2P1JA

Crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRFVEMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords DNA polymerase III polC-type
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.140 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p1jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p1jA01
1FK9A 3KK2A 3ZT3A 3OYNA 3TAMA 5KTQA 1ZBHA 3K5NA 3U3YA 1TKTA 3MXJA 3SI6A 4CE9A 4PA1A 3PV8A 1BQMA 3PX4A 3TARA 4Z4HA 4CF1A 3QNNA 4M41A 4YFUA 1R0AA 4FJXA 4OGEA 3AVCA 3AVAA 5CY4A 3V9SA 5HLFA 3V4IA 3NF8A 3L2VA 3DMJA 3PX6A 2XY8A 4KPYA 3QLHA 4LH5A 3ZT2A 4CJ4A 3VQAA 3AV9A 4DFMA 1KSPA 1S1TA 2FBYA 3DYAA 5JS1A 4DWIA 2ITGA 2JGUA 5C24A 1HYVA 3K5LA 2OPRA 3EY1A 3C94A 3HSTB 3EZ5A 2FBTA 1UA1A 2VG6A 4Y1CA 3DOKA 3OYAA 4JRQA 3V9ZA 1WSHA 3NH1A 3TAFA 4PY5A 1S6PA 2HW3A 4CIFA 4KHUA 4AHSA 3VA0A 3ZSYA 3I0RA 5CYMA 4AH9A 3WNGA 4CEZA 4J2EA 4FLXA 3SUQA 1C1BA 4CGFA 1WLJA 1NJYA 4DFJA 1GOCA 2ATQA 2B6AA 1SKSA 1T03A 1B9FA 4W5TA 4DQRA 5SZTA 4CEFA 5T7BA 4AHVA 2F96A 4M42A 1A5XA 1RBVA 3CYMA 4I7FA 2OZMA 3HPOA 1S9EA 3SJJA 4KHWA 1XWLA 4F4KA 3OYFA 4CESA 3OS0A 1EKEA 4R5PA 3M8SA 2WONA 1Y97A 1NK5A 4I9LA 3DLEA 4CGJA 4CFCA 2XY5A 2BDPA 4L8RB 1S1UA 4CEAA 3NGZA 2KQ2A 4DTOA 1QSSA 4N41A 1S1XA 2YNGA 4FJ8A 2HHVA 4CK3A 1BI4A 2IC3A 4K8XA 3AVKA 4DTUA 3SV4A 2IS3A 3QO9A 2P51A 3PY8A 1VSMA 2HNYA 3T1AA 5DMRA 3P83D 1NJXA 4CFBA 4KAZA 1KTQA 4HCBA 1D9FA 1ITGA 4FYDA 4Q0BA 1A5VA 1IKVA 3DOLA 1NK8A 1X9WA 1JXEA 1KCFA 3KK3A 3L3VA 3QESA 1ZYQA 1NJZA 4EZ9A 3IRXA 4F2RA 3HP9A 4DLGA 1TAUA 3PUFA 4O44A 1REVA 3AVGA 3TR8A 3QIOA 4IDKA 3ZT1A 1TV6A 1RDAA 4RW9A 4CHPA 1YTAA 4E0DA 2B4JA 4OKEA 4LD0A 4CEOA 4KTZA 1S9GA 1WAJA 2I5JA 1HNIA 3DM2A 3OYEA 3KLHA 4GVMA 3NE6A 5EU7A 1VSIA 4MFBA 3QEIA 3AA5X 5C25A 2G8WA 1G15A 1XI1A 5HRRA 4FM0A 3QINA 3SUOA 4Z4GA 3AVIA 3CQ8A 1SKWA 4AHTA 4QAGA 4DS5A 3CG7A 3PO5A 2QKKA 4N47A 4CJLA 4CJEA 4E19A 3HPGA 4FLUA 1SL2A 3TAPA 4OLBA 2VG5A 3VQ6A 3C95A 2HHWA 4BWJA 4J2AA 4DFPA 1SKRA 3AVHA 3I0SA 3MEDA 4E7KA 1EETA 3HL8A 3DLHA 4KKOA 1DTQA 1ZBFA 3WNFA 3SNNA 3QETA 1BCMA 4IKFA 2KFNA 1RBSA 3AO1A 4O4GA 4KTQA 1RBTA 1CXQA 3MXMA 3VQ9A 3NH0A 2OZSA 1KFDA 4NCGA 1U49A 3T3FA 2KFZA 1KFSA 2EHGA 1K6YA 4DTJA 2Z1GA 4F8RA 2RF2A 1TVRA 1GOBA 3AA2A 3SQ0A 4DTNA 4AILC 3RR8A 3FFIA 1RTIA 4Q5VA 2GUIA 4Y1DA 2YHBA 3VQ4A 4IFYA 3RRHA 2BANA 1C0MA 4QCLA 1YVUA 5HRNA 4N5SA 4KO0A 3IG1A 4OPJA 1BISA 1IKYA 3V1QA 2G8KA 2DTUA 1J53A 4B9NA 2DY4A 3HPHA 4CECA 5K14A 3OYLA 4O55A 3JYTA 1YTUA 1CZBA 4FJ5A 1JKHA 3M8PA 3MEEA 3NAEA 4FZXC 4RG8A 2F8TA 4B3OA 3TWHA 4CIEA 1EXQA 4OKKA 3AVFA 3KLFA 4HUEA 1NK7A 4F3TA 4FJLA 2ZD1A 3L8BA 3D45A 3OYIA 3V1OA 3OVNA 3L3UA 1TK0A 2P5OA 2PZSA 1ASUA 4NCBA 1NK4A 2YNHA 1RTDA 1Q8IA 4CJSA 1JLEA 1SUQA 5D3GA 1JLFA 1C6VA 2HVHA 4Z4CA 3OYBA 3TAGA 2W42A 1NK0A 1ASWA 2FBXA 4C8MA 3SUNA 3HJFA 2ZQBA 3L2RA 1B9DA 3KKSA 4B8AB 3QEWA 2XY6A 1WSEA 1RT4A 3SCXA 3MECA 3A2FA 2IDOA 4C8KA 1LW0A 4LSNA 3OJUA 1RT1A 2Z1JA 4W5RA 3KLEA 4ELVA 4JLHA 3AO3A 3DRSA 1U45A 3SPYA 2WOMA 3KLIA 3NF6A 4E7LA 3DLRA 4DTMA 3RMDA 4DQIA 3VQQA 3V9WA 4CF0A 2FC0A 1XC9A 4E7IA 2RPIA 3HXMA 4BE1A 2X6NA 3HK2A 1JL1A 4OKJA 3EYZA 4FLZA 3DI6A 1LAWA 2OPQA 4DTSA 1L5UA 1QTMA 4HTUA 4M3RA 4C8OA 2BE2A 4DSKA 4FJJA 1RT7A 3ZCMA 3H08A 4FCYA 4DF8A 3SQ2A 4E89A 4CIGA 3L2WA 1N6QA 1KRPA 4OLAA 3S3MA 3OYDA 4DQQA 1SV5A 4NYNA 2GBZA 3AVLA 1HPZA 3VQ8A 3QNOA 4KHSA 3P1GA 3VQBA 2VWJA 1KLMA 2Z1HA 3KJVA 1FKOA 3DRPA 2YNIA 1IKWA 4RW6A 4CJUA 4NYFA 3LDSA 4BE2A 4KFBA 1C1CA 2D0BA 4W5QA 4DTPA 4DSLA 2YHAA 4I2QA 2DFHA 1RT2A 1JXBA 4ELTA 3VQEA 2F8SA 3L2QA 1QSLA 3VQPA 4KV8A 3RTVA 2XO7A 4J2DA 5KGWA 3AA3A 4CHYA 2PY5A 3AO4A 3OYKA 1C0UA 4CGGA 3NFAA 3OY9A 1QHTA 4M3WA 3ZSVA 1T7PA 2E4LA 4CK2A 4H4MA 3ULDA 4E1MA 4BDPA 1KVBA 4AHUA 2BGGA 5I3UA 4CGDA 5HROA 3WNEA 2ZE2A 1VSJA 3LAKA 2KW4A 1J9AA 2QXFA 4CEBA 2HVIA 1TGOA 4FJNA 1IKXA 4CJRA 4BACA 4E7JA 4NCAA 1RDCA 3LPTA 2X6SA 4FJGA 1TKZA 4FJ7A 3KK1A 3ZT0A 1BIUA 3HO1A 5CZ1A 1U4BA 4CCHA 4DMNA 3DLBA 3SQ1A 2FBVA 1BHLA 3LPUA 4UQGA 1EP4A 1WN7A 5FRNA 1TKDA 2DFEA 4KHNA 3AO5A 3NGIA 3LANA 5FROA 3NGYA 3ISNC 3QERA 1F21A 1NOYA 4KREA 4BWMA 3B6PA 1VSFA 1HRHA 1RT6A 4M3TA 5FRMA 1CXUA 5KI6A 3HT3A 4DLEA 2PYLA 4FJIA 4CJPA 3AVNA 2PAJA 4BE0A 2QKBA 3NF9A 1L3UA 5J1EA 1SL0A 4FJKA 4B9LA 3UIQA 3ALYA 4FW1A 4CJ3A 2R7YA 4GW6A 3NCIA 3RMBA 3O3HA 1HNVA 1KVCA 3OYHA 3ITHA 4FK4A 2O4GA 2OPPA 3M8QA 2HHTA 3TABA 1X1PA 3OS2A 1RDBA 3ASMA 3SYZA 1VSLA 3O4QA 1RILA 4CJTA 3ZT4A 4CHNA 4FXDA 3NDKA 5E41A 4H8KA 3RMAA 1O1WA 1UAXA 4CJQA 4EP4A 2YV0X 3S3OA 1T05A 4B8CA 1JLBA 3NBPA 2A1SA 3C6UA 3CM5A 4F2SA 4FK0A 2HHUA 3HYFA 3M8RA 1BIZA 1DTTA 4FJ9A 3LP0A 4CEQA 1ZBUA 1QQCA 5HP1A 1NK6A 1DLOA 4DQPA 4Z4EA 4GMJB 3V1RA 3F73A 4ELUA 5C42A 1NOZA 2XY7A 3KD1E 4CERA 1TK8A 4RW8A 2XRIA 3NH2A 3I8DA 3AO2A 1FXXA 1LWCA 3CFRA 4B08A 3KD5E 3LWLA 2OPSA 4JS5A 4TSXA 1CZ9A 3TI0A 3U3GA 1U04A 3BGRA 4CJFA 2G8UA 2HMIA 1RNHA 4Z0UA 3ZSXA 4DSIA 4K8ZA 3TANA 3NHGA 1Q9YA 4CK1A 4DG1A 1C1AA 2DFFA 4B9TA 5J2MA 1X9MA 1ZBLA 2E6MA 1D5AA 1S1VA 1WSIA 1RBRA 1HYSA 1NKBA 1UWBA 4MQ3A 1LAVA 3LP1A 4CGHA 2A1RA 1WSGA 4XIUA 1SL1A 1UOCA 1WSJA 4AHRA 4CHOA 4KB0A 1JLGA 3AVMA 3ZSWA 1X9SA 1JLCA 4DSJA 4E1NA 4EZ6A 4F3OA 2VG7A 2HHSA 1LWFA 1U48A 1XHXA 4DTRA 4KB1A 3QIPA 1TL3A 3CFPA 1VSHA 4FLTA 1TK5A 1VK0A 2G8VA 1HMVA 3NF7A 4CGIA 3QEPA 4C8NA 4I9QA 3QEXA 4Z4FA 2D0AA 2P5GA 4QOZB 4M3YA 4FW2A 5DK5A 5J2NA 4KHQA 5KRSA 3ZSZA 1U47A 3MEGA 2Y1IA 1VSDA 1S1WA 5KRTA 1T8EA 4FJMA 2IAJA 1L3VA 1HJRA 2Z1IA 3V6DA 4OVLA 1L3SA 2AJQA 4WE1A 1CLQA 1VSEA 4C8LA 1HQUA 1BI4B 3DRRA 4ZHRA 3B6OA 4FLYA 3SZ2A 1MU2A 4M3UA 1BGXT 4E3SA 5HRSA 3S3NA 1BL3A 2Y1JA 1W9HA 3SUPA 2RKIA 4OJRA 4M3XA 3SQ4A 1JL2A 1IO2A 1JLAA 3DLKA 3K5OA 4N76A 4CFAA 4DS4A 1D8YA 1WAFA 3VA3A 