2P0XA

Solution structure of a non-biological atp-binding protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSFRVKPCVVCKVAPRDWRVKNRHLRIYNMCKTCFNNSIKSGDDTYHGHVDWLMYTDAKEFSST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Evolutionary Analysis of a Non-biological ATP-binding Protein
pubmed doi rcsb
molecule keywords abiotic ATP-binding, folding optimized protein
source organism Synthetic gene
molecule tags De novo protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p0xA01
2P05A 3LTBA 3DGNA 3LT9A 2P09A 1UW1A 3DGLA 3LT8A 3LTCA 3LTDA 3DGOA 2P0XA 3DGMA 3LTAA
chains in the Genus database with same CATH superfamily
1T3BA 1ULIB 3BNBA 2K3DA 4HM6B 4K1UA 1X1UA 3K5TA 1JB2A 2WGOA 1NU3A 1FUSA 5AYRB 1JBRA 1PYLA 1RKYA 2CX0A 1K8A4 1IDPA 4J8TA 1JKGB 5BU4A 4MMXB 3CCJ3 3ZG0A 2ML5A 1AV4A 2KF4A 3EBYA 3LH4A 1YNVX 3EBTA 3SX1A 1RCKA 3AMOB 2OWPA 2W9QA 3AMOA 2RFRA 2KF5A 3JUQA 1VQ53 3FG1A 1RCLA 3CD63 5GSPA 4NHFA 1IYYA 3Q1CA 2OTJ3 1DE3A 4KVHA 4N3VA 3DY5A 4BL3A 1I0XA 1GMRA 1DYUA 2KRTA 4I5QA 3G0KA 5CLKA 1RGKA 2W9PA 3L0RA 2KF3A 2Z76A 4LSOA 3JUMA 3EE1A 2OQEA 3B4OA 1W6GA 1O7NB 3FF0A 3I553 1DETA 6GSPA 5G1LA 1R4YA 3PS8A 3UL6A 3K0ZA 4LYLB 3X3XA 1ZS7A 2Z7AA 3D3LA 3B4PA 1OGZA 2XFSA 2CFGA 1Q814 3SYUA 2E2TA 5CXOA 5KP3A 1FA3A 3RNTA 1WMOA 1QJGA 4RNTA 2FXTA 1U5OA 2CC3A 5CF1A 1Z1SA 2GSPA 4IIAA 3CC43 2CFWA 1SJWA 3G4S3 4HZ9B 3FG3A 4GB5A 2C4BA 4R80A 3CPW2 1Q42A 4HM5B 1KC84 3QRDA 1NDOB 1C54A 4R4KA 1IK3A 1RGFA 2SARA 3CCM3 1D6UA 3NXJA 3SEDA 1RRHA 2J8XB 3Q90A 3H3HA 5RNTA 1SQWA 2CWUA 1JV2B 1JB4A 1W5ZA 3UB1A 3FZWA 3T8NA 1JBSA 3DM8A 3DZLA 4HM8B 3MKIA 1BNIA 1Q9EA 1I3FA 2HMOB 4PEJA 2QA43 1UDII 1FZUA 1W4NA 1BGSA 1X1XA 1SARA 5HGRA 4GL6A 1B21A 2D42A 3LTDA 3V98A 4O2HA 4EC6A 1SIHA 4G1MB 2JDIH 1N5HA 1BRSA 3F7XA 3LOYA 3J7Yd 1M1XB 5AI1A 3EN8A 1V57A 3AHWA 5EEOA 4R9LA 3OWSA 3FF2A 1Q7Y4 2F5WA 1B2XA 3VGNA 1VQ43 1NNVA 5AIIA 3M8CA 1EEJA 1LOYA 1ZX2A 2CH9A 3LTCA 3X42A 1GMQA 1IU7A 5KP1A 5M18A 1HU9A 3MSOA 1ROVA 2HMKB 5G1KA 2QGUA 2H0HA 3CCU3 3EC9A 4XDWA 5BIRA 1GMPA 1W02A 4J9AA 3EX9A 4K90B 4I4KA 3DGNA 4L7KA 1OACA 3NQYA 1MNLA 1LQMB 5JPPA 1FGMA 3LTAA 3IMAB 5I97A 4BTWA 1CH0A 2AADA 5HOHA 1PU4A 1TFOA 3DH2A 3OW22 4OK0A 1BIRA 4KZ1A 4N6NB 3CME3 3F40A 2K0MA 1TP6A 1KD14 4EV2A 2XEPA 3AHSA 1V74A 1A2PA 1QAKA 4EW5A 1RNTA 3FKAA 3H51A 4ILFA 2P0XA 1IV9A 1X1YA 1UCJA 3F7SA 1RMSA 2LQVA 3MHEA 7RNTA 4HM1B 2BT3A 1AY7A 1RGHA 2HMJB 4WYKA 3CCS3 2BNGA 4BTYA 1AQZA 3S67A 4WP5A 1LNHA 1Q7HA 2ZDJA 1BSEA 3NHXA 3EB8A 1UUVB 4RNYA 5ELUA 2QIYA 4RNZA 3D79A 5IF6A 1UCLA 2B1XB 5JPUA 2YFIB 1STDA 3O8YA 1UGHI 3PYJA 1IV7A 2UX0A 1BVIA 3D4AA 4HM4B 1UCKA 2F98A 4K61A 1IT7A 3WOFB 1W00A 3KFQC 1GOYA 1RGCA 1B20A 2BHMA 2CWTA 1N9EA 4H61A 1MWUA 1SPUA 1UW1A 1VQN3 1VQP3 1B2UA 1GD4A 3SVAA 2XFTA 3A76A 1G96A 4N6V0 1L5GB 1WNHA 2O9UX 1WMPA 3SXXA 2STDA 3X3YA 3FGYA 1TUHA 1B2SA 1D6ZA 4XB5A 1VQ63 1I2FA 1ZGXA 2CKFB 1RGGA 1WQLB 1STFI 3LT9A 1D6YA 3D5IA 3DGLA 1GY5A 2WO0A 4AKYA 1BNGA 3EJVA 5D82A 1F8NA 3IPTA 3WR2A 3HZPA 3X40A 1EKMA 2BMQB 3LT8A 4N6TA 4STDA 4HOHA 3NM7A 1ZO2A 4HAAA 1IVVA 3D9RA 5EQLA 1VQL3 2HMNB 1OHOA 3DGMA 4O3VA 3CCL3 3ZFZA 4XBYA 2O3OA 5M19A 2F56A 2WOHA 4MJDA 1M904 1W7CA 2Z77A 2CWVA 1QVF2 2R4IA 2P09A 2KXGA 1YGWA 2OQEC 1KQS2 3HIIA 1BSAA 4XBTA 5AYSC 3T0UA 2MF7A 3MG3A 4HKVB 4J5KA 5LC7A 2F86B 1VZZA 5AIGA 1FGTA 1GD3A 2P38A 1O7GB 4WHAA 3S28A 1TRQA 3SOYA 4BU4A 4BTXA 2PNCA 2HMLB 1LRAA 3PCRA 1W2B2 2RNTA 1BNFA 1MOLA 1BSDA 1W6YA 1WTHA 1RLSA 5G2GA 1OCVA 4OVMA 3STDA 1W2ZA 3OV4A 1YHQ3 2ZA4A 3I563 1CQSA 3LZAA 1RGEA 1NB3I 4FMDA 5BXQA 2RCDA 3AGNA 2Y73A 2AAEA 3BLZA 1S5AA 3CCQ3 1MGRA 3DUKA 4ORLA 1C7HA 1GOVA 2CIUA 3JUOA 3MPHA 3S29A 2GEXA 5CF2A 1VQ93 2RSXA 