;  2YFL B;  3K9M C;  6STD A;  4L7K A;  2I9W A;  4HJL B;  2RCD A;  1V74 A;  1GS3 A;  3JUM A;  1O7G B;  3CNX A;  1W01 A;  3DGO A;  3WDG B;  3WA2 X;  2PNC A;  3DZL A;  3SXX A;  4NHF A;  1JN5 B;  1FGQ A;  1W6Y A;  3K7C A;  1O7M B;  2GEY A;  1AR0 A;  2W9P A;  4XBY A;  2BHM A;  1VQ4 3;  4FCM A;  1K8A 4;  2O3O A;  3BNE A;  3HZP A;  2RFR A;  5A0O B;  1A67 A;  3FF2 A;  2CFL A;  1GY7 A;  1OGZ A;  3D3L A;  1VQN 3;  1LVN A;  1K9M 4;  4N3V A;  1Y4K A;  3CPO A;  5AIG A;  1YIJ 3;  3LOY A;  3V92 A;  2W56 A;  1M9G A;  3CCV 3;  2GBX B;  1DMM A;  2OCT A;  3BND A;  3NBJ A;  3ER7 A;  2BO9 B;  1QVG 2;  1N9E A;  1D6Z A;  4HM1 B;  1GD3 A;  1W5Z A;  4HM3 B;  3CU3 A;  3OX9 A;  1AVK A;  1TP6 A;  5IG3 A;  1YI2 3;  4AKY A;  4Q53 A;  4HZ9 B;  3FLJ A;  3EE1 A;  3LT9 A;  4G1M B;  2HML B;  1AVL A;  1Q86 4;  3FZW A;  4L8O A;  3S5C A;  3AMO A;  3A76 A;  2K0M A;  2LQV A;  3LXU X;  1M1X B;  1ROA A;  3H51 A;  3EN8 A;  2Z6B A;  1NWW A;  2OQE C;  1OCV A;  3JUO A;  5JPP A;  2XGN A;  5KP1 A;  4K1U A;  3CCJ 3;  4MEI A;  3HI7 A;  5TGN A;  4LGQ A;  1UW1 A;  2IUK A;  3VSY A;  2F99 A;  3M8C A;  4EYC A;  1O7N B;  2L4V A;  2FXT A;  4WYK B;  4KVH A;  4EV5 A;  1K28 A;  1VQ5 3;  2WOH A;  3OV4 A;  2CG0 A;  3WA3 A;  4H3U A;  1WTH A;  1A90 A;  4N6V 0;  1KC8 4;  5BXQ A;  3TDG A;  2F98 A;  4WFO A;  1SQW A;  1PFP A;  1W6C A;  4HM2 B;  3T8U A;  5AIH A;  5KP4 A;  2CW9 A;  2ML5 A;  3OWY A;  1SPU A;  1RJO A;  4R4K A;  2GU3 A;  1IV9 A;  5FGO A;  2W0Q A;  1ROV A;  3LTC A;  1PU4 A;  1HKX A;  3HIG A;  5AI1 A;  4KZ1 A;  3PS8 A;  2WOF A;  1N5P A;  1OF5 B;  1WNH A;  1A2V A;  3N54 B;  4HKV B;  3I0Y A;  3CC2 3;  4WHA A;  1NB5 I;  2PZV A;  4XBT A;  5LC7 A;  4HYZ A;  2B1X B;  2YFI B;  1TIJ A;  3PCS A;  3X41 A;  5FW5 A;  3GZX B;  2HMN B;  3OWU A;  4OVM A;  2O9U X;  5CXO A;  3X42 A;  4EBG A;  1VQ9 3;  1YJN 3;  3CCE 3;  3I55 3;  2OTJ 3;  1MOL A;  4OK0 A;  3K0Z A;  2MF7 A;  2V1L A;  3OXA A;  1JJ2 2;  2XSO B;  4XBX A;  8CHO A;  3G6E 3;  3JVC A;  5IG4 A;  3G8Z A;  1JV2 B;  1YHQ 3;  1N8Q A;  3CCM 3;  2CWV A;  4HZB B;  1STD A;  1UUV B;  5DRE A;  3NXJ A;  5AYR B;  2HMJ B;  2E2U A;  3GZB A;  1OAC A;  3SVA A;  2QA4 3;  4HM8 B;  4HBR A;  4HM6 B;  3N8B A;  3BNB A;  3DGL A;  3X3X A;  1K41 A;  3F40 A;  1Q82 4;  3NBB A;  3NM7 A;  3FSD A;  1GD4 A;  4EXR A;  4MMY B;  5IG0 A;  2INX A;  2B24 B;  1SII A;  2Z77 A;  4XB5 A;  3KII A;  1IT7 A;  3CXC 2;  1VQO 3;  3PZW A;  2P0X A;  1VZZ A;  4N6O B;  1EQK A;  1ISK A;  3O8Y A;  1WQL B;  1Z1S A;  1DMQ A;  5EVH A;  3MG3 A;  3EB8 A;  2XFT A;  4N6N B;  1RN7 A;  1VQP 3;  2XRX B;  4ZM8 A;  3PGB A;  3L0R A;  3KSE D;  3EC9 A;  4BTY A;  3LTD A;  3ALA A;  4J9A A;  1O7P B;  1Q40 A;  5IEO A;  1NDO B;  3MHE A;  3NQZ A;  3Q2P A;  1E97 A;  2XGL A;  1JRQ A;  5AIF A;  2HMK B;  2CHC A;  2W04 A;  1RRL A;  5AEU B;  4HM0 B;  3BNC A;  3JUQ A;  3LML A;  5IF6 A;  1RRH A;  2P0M A;  3KKG A;  3NX0 A;  4N6T A;  4LZI A;  3K63 A;  5JPU A;  2W6J H;  3B4P A;  3S28 A;  1IVV A;  1US1 A;  1KQS 2;  1JNQ A;  2CC3 A;  1R4C A;  2KXG A;  1IVW A;  4O2H A;  4STD A;  4R1K A;  3S27 A;  2GEX A;  4FMC A;  1IQY A;  5AEW B;  3G4S 3;  2XH9 A;  4FCJ A;  1S72 3;  1VQ6 3;  2YFJ B;  1NO3 A;  2FNQ A;  2GXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...