4LH4A 4H4OA 4CF8A 3VQCA 1BCOA 3LAMA 2KTQA 2HNDA 4KI4A 3SV3A 3K59A 4DTXA 3THVA 1QSYA 1LWEA 1FKPA 1HYZA 1QE1A 1W0HA 3K57A 4DFKA 4CJ5A 3HVTA 4JS4A 3U6FA 1NKCA 2P1JA 1VRTA 3VQDA 3V9XA 3O3GA 4W5NA 3WNHA 1S5JA 2G8HA 5FDLA 3KLGA 3HM9A 4FLVA 1LW2A 4HUGA 1J5OA 2KZZA 3TAQA 2YNFA 1XHZA 4B9MA 1TAQA 3K5MA 1IH7A 1I3AA 1UA0A 3L2UA 4FLWA 1N5YA 3K58A 4HCCA 1HQEA 2LSNA 1I39A 2YKMA 4IG0A 3LALA 4CHZA 4HVJA 3OS1A 4DSFA 2OYQA 3OYCA 3IAYA 3K2PA 4IG3A 1L3TA 3AA4A 2EX3A 3ZSOA 3RWUA 4ICLA 3RMCA 2HB5A 1NJWA 1J54A 1IG9A 2B5JA 4JRPA 2JLEA 5CYQA 1RTJA 2YKNA 2OA8A 3G0ZA 2IOCA 4DF4A 3S9HA 5KGXA 4PUOA 4FK2A 5JS2A 1NK9A 3LP2A 4CF9A 4LY7A 2G8FA 3KTQA 4ZTFA 4CEEA 4KTWA 4ID5A 3LP3A 4W5OA 2G8IA 4FZYA 1JLQA 1VSKA 4DQSA 4B9UA 4B9SA 1NKEA 1C0TA 1Q9XA 2E6LA 1EX4A 4G1QA 1S6QA 4ZTJA 4M45A 5J2PA 4I2PA 1KVAA 3MXIA 1B92A 3KIOA 4O0IA 4DU4A 1RT3A 3C6TA 3KKRA 1QS4A 2O4IA 3ZSQA 3O4NA 3VQ7A 4OPKA 4KRFA 1TL1A 3AVJA 4EP5A 3HP6A 3PO4A 3VQ5A 5HRPA 4BDYA 4IBNA 4CJWA 4OGCA 4CJVA 3G10A 3VN5A 4RW4A 4M3ZA 4RW7A 4B9VA 3V81A 1A5WA 2GV9A 4O5BA 3T19A 4DSEA 5J2QA 3DLGA 4Z4IA 3LZJA 2HHQA 2VWKA 4YNQA 1RBUA 5I42A 3TAEA 2KZMA 4ID1A 1Z25A 5SWMA 4LSLA 5CZ2A 3MAQA 3BDPA 3LZIA 4J2BA 1ZBIA 4PQUA 4FM1A 3ZSRA 4O0JA 2NUBA 3F9KA 4FM2A 3AVBA 2XHBA 1WNSA 1YT3A 3LWMA 1WSFA 2RN2A 4FZZA 4FVMA 5HBMA 3PX0A 4CF2A 2HHXA 1GOAA 4CHQA 3JSMA 4PWDA 3P5JA 3OYJA 2ETJA 1RT5A 2D5RA 1D9DA 2PYJA 4CFDA 1RTHA 1RDDA 2HNZA 1Z26A 3CFOA 4DU1A 3OYMA 3OYGA 4CJKA 3HVRA 3O3FA 3SPZA 2X78A 3CM6A 2X74A 4HHTA 3E01A 1VRUA 4AHCA 4E7HA 1LV5A 4KHYA 2D0CA 1TKXA 1RCHA 2IGIA 4N56A 3D0PA 4DU3A 1BQNA 3RR7A 4KI6A 4IFVA 4CEDA 4BDZA 3QEVA 2QK9A 3V9UA 3RRGA 2Q3SA 4HUFA 3IS9A 1KLNA 4FJHA 3OJSA 1ASVA
chains in the Genus database with same CATH superfamily
2K1AA 3J7YP 4H0YB 3O1BA 3TAMA 3Q7CA 4DUYK 1NTZE 5CCGA 1EZVG 1KXPA 3LW5H 3PLAA 1TKTA 3J7ZO 2KXPB 2RKLA 3MUDC 3FZMA 3PX4A 1EDIA 3DXMA 5DM6L 4OGEA 3AVCA 5CY4A 3NF8A 3L2VA 3E66A 2LR2A 3DMJA 3BEXA 1YIJN 1H0TB 3HTVA 4XH4A 2FSNA 1Y8AA 2BH1A 3HOSA 4LF6K 5C24A 3AE5C 1LT9A 4DKWA 2P9KA 3HSTB 3EZ5A 1GL2C 3L73G 1HX1A 2YHWA 1T6CA 3EKSA 5M1NA 1TYQB 3BF1A 3NH1A 2CH6A 4KHUA 3OA9A 1Y47A 5TKWA 3I0RA 3HZ6A 4CEZA 4J2EA 3FGUA 1ZR2A 5AW1B 1MDUB 1YVNA 4IOXA 1WLJA 5GAEP 4DR5K 1KN7A 1T03A 4W5TA 4D6TG 4CEFA 4BG9A 3HOTA 4B3MK 4V19S 3H1JJ 1HNWK 1A5XA 4KHWA 3HPOA 3WU2H 1LTSC 4NXMK 4F4KA 5AVRB 5LMNK 1Y97A 1JTHA 4CFCA 5AQVA 2V7YA 3NGZA 3C65A 1QSSA 1M1JA 1E3MA 1N36K 1P8ZA 4CK3A 4JQ0D 3CC7P 3ZX3A 1USEA 1KAXA 5CCGD 2HNYA 3T1AA 5DMRA 2YI1A 4KAZA 4FYDA 4Q0BA 1A5VA 1BGYG 3DOLA 4C46A 2HOEA 1NJZA 5K5GB 1TAUA 1OH6A 2A06E 4FL9A 4IXCA 1REVA 3CX5E 3TR8A 3QIOA 3GG2A 4IDKA 4U7BA 5H2FH 4C1NI 1YTAA 4OKEA 2Q1KA 1S9GA 1VQ7P 3WUHA 3OYEA 1LGHB 1KC8Q 1BE3J 2I7PA 4MFBA 1SQXJ 3P8CE 1K8AO 2DW3A 1M1JC 2FYNC 3L74E 1SQXK 1URQC 4Z4GA 2FYUK 5CCHC 3AVIA 1LTIC 4QAGA 1NGBA 3I55P 5FPMA 3TTCA 1RF1B 2VG5A 2CH5A 1DEJA 1SQPJ 2UXCK 2FF3B 2OTLN 1JTHB 5APYA 3THYB 3I0SA 3MEDA 1DTQA 1ZBFA 4JF7A 3Q5SA 3EN9A 2LXBA 3TU5A 1QQMA 4KTQA 1NGFA 4BRYB 5AFUA 3CC2N 1CXQA 3BF3A 3MXMA 2P9NA 1HUXA 1KFDA 1SQBG 2I8DA 1KFSA 2EHGA 1IZNB 4HWIA 4DTJA 1NJIO 3AEEC 3P7KA 4H0PA 3BCCD 2VQFK 1GOBA 3B4SA 1LTGC 1URQA 2BUPA 4CZHA 1IFDA 4JD2B 1NU0A 3H1KG 3SAGA 3FFIA 1L4AC 3H1KJ 3RR8A 1JEKA 2G8YA 2C9NY 4EYYQ 4Y1DA 3TF5A 4IFYA 3RRHA 2O3JA 3RBXA 3WMM0 4OPJA 1BISA 1HPMA 1J53A 2QWQA 3A0BH 2CGKA 5K14A 3I56P 1YTUA 1RF0A 1FZBA 4WWIA 3BATA 1X79B 1XQSC 4A61A 4CIEA 1EXQA 1NK7A 4AYCA 5M1OA 4F3TA 3TSIA 3D45A 2M0BA 3OYIA 4FOIA 1TK0A 2P5OA 1OWAA 3L71G 2PZSA 4U67L 3THXB 4JI5K 1KB9H 5AW5B 1Q2NA 1SQBE 1SUQA 2XNDH 2QWNA 3BY5A 4H03B 2HVHA 4PKGA 1NK0A 2FBXA 1X9VA 3HJFA 1Q86Q 4UB6E 3KKSA 4L73A 1WSEA 4BR7A 4H5NA 5AQZA 3MECA 3SCXA 3MCPA 1HNXK 1LW0A 3OJUA 4DV0K 2YNYA 3P4IA 3VEOA 3KLEA 1Y64A 4IFMA 3SPYA 3B5NC 2P9UB 1W2BO 1YITN 3RK3E 1J1DB 3RMDA 1HH0A 1FE6A 1T2KC 3SJHA 1XC9A 5MLCQ 1OVYA 3HXMA 1WT6A 4BE1A 2L5GB 3H1VX 1JL1A 3RSEB 2NZ2A 1QTMA 1JOCA 4AQYK 4HTUA 4ISEA 1OW7A 4C8OA 2BE2A 5C15A 3UKRA 5BREA 4EIAA 3CCSP 2YMKA 3VTHA 3CXCM 1RT7A 1L0LD 4FCYA 2UXBK 4BQLA 3BRTB 3L2WA 4OLAA 1S72P 1AJYA 2YKPA 1NTMJ 1KQSO 3OYDA 4DQQA 3HUSB 4YOTA 1HPZA 3K0SA 3VQ8A 3GF7A 5AQWA 1RF1A 2FXPA 2A41A 1KB9I 3MCAB 4AF1A 4C8KA 5KLVJ 1FKOA 3DRPA 3QB0A 2WT7A 2D0BA 5KLVK 1T3VA 3MGNA 4I2QA 5GAHP 3KWGA 1RH5B 4GVEA 3L2QA 1J1EB 5AQPA 3C6HA 3R6MA 3RTVA 1Q82O 2XNXA 2PY5A 2F7TA 5AVWB 3OYKA 1OVVA 3USSA 1JUNA 1QHTA 4JKHA 2E4LA 1X8YA 4H4MA 2WSSH 2W6AA 4DT0A 4PJ0H 3ZX0A 4AHUA 2BGGA 4CGDA 4DR7K 4EHUA 3WNEA 3G6EP 3N4XA 3C8VA 2ZE2A 2KW4A 3J8AA 3LAKA 2GM4A 3EL2A 3VN0A 1P84D 2ZT9C 1KTMA 1ZXOA 3U9DA 4NCAA 1RDCA 3R1XA 4FJGA 4FPBA 4WYBA 2LKMA 3EEQA 2A45I 3UIAA 2V4HA 2NNWA 3NTNA 2WBNA 4DMNA 5L8RJ 3IFMA 2FBVA 3LPUA 1WN7A 1TKDA 2IYOA 4R4MA 3ULEB 4BR2A 3NGYA 5KJ7D 3DXKA 2QWPA 1NOYA 4FVUA 4BWMA 3K9JA 4BR4A 4A2AA 2ASOA 2PYLA 1EZVD 4FJIA 4CJPA 4BE0A 2Y0EA 3UIQA 4CJ3A 4OGQB 2R7YA 3RMBA 4L75A 2RE2A 3ITHA 3M8QA 4IO9L 2AXCA 3TABA 3CXHD 1TU3F 1X1PA 4JNEA 1CI6A 3OS2A 4H0LD 4HTLA 3SYZA 1FOSF 2V52B 2UUAK 4RCHA 3NDKA 4F8RA 4H8KA 3PIOL 4BC3A 1KC8O 5AQXA 1JLBA 4B8CA 3CM5A 3C6UA 1WUAA 3QFPA 1TYQA 1BDCA 3D2EA 4EFHA 3M8RA 1BDDA 4B1UB 1VPCA 1NAYA 2D2CB 2BEQD 2KI7B 5AW2B 4Z4EA 4GMJB 5M1FA 4PL7A 4OGQD 3VGLA 4JYAK 2W8ZA 2KP8A 1SQKA 4K41A 2XRIA 4DV7K 1L0NK 1GLLO 3AO2A 1PGPA 4RJTA 3KD5E 4D6TD 2OPSA 3TI0A 1U04A 4YDUA 2O8EA 1OVRA 3WEEB 3JS6A 1FC2C 3HUSA 3RL0C 4CZJA 2OTKE 2RMZA 2VGNA 4B9TA 1FZGA 1XC3A 1X9MA 2QXLA 3AGKA 2E6MA 3SSUA 2E74D 1NTMD 4DV3K 3BZKA 3PH0A 3LP1A 4O9BA 1WSJA 4CHOA 1NWQA 1SL1A 4KB0A 1QVFM 3VERA 1XUPO 2HHSA 1LWFA 1XHXA 1TL3A 5EVZA 2M3EA 3NF7A 4CGIA 4Z94A 4Z4FA 2P67A 1LT9C 3AE6C 3D71A 4B3TK 3PLNA 1EZVE 1LTAC 2N1TD 