3MWZA 3DGYA 4MEIA 3U97A 1BRKA 3UJMA 3KKGA 1N8QA 5JBSA 4FCZA 3GZBA 3NX0A 1JZDA 3WA3A 1BNJA 1LVNA 3PZWA 3CCV3 2OTL3 5STDA 2JQ5A 1RSNA 3LYGA 1IQYA 2WOFA 3S5CA 1JB5A 3NQZA 3NM2A 3VSYA 1AVKA 3CC23 1G0TA 1B2ZA 1RNBA 1BANA 3WDGB 1O7MB 1TFKA 5M1AA 1OH0A 3EN1B 1CEWI 3PXMA 1RN1A 4AEQA 1JJ22 3S27A 3EHCA 1Q864 2IUKA 1A2KA 2C11A 1N9JA 3K9MC 2M7OA 4EBGA 1GOUA 4RZMA 1TRPA 6RNTA 3OXAA 4BL2A 1UGIA 4CPKA 4R9KA 1Q40A 1GS3A 1R4CA 1PY3A 2IA7A 4HVNA 1IVXA 3F14A 3VF1A 2XF3A 2IMJA 2YX9A 2WGQA 3LTBA 1QAFA 1SIIA 4JF8A 1FGQA 4KFFA 1LXEA 4O8SA 3D5GA 1K41A 2CX1A 2K54A 3X3ZA 3FH1A 5DREA 2B24B 3F8HA 2F4YA 3FG4A 1JBTA 4N6OB 1NJI4 2Y74A 4FMCA 2CG1A 1I0VA 1BRGA 1RRLA 3GWRA 3G713 3WHOA 4FMAA 3WA2X 1MWTA 3KIIA 2CW9A 1O7PB 1BRHA 1KWIA 2E2VA 2FNQA 1JN5A 4GSPA 2CFLA 4WYKB 2GU3A 1JNQA 3F8XA 3MYTA 4HM3B 3TDGA 3BNEA 2I9WA 4HM0B 4HM2B 2KF6A 2XSHB 3EF8A 3KZTA 3RDEA 4AKZA 5TGNA 2YFLB 4LZIA 4HJLB 1BRJA 2W03A 1V58A 1CYVA 4EXRA 1YJ93 2H0IA 3GZXB 1B2MA 3GSPA 3JUNA 2W04A 3Q3FA 1TU5A 2W2CA 1K9M4 3KE7A 1K734 4BIRA 4XM4A 2OCTA 1B3SA 4WWUC 3DMCA 3OX9A 1EUIC 1HKXA 5CK6A 3ROBA 1IQ8A 1DVDA 1YVSA 5BVBA 1Y4KA 3LXUX 1QVG2 3CCE3 3HX8A 1QMAA 3N9HA 2H0GA 4EYCA 1BSCA 1W01A 4MMZB 4XBXA 1RN4A 4FCJA 3EQQB 3ZG5A 1T5YA 5FGOA 1FUTA 1MGWA 2GBWB 3FCSB 1TJDA 1VQ83 1A2VA 1I8VA 2ZL8A 3NBJA 2OOVA 3PCSA 1VQK3 5IEPA 3UNLA 1E97A 1NO3A 4KFDA 2GU1A 1BOXA 5DRVA 3BIRA 1B27A 1A67A 1HZ1A 2R41A 1RGLA 3G16A 3RGAA 2E2UA 1IT8A 5D83A 1VQM3 1G02A 1BUJA 1BRIA 1UI8A 3ECFA 1JKGA 1OF5B 3NUVA 2CFDA 1OF5A 1BNEA 3E99A 1HYFA 3MG2A 5EVHA 5IG5A 1ISKA 4L8PA 1N5PA 4K1VA 5D81A 1DMNA 1O7WB 2CHCA 4LGQA 4X2OA 1LOXA 1NWWA 1CYUA 1FUWA 3GZYB 2BO9B 1T2IA 1PFPA 3IJEB 3JUPA 4EV5A 3MG1A 1MWRA 4N6UA 1OUNA 1FW7A 3ER7A 4GHOA 1JRQA 4LMIA 2C10A 3AGOA 2XSOB 5IG0A 1RHLA 4DKIA 3BNCA 3GAXA 2IUJA 4NREA 1BUQA 4H3UA 1GSPA 2CFKA 5ELJA 2GBXB 2Z6BA 3BU4A 3DXOA 2RGQA 3HK4A 4NPBA 3RGRA 4L8OA 1OPYA 3UL5A 3B8LA 5AEUB 3G6E3 3CXC2 2BIRA 1X1WA 2PZVA 1M1K4 2IY2A 3NBBA 1VQQA 2KAAA 4FMBA 1A90A 2UUGC 1GYBA 1FYSA 4N6MA 1M9GA 4R1KA 1J2BA 3G8ZA 5IERA 4KT3B 4WFOA 2KCDA 5IG3A 4J5GA 4TX4A 2GEYA 1I3IA 2CG0A 2YFJB 3CMA3 3FSDA 1KSIA 1O7HB 3URPA 3HIGA 1K28A 3T8UA 1S723 2L1SA 3CNMA 1UUWB 3SOAA 3Q2PA 1YJW3 3OWYA 3GZRA 4FR9A 4QWTA 1E3RA 1T2HA 7STDA 1U8CB 3N54B 1FGRA 3WOEB 1RGAA 2W6JH 4N6LA 1YIJ3 1GY7A 5KP4A 2L4VA 4HBRA 4CJNA 2D1WA 1VQO3 5IENA 4OUQA 3KSED 4ZM8A 1I2EA 8CHOA 1Q40B 2W0QA 2XR8B 1N8R4 5LC6A 1BNRA 3B7CA 5IW9A 3NBRA 1I70A 1EG9B 1LQGC 2CK3H 2LYXA 1ROAA 2XGNA 4RBNA 2A15A 1GY6A 3QK9A 3K7CA 1AR0A 3GRDA 5IEOA 3BB9A 5FW5A 4HYZA 3N8BA 1IVUA 3CCR3 1I2GA 3HI7A 2GXFA 3ALAA 1DVCA 4KFEA 2HMMB 3A5EA 3LMLA 4FCMA 2XGLA 4X2HA 1AVLA 1DMQA 1JN5B 1EA2A 1Q824 1IVWA 3OWUA 1BNSA 1LNIA 4HM7B 2INXA 3CPOA 2V1LA 9RNTA 3KN4A 1UI7A 2ML6A 3SLUA 3KCHA 5AIHA 7GSPA 2Q07A 1ASKA 4CDLA 4IT7A 2FGTA 3HOHA 3I0YA 6STDA 2F5MA 1VQ73 2UGIA 3X41A 3V99A 4U13A 1US1A 3FLJA 4CCVA 2F99A 1YJN3 2SBLA 5IG4A 2HOHA 1UUGB 1QALA 2BU4A 1JZOA 1YGEA 2BMOB 2ZHXB 2MC8A 1DMMA 1ULJB 3DGOA 5AIFA 1E3VA 1EQKA 1TTOA 1OHPA 4XDVA 1BU4A 3K63A 1WMNA 3CU3A 5A0OB 5AEWB 1IQXA 4JRFA 3CC73 3NV0B 1MWSA 3JVCA 1W6CA 3NV0A 3PGBA 1BSBA 1RTUA 2XRXB 3CNXA 1RJOA 8RNTA 3BNDA 2P0MA 1YIT3 1YI23 4IPBA 1RDSA 1UCIA 4LEHA 4MMYB 1OHSA 1OGXA 1BAOA 1TIJA 2IYJA 2W56B 3F9SA 4O02B 2W56A 2P05A 2QEX3 2RBIA 4Q53A 1YVBI 3V92A 1NB5I 2XH9A 1LOVA 1FGOA 1RN7A 4HZBB 1LOWA 3WMDA 2OOVC 3WODG 3U1WA 2BMRB 3KSPA 1BRNL
chains in the Genus database with same CATH topology
