2P13A

Transporter associated domain corc_hlyc from nitrosomonas europaea
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
EKVVAEQQADGTWLMDGWISIRKASNLLEHDLVDEAERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the transporter associated domain CorC_HlyC from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
molecule keywords CBS domain
total genus 21
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2p13A00
2GQUA 1VAOA 4ML8A 4O95A 3LAEA 4BBYA 3S1EA 1SB3B 1T3QC 1DZNA 2BVFA 1I19A 1N5WC 1N60C 1RM6B 1MBBA 2AXRA 1V97A 2QKNA 3AN1A 1N62C 2VFUA 1N61C 1W1KA 1JRPA 5AE3A 1MBTA 1VDVA 2NQWA 4BC7A 3KJMA 1W1MA 1E0YA 1FFUC 1ZXIC 3NVYB 3BW7A 1FIQB 5ADZA 5FXDA 3W8ZA 2E3TA 1WVEA 2YVSA 3S1DA 3HRDC 4BC9A 2VFRA 1WVFA 1DIQA 2GQTA 1E8HA 2O3GA 1AHZA 1QLTA 1FO4A 1W1QA 1WYGA 2RK5A 5FXPA 3S1CA 1W1OA 2I0KA 3DQ0A 4JB1A 5FXEA 3W8WA 2W3SA 3NS1B 1N5XA 1N63C 5AE1A 1HSKA 4JAYA 1W1SA 3I99A 2VFVA 2VFSA 1E8GA 1W1JA 5FXFA 2PLSA 1F0XA 1E8FA 1W1RA 4MLAA 2MBRA 2VAOA 4BCAA 2P4PA 2OAIA 3S1FA 3NVZB 3AMZA 3NVVB 4HG0A 2PLIA 2W55A 1DIIA 3LLBA 2R2ZA 2W54A 3EUB3 3PM9A 5HMRA 3W8XA 1JROA 3C0PA 3DEDA 4OALA 3JS8A 4PYTA 5G5GB 5AE2A 2BVGA 1W1LA 2P3HA 2EXRA 3TX1A 4XLOA 3NRZB 1AHUA 4ZOHB 2VFTA 3ETRB 1UXYA 2P13A 1ZR6A 3B9JB 2Q85A 2Q4WA 1AHVA 1QLUA 2W3RA 5G5HB 2R8DA 2QPMA 2BVHA 3NVWB 3SR6B 1FFVC 3AM9A 5HHZA 5HQXA
chains in the Genus database with same CATH superfamily
2GQUA 1VAOA 4ML8A 4O95A 3LAEA 4BBYA 4DNSA 3S1EA 1SB3B 1T3QC 4PWCA 1DZNA 2BVFA 1I19A 1N5WC 1N60C 1RM6B 1MBBA 2AXRA 1V97A 2QKNA 3AN1A 1N62C 2VFUA 4PZFA 1N61C 1W1KA 3D2JA 1JRPA 5AE3A 1MBTA 1VDVA 2NQWA 4BC7A 3VTEA 3KJMA 1W1MA 1E0YA 1FFUC 1ZXIC 3GSYA 3NVYB 3BW7A 1FIQB 5L6FA 5FXDA 3W8ZA 2E3TA 5ADZA 1WVEA 2YVSA 3S1DA 3HRDC 4BC9A 2VFRA 1WVFA 1DIQA 2Y08A 2GQTA 1E8HA 2O3GA 2UUVA 2Y3SA 5I1VA 1AHZA 1QLTA 3TSJA 1FO4A 4PVJA 3RJAA 4EC3A 1W1QA 1WYGA 2RK5A 5FXPA 3S1CA 3FW7A 1W1OA 2I0KA 3DQ0A 4JB1A 5FXEA 3W8WA 2W3SA 3NS1B 1N5XA 1N63C 5AE1A 1HSKA 4JAYA 1W1SA 3I99A 4PVEA 2VFVA 4PWBA 2VFSA 1E8GA 4UD8A 1W1JA 3D2HA 5FXFA 2PLSA 1F0XA 1E8FA 1W1RA 4MLAA 2MBRA 2VAOA 3HSUA 4BCAA 2P4PA 2OAIA 3S1FA 3NVZB 3AMZA 3NVVB 4HG0A 2PLIA 2W55A 5D79A 1DIIA 3LLBA 3FW8A 2R2ZA 2Y4GA 5I1WA 4PVKA 2W54A 