2P13A

Transporter associated domain corc_hlyc from nitrosomonas europaea
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
EKVVAEQQADGTWLMDGWISIRKASNLLEHDLVDEAERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the transporter associated domain CorC_HlyC from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
molecule keywords CBS domain
total genus 21
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2p13A00
1FIQB 3W8WA 1W1RA 2Q4WA 5HHZA 3AN1A 2VFSA 1E8HA 3S1DA 1N63C 1JRPA 2OAIA 3TX1A 1WYGA 3DEDA 4OALA 5AE1A 4ZOHB 3W8XA 1N5XA 1E0YA 3PM9A 1W1SA 4BBYA 1UXYA 2QKNA 5HMRA 5FXEA 3LAEA 1WVEA 5AE3A 5FXPA 1W1MA 1VDVA 3SR6B 5ADZA 4BC7A 5FXFA 5HQXA 2W55A 1DZNA 1F0XA 2R2ZA 3NVYB 2P4PA 2MBRA 3S1CA 2QPMA 3AM9A 3NRZB 1FO4A 1E8FA 2VFVA 2I0KA 1FFUC 2W3RA 5G5GB 1FFVC 2VFRA 2O3GA 1ZR6A 2NQWA 3JS8A 2GQTA 1QLTA 2YVSA 1DIQA 4BC9A 1E8GA 3EUB3 1N60C 2W54A 4ML8A 2PLIA 3BW7A 3W8ZA 2VAOA 1V97A 1N61C 4PYTA 3KJMA 1W1KA 2R8DA 1MBTA 3I99A 4BCAA 2BVHA 3AMZA 2VFUA 1W1QA 3NS1B 1AHUA 3S1EA 3NVWB 1AHVA 1ZXIC 1AHZA 3B9JB 1DIIA 1MBBA 1W1JA 3NVVB 1W1OA 2E3TA 5AE2A 3S1FA 4JAYA 3HRDC 2BVGA 2AXRA 2P13A 2VFTA 2W3SA 1RM6B 2P3HA 3C0PA 2GQUA 3DQ0A 3NVZB 2EXRA 2RK5A 4JB1A 4MLAA 5G5HB 1I19A 1N62C 5FXDA 4O95A 1W1LA 2Q85A 1WVFA 1VAOA 2BVFA 3LLBA 4HG0A 1N5WC 1QLUA 2PLSA 1JROA 3ETRB 1HSKA 1T3QC 4XLOA 1SB3B
chains in the Genus database with same CATH superfamily
1FIQB 3W8WA 1W1RA 2Q4WA 5HHZA 3AN1A 2VFSA 1E8HA 3FW7A 4PVKA 3S1DA 1N63C 1JRPA 2OAIA 3TX1A 2UUUA 1WYGA 4PZFA 5AWVA 3D2HA 3DEDA 4OALA 5AE1A 4ZOHB 3W8XA 1N5XA 1E0YA 3PM9A 1W1SA 4BBYA 1UXYA 2QKNA 5HMRA 5FXEA 3LAEA 1WVEA 3RJ8A 2Y4GA 4UD8A 5AE3A 3PQBA 3FW9A 2Y08A 5FXPA 1W1MA 1VDVA 3SR6B 5ADZA 3D2DA 5FXFA 4BC7A 5HQXA 5I1WA 4PWBA 2W55A 1DZNA 1F0XA 2R2ZA 3NVYB 2P4PA 2MBRA 3S1CA 2QPMA 3AM9A 3NRZB 1FO4A 1E8FA 3FW8A 2VFVA 2I0KA 1FFUC 2W3RA 5G5GB 1FFVC 2VFRA 2O3GA 1ZR6A 2NQWA 2WDWA 3JS8A 2GQTA 2UUVA 1QLTA 2YVSA 2Y3RA 1DIQA 4BC9A 1E8GA 2IPIA 5L6GA 3RJAA 3EUB3 1N60C 2W54A 4ML8A 2PLIA 3BW7A 3TSJA 2VAOA 1V97A 3W8ZA 1N61C 4PYTA 3KJMA 1W1KA 2R8DA 1MBTA 2Y3SA 3I99A 4BCAA 2BVHA 3AMZA 2VFUA 3POPA 1W1QA 3NS1B 4PVJA 1AHUA 3S1EA 3NVWB 1AHVA 1ZXIC 1AHZA 3B9JB 1DIIA 1MBBA 3HSUA 1W1JA 