1ULIB 3BNBA 4HM6B 4K1UA 3K5TA 1JB2A 2WGOA 1NU3A 5AYRB 1RKYA 1K8A4 1IDPA 4J8TA 1JKGB 4MMXB 3CCJ3 2ML5A 1AV4A 3EBYA 3LH4A 3EBTA 3SX1A 3AMOB 2OWPA 2W9QA 3AMOA 2RFRA 3JUQA 1VQ53 3FG1A 3CD63 4NHFA 3Q1CA 2OTJ3 4KVHA 4N3VA 3DY5A 1DYUA 2KRTA 3G0KA 5CLKA 2W9PA 3L0RA 2Z76A 4LSOA 3JUMA 3EE1A 2OQEA 3B4OA 1W6GA 1O7NB 3FF0A 3I553 3PS8A 3UL6A 3K0ZA 3X3XA 2Z7AA 3D3LA 3B4PA 1OGZA 2XFSA 2CFGA 1Q814 2E2TA 5CXOA 5KP3A 1FA3A 1WMOA 1QJGA 2FXTA 1U5OA 2CC3A 5CF1A 1Z1SA 4IIAA 3CC43 2CFWA 1SJWA 3G4S3 4HZ9B 3FG3A 4GB5A 4R80A 3CPW2 1Q42A 4HM5B 1KC84 3QRDA 1NDOB 4R4KA 1IK3A 3CCM3 1D6UA 3NXJA 3SEDA 1RRHA 3Q90A 3H3HA 1SQWA 2CWUA 1JV2B 1JB4A 1W5ZA 3UB1A 3FZWA 3T8NA 3DM8A 3DZLA 4HM8B 3MKIA 2HMOB 2QA43 4PEJA 1W4NA 5HGRA 4GL6A 3LTDA 2D42A 3V98A 4O2HA 4EC6A 1SIHA 4G1MB 2JDIH 1N5HA 3LOYA 3F7XA 3J7Yd 1M1XB 5AI1A 3EN8A 5EEOA 4R9LA 3OWSA 3FF2A 1Q7Y4 3VGNA 1VQ43 5AIIA 3M8CA 1ZX2A 2CH9A 3X42A 3LTCA 5KP1A 1IU7A 1HU9A 3MSOA 1ROVA 2HMKB 2QGUA 3CCU3 3EC9A 4XDWA 1W02A 4J9AA 3EX9A 4K90B 4I4KA 3DGNA 4L7KA 1OACA 3NQYA 1MNLA 5JPPA 1FGMA 3LTAA 3IMAB 5I97A 4BTWA 3OW22 1PU4A 1TFOA 4OK0A 4KZ1A 4N6NB 3CME3 3F40A 2K0MA 1TP6A 1KD14 4EV2A 2XEPA 1V74A 1QAKA 3CCQ3 3FKAA 3H51A 3CC73 2P0XA 1IV9A 3F7SA 3MHEA 2LQVA 4HM1B 2BT3A 2HMJB 4WYKA 3CCS3 2BNGA 4BTYA 3S67A 4WP5A 1LNHA 2ZDJA 3NHXA 4RNYA 3EB8A 1UUVB 5ELUA 5IF6A 2QIYA 4RNZA 2B1XB 5JPUA 2YFIB 1STDA 3O8YA 3PYJA 1IV7A 2UX0A 4HM4B 2F98A 4K61A 1IT7A 3WOFB 1W00A 3KFQC 2BHMA 2CWTA 1N9EA 4H61A 1SPUA 1UW1A 1VQN3 1VQP3 1GD4A 3SVAA 2XFTA 3A76A 1G96A 4N6V0 1L5GB 1WNHA 2O9UX 1WMPA 3SXXA 2STDA 3X3YA 3FGYA 1TUHA 1D6ZA 4XB5A 1VQ63 2CKFB 1WQLB 1STFI 3LT9A 1D6YA 3DGLA 1GY5A 2WO0A 4AKYA 3EJVA 5D82A 1F8NA 3IPTA 3HZPA 3X40A 1EKMA 2BMQB 3LT8A 4N6TA 4STDA 3NM7A 1ZO2A 1VQL3 1IVVA 3D9RA 5EQLA 2HMNB 1OHOA 3DGMA 4O3VA 3CCL3 4XBYA 2O3OA 2WOHA 4MJDA 1M904 1W7CA 2Z77A 2CWVA 1QVF2 2R4IA 2P09A 2KXGA 2OQEC 1KQS2 3HIIA 4XBTA 3T0UA 5AYSC 2MF7A 3MG3A 4HKVB 5LC7A 2F86B 1VZZA 5AIGA 1FGTA 1GD3A 2P38A 1O7GB 4WHAA 3S28A 3SOYA 4BTXA 1W2B2 2PNCA 2HMLB 3PCRA 1MOLA 1W6YA 1WTHA 5G2GA 1OCVA 4OVMA 3STDA 1W2ZA 3OV4A 1YHQ3 3I563 1CQSA 3LZAA 1NB3I 4FMDA 5BXQA 2RCDA 2Y73A 3BLZA 1S5AA 3DUKA 4ORLA 1C7HA 2CIUA 3JUOA 3MPHA 3S29A 2GEXA 5CF2A 1VQ93 2RSXA 3MWZA 4MEIA 3U97A 3UJMA 3KKGA 1N8QA 5JBSA 4FCZA 3GZBA 3NX0A 3WA3A 3PZWA 1LVNA 3CCV3 2OTL3 5STDA 2JQ5A 3LYGA 1IQYA 2WOFA 3S5CA 1JB5A 3NQZA 3NM2A 3VSYA 1AVKA 3CC23 3WDGB 1O7MB 1TFKA 1OH0A 3EN1B 1CEWI 3PXMA 4AEQA 1JJ22 3S27A 3EHCA 1Q864 2IUKA 1A2KA 2C11A 1N9JA 3K9MC 2M7OA 4EBGA 4RZMA 3OXAA 4R9KA 1Q40A 1GS3A 1R4CA 2IA7A 4HVNA 1IVXA 3F14A 3VF1A 2XF3A 2IMJA 2YX9A 2WGQA 3LTBA 1QAFA 1SIIA 4JF8A 1FGQA 4KFFA 1LXEA 4O8SA 1K41A 2K54A 3X3ZA 3FH1A 5DREA 2B24B 3F8HA 3FG4A 4N6OB 1NJI4 2Y74A 4FMCA 2CG1A 1RRLA 3GWRA 3G713 3WA2X 4FMAA 3KIIA 2CW9A 1O7PB 1KWIA 2E2VA 2FNQA 1JN5A 2CFLA 4WYKB 2GU3A 1JNQA 3F8XA 3MYTA 4HM3B 3TDGA 3BNEA 2I9WA 4HM0B 4HM2B 2XSHB 3EF8A 3KZTA 3RDEA 4AKZA 5TGNA 2YFLB 4LZIA 4HJLB 2W03A 1CYVA 4EXRA 1YJ93 3GZXB 3JUNA 2W04A 1TU5A 2W2CA 1K9M4 3KE7A 1K734 4XM4A 2OCTA 4WWUC 3DMCA 3OX9A 1HKXA 5CK6A 3ROBA 1DVDA 1IQ8A 5BVBA 1Y4KA 3LXUX 1QVG2 3CCE3 3HX8A 1QMAA 3N9HA 4EYCA 1W01A 4MMZB 4XBXA 4FCJA 3EQQB 1T5YA 5FGOA 2GBWB 3FCSB 1VQ83 1A2VA 2ZL8A 3NBJA 2OOVA 3PCSA 1VQK3 5IEPA 3UNLA 1E97A 1NO3A 4KFDA 2GU1A 5DRVA 1A67A 3G16A 3RGAA 2E2UA 1IT8A 5D83A 1VQM3 1UI8A 3ECFA 1JKGA 1OF5B 3NUVA 2CFDA 1OF5A 5EVHA 3E99A 3MG2A 5IG5A 1ISKA 4L8PA 1N5PA 4K1VA 5D81A 1DMNA 1O7WB 2CHCA 4LGQA 4X2OA 1LOXA 1NWWA 1CYUA 1FUWA 3GZYB 2BO9B 1PFPA 3IJEB 3JUPA 4EV5A 3MG1A 4N6UA 1OUNA 3ER7A 1JRQA 4LMIA 2C10A 2XSOB 5IG0A 3BNCA 3GAXA 2IUJA 4NREA 1BUQA 4H3UA 2CFKA 5ELJA 2GBXB 2Z6BA 3DXOA 3HK4A 2RGQA 3G6E3 3RGRA 3UL5A 4L8OA 1OPYA 5AEUB 3B8LA 3CXC2 2PZVA 1M1K4 3NBBA 4FMBA 1A90A 1GYBA 4N6MA 1M9GA 4R1KA 1J2BA 3G8ZA 5IERA 4WFOA 2KCDA 5IG3A 4TX4A 2GEYA 2CG0A 2YFJB 3CMA3 3FSDA 1KSIA 