1T8EA 1S1WA 1VQ4N 3FXEA 5AW3B 3F2KA 4FJMA 1KQFB 4YDUC 1CLQA 3MWTA 1L3SA 1LTTC 1Q18A 3W3DA 4A59A 5H1SQ 1BI4B 2QJPB 1T6DA 4M3UA 1MU2A 4BREA 5EOYA 1NTZK 2PGDA 4JYCA 2RKIA 2O01J 3THXA 2Q5UA 3K5OA 5BRDA 3NMDA 3VA3A 3VP9A 1MFZA 3SWFA 3ULEA 2HFED 3VQCA 2KK7A 3LAMA 3LIDA 2KTQA 4KI4A 3SV3A 2HODA 4DTXA 1QSYA 2HBLA 1LWEA 1P84E 3M91A 1HYZA 2A3ZA 3E9OA 3U6FA 3AEAC 1M1KQ 3EE9A 3AE2C 3A5OC 1XMQK 2MJZA 3VQDA 3V9XA 2RN0A 1VF5D 3HE4A 1VQKN 3HM9A 2Y9YA 1LW2A 4O8KA 1S4XA 3UE5A 3TAQA 3ZX2A 3K5MA 3VTIA 1KV4A 1I3AA 3K58A 1MWMA 1HQEA 2LSNA 2ZT9D 2YKMA 1LP1B 3AEGC 4IJAA 4XH5A 4DSFA 2OYQA 1OVUA 3H1KD 4BY9C 3MTUE 4XH1A 1X22A 1N7SC 4W80A 1NJWA 3MUDA 1J54A 4IOIH 4TT3H 3UKUA 4GNIA 2OA8A 3WT0A 3G0ZA 2IOCA 4DF4A 3KK7A 4CF9A 1HUCA 4LY7A 1L0LE 1PIXA 1GLJO 4W5OA 4DB3A 4ZTFA 1PZQA 4M3LA 1VSKA 1EC5A 3RK3C 4G1QA 4XEIA 1NHLA 1KVAA 4YTPC 3F5TA 1RT3A 1QS4A 3O4NA 1FOSE 3HP6A 5KLVE 1OVQA 3VEZA 4IBNA 4CJWA 4CJVA 2JWLA 2KLAA 4M63C 1YYCA 4EOTA 4M3ZA 5KAIH 4RW7A 1A5WA 3JSVC 1LT1A 4C7NA 3HD7D 2E5YA 5AFUH 2KOGA 2WPQA 4WCEL 2H7HA 1NOHA 2M3BA 2QWRA 5I42A 3AECC 3M5RA 1Z25A 5SWMA 3CCRN 4DJGA 4DOJA 3ZETA 4JI4K 1ZBIA 5JMVA 1SVFA 3EE8A 1LT9B 4JV5K 4JKGB 1WSFA 2RN2A 1YXQA 4FZZA 4M7XA 5HBMA 2ITAA 4CF2A 2HHXA 2ASPA 4LFCK 2JEEA 2XZRA 2GWKA 3CFOA 3CC4N 1Z26A 4BRNA 4CZIA 4E1JA 1QL2A 3VP8A 5GTHH 3VEXA 3ZEUB 2X74A 5CBOA 4HHTA 1VRUA 4DR6K 1BCCD 2NZTA 1FDMA 3QFUA 4WY4B 3HTKB 5E84A 4ZKPA 4IFVA 4CZEA 3Q7BA 2QVAA 4FJHA 5BPLA 1YUWA 5CHIA 1XNRK 1FK9A 3KK2A 1ZRTD 5KTQA 4HYTB 3U3YA 2HODB 2IDBA 1W2BM 3CCMP 3SI6A 2WC9A 3U4LA 1N7SB 3TARA 3RK2D 1KB9D 1R0AA 3T97B 1FZCA 5HLFA 3V4IA 3L70G 1NTKJ 4IFFA 4KPYA 4MLHA 1J6ZA 4LH5A 4CJ4A 3VQAA 3J80O 2E74C 1GLEG 1S1TA 2FBYA 3DYAA 5GIPA 4YOVA 3TSQA 2JGUA 1IBMK 1M90Q 4DWIA 1Q82Q 1HYVA 2K9JB 1L4AD 1LP1A 1KQSM 2O8FA 4I6MC 1GW3A 3CERA 4DR1K 1TUUA 4Y1CA 2KUBA 3V9ZA 1WSHA 4CEEA 5GINA 4PY5A 2O1JA 3QBWA 1N73B 1SZ2A 2YO3A 3KYQA 3AE4C 4AH9A 1DD4A 4UB6H 4F9OA 4FLXA 2YXQB 1NJYA 2ATQA 2B6AA 2NRWA 3D6YA 5AQKA 1S5LE 1HKGA 2KYVA 2FFDC 4AHVA 2F96A 3WU2E 3RK3B 3CYMA 2OZMA 3U1CA 2E75B 1S9EA 1XWLA 2OYIC 3V4QA 3VOPA 4CESA 4KH4A 1M8OB 1L4AA 4I9LA 3DLEA 1KFNA 4GODA 1RE3A 4L8RB 2IZ1A 3GE1A 2YNGA 3M0DC 1D4XA 4JKFA 1VQ5P 5KLIC 4WFBL 2A06D 3AE7C 3AVKA 3MDQA 4DTUA 2AEFA 4BR9A 3QO9A 2P51A 3PY8A 2B87A 3IUCA 3P83D 1KTQA 3KVGA 4HCBA 2FYUE 1X9WA 2E75D 4F2RA 2WWWA 3PHLA 3L3VA 3SMSA 4EZ9A 3IRXA 4DLGA 2Y9ZA 1HNZK 2UUBK 3CLQA 3D7EO 4BRYA 3VGKA 4EHTA 1IC2A 1RDAA 4BRCA 4CHPA 2B87B 2JP3A 2B4JA 1NBWA 4XA4A 3CJ7A 3D2EB 3FWNA 1S9KD 3KLHA 1GU5A 3NE6A 2A06G 1DT9A 5EU7A 3HE4B 3THYA 4GY2B 2G8WA 3CJBA 5HRRA 3S4RA 3E9PA 4YXWH 1EWQA 3CXHH 1JY2P 3L36A 1CI6B 4AHTA 1SKWA 4DS5A 5AQJA 3H1KE 4CJEA 3HPGA 3TAPA 3C95A 4A7PA 3CETA 3VMFB 2HHWA 3R8EA 1J2JB 5BVZA 2FFDA 3MX2A 4BRHA 1SKRA 5CMZA 3AVHA 2O8EB 5BPMA 1NTKD 5GTIE 3FX0A 1DD3A 3WNFA 3QETA 3WQUA 1BCMA 2KFNA 1N7SA 1Q81O 1NYHA 4IL6X 1RBTA 3O6QA 3MZWB 2E1ZA 3IAOA 1PGJA 3NH0A 2OZSA 2E8AA 5AQFA 1MFTA 2CK3H 3CX5H 2W6BA 1DX7A 5KJ7A 3IFRA 1YQ3C 1RF1C 2RF2A 1TVRA 4LLHA 1KYOD 5AQYA 1KYOH 3SQ0A 4DTNA 4AILC 4U7JA 1PP9G 2AEJA 1YHQP 1RTIA 3VOVA 4HJGH 1VAZA 2D2CD 3BP8A 1C0MA 1YVUA 4N5SA 1PPJE 5CJ4A 1RDUA 3OAKA 1QLED 3H1LE 4DR2K 1DIPA 1IKYA 3I33A 4B9NA 2DY4A 1KILE 4CECA 4BRAA 4O55A 5APQA 5I9EB 3JYTA 2GWJA 1JKHA 4Z1MH 3SBGA 3NAEA 5B8HA 4HUEA 4FJLA 2ZD1A 4I7ZB 3L8BA 2O01N 5LJWA 1LWUA 1GDTA 2YO2A 1ASUA 1VQNP 1PP9D 4DV2K 1Q8IA 4KHXA 1A02J 1JLEA 4CJSA 2GUVA 2NRXA 1JLFA 1C6VA 2P9IB 1NTMK 1URQB 1EQ7A 4IZ9A 2VWBA 3TAGA 1ASWA 3CMAP 5ELZA 4OPAA 1K9MQ 3L2RA 4O8UA 3D6RA 1B9DA 3QEWA 3GOIA 1FDOA 5HOOA 2IVOA 4XFJA 3MN6A 4JKGA 3A2FA 2IDOA 5KPRA 1RT1A 3L70E 3Q5RA 2QG4A 4BR0A 4W5RA 3H32B 4JLHA 3BVHA 1GLBG 1U2VA 3NF6A 5AQMA 4DQIA 1VQPN 3H1HJ 2P2UA 3HD7C 5AVXB 5E79E 2FC0A 2QA4N 5H2FE 4OH8B 4JK8A 2PFUA 2ZF5O 4OKJA 5AQGA 3EYZA 3HK2A 2B9BA 3NVKA 1LAWA 2HF3A 2OPQA 4DTSA 1I94K 1SAZA 2O8CA 3AE3C 4DHYA 3D2FA 4K25A 3D6ZA 3MN9A 2J4RA 2FSKA 4FJJA 4DF8A 1PL5A 2BTFA 4NYNA 4MDBA 3CCEN 3SAFA 4EI2A 3H1LG 1MA9B 3QNOA 3VQBA 4KHSA 2Z1HA 2N1TA 4RESB 1ZR4A 4NYFA 4BE2A 2OYIA 1MKMA 4DTPA 2M5AB 2QJYC 2YHAA 2WVRA 4ELTA 1NNEA 1JXBA 3OA7A 3L71E 1N32K 2I1KA 3H1IE 4CZKA 4KV8A 2XO7A 4H5VA 1SQPG 5KGWA 3C7NA 3TPQA 4CHYA 1JMMA 1YITP 2QJKB 3M0AA 2Q3EA 5DJTB 4CGGA 2IVNA 3O9SA 5BU5A 3ZSVA 1T7PA 1Y9BA 3B71A 3ULDA 2WT7B 2KKZA 3DJCA 1YAGA 3U8XA 1VSJA 2P9UA 3PJSK 5AVUB 3TTFA 4BRPA 1VQ9P 3S9OA 2IFMA 4E7JA 4BRQA 2E76B 3PSFA 2X6SA 2L91A 3FZFA 5BRHA 1T44A 3A0BE 1BCCJ 2E2QA 1SQQD 4QS7A 5CZ1A 1U4BA 1SQVD 3CPEA 3MK6A 3DLBA 3JAMO 1Z6RA 5FLXO 4YPCA 4JYBA 2Q36A 2DFEA 4KHNA 3AO5A 1SFCC 3LANA 3C7NB 2O8DB 4KREA 3B6PA 4OPHA 4GOFA 1RT6A 4PKHA 1RHZB 4FWRA 4WQ5A 1WBBA 3HT3A 3A2AA 4DLEA 1HKCA 3K5BA 2QKBA 1JY2N 4YXDC 1L3UA 5J1EA 2YKQA 4FJKA 3KDPB 1NGJA 2AA4A 4FW1A 4NXNK 1K8AQ 3JXUA 4GW6A 3PTZA 2GX9A 2IPPA 1H0TA 4FK4A 2O4GA 1LTJB 1SQVJ 1S3JA 2W27A 3ENBA 2O01H 2WITA 1HGVA 3D70A 4BC4A 1EXIA 3H1JG 4CHNA 3FLCO 3L74G 5E41A 3RMAA 1UAXA 4EP4A 2YV0X 2WSCH 1GTWA 2C0XA 2A1SA 3G3ZA 3NBPA 4FK0A 1ZC6A 4JK7A 2HHUA 4KH6A 5APXA 1BIZA 1WB9A 3LP0A 4H5RA 1ATSA 3TK1A 2HMPA 1OX3A 1ZBUA 1RQUA 1QQCA 2NRVA 5HP1A 1NK6A 1DLOA 4BGBA 4DQPA 3V1RA 3C9IA 2H3GX 3CWBJ 3KD1E 4ILHA 3JCUE 4DCKA 5AQRA 5AW6B 1VQ6P 2R32A 3I8DA 3LIEA 1K04A 5KPTA 2E5TA 1VQ9N 3WXJA 3RL0D 5TISH 3CPWO 1FXXA 4K35A 3PSIA 1FBMA 1GK4A 2IX7C 3LWLA 2K9YA 4WY4D 4TSXA 1NTZG 5AQNA 1NGCA 3RK3D 4DZOA 3QH9A 1RNHA 4DSIA 3ZSXA 1JY3N 3G25A 3AARA 1BUPA 1M1JB 2FYNB 3CJCA 4JD2A 1G2CA 4CK1A 4DG1A 3EFFK 5KJ7C 1GLCG 1QX8A 4NLBA 5B5EE 1C1AA 2DFFA 2YJEA 2GELA 4YOWA 1ZBLA 1D5AA 1S1VA 5APUA 5B66E 1RBRA 3T1HK 2ZWHA 1UWBA 4MQ3A 1LAVA 1BE3D 2CGJA 4CGHA 3CWBD 4H0XB 4XIUA 2QSIA 4AHRA 