5I1VA 3NVVB 1W1OA 2E3TA 5AE2A 3TSHA 3S1FA 4JAYA 3HRDC 2BVGA 2AXRA 2P13A 2VFTA 2W3SA 1RM6B 2P3HA 4EC3A 3C0PA 2GQUA 3DQ0A 3GSYA 3NVZB 5L6FA 2EXRA 5D79A 2RK5A 4JB1A 4MLAA 4PVHA 5G5HB 3FWAA 1I19A 4PVEA 1N62C 3VTEA 5FXDA 4O95A 4DNSA 4PWCA 1W1LA 3D2JA 2Q85A 5K8EA 1WVFA 1VAOA 2BVFA 3LLBA 4HG0A 1N5WC 1QLUA 2PLSA 1JROA 3ETRB 1HSKA 1T3QC 4XLOA 1SB3B
chains in the Genus database with same CATH topology
1FIQB 3W8WA 1W1RA 2Q4WA 5HHZA 3AN1A 2VFSA 1E8HA 3FW7A 4PVKA 3S1DA 1N63C 1JRPA 2OAIA 3TX1A 2UUUA 1WYGA 4PZFA 5AWVA 3D2HA 3DEDA 4OALA 5AE1A 4ZOHB 3W8XA 1N5XA 1E0YA 3PM9A 1W1SA 4BBYA 1UXYA 2QKNA 5HMRA 5FXEA 3LAEA 1WVEA 3RJ8A 2Y4GA 4UD8A 5AE3A 3PQBA 3FW9A 2Y08A 5FXPA 1W1MA 1VDVA 3SR6B 5ADZA 3D2DA 5FXFA 4BC7A 5HQXA 5I1WA 4PWBA 2W55A 1DZNA 1F0XA 2R2ZA 3NVYB 2P4PA 2MBRA 3S1CA 2QPMA 3AM9A 3NRZB 1FO4A 1E8FA 3FW8A 2VFVA 2I0KA 1FFUC 2W3RA 5G5GB 1FFVC 2VFRA 2O3GA 1ZR6A 2NQWA 2WDWA 3JS8A 2GQTA 2UUVA 1QLTA 2YVSA 2Y3RA 1DIQA 4BC9A 1E8GA 2IPIA 5L6GA 3RJAA 3EUB3 1N60C 2W54A 4ML8A 2PLIA 3BW7A 3TSJA 2VAOA 1V97A 3W8ZA 1N61C 4PYTA 3KJMA 1W1KA 2R8DA 1MBTA 2Y3SA 3I99A 4BCAA 2BVHA 3AMZA 2VFUA 3POPA 1W1QA 3NS1B 4PVJA 1AHUA 3S1EA 3NVWB 1AHVA 1ZXIC 1AHZA 3B9JB 1DIIA 1MBBA 3HSUA 1W1JA 5I1VA 3NVVB 1W1OA 2E3TA 5AE2A 3TSHA 3S1FA 4JAYA 3HRDC 2BVGA 2AXRA 2P13A 2VFTA 2W3SA 1RM6B 2P3HA 4EC3A 3C0PA 2GQUA 3DQ0A 3GSYA 3NVZB 5L6FA 2EXRA 5D79A 2RK5A 4JB1A 4MLAA 4PVHA 5G5HB 3FWAA 1I19A 4PVEA 1N62C 3VTEA 5FXDA 4O95A 4DNSA 4PWCA 1W1LA 3D2JA 2Q85A 5K8EA 1WVFA 1VAOA 2BVFA 3LLBA 4HG0A 1N5WC 1QLUA 2PLSA 1JROA 3ETRB 1HSKA 1T3QC 4XLOA 1SB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ B;  3W8W A;  1W1R A;  2Q4W A;  5HHZ A;  3AN1 A;  2VFS A;  1E8H A;  3S1D A;  1N63 C;  1JRP A;  2OAI A;  3TX1 A;  1WYG A;  3DED A;  4OAL A;  5AE1 A;  4ZOH B;  3W8X A;  1N5X A;  1E0Y A;  3PM9 A;  1W1S A;  4BBY A;  1UXY A;  2QKN A;  5HMR A;  5FXE A;  3LAE A;  1WVE A;  5AE3 A;  5FXP A;  1W1M A;  1VDV A;  3SR6 B;  5ADZ A;  4BC7 A;  5FXF A;  5HQX A;  2W55 A;  1DZN A;  1F0X A;  2R2Z A;  3NVY B;  2P4P A;  2MBR A;  3S1C A;  2QPM A;  3AM9 A;  3NRZ B;  1FO4 A;  1E8F A;  2VFV A;  2I0K A;  1FFU C;  2W3R A;  5G5G B;  1FFV C;  2VFR A;  2O3G A;  1ZR6 A;  2NQW A;  