1O7HB 3HIGA 1K28A 3T8UA 1S723 3CNMA 1UUWB 3SOAA 3Q2PA 1YJW3 3OWYA 3GZRA 4FR9A 4QWTA 1E3RA 7STDA 1U8CB 3N54B 1FGRA 3WOEB 2W6JH 4N6LA 1YIJ3 1GY7A 5KP4A 2L4VA 4HBRA 2D1WA 1VQO3 5IENA 4OUQA 3KSED 4ZM8A 8CHOA 1Q40B 2W0QA 2XR8B 1N8R4 5LC6A 3B7CA 5IW9A 3NBRA 1EG9B 2CK3H 2LYXA 1ROAA 2XGNA 4RBNA 2A15A 1GY6A 3QK9A 3K7CA 1AR0A 3GRDA 5IEOA 3BB9A 5FW5A 4HYZA 3N8BA 1IVUA 3CCR3 3HI7A 2GXFA 3ALAA 1DVCA 4KFEA 2HMMB 3LMLA 4FCMA 2XGLA 4X2HA 1AVLA 1DMQA 1JN5B 1EA2A 1Q824 1IVWA 3OWUA 4HM7B 2INXA 3CPOA 2V1LA 3KN4A 1UI7A 2ML6A 3SLUA 5AIHA 2Q07A 1ASKA 4CDLA 4IT7A 2FGTA 3I0YA 6STDA 1VQ73 3X41A 3V99A 4U13A 1US1A 3FLJA 4CCVA 2F99A 1YJN3 2SBLA 5IG4A 1QALA 1YGEA 2BMOB 2MC8A 1DMMA 1ULJB 3DGOA 5AIFA 1E3VA 1EQKA 1OHPA 4XDVA 3K63A 1WMNA 3CU3A 5A0OB 5AEWB 1IQXA 4JRFA 3NV0B 3JVCA 1W6CA 3NV0A 3PGBA 2XRXB 3CNXA 1RJOA 3BNDA 2P0MA 1YIT3 1YI23 4IPBA 4LEHA 4MMYB 1OHSA 1OGXA 1TIJA 3F9SA 2W56B 4O02B 2W56A 2P05A 2QEX3 4Q53A 1YVBI 3V92A 1NB5I 2XH9A 1FGOA 1RN7A 4HZBB 3WMDA 3WODG 2OOVC 3U1WA 2BMRB 3KSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  3LTB A;  3DGN A;  3LT9 A;  2P09 A;  1UW1 A;  3DGL A;  3LT8 A;  3LTC A;  3LTD A;  3DGO A;  2P0X A;  3DGM A;  3LTA A; 
#chains in the Genus database with same CATH topology
 1T3B A;  1ULI B;  3BNB A;  2K3D A;  4HM6 B;  4K1U A;  1X1U A;  3K5T A;  1JB2 A;  2WGO A;  1NU3 A;  1FUS A;  5AYR B;  1JBR A;  1PYL A;  1RKY A;  2CX0 A;  1K8A 4;  1IDP A;  4J8T A;  1JKG B;  5BU4 A;  4MMX B;  3CCJ 3;  3ZG0 A;  2ML5 A;  1AV4 A;  2KF4 A;  3EBY A;  3LH4 A;  1YNV X;  3EBT A;  3SX1 A;  1RCK A;  3AMO B;  2OWP A;  2W9Q A;  3AMO A;  2RFR A;  2KF5 A;  3JUQ A;  1VQ5 3;  3FG1 A;  1RCL A;  3CD6 3;  5GSP A;  4NHF A;  1IYY A;  3Q1C A;  2OTJ 3;  1DE3 A;  4KVH A;  4N3V A;  3DY5 A;  4BL3 A;  1I0X A;  1GMR A;  1DYU A;  2KRT A;  4I5Q A;  3G0K A;  5CLK A;  1RGK A;  2W9P A;  3L0R A;  2KF3 A;  2Z76 A;  4LSO A;  3JUM A;  3EE1 A;  2OQE A;  3B4O A;  1W6G A;  1O7N B;  3FF0 A;  3I55 3;  1DET A;  6GSP A;  5G1L A;  1R4Y A;  3PS8 A;  3UL6 A;  3K0Z A;  4LYL B;  3X3X A;  1ZS7 A;  2Z7A A;  3D3L A;  3B4P A;  1OGZ A;  2XFS A;  2CFG A;  1Q81 4;  3SYU A;  2E2T A;  5CXO A;  5KP3 A;  1FA3 A;  3RNT A;  1WMO A;  1QJG A;  4RNT A;  2FXT A;  1U5O A;  2CC3 A;  5CF1 A;  1Z1S A;  2GSP A;  4IIA A;  3CC4 3;  2CFW A;  1SJW A;  3G4S 3;  4HZ9 B;  3FG3 A;  4GB5 A;  2C4B A;  4R80 A;  3CPW 2;  1Q42 A;  4HM5 B;  1KC8 4;  3QRD A;  1NDO B;  1C54 A;  4R4K A;  1IK3 A;  1RGF A;  2SAR A;  3CCM 3;  1D6U A;  3NXJ A;  3SED A;  1RRH A;  2J8X B;  3Q90 A;  3H3H A;  5RNT A;  1SQW A;  2CWU A;  1JV2 B;  1JB4 A;  1W5Z A;  3UB1 A;  3FZW A;  3T8N A;  1JBS A;  3DM8 A;  3DZL A;  4HM8 B;  3MKI A;  1BNI A;  1Q9E A;  1I3F A;  2HMO B;  4PEJ A;  2QA4 3;  1UDI I;  1FZU A;  1W4N A;  1BGS A;  1X1X A;  1SAR A;  5HGR A;  4GL6 A;  1B21 A;  2D42 A;  3LTD A;  3V98 A;  4O2H A;  4EC6 A;  1SIH A;  4G1M B;  2JDI H;  1N5H A;  1BRS A;  3F7X A;  3LOY A;  3J7Y d;  1M1X B;  5AI1 A;  3EN8 A;  1V57 A;  3AHW A;  5EEO A;  4R9L A;  3OWS A;  3FF2 A;  1Q7Y 4;  2F5W A;  1B2X A;  3VGN A;  1VQ4 3;  1NNV A;  5AII A;  3M8C A;  1EEJ A;  1LOY A;  1ZX2 A;  2CH9 A;  3LTC A;  3X42 A;  1GMQ A;  1IU7 A;  5KP1 A;  5M18 A;  1HU9 A;  3MSO A;  1ROV A;  2HMK B;  5G1K A;  2QGU A;  2H0H A;  3CCU 3;  3EC9 A;  4XDW A;  5BIR A;  1GMP A;  1W02 A;  4J9A A;  3EX9 A;  4K90 B;  4I4K A;  3DGN A;  4L7K A;  1OAC A;  3NQY A;  1MNL A;  1LQM B;  5JPP A;  1FGM A;  3LTA A;  3IMA B;  5I97 A;  4BTW A;  1CH0 A;  2AAD A;  5HOH A;  1PU4 A;  1TFO A;  3DH2 A;  3OW2 2;  4OK0 A;  1BIR A;  4KZ1 A;  4N6N B;  3CME 3;  3F40 A;  2K0M A;  1TP6 A;  1KD1 4;  4EV2 A;  2XEP A;  3AHS