2A1RA 3P8MC 4GOEA 2JDIH 1GLAG 3AVMA 4E1NA 4BGAA 2FYZA 1LJ2A 4F3OA 2N9YB 2ITMA 1U48A 3NXSA 3CFPA 3L75D 2QM1A 4FLTA 3R2PA 4WY4A 3ZDMA 1ZMEC 3ZETB 1NMDA 3IR9A 2P7JA 4I9QA 3QEXA 2WFBA 4M3YA 5AZJA 1WOQA 2YHXA 2QE7H 3H1QA 1L0NJ 3GG4A 3ZSZA 1NO4A 2GUPA 3SWYA 1VSDA 2IVPA 2F9TA 5KRTA 2AJQA 1RE4A 1HJRA 1GD2E 2CGLA 3H1LJ 1OXZA 1VSEA 4WE1A 4B9QA 1PFIA 3O4WA 1BGXT 2D4WA 4JKEA 1Q86O 2Y1JA 1DGKN 3SUPA 4OJRA 2P9LA 3V2PA 1VHXA 2E88A 1HLUA 3H3OB 4BRKA 1SQQE 2H88C 1IO2A 3SBTA 1AA0A 1JCGA 4N78D 4U3FE 1SQQK 5AW4B 1NWKA 1WAFA 4DS4A 1K73O 3CC7N 3BCCE 1FU1A 3DXKB 4OX9K 1NGMB 4GIFA 5APTA 1YF5L 1UIIA 3F89A 4H44D 1FKPA 1JB0J 1P90A 4DFKA 3AE9C 4CJ5A 4JS4A 4FPAA 1VRTA 2Z5IA 3VPZA 2W41A 2NLXA 1S5JA 3CCQP 1Q7YQ 3P32A 3E1YA 4KH5A 2AEMA 2KZZA 4B9MA 4YOYA 2VQEK 1RE4C 1UA0A 2KNCA 3G71N 1ZW0A 4HCCA 1JM0A 1VQON 1K73Q 4HVJA 4IEIA 3OS1A 1L3TA 1U7MA 1X3MA 3L6QA 3CMEN 3RMCA 4BVOA 3KZIH 1IG9A 3I55N 4CPGA 1NG9A 1BG3A 4DV1K 4FK2A 1NK9A 2SPZA 3LP2A 4LF4K 2F4VK 5AVQB 4KTWA 2G8IA 3CX5D 3HRGA 2E42A 3CCMN 4FZYA 3L73J 1Q9XA 2FBWC 1AV1A 3THWA 2E75C 2Y0DA 1EX4A 4ZTJA 5J2PA 5C39A 4I2PA 2FYUJ 3EKUA 3KKRA 1LTJC 3ZSQA 4OPKA 4BROA 3AVJA 3PO4A 3L75J 4FWNA 1TUYA 3MP7B 3G10A 1BGYD 3NVMA 5AQLA 2HBKA 4JHDB 4B9VA 2GV9A 3T19A 5J2QA 5GTIH 5BRFA 3LZJA 4I6MB 4LF8K 2JO1A 5LY3A 3CJAA 2BEZF 5CZ2A 3MX5A 4J2BA 1QVGO 5ADXA 3ZSRA 4O0JA 3L35A 4A57A 2A42A 2BCCJ 3G4SP 1NTKK 2YIUC 3CCQN 1AFOA 2YJFA 3JSMA 3CCLN 3VF2A 3OYJA 4KJMA 3CCVP 1NAFA 2PYJA 1N7SD 1RTHA 4CFDA 3LL3A 2KZJA 4PV1C 3TSUA 2W90A 2A6AA 3OYMA 3OYGA 1USDA 2X78A 3CM6A 3BRVB 3E01A 4HKZH 3N4QA 3C0BA 1TKXA 3RVCA 1BU6O 2IGIA 3D0PA 2QEXP 3RR7A 4BDZA 3QEVA 2J59M 5AZIB 4XE5B 3TGUG 3CMAN 4HUFA 2M5AA 3IS9A 2HBJA 3H1LD 3EWKA 1A02F 1N73A 4NB4A 1VQ6N 3ZT3A 1N8RO 3H1HG 4LC9B 5AW0B 3B5NA 3VEVA 2FXOA 3LDOA 3PV8A 3O8ZA 3CCUN 4IFEA 4CW7B 3BCCG 4OWFA 5DM7L 4M41A 3QNNA 4ISGA 3H45C 5APSA 3PIPL 5AQIA 4FJXA 5AZIA 2P9PB 4U3FJ 1ATRA 3T1YK 2Q1NA 2V7QH 4H0VB 3AV9A 4NLCA 4DFMA 3QICA 4CI6A 1KSPA 1GW4A 1IFNA 1VQ7N 2KNCB 3TGUD 4CD1A 3AE8C 2ZVNB 3M1FA 3EY1A 5LJVA 4YY3K 3CCSN 2PAVA 3C94A 3L4QA 1MZ9A 2Y0CA 3CD6N 2VG6A 4JRQA 1PGQA 1SFCD 3BCCJ 3MWPA 2FXUA 3TAFA 2HW3A 4CIFA 3ZSYA 3WNGA 1ZP0C 3SUQA 1C1BA 3HD7B 4DFJA 1YTZI 1JO5A 3IKMA 1B9FA 2XU6A 4AM6A 1YQ4C 3A5TA 5T7BA 2Q0UA 4WFNL 2YIUB 4I7FA 3SJJA 1NGDA 3TGUJ 1YJ9P 2BASA 3OYFA 1S9KE 2CPBA 3RGUA 1NK5A 3B8EB 2XY5A 2BDPA 3GHGA 1L0NE 1S1UA 4ILGB 4CEAA 1XTGB 3WUVA 5GAGP 4H5WA 4N41A 2IC3A 1Z05A 4K8XA 3SV4A 1BGYE 4BRFA 2O8CB 5BU8B 1CZQA 2FYUD 1NJXA 1NU1G 4ZNCA 4CVNE 3H1JD 1D9FA 4BC2A 4DV5K 3VYIA 2A40A 2OARA 1IKVA 1FJPA 1NK8A 3W68A 1U2VB 2KLVA 1KCFA 1KILB 3QESA 5APVA 3O9UA 3HP9A 1VQ8N 1K9MO 2ZYGA 3GDQA 3AVGA 4H5TA 3C6AA 3Q1MA 3I56N 4NPDA 2HF4A 1L0LG 2FSJA 2HLOA 4LD0A 4CEOA 1KZUB 1AVOA 1QHAA 2I5JA 4KTZA 1HNIA 1AVYA 1S1CX 3EO3A 2QWOA 2YMYA 3DWLA 3IF4A 1GZLA 1VSIA 3QEIA 2WSFH 2QJKC 3AA5X 5C25A 1G15A 4FWKA 1YHQN 1H88A 1P84H 4FM0A 3QINA 4X65K 4PV1B 3CMEP 1G1JA 2FYUG 3KQGA 3CG7A 3AEFC 2QKKA 4H0LC 1NGEA 4E19A 4FLUA 5JLFA 4U3FG 4OLBA 1M90O 4J2AA 4JKAA 4DFPA 3CL3D 1NGHA 1OH5A 1T6AA 4E7KA 1VL2A 4C23A 3DLHA 3SNNA 4IKFA 1HKBA 2C9LY 3AO1A 4O4GA 3SMPA 2ASMA 2GUSA 4FWPA 1Z56A 3VQ9A 2EWSA 5LMUK 1JCCA 1VQPP 3T3FA 2KFZA 1K6YA 1T2KD 5F0XA 1ILYA 2R3CA 3WQTA 2FFDB 1VQ5N 3FR0A 4FSVA 4ZMDA 2POHA 3GBTA 1OFCX 1OIPA 5C10A 4U3FD 3V2NA 2K88A 4I1LA 1JMBA 4N78E 3AA2A 3L0QA 3CCJN 2YHBA 1ZRTE 2WPVB 2BANA 4GKKK 1L0NG 4DV4K 5HRNA 4QCLA 4KO0A 3IG1A 5AZJB 3V1QA 3DLLL 4B1VA 2DTUA 1OKJA 2Q0RA 3S41A 5C2DA 4FWLA 3CI9A 3WXIA 3OYLA 3H46O 3G4SN 2W83C 2IBZI 3M8PA 3MEEA 2A45G 2ZGYA 5M1PA 1BCCE 4IO8A 4B3OA 4PD4D 3OHRA 2IZ0A 4OKKA 4JAXA 3V1OA 1N34K 2R5BA 5CCHD 2IBZG 1E4FT 1RTDA 2JKVA 2E76C 3O1WA 2XV5A 5D3GA 3KPEA 4Z4CA 2IYPA 4IJNA 2W42A 2G3AA 1RFQA 2ZYDA 4LFAK 2P9SA 3GHGC 2ZQBA 2QIWA 3CWBE 4B8AB 1VF5B 3G6EN 5A2QO 1W5CE 5AVTB 3ENHA 4PHTX 2KSJA 1RT4A 1KORA 2ZM6K 1QQOA 3J7AP 3UKRB 4WY4C 1FZCC 2E2OA 3DRSA 3L71J 4E7LA 1IK9A 3DLRA 3RL0g 3E9LA 4DTMA 3VQQA 1KFMA 2OYHC 5KLVD 1HJBA 5FPNA 4FLZA 1N73C 3H1HE 2IBZE 1L5UA 4FWMA 3V2QA 4M3RA 3JCUH 4TLFA 3EZWA 4IFDK 1FZFA 4MO4A 3H6PA 1N8RQ 3THWB 1WBDA 2HG5D 2D1KA 3H08A 3QBXA 4WQ4C 1EWRA 3ZCMA 4UB8E 3L73D 4E89A 1N6QA 1KRPA 1NTMG 3S3MA 4CZMA 1SV5A 3J81O 2GBZA 2WSCJ 3AVLA 5AQTA 1JY2O 1RGIA 4RWTA 2VWJA 3CIPA 1YIJP 2WUSA 3LDSA 2YNIA 4RW6A 2UWJE 1Q90D 2D0OA 3A5NC 3VMAA 2GA1A 1VQOP 1IK7A 1ZN5A 1QSLA 4K42A 5EX5A 3AA3A 1ESVA 2KSEA 4JI6K 1C0UA 3NFAA 4M3WA 4JHDA 1MV8A 4CK2A 1ZXGA 4E1MA 3P39A 1KVBA 3IDHA 5BR9A 2N9BA 5I3UA 4PJ0E 5KKZB 2V7QJ 4JN4A 2QXFA 4CEBA 4FJNA 1HGZA 3MMVA 3LPTA 5JS1A 3H1IG 3MHVA 1TKZA 3IMXA 3LDQA 3KK1A 5IWAK 2PP6A 3ZT0A 1BIUA 5AW9B 2QA4P 3HO1A 3SQ1A 3VEWA 2AXTE 1BHLA 1QQNA 1EP4A 5FRNA 5C0YA 4M7YA 3R9PA 4BC5A 1C0GA 3JC22 4MLEA 3BZCA 5FPEA 1F21A 3V2RA 2Q7CA 4JEPA 1VSFA 4PKIA 3N7NA 1H89A 4BRGA 4M3TA 5FRMA 1CXUA 4H44C 1YJWN 3AEDC 5AVSB 3AVNA 2PAJA 2H89C 1IFPA 2OYIB 3OW2M 2WSEH 3NF9A 3CCRP 1SL0A 3PP5A 2P9IA 2H8PD 3CCEP 1YTZT 3H1ID 4CD3A 1HNVA 1KVCA 3WXMB 4GV6A 3R4YA 4IEEA 3L71D 2OPPA 4CZFA 4DQ8A 2OGUA 1E5WA 1FDIA 2OTLP 1RDBA 3ASMA 1NU1E 4JKCA 1OMIA 4L74A 3O4QA 1RILA 3ZT4A 2O1KA 3FXDA 1IFJA 4MDAA 1O1WA 4CJQA 2NPSA 4F2SA 1HF9A 3GLMA 4R4LA 4CZLA 1XMOK 3CC2P 1DTTA 2XDJA 3O5BA 1VQMP 4CEQA 2W40A 5JVHL 1VQLP 4JK9A 3HE5A 2YXRB 5C42A 1NOZA 2P9KB 3VTPC 1RF0C 2UXDK 1TK8A 4RW8A 1X3NA 2WPRA 2QRXA 1LWCA 4RTFD 2NRRA 4D6TE 3O6WA 4JS5A 1CZ9A 3SFEC 3U3GA 2HMIA 5AW7B 4EAHD 1NVOA 4K8ZA 2NPSD 1HR0K 3TANA 4YHHK 3NHGA 5KLIB 3L70D 4WVZA 4EDFA 3L4IA 4LC1A 5TJHA 5CR4A 2MKVA 5J2MA 2KB7P 3QMLA 1HYSA 1WSIA 5AQQA 1NKBA 1SP4A 5EFWB 1UOCA 3OW2O 1JLGA 3VF6A 1X9SA 1JLCA 4ISFA 4DSJA 2R3SA 1DEBA 1HJOA 1NU1D 