4PVHA 3EUB3 3PM9A 5HMRA 3W8XA 1JROA 3C0PA 3DEDA 3RJ8A 2WDWA 4OALA 3FW9A 3JS8A 4PYTA 3POPA 5G5GB 5AE2A 2BVGA 3TSHA 1W1LA 2P3HA 3PQBA 2EXRA 3TX1A 4XLOA 3NRZB 1AHUA 4ZOHB 2VFTA 3ETRB 1UXYA 2P13A 5L6GA 3D2DA 1ZR6A 3B9JB 2Q85A 2Q4WA 1AHVA 1QLUA 2W3RA 2IPIA 5G5HB 2R8DA 2Y3RA 2QPMA 2BVHA 2UUUA 3NVWB 3SR6B 5AWVA 1FFVC 3FWAA 3AM9A 5HHZA 5K8EA 5HQXA
chains in the Genus database with same CATH topology
2GQUA 1VAOA 4ML8A 4O95A 3LAEA 4BBYA 4DNSA 3S1EA 1SB3B 1T3QC 4PWCA 1DZNA 2BVFA 1I19A 1N5WC 1N60C 1RM6B 1MBBA 2AXRA 1V97A 2QKNA 3AN1A 1N62C 2VFUA 4PZFA 1N61C 1W1KA 3D2JA 1JRPA 5AE3A 1MBTA 1VDVA 2NQWA 4BC7A 3VTEA 3KJMA 1W1MA 1E0YA 1FFUC 1ZXIC 3GSYA 3NVYB 3BW7A 1FIQB 5L6FA 5FXDA 3W8ZA 2E3TA 5ADZA 1WVEA 2YVSA 3S1DA 3HRDC 4BC9A 2VFRA 1WVFA 1DIQA 2Y08A 2GQTA 1E8HA 2O3GA 2UUVA 2Y3SA 5I1VA 1AHZA 1QLTA 3TSJA 1FO4A 4PVJA 3RJAA 4EC3A 1W1QA 1WYGA 2RK5A 5FXPA 3S1CA 3FW7A 1W1OA 2I0KA 3DQ0A 4JB1A 5FXEA 3W8WA 2W3SA 3NS1B 1N5XA 1N63C 5AE1A 1HSKA 4JAYA 1W1SA 3I99A 4PVEA 2VFVA 4PWBA 2VFSA 1E8GA 4UD8A 1W1JA 3D2HA 5FXFA 2PLSA 1F0XA 1E8FA 1W1RA 4MLAA 2MBRA 2VAOA 3HSUA 4BCAA 2P4PA 2OAIA 3S1FA 3NVZB 3AMZA 3NVVB 4HG0A 2PLIA 2W55A 5D79A 1DIIA 3LLBA 3FW8A 2R2ZA 2Y4GA 5I1WA 4PVKA 2W54A 4PVHA 3EUB3 3PM9A 5HMRA 3W8XA 1JROA 3C0PA 3DEDA 3RJ8A 2WDWA 4OALA 3FW9A 3JS8A 4PYTA 3POPA 5G5GB 5AE2A 2BVGA 3TSHA 1W1LA 2P3HA 3PQBA 2EXRA 3TX1A 4XLOA 3NRZB 1AHUA 4ZOHB 2VFTA 3ETRB 1UXYA 2P13A 5L6GA 3D2DA 1ZR6A 3B9JB 2Q85A 2Q4WA 1AHVA 1QLUA 2W3RA 2IPIA 5G5HB 2R8DA 2Y3RA 2QPMA 2BVHA 2UUUA 3NVWB 3SR6B 5AWVA 1FFVC 3FWAA 3AM9A 5HHZA 5K8EA 5HQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQU A;  1VAO A;  4ML8 A;  4O95 A;  3LAE A;  4BBY A;  3S1E A;  1SB3 B;  1T3Q C;  1DZN A;  2BVF A;  1I19 A;  1N5W C;  1N60 C;  1RM6 B;  1MBB A;  2AXR A;  1V97 A;  2QKN A;  3AN1 A;  1N62 C;  2VFU A;  1N61 C;  1W1K A;  1JRP A;  5AE3 A;  1MBT A;  1VDV A;  2NQW A;  4BC7 A;  3KJM A;  1W1M A;  1E0Y A;  1FFU C;  1ZXI C;  3NVY B;  3BW7 A;  1FIQ B;  5ADZ A;  5FXD A;  3W8Z A;  2E3T A;  1WVE A;  2YVS A;  3S1D A;  3HRD C;  4BC9 A;  2VFR A;  1WVF A;  1DIQ A;  2GQT A;  1E8H A;  2O3G A;  1AHZ A;  1QLT A;  1FO4 A;  1W1Q A;  1WYG A;  2RK5 A;  5FXP A;  3S1C A;  1W1O A;  