A;  1V74 A;  1A2P A;  1QAK A;  4EW5 A;  1RNT A;  3FKA A;  3H51 A;  4ILF A;  2P0X A;  1IV9 A;  1X1Y A;  1UCJ A;  3F7S A;  1RMS A;  2LQV A;  3MHE A;  7RNT A;  4HM1 B;  2BT3 A;  1AY7 A;  1RGH A;  2HMJ B;  4WYK A;  3CCS 3;  2BNG A;  4BTY A;  1AQZ A;  3S67 A;  4WP5 A;  1LNH A;  1Q7H A;  2ZDJ A;  1BSE A;  3NHX A;  3EB8 A;  1UUV B;  4RNY A;  5ELU A;  2QIY A;  4RNZ A;  3D79 A;  5IF6 A;  1UCL A;  2B1X B;  5JPU A;  2YFI B;  1STD A;  3O8Y A;  1UGH I;  3PYJ A;  1IV7 A;  2UX0 A;  1BVI A;  3D4A A;  4HM4 B;  1UCK A;  2F98 A;  4K61 A;  1IT7 A;  3WOF B;  1W00 A;  3KFQ C;  1GOY A;  1RGC A;  1B20 A;  2BHM A;  2CWT A;  1N9E A;  4H61 A;  1MWU A;  1SPU A;  1UW1 A;  1VQN 3;  1VQP 3;  1B2U A;  1GD4 A;  3SVA A;  2XFT A;  3A76 A;  1G96 A;  4N6V 0;  1L5G B;  1WNH A;  2O9U X;  1WMP A;  3SXX A;  2STD A;  3X3Y A;  3FGY A;  1TUH A;  1B2S A;  1D6Z A;  4XB5 A;  1VQ6 3;  1I2F A;  1ZGX A;  2CKF B;  1RGG A;  1WQL B;  1STF I;  3LT9 A;  1D6Y A;  3D5I A;  3DGL A;  1GY5 A;  2WO0 A;  4AKY A;  1BNG A;  3EJV A;  5D82 A;  1F8N A;  3IPT A;  3WR2 A;  3HZP A;  3X40 A;  1EKM A;  2BMQ B;  3LT8 A;  4N6T A;  4STD A;  4HOH A;  3NM7 A;  1ZO2 A;  4HAA A;  1IVV A;  3D9R A;  5EQL A;  1VQL 3;  2HMN B;  1OHO A;  3DGM A;  4O3V A;  3CCL 3;  3ZFZ A;  4XBY A;  2O3O A;  5M19 A;  2F56 A;  2WOH A;  4MJD A;  1M90 4;  1W7C A;  2Z77 A;  2CWV A;  1QVF 2;  2R4I A;  2P09 A;  2KXG A;  1YGW A;  2OQE C;  1KQS 2;  3HII A;  1BSA A;  4XBT A;  5AYS C;  3T0U A;  2MF7 A;  3MG3 A;  4HKV B;  4J5K A;  5LC7 A;  2F86 B;  1VZZ A;  5AIG A;  1FGT A;  1GD3 A;  2P38 A;  1O7G B;  4WHA A;  3S28 A;  1TRQ A;  3SOY A;  4BU4 A;  4BTX A;  2PNC A;  2HML B;  1LRA A;  3PCR A;  1W2B 2;  2RNT A;  1BNF A;  1MOL A;  1BSD A;  1W6Y A;  1WTH A;  1RLS A;  5G2G A;  1OCV A;  4OVM A;  3STD A;  1W2Z A;  3OV4 A;  1YHQ 3;  2ZA4 A;  3I56 3;  1CQS A;  3LZA A;  1RGE A;  1NB3 I;  4FMD A;  5BXQ A;  2RCD A;  3AGN A;  2Y73 A;  2AAE A;  3BLZ A;  1S5A A;  3CCQ 3;  1MGR A;  3DUK A;  4ORL A;  1C7H A;  1GOV A;  2CIU A;  3JUO A;  3MPH A;  3S29 A;  2GEX A;  5CF2 A;  1VQ9 3;  2RSX A;  3MWZ A;  3DGY A;  4MEI A;  3U97 A;  1BRK A;  3UJM A;  3KKG A;  1N8Q A;  5JBS A;  4FCZ A;  3GZB A;  3NX0 A;  1JZD A;  3WA3 A;  1BNJ A;  1LVN A;  3PZW A;  3CCV 3;  2OTL 3;  5STD A;  2JQ5 A;  1RSN A;  3LYG A;  1IQY A;  2WOF A;  3S5C A;  1JB5 A;  3NQZ A;  3NM2 A;  3VSY A;  1AVK A;  3CC2 3;  1G0T A;  1B2Z A;  1RNB A;  1BAN A;  3WDG B;  1O7M B;  1TFK A;  5M1A A;  1OH0 A;  3EN1 B;  1CEW I;  3PXM A;  1RN1 A;  4AEQ A;  1JJ2 2;  3S27 A;  3EHC A;  1Q86 4;  2IUK A;  1A2K A;  2C11 A;  1N9J A;  3K9M C;  2M7O A;  4EBG A;  1GOU A;  4RZM A;  1TRP A;  6RNT A;  3OXA A;  4BL2 A;  1UGI A;  4CPK A;  4R9K A;  1Q40 A;  1GS3 A;  1R4C A;  1PY3 A;  2IA7 A;  4HVN A;  1IVX A;  3F14 A;  3VF1 A;  2XF3 A;  2IMJ A;  2YX9 A;  2WGQ A;  3LTB A;  1QAF A;  1SII A;  4JF8 A;  1FGQ A;  4KFF A;  1LXE A;  4O8S A;  3D5G A;  1K41 A;  2CX1 A;  2K54 A;  3X3Z A;  3FH1 A;  5DRE A;  2B24 B;  3F8H A;  2F4Y A;  3FG4 A;  1JBT A;  4N6O B;  1NJI 4;  2Y74 A;  4FMC A;  2CG1 A;  1I0V A;  1BRG A;  1RRL A;  3GWR A;  3G71 3;  3WHO A;  4FMA A;  3WA2 X;  1MWT A;  3KII A;  2CW9 A;  1O7P B;  1BRH A;  1KWI A;  2E2V A;  2FNQ A;  1JN5 A;  4GSP A;  2CFL A;  4WYK B;  2GU3 A;  1JNQ A;  3F8X A;  3MYT A;  4HM3 B;  3TDG A;  3BNE A;  2I9W A;  4HM0 B;  4HM2 B;  2KF6 A;  2XSH B;  3EF8 A;  3KZT A;  3RDE A;  4AKZ A;  5TGN A;  2YFL B;  4LZI A;  4HJL B;  1BRJ A;  2W03 A;  1V58 A;  1CYV A;  4EXR A;  1YJ9 3;  2H0I A;  3GZX B;  1B2M A;  3GSP A;  3JUN A;  2W04 A;  3Q3F A;  1TU5 A;  2W2C A;  1K9M 4;  3KE7 A;  1K73 4;  4BIR A;  4XM4 A;  2OCT A;  