4H13C 4DTRA 4KB1A 3QIPA 2KLUA 2HPCA 1PP9E 1U7JA 3CXHE 1VSHA 3N4PA 2JWKA 1VK0A 2G8VA 4JBZA 1HMVA 2P9NB 2NPSB 3GF3A 1RY3A 2D0AA 2P5GA 4I7ZC 3AY9A 1JY3O 4FW2A 5J2NA 4LF5K 4H13D 4H44B 1U47A 3O8MA 3L72J 5ADXH 1LNQA 3WEEA 4CBXA 3E1RA 3V6DA 3WXKA 5M1KA 2ZJSE 4C8LA 1HQUA 3B6OA 3II6A 4E3SA 5HRSA 3S3NA 1VQ8P 1NM1A 1W9HA 3DLKA 1JLAA 4N76A 4CFAA 2I1JA 1H1VA 5CBNA 1KYOE 1W97L 4LH4A 4H4OA 4CF8A 4JI0K 1T3UA 5LL6Z 3VEYA 1BCOA 2HNDA 4H13B 1ZBSA 3THVA 4OO1J 1KMIZ 3AEBC 1O13A 1QE1A 5JLHA 2A45H 3A0HH 3FGAD 3HVTA 4A5BA 2N1TC 3LW5J 4BG8A 2VCPA 2G8HA 1BSNA 4WFAL 4FLVA 1NKZB 1NTKE 3RL0B 1QVGM 2YNFA 1XHZA 1SQPE 1IH7A 1BWFO 1U57A 1N5YA 4WQ4A 3HRNA 1I39A 1EDLA 1YJNP 2UUCK 1N86A 3K2PA 4IG3A 2EX3A 3CHWA 2JWDA 3VMYA 3RWUA 4ICLA 4D6TJ 2HB5A 2B5JA 1IV0A 5CYQA 1RTJA 2Q6QA 1NGGA 3CXHI 1IBKK 3HD7A 3S9HA 2D2CC 4MN4C 5KAFH 2E43A 5KGXA 2OTJN 2VYPA 1VQ4P 2G8FA 1HBWA 2KS1A 2ZGZA 3LP3A 4ILJA 3H3NO 3CCJP 4ID5A 1E79H 4KBOA 3F5HA 4B1XB 4DQSA 1S22A 2E6LA 4ZKUA 5CE3A 4M45A 2IBZD 2UU9K 1IO4A 2WSFJ 1B92A 4O0IA 3MXIA 5KQ8A 4PD4I 1TL1A 4EP5A 3VQ5A 4OGCA 4OGQC 4YOXA 3CQXA 3B5ND 4O5BA 4WQ5C 4DSEA 3ENOA 3DLGA 2HHQA 1AQTA 4G9ZA 1RBUA 5DJUB 3IN6A 3W67A 5EXWA 4LSLA 3MAQA 2FLOA 3BDPA 2KZIA 4PQUA 2NUBA 3RBZA 3F9KA 5AQUA 4FM2A 2XHBA 1WNSA 1YT3A 1NU1J 1NLVA 5CJ0A 5TKYA 3PX0A 5KLVG 5F1XA 1GOAA 2A5XA 2OTJP 3KZBA 4CHQA 1D7MA 4PWDA 2D5RA 1D9DA 3G71P 1RDDA 3E1IA 4AUWA 3HI0A 4DU1A 5JICA 3M9BA 4C1NK 3O3FA 1YJWP 3CJ9A 4FWQA 3TSPA 4E7HA 3CD6P 1L0LJ 4J8FA 1Q7YO 4N56A 3QDKA 4GKJK 4QMAA 1BQNA 1NTKG 1IFMA 2WTYA 4KI6A 2QK9A 3ABVC 5HL7L 3RRGA 1KLNA 4IL6H 3VMXA 3OJSA 4PD4H 3OYNA 2O8BB 1FS0E 1KQLA 1ZBHA 3K5NA 4BQZA 3Q2YA 5GADP 1KILC 1OH8A 3MXJA 2UYTA 4CE9A 4PA1A 1BQMA 3AAPA 1N2DC 4Z4HA 1KB9E 2FY8A 4CF1A 4YFUA 2E1YA 4H0TB 4AQRD 1GL2A 3AVAA 5AQSA 3V9SA 5EY4A 1IG8A 4B1ZA 5JVGL 3PX6A 2XY8A 3QLHA 4GV3A 3ZT2A 5KQDA 2QJPC 3ZEUA 5BPNA 5CCHA 2ITGA 3O9QA 5KKZC 4LFBK 3CC4P 2QW9A 4FWOA 4JKDA 1M7LA 2JJLA 1Q81Q 2OPRA 3K5LA 1YI2P 2OCEA 3CF5L 3S1KA 2FBTA 1UA1A 4B3RK 1QVFO 3DOKA 3OYAA 4LF9K 2P9PA 1S72N 2QWMA 1S6PA 4ASWA 1K8KB 4AHSA 3VA0A 2NRTA 5CYMA 3L4FA 4CGFA 1ZLLA 1KILA 1GOCA 1SKSA 3AE1C 1BSHA 2Q9IA 2HPCB 3DAWA 3CCLP 4DCHA 4GKGA 5SZTA 2FF6A 4DQRA 4M42A 1RBVA 3FE1A 3P8CD 3G9RA 3OS0A 2CPSA 1EKEA 4R5PA 3M8SA 2WONA 4CGJA 3U1AA 2NRGA 3QWOC 5E79H 1R8EA 2E74B 2KIKA 2KQ2A 4DTOA 3SWKA 1S1XA 4OVNF 3KHUA 4FJ8A 2HHVA 2OQQA 1BI4A 3O9TA 2I7NA 1NJIQ 2IS3A 1VSMA 1VDFA 4PV1D 4CFBA 3TTDA 1SQBK 1ITGA 5GTHE 2OYHB 3A8YA 1JXEA 4KT0J 4N6JA 3KK3A 1ZYQA 1EQYA 3CI5A 1SQQG 3PUFA 3L37A 3E7KA 1SFCA 4O44A 5AR0A 4CBUA 4X66K 2O8DA 4K43A 5B5EH 1TV6A 3ZT1A 2N1TB 2R5DA 4RW9A 3NFQA 3T7ZA 1URQD 3EQ2A 2NRZA 1C0FA 4E0DA 2O8FB 3ID6A 1N33K 1S5LH 1WAJA 3P38A 3DM2A 1VF5C 3TNUB 1K8KA 1BA1A 4GVMA 4W7ZA 3RK2B 1WMKA 2QM7A 4FO0A 1HTLC 2OANA 1XI1A 4HH2A 3I5CA 3SUOA 2ZJPL 1VQNN 1NGAA 3CQ8A 3A0HE 2E20A 3MN5A 2JWAA 2OYOA 3MD0A 3HBTA 1VQMN 2QWLA 3PO5A 4N47A 4CJLA 3ITKA 3U9ZA 1SL2A 3VF4A 3VQ6A 4IL6E 1NGIA 4BWJA 1XTCC 1FJKA 1SQPD 1EDKA 1LWUC 2M8RA 3UB5A 3V4WA 1GLFO 3HSCA 1EETA 3HL8A 1FAVA 3WUTA 4KKOA 2WSEJ 2PRRA 3UKUB 1EXJA 1RBSA 5KTBA 3TGUE 4H0OA 3A3YB 1JNMA 3MN7A 2AP1A 3AAQA 4WB4A 4BRLA 4DV6K 3HTKA 4NCGA 1U49A 3OTOK 1NU1K 4JI8K 3V6IA 2Z4EA 2Z1GA 5IT9O 1T8ZA 2C0WA 3CPWM 4DUZK 1SQVK 2ZXXA 1RDWX 2HSTA 1BOTO 1G2CB 1H8AA 2GEMA 1KD1O 4RO0A 4Q5VA 1R59O 2GUIA 4A5AA 1SQVG 1NTZD 1MWKA 5E26A 3VQ4A 3KXDA 5AQHA 3FFKB 1JY3P 2KS1B 2G8KA 3HPHA 4YORA 2ZYAA 3T69A 1SQPK 3ZYYX 3TYYA 4B1WB 4A62A 1CZBA 4FJ5A 1S5LX 2F8TA 4FZXC 4RG8A 3TWHA 3KLFA 3AVFA 1E4GT 2P10A 3OVNA 3L3UA 2P9LB 4JI1K 2JR8A 4JI2K 4NCBA 1NK4A 2YNHA 1KD1Q 4CZGA 4WF9L 2HYNA 3L75G 5AQOA 1BCCG 1DH3A 2VGMA 2QEXN 1SS6A 1K05A 3OYBA 3KZIE 4C8MA 3HUSC 3SUNA 5KAFE 2FKWB 3WXLA 1LTJA 3A5MC 1BDGA 3R3LA 2XY6A 4X64K 1NTME 1FJGK 2WPSA 2RHKA 3VESA 2RH0A 4LSNA 3BASA 2Z1JA 4ELVA 3AO3A 1U45A 4CJ7A 2WOMA 3KLIA 4B86A 3V9WA 4CF0A 2V7ZA 3SLCA 3OBWA 4E7IA 2RPIA 3FZKA 2YCHA 2BCCE 1X0TA 2ZFCA 2X6NA 3F9MA 2J5UA 1BGYJ 3DI6A 4R79A 1QEXA 4I2LC 1SS1A 1MUUA 1V4SA 4PL8A 4DSKA 1CSBA 4IDHA 3VETA 3FZLA 1JCEA 3LDPA 3SQ2A 4CIGA 3A5LC 4UY8O 3ID8A 2WQYC 3EFGA 1AQ5A 3ATVA 1BE3G 1RE3C 4X62K 5M1BA 3P1GA 4Y99C 1KLMA 1HVVA 2YX6A 4BXLA 4CJUA 3KJVA 1IKWA 2PBDA 4LF7K 4DSLA 4KFBA 1C1CA 1G99A 4W5QA 4YOUA 2DFHA 1RT2A 1SQBJ 3TNUA 3VQEA 1OH7A 2F8SA 3V5BA 4BRMA 1J1DC 1YI2N 1YJ9N 3B5NB 3VQPA 1PGOA 2ZJQL 4J2DA 1NKNA 3LM2A 4JI7K 2Q31A 3AO4A 3OY9A 3A0IX 2K3RA 5AVVB 2QM8A 3OJAB 5APWA 2E2NA 5FPDA 4BDPA 1CW5A 1G1IA 3W0LA 5HROA 5AVYB 5C12A 1S2EA 4GV9A 1J9AA 2D0PA 3GHGB 2ZJRL 2HVIA 3WUUA 1TGOA 1IKXA 2F9WA 4MO5A 4CJRA 4BACA 1YBKA 3RSEA 5BN8A 3GMAA 4FJ7A 3O6QB 3H25A 1OW6A 1JCFA 3D2FB 2WMMA 4FOEA 3M9HA 4CCHA 4NO7A 1ZV8A 4UQGA 2OYHA 2DPNA 4EIJA 4L76A 1KYOI 3NGIA 2O8BA 4B1YB 3O80A 5FROA 3ISNC 3QERA 2J58A 1DEEG 1HRHA 1ATNA 1U6ZA 3SFDC 5KI6A 1PV3A 3L72E 1UIXA 1OW8A 4B9LA 1IJDB 3ALYA 2HBMA 1BA0A 3NCIA 3O3HA 3OYHA 4GDOA 1SQXG 4CBWA 2Q97A 2HHTA 5BR8K 2B89A 1CZAN 3L75E 1PP9J 2Q2RA 1VSLA 4FXDA 1XNQK 4CJTA 3T97A 3Q5PA 1FZCB 3S3OA 1T05A 1W7AA 1W2EA 3CX5I 3FZHA 1GLDG 3HYFA 1BE3E 3L73E 3B8AX 4FJ9A 1QL1A 2W6JH 3OBYA 1GK6A 4Y28J 1BO5O 1SFCB 3P31A 1M1KO 1T3JA 3F73A 1M57D 4ELUA 2XY7A 4CERA 3M3ZA 2NPSC 3H1HD 3NH2A 2Z5HA 1SQXD 2QTDA 1M56D 2FXMA 4IWVA 4ASVA 4BVPA 3CFRA 4I6MA 4B08A 3L74J 5TISE 4H0LB 4QS9A 2K37A 1SQXE 3H32A 2G8UA 3BGRA 4CJFA 1DKGD 4Z0UA 2ZT9B 1Q9YA 2H43A 1NMNA 3L72G 5CHXA 3LDLA 5GIOA 4K0KK 5AJ3K 3C1LA 2P58A 3A7OA 1WSGA 3KWIA 1R5LA 4EZ6A 4A2BA 3ZSWA 1YJNN 3SK3A 3M9QA 3O08A 2VG7A 1J1EC 3HM8A 1SQBD 2PFXA 4NPEA 1TK5A 3H6EA 2HR3A 3VGMA 4LGDE 3QEPA 4C8NA 4QOZB 5DK5A 4PD4E 4KHQA 3L72D 5KRSA 1ZOYC 3MEGA 2Y1IA 4JKBA 2V51B 4O5FA 