2I0K A;  3DQ0 A;  4JB1 A;  5FXE A;  3W8W A;  2W3S A;  3NS1 B;  1N5X A;  1N63 C;  5AE1 A;  1HSK A;  4JAY A;  1W1S A;  3I99 A;  2VFV A;  2VFS A;  1E8G A;  1W1J A;  5FXF A;  2PLS A;  1F0X A;  1E8F A;  1W1R A;  4MLA A;  2MBR A;  2VAO A;  4BCA A;  2P4P A;  2OAI A;  3S1F A;  3NVZ B;  3AMZ A;  3NVV B;  4HG0 A;  2PLI A;  2W55 A;  1DII A;  3LLB A;  2R2Z A;  2W54 A;  3EUB 3;  3PM9 A;  5HMR A;  3W8X A;  1JRO A;  3C0P A;  3DED A;  4OAL A;  3JS8 A;  4PYT A;  5G5G B;  5AE2 A;  2BVG A;  1W1L A;  2P3H A;  2EXR A;  3TX1 A;  4XLO A;  3NRZ B;  1AHU A;  4ZOH B;  2VFT A;  3ETR B;  1UXY A;  2P13 A;  1ZR6 A;  3B9J B;  2Q85 A;  2Q4W A;  1AHV A;  1QLU A;  2W3R A;  5G5H B;  2R8D A;  2QPM A;  2BVH A;  3NVW B;  3SR6 B;  1FFV C;  3AM9 A;  5HHZ A;  5HQX A; 
#chains in the Genus database with same CATH topology
 2GQU A;  1VAO A;  4ML8 A;  4O95 A;  3LAE A;  4BBY A;  4DNS A;  3S1E A;  1SB3 B;  1T3Q C;  4PWC A;  1DZN A;  2BVF A;  1I19 A;  1N5W C;  1N60 C;  1RM6 B;  1MBB A;  2AXR A;  1V97 A;  2QKN A;  3AN1 A;  1N62 C;  2VFU A;  4PZF A;  1N61 C;  1W1K A;  3D2J A;  1JRP A;  5AE3 A;  1MBT A;  1VDV A;  2NQW A;  4BC7 A;  3VTE A;  3KJM A;  1W1M A;  1E0Y A;  1FFU C;  1ZXI C;  3GSY A;  3NVY B;  3BW7 A;  1FIQ B;  5L6F A;  5FXD A;  3W8Z A;  2E3T A;  5ADZ A;  1WVE A;  2YVS A;  3S1D A;  3HRD C;  4BC9 A;  2VFR A;  1WVF A;  1DIQ A;  2Y08 A;  2GQT A;  1E8H A;  2O3G A;  2UUV A;  2Y3S A;  5I1V A;  1AHZ A;  1QLT A;  3TSJ A;  1FO4 A;  4PVJ A;  3RJA A;  4EC3 A;  1W1Q A;  1WYG A;  2RK5 A;  5FXP A;  3S1C A;  3FW7 A;  1W1O A;  2I0K A;  3DQ0 A;  4JB1 A;  5FXE A;  3W8W A;  2W3S A;  3NS1 B;  1N5X A;  1N63 C;  5AE1 A;  1HSK A;  4JAY A;  1W1S A;  3I99 A;  4PVE A;  2VFV A;  4PWB A;  2VFS A;  1E8G A;  4UD8 A;  1W1J A;  3D2H A;  5FXF A;  2PLS A;  1F0X A;  1E8F A;  1W1R A;  4MLA A;  2MBR A;  2VAO A;  3HSU A;  4BCA A;  2P4P A;  2OAI A;  3S1F A;  3NVZ B;  3AMZ A;  3NVV B;  4HG0 A;  2PLI A;  2W55 A;  5D79 A;  1DII A;  3LLB A;  3FW8 A;  2R2Z A;  2Y4G A;  5I1W A;  4PVK A;  2W54 A;  4PVH A;  3EUB 3;  3PM9 A;  5HMR A;  3W8X A;  1JRO A;  3C0P A;  3DED A;  3RJ8 A;  2WDW A;  4OAL A;  3FW9 A;  3JS8 A;  4PYT A;  3POP A;  5G5G B;  5AE2 A;  2BVG A;  3TSH A;  