1B3S A;  4WWU C;  3DMC A;  3OX9 A;  1EUI C;  1HKX A;  5CK6 A;  3ROB A;  1IQ8 A;  1DVD A;  1YVS A;  5BVB A;  1Y4K A;  3LXU X;  1QVG 2;  3CCE 3;  3HX8 A;  1QMA A;  3N9H A;  2H0G A;  4EYC A;  1BSC A;  1W01 A;  4MMZ B;  4XBX A;  1RN4 A;  4FCJ A;  3EQQ B;  3ZG5 A;  1T5Y A;  5FGO A;  1FUT A;  1MGW A;  2GBW B;  3FCS B;  1TJD A;  1VQ8 3;  1A2V A;  1I8V A;  2ZL8 A;  3NBJ A;  2OOV A;  3PCS A;  1VQK 3;  5IEP A;  3UNL A;  1E97 A;  1NO3 A;  4KFD A;  2GU1 A;  1BOX A;  5DRV A;  3BIR A;  1B27 A;  1A67 A;  1HZ1 A;  2R41 A;  1RGL A;  3G16 A;  3RGA A;  2E2U A;  1IT8 A;  5D83 A;  1VQM 3;  1G02 A;  1BUJ A;  1BRI A;  1UI8 A;  3ECF A;  1JKG A;  1OF5 B;  3NUV A;  2CFD A;  1OF5 A;  1BNE A;  3E99 A;  1HYF A;  3MG2 A;  5EVH A;  5IG5 A;  1ISK A;  4L8P A;  1N5P A;  4K1V A;  5D81 A;  1DMN A;  1O7W B;  2CHC A;  4LGQ A;  4X2O A;  1LOX A;  1NWW A;  1CYU A;  1FUW A;  3GZY B;  2BO9 B;  1T2I A;  1PFP A;  3IJE B;  3JUP A;  4EV5 A;  3MG1 A;  1MWR A;  4N6U A;  1OUN A;  1FW7 A;  3ER7 A;  4GHO A;  1JRQ A;  4LMI A;  2C10 A;  3AGO A;  2XSO B;  5IG0 A;  1RHL A;  4DKI A;  3BNC A;  3GAX A;  2IUJ A;  4NRE A;  1BUQ A;  4H3U A;  1GSP A;  2CFK A;  5ELJ A;  2GBX B;  2Z6B A;  3BU4 A;  3DXO A;  2RGQ A;  3HK4 A;  4NPB A;  3RGR A;  4L8O A;  1OPY A;  3UL5 A;  3B8L A;  5AEU B;  3G6E 3;  3CXC 2;  2BIR A;  1X1W A;  2PZV A;  1M1K 4;  2IY2 A;  3NBB A;  1VQQ A;  2KAA A;  4FMB A;  1A90 A;  2UUG C;  1GYB A;  1FYS A;  4N6M A;  1M9G A;  4R1K A;  1J2B A;  3G8Z A;  5IER A;  4KT3 B;  4WFO A;  2KCD A;  5IG3 A;  4J5G A;  4TX4 A;  2GEY A;  1I3I A;  2CG0 A;  2YFJ B;  3CMA 3;  3FSD A;  1KSI A;  1O7H B;  3URP A;  3HIG A;  1K28 A;  3T8U A;  1S72 3;  2L1S A;  3CNM A;  1UUW B;  3SOA A;  3Q2P A;  1YJW 3;  3OWY A;  3GZR A;  4FR9 A;  4QWT A;  1E3R A;  1T2H A;  7STD A;  1U8C B;  3N54 B;  1FGR A;  3WOE B;  1RGA A;  2W6J H;  4N6L A;  1YIJ 3;  1GY7 A;  5KP4 A;  2L4V A;  4HBR A;  4CJN A;  2D1W A;  1VQO 3;  5IEN A;  4OUQ A;  3KSE D;  4ZM8 A;  1I2E A;  8CHO A;  1Q40 B;  2W0Q A;  2XR8 B;  1N8R 4;  5LC6 A;  1BNR A;  3B7C A;  5IW9 A;  3NBR A;  1I70 A;  1EG9 B;  1LQG C;  2CK3 H;  2LYX A;  1ROA A;  2XGN A;  4RBN A;  2A15 A;  1GY6 A;  3QK9 A;  3K7C A;  1AR0 A;  3GRD A;  5IEO A;  3BB9 A;  5FW5 A;  4HYZ A;  3N8B A;  1IVU A;  3CCR 3;  1I2G A;  3HI7 A;  2GXF A;  3ALA A;  1DVC A;  4KFE A;  2HMM B;  3A5E A;  3LML A;  4FCM A;  2XGL A;  4X2H A;  1AVL A;  1DMQ A;  1JN5 B;  1EA2 A;  1Q82 4;  1IVW A;  3OWU A;  1BNS A;  1LNI A;  4HM7 B;  2INX A;  3CPO A;  2V1L A;  9RNT A;  3KN4 A;  1UI7 A;  2ML6 A;  3SLU A;  3KCH A;  5AIH A;  7GSP A;  2Q07 A;  1ASK A;  4CDL A;  4IT7 A;  2FGT A;  3HOH A;  3I0Y A;  6STD A;  2F5M A;  1VQ7 3;  2UGI A;  3X41 A;  3V99 A;  4U13 A;  1US1 A;  3FLJ A;  4CCV A;  2F99 A;  1YJN 3;  2SBL A;  5IG4 A;  2HOH A;  1UUG B;  1QAL A;  2BU4 A;  1JZO A;  1YGE A;  2BMO B;  2ZHX B;  2MC8 A;  1DMM A;  1ULJ B;  3DGO A;  5AIF A;  1E3V A;  1EQK A;  1TTO A;  1OHP A;  4XDV A;  1BU4 A;  3K63 A;  1WMN A;  3CU3 A;  5A0O B;  5AEW B;  1IQX A;  4JRF A;  3CC7 3;  3NV0 B;  1MWS A;  3JVC A;  1W6C A;  3NV0 A;  3PGB A;  1BSB A;  1RTU A;  2XRX B;  3CNX A;  1RJO A;  8RNT A;  3BND A;  2P0M A;  1YIT 3;  1YI2 3;  4IPB A;  1RDS A;  1UCI A;  4LEH A;  4MMY B;  1OHS A;  1OGX A;  1BAO A;  1TIJ A;  2IYJ A;  2W56 B;  3F9S A;  4O02 B;  2W56 A;  2P05 A;  2QEX 3;  2RBI A;  4Q53 A;  1YVB I;  3V92 A;  1NB5 I;  2XH9 A;  1LOV A;  1FGO A;  1RN7 A;  4HZB B;  1LOW A;  3WMD A;  2OOV C;  3WOD G;  3U1W A;  2BMR B;  3KSP A;  1BRN L; 
#chains in the Genus database with same CATH homology