2IAJA 1L3VA 2Z1IA 1EDJA 4OVLA 3ATUA 2HHHK 1FW6A 3HE5B 3DRRA 1JCDA 4ZHRA 4FLYA 3SZ2A 2GTDA 1IBLK 4WBAA 3DXMB 5KPZA 4IOCL 1BL3A 1L0LK 4N3YB 1LWUB 1SQVE 4M3XA 3SQ4A 1JL2A 1QGKB 1D8YA 3BUZB 5CCGC 3Q3DA 1SQQJ 1S3XA 3TDKA 3K59A 1NH4A 3I8BA 1FZEA 2Q3IA 1W0HA 4W7YA 3K57A 4DR4K 1NKCA 3RK2C 2P1JA 1GMJA 1KQGB 4C7NB 1SLQA 1IFIA 1HWTC 2QI2A 3O3GA 4W5NA 3WNHA 5FDLA 4FWSA 3KLGA 4HUGA 1FZAA 4BWNA 1J5OA 2AXTH 2P9SB 2E2PA 1TAQA 1V4TA 4L3QA 3L2UA 4FLWA 4IG0A 3LALA 4CHZA 3IAYA 5BN9A 4B3SK 1KAYA 2BCCG 3OYCA 2WTUA 2QJYB 4HB1A 3AA4A 3KHYA 5M1QA 1L2PA 1NTZJ 3ZSOA 2LXCB 2KHOA 2XKMA 3L74D 4QS8A 2IFNA 4JRPA 3GW6A 2JLEA 1GU4A 4BR5A 2YKNA 3VMZA 4PUOA 5JS2A 3CCVN 1RQVA 1N7LA 3KTQA 1JLQA 4B9UA 4B9SA 1NKEA 1C0TA 3H1IJ 1LTBC 3PRJA 2ZXEB 1S6QA 5AVZB 1L4AB 1LOTB 3KIOA 2YKOA 4DU4A 3C6TA 2BCCD 1X9JA 2O4IA 3H1JE 3VQ7A 4KRFA 5B66H 2E5LK 4C7RA 5HRPA 4BDYA 2ZAEB 2NRHA 1R5SA 3CQYA 3VN5A 4RW4A 3CJ1A 2ZVOB 4DR3K 3V81A 4Y99B 5KAIE 2WZ7A 3ZLJA 4Z4IA 1IJJA 3M6GA 4JI3K 2R44A 2VWKA 1EO1A 4UB8H 4Y0WA 1L0ND 1WRGA 4YNQA 3CCUP 2W6KA 3TAEA 1GL2D 1P84I 4ID1A 2KZMA 3FWLA 3CWBG 4BRDA 4JPZB 1QZ5A 3LM9A 3LZIA 4RKUJ 3O9RA 4FM1A 1PPJG 5C2FA 1J5EK 3AVBA 2B88A 1HJ0A 3LWMA 3K9KA 1VQKP 3VENA 4FVMA 4KHPK 4K3AA 3P5JA 2E76D 1RT5A 2ETJA 3SAHA 2HNZA 1JJ2M 3NMUA 4CJKA 3L70J 3HVRA 3GL1A 2YHYA 5F2RA 3SPZA 3M0DA 4AHCA 1LV5A 2IIRA 1KAZA 2D0CA 3U59A 4BRIA 4KHYA 1RCHA 2K9JA 1OZHA 2W6LA 3LDNA 4GT1A 4DU3A 1GL2B 1EZVI 5AW8B 4IOAL 4CEDA 1VQLN 3M06A 1KILD 3V9UA 1QZ6A 3MIWA 1LCUA 2Q3SA 4AM7A 2VRSA 4NPFX 3AGRA 1ASVA 1PPJD
chains in the Genus database with same CATH topology
3TAMA 5CCGA 3LW5H 1TKTA 3PX4A 4OGEA 3AVCA 5CY4A 3NF8A 3L2VA 3DMJA 5C24A 1LT9A 3HSTB 3EZ5A 1GL2C 3NH1A 4KHUA 3I0RA 4CEZA 4J2EA 1ZR2A 5AW1B 1WLJA 1T03A 4W5TA 4CEFA 1A5XA 4KHWA 3HPOA 1LTSC 4F4KA 5AVRB 1Y97A 1JTHA 4CFCA 3NGZA 1QSSA 1M1JA 4CK3A 2HNYA 5CCGD 3T1AA 5DMRA 4KAZA 4FYDA 4Q0BA 1A5VA 3DOLA 4C46A 1NJZA 1TAUA 1REVA 3TR8A 3QIOA 4IDKA 1YTAA 4OKEA 1S9GA 3OYEA 1LGHB 4MFBA 3P8CE 1M1JC 1SQXK 1URQC 4Z4GA 2FYUK 5CCHC 3AVIA 1LTIC 4QAGA 1RF1B 2VG5A 1JTHB 5APYA 3I0SA 3MEDA 1DTQA 1ZBFA 4JF7A 4KTQA 1CXQA 3MXMA 1KFDA 1KFSA 2EHGA 4DTJA 3P7KA 1GOBA 1LTGC 1URQA 1IFDA 3RR8A 3FFIA 1L4AC 2C9NY 4Y1DA 4IFYA 3RRHA 3WMM0 4OPJA 1BISA 1J53A 5K14A 1YTUA 1RF0A 1FZBA 3BATA 1X79B 4CIEA 1EXQA 1NK7A 4AYCA 4F3TA 3TSIA 3D45A 3OYIA 1TK0A 2P5OA 1OWAA 2PZSA 5AW5B 1SUQA 2HVHA 1NK0A 2FBXA 1X9VA 3HJFA 3KKSA 1WSEA 3SCXA 3MECA 1LW0A 3OJUA 2YNYA 3KLEA 4IFMA 3SPYA 3B5NC 1J1DB 3RMDA 1HH0A 1T2KC 1XC9A 3HXMA 4BE1A 1WT6A 2L5GB 1JL1A 1QTMA 1JOCA 4HTUA 4C8OA 2BE2A 1RT7A 4FCYA 3BRTB 3L2WA 4OLAA 2YKPA 3OYDA 4DQQA 3HUSB 1HPZA 3VQ8A 1RF1A 4C8KA 1FKOA 3DRPA 2WT7A 2D0BA 5KLVK 3MGNA 4I2QA 3L2QA 1J1EB 3RTVA 2XNXA 2PY5A 5AVWB 3OYKA 1JUNA 1QHTA 2E4LA 1X8YA 4H4MA 2W6AA 4AHUA 2BGGA 4CGDA 3WNEA 2ZE2A 3N4XA 3LAKA 2KW4A 2GM4A 3VN0A 4NCAA 1RDCA 4FJGA 2LKMA 2A45I 3UIAA 3NTNA 4DMNA 2FBVA 3IFMA 3LPUA 1WN7A 1TKDA 3NGYA 5KJ7D 1NOYA 4BWMA 2PYLA 4FJIA 4CJPA 4BE0A 3UIQA 4CJ3A 2R7YA 3RMBA 3ITHA 3M8QA 3TABA 1X1PA 1CI6A 3OS2A 3SYZA 1FOSF 3NDKA 4F8RA 4H8KA 4B8CA 1JLBA 3CM5A 3C6UA 3M8RA 1VPCA 5AW2B 4Z4EA 4GMJB 2KP8A 2XRIA 1L0NK 3AO2A 3KD5E 2OPSA 3TI0A 1U04A 3HUSA 3RL0C 4B9TA 1FZGA 1X9MA 2E6MA 3LP1A 4O9BA 1WSJA 4CHOA 1NWQA 1SL1A 4KB0A 2HHSA 1LWFA 1XHXA 1TL3A 3NF7A 4CGIA 4Z4FA 2P67A 1LT9C 1LTAC 2N1TD 1T8EA 1S1WA 5AW3B 4FJMA 1CLQA 1L3SA 1LTTC 1BI4B 4M3UA 1MU2A 1NTZK 4JYCA 2RKIA 2Q5UA 3K5OA 3NMDA 3VA3A 3VP9A 1MFZA 3SWFA 2HFED 3VQCA 3LAMA 3LIDA 2KTQA 4KI4A 3SV3A 2HODA 4DTXA 1QSYA 1LWEA 1HYZA 3M91A 3U6FA 2MJZA 3VQDA 3V9XA 3HE4A 3HM9A 1LW2A 3TAQA 3K5MA 1I3AA 3K58A 1HQEA 2LSNA 2YKMA 4DSFA 2OYQA 3MTUE 1N7SC 4W80A 1NJWA 3MUDA 1J54A 2OA8A 3G0ZA 2IOCA 4DF4A 4CF9A 1HUCA 4LY7A 4ZTFA 4W5OA 4M3LA 1VSKA 3RK3C 4G1QA 1NHLA 1KVAA 1RT3A 1QS4A 3O4NA 1FOSE 3HP6A 4IBNA 4CJWA 4CJVA 1YYCA 4EOTA 4M3ZA 4RW7A 1A5WA 4C7NA 3HD7D 2KOGA 2WPQA 2H7HA 1NOHA 2M3BA 5I42A 1Z25A 5SWMA 4DOJA 1ZBIA 1SVFA 1LT9B 1WSFA 2RN2A 4FZZA 5HBMA 4CF2A 2HHXA 2JEEA 2XZRA 3CFOA 1Z26A 1QL2A 3VP8A 2X74A 4HHTA 1VRUA 1FDMA 4WY4B 3HTKB 4ZKPA 4IFVA 4FJHA 1FK9A 3KK2A 5KTQA 4HYTB 3U3YA 2HODB 3SI6A 1N7SB 3TARA 3RK2D 1R0AA 1FZCA 5HLFA 3V4IA 4KPYA 4IFFA 4LH5A 4CJ4A 3VQAA 1S1TA 2FBYA 3DYAA 5JS1A 4DWIA 2JGUA 1HYVA 1L4AD 4I6MC 1GW3A 4Y1CA 3V9ZA 1WSHA 4PY5A 2O1JA 1N73B 2YO3A 3KYQA 4AH9A 4FLXA 1NJYA 2ATQA 2B6AA 2KYVA 2FFDC 4AHVA 2F96A 3RK3B 3CYMA 2OZMA 3U1CA 1S9EA 1XWLA 2OYIC 3V4QA 3VOPA 4CESA 1L4AA 4I9LA 3DLEA 1KFNA 1RE3A 4L8RB 2YNGA 3M0DC 3AVKA 4DTUA 3QO9A 2P51A 3PY8A 3P83D 1KTQA 4HCBA 1X9WA 4F2RA 2WWWA 3L3VA 4EZ9A 3IRXA 4DLGA 3CLQA 1IC2A 1RDAA 4CHPA 2B4JA 4XA4A 1S9KD 3KLHA 1GU5A 3NE6A 5EU7A 3HE4B 2G8WA 5HRRA 1SKWA 1JY2P 3L36A 1CI6B 4AHTA 4DS5A 4CJEA 3HPGA 3TAPA 3C95A 2HHWA 1J2JB 5BVZA 2FFDA 1SKRA 5CMZA 3AVHA 3WNFA 3QETA 1BCMA 2KFNA 1N7SA 1RBTA 3NH0A 2OZSA 2W6BA 1DX7A 5KJ7A 1RF1C 2RF2A 1TVRA 4LLHA 3SQ0A 4DTNA 4AILC 1RTIA 1C0MA 1YVUA 4N5SA 5CJ4A 3OAKA 1IKYA 4B9NA 2DY4A 4CECA 3JYTA 4O55A 5APQA 1JKHA 3NAEA 4HUEA 4FJLA 2ZD1A 3L8BA 1LWUA 1GDTA 2YO2A 1ASUA 1Q8IA 4KHXA 1A02J 1JLEA 4CJSA 2GUVA 1JLFA 1C6VA 1NTMK 1URQB 1EQ7A 3TAGA 1ASWA 3L2RA 1B9DA 3QEWA 3A2FA 2IDOA 1RT1A 4W5RA 3H32B 4JLHA 3BVHA 3NF6A 4DQIA 3HD7C 2P2UA 2FC0A 5AVXB 4OH8B 3HK2A 4OKJA 3EYZA 1LAWA 2OPQA 4DTSA 4FJJA 4DF8A 4NYNA 3QNOA 4KHSA 3VQBA 2Z1HA 2N1TA 4RESB 1ZR4A 4BE2A 4NYFA 2OYIA 4DTPA 2YHAA 4ELTA 1JXBA 3OA7A 2I1KA 4KV8A 2XO7A 5KGWA 4CHYA 1JMMA 3M0AA 4CGGA 5BU5A 3ZSVA 1T7PA 3ULDA 2WT7B 1VSJA 5AVUB 2IFMA 4E7JA 2X6SA 5CZ1A 1U4BA 3DLBA 4JYBA 2DFEA 4KHNA 3AO5A 1SFCC 3LANA 4KREA 3B6PA 1RT6A 3HT3A 3A2AA 4DLEA 2QKBA 1JY2N 1L3UA 5J1EA 2YKQA 4FJKA 3KDPB 4FW1A 4GW6A 