3JS8 A;  2GQT A;  1QLT A;  2YVS A;  1DIQ A;  4BC9 A;  1E8G A;  3EUB 3;  1N60 C;  2W54 A;  4ML8 A;  2PLI A;  3BW7 A;  3W8Z A;  2VAO A;  1V97 A;  1N61 C;  4PYT A;  3KJM A;  1W1K A;  2R8D A;  1MBT A;  3I99 A;  4BCA A;  2BVH A;  3AMZ A;  2VFU A;  1W1Q A;  3NS1 B;  1AHU A;  3S1E A;  3NVW B;  1AHV A;  1ZXI C;  1AHZ A;  3B9J B;  1DII A;  1MBB A;  1W1J A;  3NVV B;  1W1O A;  2E3T A;  5AE2 A;  3S1F A;  4JAY A;  3HRD C;  2BVG A;  2AXR A;  2P13 A;  2VFT A;  2W3S A;  1RM6 B;  2P3H A;  3C0P A;  2GQU A;  3DQ0 A;  3NVZ B;  2EXR A;  2RK5 A;  4JB1 A;  4MLA A;  5G5H B;  1I19 A;  1N62 C;  5FXD A;  4O95 A;  1W1L A;  2Q85 A;  1WVF A;  1VAO A;  2BVF A;  3LLB A;  4HG0 A;  1N5W C;  1QLU A;  2PLS A;  1JRO A;  3ETR B;  1HSK A;  1T3Q C;  4XLO A;  1SB3 B; 
#chains in the Genus database with same CATH topology
 1FIQ B;  3W8W A;  1W1R A;  2Q4W A;  5HHZ A;  3AN1 A;  2VFS A;  1E8H A;  3FW7 A;  4PVK A;  3S1D A;  1N63 C;  1JRP A;  2OAI A;  3TX1 A;  2UUU A;  1WYG A;  4PZF A;  5AWV A;  3D2H A;  3DED A;  4OAL A;  5AE1 A;  4ZOH B;  3W8X A;  1N5X A;  1E0Y A;  3PM9 A;  1W1S A;  4BBY A;  1UXY A;  2QKN A;  5HMR A;  5FXE A;  3LAE A;  1WVE A;  3RJ8 A;  2Y4G A;  4UD8 A;  5AE3 A;  3PQB A;  3FW9 A;  2Y08 A;  5FXP A;  1W1M A;  1VDV A;  3SR6 B;  5ADZ A;  3D2D A;  5FXF A;  4BC7 A;  5HQX A;  5I1W A;  4PWB A;  2W55 A;  1DZN A;  1F0X A;  2R2Z A;  3NVY B;  2P4P A;  2MBR A;  3S1C A;  2QPM A;  3AM9 A;  3NRZ B;  1FO4 A;  1E8F A;  3FW8 A;  2VFV A;  2I0K A;  1FFU C;  2W3R A;  5G5G B;  1FFV C;  2VFR A;  2O3G A;  1ZR6 A;  2NQW A;  2WDW A;  3JS8 A;  2GQT A;  2UUV A;  1QLT A;  2YVS A;  2Y3R A;  1DIQ A;  4BC9 A;  1E8G A;  2IPI A;  5L6G A;  3RJA A;  3EUB 3;  1N60 C;  2W54 A;  4ML8 A;  2PLI A;  3BW7 A;  3TSJ A;  2VAO A;  1V97 A;  3W8Z A;  1N61 C;  4PYT A;  3KJM A;  1W1K A;  2R8D A;  1MBT A;  2Y3S A;  3I99 A;  4BCA A;  2BVH A;  3AMZ A;  2VFU A;  3POP A;  1W1Q A;  3NS1 B;  4PVJ A;  1AHU A;  3S1E A;  3NVW B;  1AHV A;  1ZXI C;  1AHZ A;  3B9J B;  1DII A;  1MBB A;  3HSU A;  1W1J A;  5I1V A;  3NVV B;  1W1O A;  2E3T A;  5AE2 A;  3TSH A;  3S1F A;  4JAY A;  3HRD C;  2BVG A;  2AXR A;  2P13 A;  2VFT A;  2W3S A;  1RM6 B;  2P3H A;  4EC3 A;  3C0P A;  2GQU A;  