 1ULI B;  3BNB A;  4HM6 B;  4K1U A;  3K5T A;  1JB2 A;  2WGO A;  1NU3 A;  5AYR B;  1RKY A;  1K8A 4;  1IDP A;  4J8T A;  1JKG B;  4MMX B;  3CCJ 3;  2ML5 A;  1AV4 A;  3EBY A;  3LH4 A;  3EBT A;  3SX1 A;  3AMO B;  2OWP A;  2W9Q A;  3AMO A;  2RFR A;  3JUQ A;  1VQ5 3;  3FG1 A;  3CD6 3;  4NHF A;  3Q1C A;  2OTJ 3;  4KVH A;  4N3V A;  3DY5 A;  1DYU A;  2KRT A;  3G0K A;  5CLK A;  2W9P A;  3L0R A;  2Z76 A;  4LSO A;  3JUM A;  3EE1 A;  2OQE A;  3B4O A;  1W6G A;  1O7N B;  3FF0 A;  3I55 3;  3PS8 A;  3UL6 A;  3K0Z A;  3X3X A;  2Z7A A;  3D3L A;  3B4P A;  1OGZ A;  2XFS A;  2CFG A;  1Q81 4;  2E2T A;  5CXO A;  5KP3 A;  1FA3 A;  1WMO A;  1QJG A;  2FXT A;  1U5O A;  2CC3 A;  5CF1 A;  1Z1S A;  4IIA A;  3CC4 3;  2CFW A;  1SJW A;  3G4S 3;  4HZ9 B;  3FG3 A;  4GB5 A;  4R80 A;  3CPW 2;  1Q42 A;  4HM5 B;  1KC8 4;  3QRD A;  1NDO B;  4R4K A;  1IK3 A;  3CCM 3;  1D6U A;  3NXJ A;  3SED A;  1RRH A;  3Q90 A;  3H3H A;  1SQW A;  2CWU A;  1JV2 B;  1JB4 A;  1W5Z A;  3UB1 A;  3FZW A;  3T8N A;  3DM8 A;  3DZL A;  4HM8 B;  3MKI A;  2HMO B;  2QA4 3;  4PEJ A;  1W4N A;  5HGR A;  4GL6 A;  3LTD A;  2D42 A;  3V98 A;  4O2H A;  4EC6 A;  1SIH A;  4G1M B;  2JDI H;  1N5H A;  3LOY A;  3F7X A;  3J7Y d;  1M1X B;  5AI1 A;  3EN8 A;  5EEO A;  4R9L A;  3OWS A;  3FF2 A;  1Q7Y 4;  3VGN A;  1VQ4 3;  5AII A;  3M8C A;  1ZX2 A;  2CH9 A;  3X42 A;  3LTC A;  5KP1 A;  1IU7 A;  1HU9 A;  3MSO A;  1ROV A;  2HMK B;  2QGU A;  3CCU 3;  3EC9 A;  4XDW A;  1W02 A;  4J9A A;  3EX9 A;  4K90 B;  4I4K A;  3DGN A;  4L7K A;  1OAC A;  3NQY A;  1MNL A;  5JPP A;  1FGM A;  3LTA A;  3IMA B;  5I97 A;  4BTW A;  3OW2 2;  1PU4 A;  1TFO A;  4OK0 A;  4KZ1 A;  4N6N B;  3CME 3;  3F40 A;  2K0M A;  1TP6 A;  1KD1 4;  4EV2 A;  2XEP A;  1V74 A;  1QAK A;  3CCQ 3;  3FKA A;  3H51 A;  3CC7 3;  2P0X A;  1IV9 A;  3F7S A;  3MHE A;  2LQV A;  4HM1 B;  2BT3 A;  2HMJ B;  4WYK A;  3CCS 3;  2BNG A;  4BTY A;  3S67 A;  4WP5 A;  1LNH A;  2ZDJ A;  3NHX A;  4RNY A;  3EB8 A;  1UUV B;  5ELU A;  5IF6 A;  2QIY A;  4RNZ A;  2B1X B;  5JPU A;  2YFI B;  1STD A;  3O8Y A;  3PYJ A;  1IV7 A;  2UX0 A;  4HM4 B;  2F98 A;  4K61 A;  1IT7 A;  3WOF B;  1W00 A;  3KFQ C;  2BHM A;  2CWT A;  1N9E A;  4H61 A;  1SPU A;  1UW1 A;  1VQN 3;  1VQP 3;  1GD4 A;  3SVA A;  2XFT A;  3A76 A;  1G96 A;  4N6V 0;  1L5G B;  1WNH A;  2O9U X;  1WMP A;  3SXX A;  2STD A;  3X3Y A;  3FGY A;  1TUH A;  1D6Z A;  4XB5 A;  1VQ6 3;  2CKF B;  1WQL B;  1STF I;  3LT9 A;  1D6Y A;  3DGL A;  1GY5 A;  2WO0 A;  4AKY A;  3EJV A;  5D82 A;  1F8N A;  3IPT A;  3HZP A;  3X40 A;  1EKM A;  2BMQ B;  3LT8 A;  4N6T A;  4STD A;  3NM7 A;  1ZO2 A;  1VQL 3;  1IVV A;  3D9R A;  5EQL A;  2HMN B;  1OHO A;  3DGM A;  4O3V A;  3CCL 3;  4XBY A;  2O3O A;  2WOH A;  4MJD A;  1M90 4;  1W7C A;  2Z77 A;  2CWV A;  1QVF 2;  2R4I A;  2P09 A;  2KXG A;  2OQE C;  1KQS 2;  3HII A;  4XBT A;  3T0U A;  5AYS C;  2MF7 A;  3MG3 A;  4HKV B;  5LC7 A;  2F86 B;  1VZZ A;  5AIG A;  1FGT A;  1GD3 A;  2P38 A;  1O7G B;  4WHA A;  3S28 A;  3SOY A;  4BTX A;  1W2B 2;  2PNC A;  2HML B;  3PCR A;  1MOL A;  1W6Y A;  1WTH A;  5G2G A;  1OCV A;  4OVM A;  3STD A;  1W2Z A;  3OV4 A;  1YHQ 3;  3I56 3;  1CQS A;  3LZA A;  1NB3 I;  4FMD A;  5BXQ A;  2RCD A;  2Y73 A;  3BLZ A;  1S5A A;  3DUK A;  4ORL A;  1C7H A;  2CIU A;  3JUO A;  3MPH A;  3S29 A;  2GEX A;  5CF2 A;  1VQ9 3;  2RSX A;  3MWZ A;  4MEI A;  3U97 A;  3UJM A;  3KKG A;  1N8Q A;  5JBS A;  4FCZ A;  3GZB A;  3NX0 A;  3WA3 A;  3PZW A;  1LVN A;  3CCV 3;  2OTL 3;  5STD A;  2JQ5 A;  3LYG A;  1IQY A;  2WOF A;  3S5C A;  1JB5 A;  3NQZ A;  3NM2 A;  3VSY A;  1AVK A;  3CC2 3;  3WDG B;  1O7M B;  1TFK A;  1OH0 A;  3EN1 B;  1CEW I;  3PXM A;  4AEQ A;  1JJ2 2;  3S27 A;  3EHC A;  1Q86 4;  2IUK A;  