1W1L A;  2P3H A;  3PQB A;  2EXR A;  3TX1 A;  4XLO A;  3NRZ B;  1AHU A;  4ZOH B;  2VFT A;  3ETR B;  1UXY A;  2P13 A;  5L6G A;  3D2D A;  1ZR6 A;  3B9J B;  2Q85 A;  2Q4W A;  1AHV A;  1QLU A;  2W3R A;  2IPI A;  5G5H B;  2R8D A;  2Y3R A;  2QPM A;  2BVH A;  2UUU A;  3NVW B;  3SR6 B;  5AWV A;  1FFV C;  3FWA A;  3AM9 A;  5HHZ A;  5K8E A;  5HQX A; 
#chains in the Genus database with same CATH homology
 2GQU A;  1VAO A;  4ML8 A;  4O95 A;  3LAE A;  4BBY A;  4DNS A;  3S1E A;  1SB3 B;  1T3Q C;  4PWC A;  1DZN A;  2BVF A;  1I19 A;  1N5W C;  1N60 C;  1RM6 B;  1MBB A;  2AXR A;  1V97 A;  2QKN A;  3AN1 A;  1N62 C;  2VFU A;  4PZF A;  1N61 C;  1W1K A;  3D2J A;  1JRP A;  5AE3 A;  1MBT A;  1VDV A;  2NQW A;  4BC7 A;  3VTE A;  3KJM A;  1W1M A;  1E0Y A;  1FFU C;  1ZXI C;  3GSY A;  3NVY B;  3BW7 A;  1FIQ B;  5L6F A;  5FXD A;  3W8Z A;  2E3T A;  5ADZ A;  1WVE A;  2YVS A;  3S1D A;  3HRD C;  4BC9 A;  2VFR A;  1WVF A;  1DIQ A;  2Y08 A;  2GQT A;  1E8H A;  2O3G A;  2UUV A;  2Y3S A;  5I1V A;  1AHZ A;  1QLT A;  3TSJ A;  1FO4 A;  4PVJ A;  3RJA A;  4EC3 A;  1W1Q A;  1WYG A;  2RK5 A;  5FXP A;  3S1C A;  3FW7 A;  1W1O A;  2I0K A;  3DQ0 A;  4JB1 A;  5FXE A;  3W8W A;  2W3S A;  3NS1 B;  1N5X A;  1N63 C;  5AE1 A;  1HSK A;  4JAY A;  1W1S A;  3I99 A;  4PVE A;  2VFV A;  4PWB A;  2VFS A;  1E8G A;  4UD8 A;  1W1J A;  3D2H A;  5FXF A;  2PLS A;  1F0X A;  1E8F A;  1W1R A;  4MLA A;  2MBR A;  2VAO A;  3HSU A;  4BCA A;  2P4P A;  2OAI A;  3S1F A;  3NVZ B;  3AMZ A;  3NVV B;  4HG0 A;  2PLI A;  2W55 A;  5D79 A;  1DII A;  3LLB A;  3FW8 A;  2R2Z A;  2Y4G A;  5I1W A;  4PVK A;  2W54 A;  4PVH A;  3EUB 3;  3PM9 A;  5HMR A;  3W8X A;  1JRO A;  3C0P A;  3DED A;  3RJ8 A;  2WDW A;  4OAL A;  3FW9 A;  3JS8 A;  4PYT A;  3POP A;  5G5G B;  5AE2 A;  2BVG A;  3TSH A;  1W1L A;  2P3H A;  3PQB A;  2EXR A;  3TX1 A;  4XLO A;  3NRZ B;  1AHU A;  4ZOH B;  2VFT A;  3ETR B;  1UXY A;  2P13 A;  5L6G A;  3D2D A;  1ZR6 A;  3B9J B;  2Q85 A;  2Q4W A;  1AHV A;  1QLU A;  2W3R A;  2IPI A;  5G5H B;  2R8D A;  2Y3R A;  2QPM A;  2BVH A;  2UUU A;  3NVW B;  3SR6 B;  5AWV A;  1FFV C;  3FWA A;  3AM9 A;  5HHZ A;  5K8E A;  5HQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...