3DQ0 A;  3GSY A;  3NVZ B;  5L6F A;  2EXR A;  5D79 A;  2RK5 A;  4JB1 A;  4MLA A;  4PVH A;  5G5H B;  3FWA A;  1I19 A;  4PVE A;  1N62 C;  3VTE A;  5FXD A;  4O95 A;  4DNS A;  4PWC A;  1W1L A;  3D2J A;  2Q85 A;  5K8E A;  1WVF A;  1VAO A;  2BVF A;  3LLB A;  4HG0 A;  1N5W C;  1QLU A;  2PLS A;  1JRO A;  3ETR B;  1HSK A;  1T3Q C;  4XLO A;  1SB3 B; 
#chains in the Genus database with same CATH homology
 1FIQ B;  3W8W A;  1W1R A;  2Q4W A;  5HHZ A;  3AN1 A;  2VFS A;  1E8H A;  3FW7 A;  4PVK A;  3S1D A;  1N63 C;  1JRP A;  2OAI A;  3TX1 A;  2UUU A;  1WYG A;  4PZF A;  5AWV A;  3D2H A;  3DED A;  4OAL A;  5AE1 A;  4ZOH B;  3W8X A;  1N5X A;  1E0Y A;  3PM9 A;  1W1S A;  4BBY A;  1UXY A;  2QKN A;  5HMR A;  5FXE A;  3LAE A;  1WVE A;  3RJ8 A;  2Y4G A;  4UD8 A;  5AE3 A;  3PQB A;  3FW9 A;  2Y08 A;  5FXP A;  1W1M A;  1VDV A;  3SR6 B;  5ADZ A;  3D2D A;  5FXF A;  4BC7 A;  5HQX A;  5I1W A;  4PWB A;  2W55 A;  1DZN A;  1F0X A;  2R2Z A;  3NVY B;  2P4P A;  2MBR A;  3S1C A;  2QPM A;  3AM9 A;  3NRZ B;  1FO4 A;  1E8F A;  3FW8 A;  2VFV A;  2I0K A;  1FFU C;  2W3R A;  5G5G B;  1FFV C;  2VFR A;  2O3G A;  1ZR6 A;  2NQW A;  2WDW A;  3JS8 A;  2GQT A;  2UUV A;  1QLT A;  2YVS A;  2Y3R A;  1DIQ A;  4BC9 A;  1E8G A;  2IPI A;  5L6G A;  3RJA A;  3EUB 3;  1N60 C;  2W54 A;  4ML8 A;  2PLI A;  3BW7 A;  3TSJ A;  2VAO A;  1V97 A;  3W8Z A;  1N61 C;  4PYT A;  3KJM A;  1W1K A;  2R8D A;  1MBT A;  2Y3S A;  3I99 A;  4BCA A;  2BVH A;  3AMZ A;  2VFU A;  3POP A;  1W1Q A;  3NS1 B;  4PVJ A;  1AHU A;  3S1E A;  3NVW B;  1AHV A;  1ZXI C;  1AHZ A;  3B9J B;  1DII A;  1MBB A;  3HSU A;  1W1J A;  5I1V A;  3NVV B;  1W1O A;  2E3T A;  5AE2 A;  3TSH A;  3S1F A;  4JAY A;  3HRD C;  2BVG A;  2AXR A;  2P13 A;  2VFT A;  2W3S A;  1RM6 B;  2P3H A;  4EC3 A;  3C0P A;  2GQU A;  3DQ0 A;  3GSY A;  3NVZ B;  5L6F A;  2EXR A;  5D79 A;  2RK5 A;  4JB1 A;  4MLA A;  4PVH A;  5G5H B;  3FWA A;  1I19 A;  4PVE A;  1N62 C;  3VTE A;  5FXD A;  4O95 A;  4DNS A;  4PWC A;  1W1L A;  3D2J A;  2Q85 A;  5K8E A;  1WVF A;  1VAO A;  2BVF A;  3LLB A;  4HG0 A;  1N5W C;  1QLU A;  2PLS A;  1JRO A;  3ETR B;  1HSK A;  1T3Q C;  4XLO A;  1SB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...