1A2K A;  2C11 A;  1N9J A;  3K9M C;  2M7O A;  4EBG A;  4RZM A;  3OXA A;  4R9K A;  1Q40 A;  1GS3 A;  1R4C A;  2IA7 A;  4HVN A;  1IVX A;  3F14 A;  3VF1 A;  2XF3 A;  2IMJ A;  2YX9 A;  2WGQ A;  3LTB A;  1QAF A;  1SII A;  4JF8 A;  1FGQ A;  4KFF A;  1LXE A;  4O8S A;  1K41 A;  2K54 A;  3X3Z A;  3FH1 A;  5DRE A;  2B24 B;  3F8H A;  3FG4 A;  4N6O B;  1NJI 4;  2Y74 A;  4FMC A;  2CG1 A;  1RRL A;  3GWR A;  3G71 3;  3WA2 X;  4FMA A;  3KII A;  2CW9 A;  1O7P B;  1KWI A;  2E2V A;  2FNQ A;  1JN5 A;  2CFL A;  4WYK B;  2GU3 A;  1JNQ A;  3F8X A;  3MYT A;  4HM3 B;  3TDG A;  3BNE A;  2I9W A;  4HM0 B;  4HM2 B;  2XSH B;  3EF8 A;  3KZT A;  3RDE A;  4AKZ A;  5TGN A;  2YFL B;  4LZI A;  4HJL B;  2W03 A;  1CYV A;  4EXR A;  1YJ9 3;  3GZX B;  3JUN A;  2W04 A;  1TU5 A;  2W2C A;  1K9M 4;  3KE7 A;  1K73 4;  4XM4 A;  2OCT A;  4WWU C;  3DMC A;  3OX9 A;  1HKX A;  5CK6 A;  3ROB A;  1DVD A;  1IQ8 A;  5BVB A;  1Y4K A;  3LXU X;  1QVG 2;  3CCE 3;  3HX8 A;  1QMA A;  3N9H A;  4EYC A;  1W01 A;  4MMZ B;  4XBX A;  4FCJ A;  3EQQ B;  1T5Y A;  5FGO A;  2GBW B;  3FCS B;  1VQ8 3;  1A2V A;  2ZL8 A;  3NBJ A;  2OOV A;  3PCS A;  1VQK 3;  5IEP A;  3UNL A;  1E97 A;  1NO3 A;  4KFD A;  2GU1 A;  5DRV A;  1A67 A;  3G16 A;  3RGA A;  2E2U A;  1IT8 A;  5D83 A;  1VQM 3;  1UI8 A;  3ECF A;  1JKG A;  1OF5 B;  3NUV A;  2CFD A;  1OF5 A;  5EVH A;  3E99 A;  3MG2 A;  5IG5 A;  1ISK A;  4L8P A;  1N5P A;  4K1V A;  5D81 A;  1DMN A;  1O7W B;  2CHC A;  4LGQ A;  4X2O A;  1LOX A;  1NWW A;  1CYU A;  1FUW A;  3GZY B;  2BO9 B;  1PFP A;  3IJE B;  3JUP A;  4EV5 A;  3MG1 A;  4N6U A;  1OUN A;  3ER7 A;  1JRQ A;  4LMI A;  2C10 A;  2XSO B;  5IG0 A;  3BNC A;  3GAX A;  2IUJ A;  4NRE A;  1BUQ A;  4H3U A;  2CFK A;  5ELJ A;  2GBX B;  2Z6B A;  3DXO A;  3HK4 A;  2RGQ A;  3G6E 3;  3RGR A;  3UL5 A;  4L8O A;  1OPY A;  5AEU B;  3B8L A;  3CXC 2;  2PZV A;  1M1K 4;  3NBB A;  4FMB A;  1A90 A;  1GYB A;  4N6M A;  1M9G A;  4R1K A;  1J2B A;  3G8Z A;  5IER A;  4WFO A;  2KCD A;  5IG3 A;  4TX4 A;  2GEY A;  2CG0 A;  2YFJ B;  3CMA 3;  3FSD A;  1KSI A;  1O7H B;  3HIG A;  1K28 A;  3T8U A;  1S72 3;  3CNM A;  1UUW B;  3SOA A;  3Q2P A;  1YJW 3;  3OWY A;  3GZR A;  4FR9 A;  4QWT A;  1E3R A;  7STD A;  1U8C B;  3N54 B;  1FGR A;  3WOE B;  2W6J H;  4N6L A;  1YIJ 3;  1GY7 A;  5KP4 A;  2L4V A;  4HBR A;  2D1W A;  1VQO 3;  5IEN A;  4OUQ A;  3KSE D;  4ZM8 A;  8CHO A;  1Q40 B;  2W0Q A;  2XR8 B;  1N8R 4;  5LC6 A;  3B7C A;  5IW9 A;  3NBR A;  1EG9 B;  2CK3 H;  2LYX A;  1ROA A;  2XGN A;  4RBN A;  2A15 A;  1GY6 A;  3QK9 A;  3K7C A;  1AR0 A;  3GRD A;  5IEO A;  3BB9 A;  5FW5 A;  4HYZ A;  3N8B A;  1IVU A;  3CCR 3;  3HI7 A;  2GXF A;  3ALA A;  1DVC A;  4KFE A;  2HMM B;  3LML A;  4FCM A;  2XGL A;  4X2H A;  1AVL A;  1DMQ A;  1JN5 B;  1EA2 A;  1Q82 4;  1IVW A;  3OWU A;  4HM7 B;  2INX A;  3CPO A;  2V1L A;  3KN4 A;  1UI7 A;  2ML6 A;  3SLU A;  5AIH A;  2Q07 A;  1ASK A;  4CDL A;  4IT7 A;  2FGT A;  3I0Y A;  6STD A;  1VQ7 3;  3X41 A;  3V99 A;  4U13 A;  1US1 A;  3FLJ A;  4CCV A;  2F99 A;  1YJN 3;  2SBL A;  5IG4 A;  1QAL A;  1YGE A;  2BMO B;  2MC8 A;  1DMM A;  1ULJ B;  3DGO A;  5AIF A;  1E3V A;  1EQK A;  1OHP A;  4XDV A;  3K63 A;  1WMN A;  3CU3 A;  5A0O B;  5AEW B;  1IQX A;  4JRF A;  3NV0 B;  3JVC A;  1W6C A;  3NV0 A;  3PGB A;  2XRX B;  3CNX A;  1RJO A;  3BND A;  2P0M A;  1YIT 3;  1YI2 3;  4IPB A;  4LEH A;  4MMY B;  1OHS A;  1OGX A;  1TIJ A;  3F9S A;  2W56 B;  4O02 B;  2W56 A;  2P05 A;  2QEX 3;  4Q53 A;  1YVB I;  3V92 A;  1NB5 I;  2XH9 A;  1FGO A;  1RN7 A;  4HZB B;  3WMD A;  3WOD G;  2OOV C;  3U1W A;  2BMR B;  3KSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...