2IPPA 4FK4A 2O4GA 1LTJB 2W27A 2O01H 2WITA 1HGVA 4CHNA 5E41A 3RMAA 1UAXA 4EP4A 2YV0X 2WSCH 1GTWA 2C0XA 2A1SA 3G3ZA 3NBPA 4FK0A 2HHUA 5APXA 1BIZA 3LP0A 3TK1A 1ZBUA 1QQCA 5HP1A 1NK6A 1DLOA 4DQPA 3V1RA 3C9IA 3KD1E 5AW6B 2R32A 3I8DA 3LIEA 3RL0D 1FXXA 1FBMA 1GK4A 2IX7C 3LWLA 4WY4D 4TSXA 3RK3D 4DZOA 1RNHA 4DSIA 3ZSXA 1JY3N 1M1JB 1G2CA 4CK1A 4DG1A 5KJ7C 1C1AA 2DFFA 1ZBLA 1D5AA 1S1VA 5APUA 1RBRA 1UWBA 4MQ3A 1LAVA 4CGHA 2A1RA 4XIUA 4AHRA 3P8MC 3AVMA 4E1NA 2FYZA 4F3OA 1U48A 3NXSA 3CFPA 4FLTA 3R2PA 4WY4A 3IR9A 2P7JA 4I9QA 3QEXA 4M3YA 3ZSZA 1NO4A 3SWYA 1VSDA 5KRTA 2AJQA 1RE4A 1HJRA 1GD2E 4WE1A 1VSEA 1OXZA 1PFIA 1BGXT 2Y1JA 3SUPA 4OJRA 3V2PA 1IO2A 4N78D 4DS4A 1SQQK 5AW4B 1WAFA 1FU1A 4GIFA 5APTA 1FKPA 4DFKA 4CJ5A 4JS4A 1VRTA 2Z5IA 1S5JA 3P32A 2KZZA 4B9MA 1RE4C 1UA0A 4HCCA 4HVJA 3OS1A 1L3TA 3RMCA 1IG9A 4FK2A 1NK9A 3LP2A 5AVQB 4KTWA 2G8IA 4FZYA 2E42A 1Q9XA 1EX4A 4ZTJA 5J2PA 4I2PA 3KKRA 1LTJC 3ZSQA 4OPKA 3AVJA 3PO4A 3G10A 4B9VA 2GV9A 3T19A 5J2QA 3LZJA 5CZ2A 4J2BA 3ZSRA 4O0JA 3L35A 1NTKK 1AFOA 3JSMA 3OYJA 1NAFA 2PYJA 1N7SD 1RTHA 4CFDA 3OYMA 3OYGA 2X78A 3CM6A 3BRVB 3E01A 1TKXA 2IGIA 3D0PA 3RR7A 4BDZA 3QEVA 2J59M 4XE5B 4HUFA 3IS9A 1A02F 1N73A 3ZT3A 5AW0B 3B5NA 3PV8A 3O8ZA 3QNNA 4M41A 4FJXA 5APSA 3AV9A 4DFMA 1KSPA 1GW4A 1IFNA 3EY1A 3C94A 1MZ9A 2VG6A 4JRQA 1SFCD 3TAFA 2HW3A 4CIFA 3ZSYA 3WNGA 3SUQA 1C1BA 3HD7B 4DFJA 1YTZI 1JO5A 1B9FA 2XU6A 3A5TA 5T7BA 4I7FA 3SJJA 2BASA 3OYFA 1S9KE 2CPBA 1NK5A 3B8EB 2XY5A 2BDPA 3GHGA 1S1UA 4CEAA 1XTGB 4N41A 2IC3A 4K8XA 3SV4A 5BU8B 1CZQA 1NJXA 1D9FA 3VYIA 2OARA 1IKVA 1FJPA 1NK8A 2KLVA 1KCFA 1KILB 3QESA 5APVA 3HP9A 3AVGA 2HLOA 4LD0A 4CEOA 1KZUB 4KTZA 2I5JA 1HNIA 2YMYA 1GZLA 1VSIA 3QEIA 2WSFH 3AA5X 5C25A 1G15A 1H88A 4FM0A 3QINA 1G1JA 3KQGA 3CG7A 2QKKA 4E19A 4FLUA 4OLBA 4J2AA 4DFPA 3CL3D 4E7KA 3DLHA 3SNNA 4IKFA 2C9LY 3AO1A 4O4GA 2GUSA 1Z56A 3VQ9A 1JCCA 3T3FA 2KFZA 1K6YA 1T2KD 2R3CA 2FFDB 2POHA 3V2NA 4N78E 3AA2A 4I1LA 2YHBA 2BANA 4QCLA 5HRNA 4KO0A 3IG1A 3V1QA 2DTUA 3CI9A 3OYLA 3M8PA 3MEEA 2A45G 4B3OA 4OKKA 3V1OA 2R5BA 5CCHD 1RTDA 2XV5A 5D3GA 3KPEA 4Z4CA 2W42A 3GHGC 2ZQBA 4B8AB 5AVTB 2KSJA 1RT4A 4WY4C 1FZCC 3DRSA 4E7LA 1IK9A 3DLRA 4DTMA 3VQQA 1KFMA 2OYHC 1HJBA 4FLZA 1N73C 1L5UA 3V2QA 4M3RA 4IFDK 1FZFA 3H6PA 2HG5D 3H08A 3ZCMA 4E89A 1N6QA 1KRPA 3S3MA 1SV5A 2GBZA 3AVLA 1JY2O 2VWJA 3LDSA 2YNIA 4RW6A 1ZN5A 1QSLA 3AA3A 1C0UA 3NFAA 4M3WA 1MV8A 4CK2A 4E1MA 1KVBA 2N9BA 5I3UA 2QXFA 4CEBA 4FJNA 1HGZA 3LPTA 1TKZA 3KK1A 2PP6A 3ZT0A 1BIUA 5AW9B 3HO1A 3SQ1A 5FRNA 1BHLA 1EP4A 1F21A 3V2RA 2Q7CA 1VSFA 3N7NA 1H89A 4M3TA 5FRMA 1CXUA 5AVSB 3AVNA 2PAJA 2OYIB 2WSEH 3NF9A 1SL0A 3PP5A 2H8PD 1YTZT 1HNVA 1KVCA 2OPPA 1E5WA 1RDBA 3ASMA 3O4QA 1RILA 3ZT4A 2O1KA 1IFJA 1O1WA 4CJQA 2NPSA 4F2SA 1DTTA 2XDJA 4CEQA 3HE5A 5C42A 1NOZA 3VTPC 1RF0C 1TK8A 4RW8A 2WPRA 1LWCA 4JS5A 1CZ9A 3U3GA 2HMIA 5AW7B 4K8ZA 2NPSD 3TANA 3NHGA 4LC1A 5J2MA 2KB7P 1HYSA 1WSIA 1NKBA 1SP4A 1UOCA 1JLGA 1X9SA 1JLCA 4DSJA 1DEBA 4DTRA 4KB1A 3QIPA 2HPCA 1VSHA 1VK0A 2G8VA 1HMVA 2NPSB 1RY3A 2D0AA 2P5GA 1JY3O 4FW2A 5J2NA 1U47A 3V6DA 4C8LA 1HQUA 3B6OA 3II6A 4E3SA 5HRSA 3S3NA 1W9HA 3DLKA 1JLAA 4N76A 4CFAA 2I1JA 4LH4A 4H4OA 4CF8A 1T3UA 1BCOA 2HNDA 3THVA 1QE1A 2A45H 3HVTA 2N1TC 2G8HA 4FLVA 1NKZB 3RL0B 2YNFA 1XHZA 1IH7A 1N5YA 3HRNA 1I39A 1N86A 3K2PA 4IG3A 2EX3A 3VMYA 3RWUA 4ICLA 2HB5A 2B5JA 5CYQA 1RTJA 3HD7A 3S9HA 2E43A 5KGXA 2G8FA 1HBWA 4CEEA 4ID5A 3LP3A 4DQSA 2E6LA 4ZKUA 4M45A 1IO4A 3MXIA 1B92A 4O0IA 1TL1A 4EP5A 3VQ5A 4OGCA 3B5ND 4O5BA 4DSEA 3DLGA 2HHQA 1RBUA 4LSLA 3MAQA 3BDPA 4PQUA 4FM2A 2NUBA 3F9KA 2XHBA 1WNSA 1YT3A 5CJ0A 3PX0A 1GOAA 4CHQA 4PWDA 2D5RA 1D9DA 1RDDA 3E1IA 4AUWA 4DU1A 3M9BA 3O3FA 4E7HA 4N56A 1BQNA 4KI6A 1IFMA 2WTYA 2QK9A 3RRGA 1KLNA 3VMXA 3OJSA 3OYNA 1KQLA 1ZBHA 3K5NA 1KILC 3MXJA 4CE9A 4PA1A 1BQMA 1N2DC 4Z4HA 4CF1A 4YFUA 4AQRD 1GL2A 3AVAA 3V9SA 3PX6A 2XY8A 3QLHA 3ZT2A 5CCHA 2ITGA 1M7LA 2JJLA 2OPRA 3K5LA 2FBTA 1UA1A 3OYAA 3DOKA 1S6PA 4AHSA 3VA0A 5CYMA 3L4FA 4CGFA 1ZLLA 1KILA 1GOCA 1SKSA 2Q9IA 2HPCB 4DQRA 4GKGA 5SZTA 4M42A 1RBVA 3P8CD 3OS0A 2CPSA 1EKEA 4R5PA 3M8SA 2WONA 4CGJA 3U1AA 2KQ2A 4DTOA 1S1XA 4FJ8A 2HHVA 1BI4A 2IS3A 1VSMA 1VDFA 4CFBA 1SQBK 1ITGA 2OYHB 1JXEA 3KK3A 4N6JA 1ZYQA 3PUFA 3L37A 4O44A 1SFCA 3ZT1A 1TV6A 2N1TB 2R5DA 4RW9A 3NFQA 1URQD 3EQ2A 4E0DA 1WAJA 3DM2A 3TNUB 4GVMA 4W7ZA 3RK2B 2QM7A 1HTLC 1XI1A 4HH2A 3I5CA 3SUOA 3CQ8A 3PO5A 3MD0A 4N47A 4CJLA 1SL2A 3VQ6A 4BWJA 1XTCC 1FJKA 1LWUC 2M8RA 3V4WA 1EETA 3HL8A 1FAVA 4KKOA 1RBSA 5KTBA 3A3YB 1JNMA 4WB4A 3HTKA 4NCGA 1U49A 1NU1K 2Z4EA 2Z1GA 1T8ZA 2C0WA 1SQVK 1G2CB 1H8AA 4Q5VA 2GUIA 3VQ4A 1JY3P 2G8KA 3HPHA 1SQPK 3TYYA 1CZBA 4FJ5A 2F8TA 4FZXC 4RG8A 3TWHA 3KLFA 3AVFA 3OVNA 3L3UA 4NCBA 1NK4A 2YNHA 2HYNA 1DH3A 3OYBA 4C8MA 3HUSC 3SUNA 2FKWB 1LTJA 2XY6A 2WPSA 4LSNA 3BASA 2Z1JA 4ELVA 3AO3A 1U45A 2WOMA 3KLIA 4B86A 3V9WA 4CF0A 4E7IA 2RPIA 2X6NA 2ZFCA 3DI6A 4I2LC 1MUUA 4DSKA 1CSBA 3SQ2A 4CIGA 3EFGA 1AQ5A 1RE3C 3P1GA 4Y99C 1KLMA 1HVVA 3KJVA 4CJUA 1IKWA 4DSLA 4KFBA 1C1CA 4W5QA 2DFHA 1RT2A 3TNUA 3VQEA 2F8SA 3V5BA 1J1DC 3B5NB 3VQPA 4J2DA 1NKNA 3AO4A 3OY9A 2QM8A 3OJAB 5APWA 5AVVB 4BDPA 1CW5A 1G1IA 5HROA 5AVYB 1J9AA 3GHGB 2HVIA 1TGOA 1IKXA 4CJRA 4BACA 4FJ7A 3M9HA 4CCHA 1ZV8A 4UQGA 2OYHA 4EIJA 3NGIA 5FROA 3ISNC 3QERA 2J58A 1HRHA 5KI6A 4B9LA 1IJDB 3ALYA 3NCIA 3O3HA 3OYHA 2HHTA 1VSLA 4FXDA 4CJTA 3T97A 1FZCB 3S3OA 1T05A 1W2EA 3HYFA 4FJ9A 1QL1A 1GK6A 1SFCB 1T3JA 3F73A 4ELUA 2XY7A 4CERA 2NPSC 3NH2A 2Z5HA 2FXMA 3CFRA 4B08A 3H32A 2G8UA 3BGRA 4CJFA 4Z0UA 1Q9YA 2H43A 5CHXA 3A7OA 1WSGA 4EZ6A 3ZSWA 3M9QA 2VG7A 1J1EC 1TK5A 4LGDE 3QEPA 4C8NA 4QOZB 5DK5A 4KHQA 5KRSA 3MEGA 2Y1IA 2IAJA 1L3VA 2Z1IA 4OVLA 3HE5B 4FLYA 1JCDA 3DRRA 3SZ2A 4ZHRA 4WBAA 1BL3A 1L0LK 4N3YB 1LWUB 4M3XA 3SQ4A 1JL2A 1D8YA 5CCGC 3K59A 1NH4A 1FZEA 2Q3IA 1W0HA 4W7YA 3K57A 1NKCA 3RK2C 2P1JA 4C7NB 1SLQA 1IFIA 1HWTC 3O3GA 4W5NA 3WNHA 5FDLA 3KLGA 4HUGA 1FZAA 1J5OA 1TAQA 3L2UA 4FLWA 4IG0A 3LALA 4CHZA 3IAYA 3OYCA 3AA4A 3ZSOA 2XKMA 2IFNA 4JRPA 2JLEA 1GU4A 2YKNA 3VMZA 4PUOA 5JS2A 1N7LA 3KTQA 1JLQA 4B9UA 4B9SA 1NKEA 1C0TA 1LTBC 2ZXEB 1S6QA 5AVZB 1L4AB 3KIOA 2YKOA 4DU4A 3C6TA 2O4IA 3VQ7A 4KRFA 4C7RA 5HRPA 4BDYA 3VN5A 4RW4A 3V81A 4Y99B 2WZ7A 4Z4IA 2VWKA 4YNQA 1WRGA 3TAEA 1GL2D 4ID1A 2KZMA 3LZIA 4FM1A 3AVBA 3LWMA 4FVMA 3P5JA 2ETJA 1RT5A 2HNZA 4CJKA 3HVRA 3SPZA 3M0DA 4AHCA 1LV5A 4KHYA 2D0CA 3U59A 1RCHA 4GT1A 4DU3A 1GL2B 5AW8B 4CEDA 3M06A 1KILD 3V9UA 3MIWA 2Q3SA 2VRSA 1ASVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FK9 A;  3KK2 A;  3ZT3 A;  3OYN A;  3TAM A;  5KTQ A;  1ZBH A;  3K5N A;  3U3Y A;  1TKT A;  3MXJ A;  3SI6 A;  4CE9 A;  4PA1 A;  3PV8 A;  1BQM A;  3PX4 A;  3TAR A;  4Z4H A;  4CF1 A;  3QNN A;  4M41 A;  4YFU A;  1R0A A;  4FJX A;  4OGE A;  3AVC A;  3AVA A;  5CY4 A;  3V9S A;  5HLF A;  3V4I A;  3NF8 A;  3L2V A;  3DMJ A;  3PX6 A;  2XY8 A;  4KPY A;  3QLH A;  4LH5 A;  3ZT2 A;  4CJ4 A;  3VQA A;  3AV9 A;  4DFM A;  1KSP A;  1S1T A;  2FBY A;  3DYA A;  5JS1 A;  4DWI A;  2ITG A;  2JGU A;  5C24 A;  1HYV A;  3K5L A;  2OPR A;  3EY1 A;  3C94 A;  3HST B;  3EZ5 A;  2FBT A;  1UA1 A;  2VG6 A;  4Y1C A;  3DOK A;  3OYA A;  4JRQ A;  3V9Z A;  1WSH A;  3NH1 A;  3TAF A;  4PY5 A;  1S6P A;  2HW3 A;  4CIF A;  4KHU A;  4AHS A;  3VA0 A;  3ZSY A;  3I0R A;  5CYM A;  4AH9 A;  3WNG A;  4CEZ A;  4J2E A;  4FLX A;  3SUQ A;  1C1B A;  4CGF A;  1WLJ A;  1NJY A;  4DFJ A;  1GOC A;  2ATQ A;  2B6A A;  1SKS A;  1T03 A;  1B9F A;  4W5T A;  4DQR A;  5SZT A;  4CEF A;  5T7B A;  4AHV A;  2F96 A;  4M42 A;  1A5X A;  1RBV A;  3CYM A;  4I7F A;  2OZM A;  3HPO A;  1S9E A;  3SJJ A;  4KHW A;  1XWL A;  4F4K A;  3OYF A;  4CES A;  3OS0 A;  1EKE A;  4R5P A;  3M8S A;  2WON A;  1Y97 A;  1NK5 A;  4I9L A;  3DLE A;  4CGJ A;  4CFC A;  2XY5 A;  2BDP A;  4L8R B;  1S1U A;  4CEA A;  3NGZ A;  2KQ2 A;  4DTO A;  1QSS A;  4N41 A;  1S1X A;  2YNG A;  4FJ8 A;  2HHV A;  4CK3 A;  1BI4 A;  2IC3 A;  4K8X A;  3AVK A;  4DTU A;  3SV4 A;  2IS3 A;  3QO9 A;  2P51 A;  3PY8 A;  1VSM A;  2HNY A;  3T1A A;  5DMR A;  3P83 D;  1NJX A;  4CFB A;  4KAZ A;  1KTQ A;  4HCB A;  1D9F A;  1ITG A;  4FYD A;  4Q0B A;  1A5V A;  1IKV A;  3DOL A;  1NK8 A;  1X9W A;  1JXE A;  1KCF A;  3KK3 A;  3L3V A;  3QES A;  1ZYQ A;  1NJZ A;  4EZ9 A;  3IRX A;  4F2R A;  3HP9 A;  4DLG A;  1TAU A;  3PUF A;  4O44 A;  1REV A;  3AVG A;  3TR8 A;  3QIO A;  4IDK A;  3ZT1 A;  1TV6 A;  1RDA A;  4RW9 A;  4CHP A;  1YTA A;  4E0D A;  2B4J A;  4OKE A;  4LD0 A;  4CEO A;  4KTZ A;  1S9G A;  1WAJ A;  2I5J A;  1HNI A;  3DM2 A;  3OYE A;  3KLH A;  4GVM A;  3NE6 A;  5EU7 A;  1VSI A;  4MFB A;  3QEI A;  3AA5 X;  5C25 A;  2G8W A;  1G15 A;  1XI1 A;  5HRR A;  4FM0 A;  3QIN A;  3SUO A;  4Z4G A;  3AVI A;  3CQ8 A;  1SKW A;  4AHT A;  4QAG A;  4DS5 A;  3CG7 A;  3PO5 A;  2QKK A;  4N47 A;  4CJL A;  4CJE A;  4E19 A;  3HPG A;  4FLU A;  1SL2 A;  3TAP A;  4OLB A;  2VG5 A;  3VQ6 A;  3C95 A;  2HHW A;  4BWJ A;  4J2A A;  4DFP A;  1SKR A;  3AVH A;  3I0S A;  3MED A;  4E7K A;  1EET A;  3HL8 A;  3DLH A;  4KKO A;  1DTQ A;  1ZBF A;  3WNF A;  3SNN A;  3QET A;  1BCM A;  4IKF A;  2KFN A;  1RBS A;  3AO1 A;  4O4G A;  4KTQ A;  1RBT A;  1CXQ A;  3MXM A;  3VQ9 A;  3NH0 A;  2OZS A;  1KFD A;  4NCG A;  1U49 A;  3T3F A;  2KFZ A;  1KFS A;  2EHG A;  1K6Y A;  4DTJ A;  2Z1G A;  4F8R A;  2RF2 A;  1TVR A;  1GOB A;  3AA2 A;  3SQ0 A;  4DTN A;  4AIL C;  3RR8 A;  3FFI A;  1RTI A;  4Q5V A;  2GUI A;  4Y1D A;  2YHB A;  3VQ4 A;  4IFY A;  3RRH A;  2BAN A;  1C0M A;  4QCL A;  1YVU A;  5HRN A;  4N5S A;  4KO0 A;  3IG1 A;  4OPJ A;  1BIS A;  1IKY A;  3V1Q A;  2G8K A;  2DTU A;  1J53 A;  4B9N A;  2DY4 A;  3HPH A;  4CEC A;  5K14 A;  3OYL A;  4O55 A;  3JYT A;  1YTU A;  1CZB A;  4FJ5 A;  1JKH A;  3M8P A;  3MEE A;  3NAE A;  4FZX C;  4RG8 A;  2F8T A;  4B3O A;  3TWH A;  4CIE A;  1EXQ A;  4OKK A;  3AVF A;  3KLF A;  4HUE A;  1NK7 A;  4F3T A;  4FJL A;  2ZD1 A;  3L8B A;  3D45 A;  3OYI A;  3V1O A;  3OVN A;  3L3U A;  1TK0 A;  2P5O A;  2PZS A;  1ASU A;  4NCB A;  1NK4 A;  2YNH A;  1RTD A;  1Q8I A;  4CJS A;  1JLE A;  1SUQ A;  5D3G A;  1JLF A;  1C6V A;  2HVH A;  4Z4C A;  3OYB A;  3TAG A;  2W42 A;  1NK0 A;  1ASW A;  2FBX A;  4C8M A;  3SUN A;  3HJF A;  2ZQB A;  3L2R A;  1B9D A;  3KKS A;  4B8A B;  3QEW A;  2XY6 A;  1WSE A;  1RT4 A;  3SCX A;  3MEC A;  3A2F A;  2IDO A;  4C8K A;  1LW0 A;  4LSN A;  3OJU A;  1RT1 A;  2Z1J A;  4W5R A;  3KLE A;  4ELV A;  4JLH A;  3AO3 A;  3DRS A;  1U45 A;  3SPY A;  2WOM A;  3KLI A;  3NF6 A;  4E7L A;  3DLR A;  4DTM A;  3RMD A;  4DQI A;  3VQQ A;  3V9W A;  4CF0 A;  2FC0 A;  1XC9 A;  4E7I A;  2RPI A;  3HXM A;  4BE1 A;  2X6N A;  3HK2 A;  1JL1 A;  4OKJ A;  3EYZ A;  4FLZ A;  3DI6 A;  1LAW A;  2OPQ A;  4DTS A;  1L5U A;  1QTM A;  4HTU A;  4M3R A;  4C8O A;  2BE2 A;  4DSK A;  4FJJ A;  1RT7 A;  3ZCM A;  3H08 A;  4FCY A;  4DF8 A;  3SQ2 A;  4E89 A;  4CIG A;  3L2W A;  1N6Q A;  1KRP A;  4OLA A;  3S3M A;  3OYD A;  4DQQ A;  1SV5 A;  4NYN A;  2GBZ A;  3AVL A;  1HPZ A;  3VQ8 A;  3QNO A;  4KHS A;  3P1G A;  3VQB A;  2VWJ A;  1KLM A;  2Z1H A;  3KJV A;  1FKO A;  3DRP A;  2YNI A;  1IKW A;  4RW6 A;  4CJU A;  4NYF A;  3LDS A;  4BE2 A;  4KFB A;  1C1C A;  2D0B A;  4W5Q A;  4DTP A;  4DSL A;  2YHA A;  4I2Q A;  2DFH A;  1RT2 A;  1JXB A;  4ELT A;  3VQE A;  2F8S A;  3L2Q A;  1QSL A;  3VQP A;  4KV8 A;  3RTV A;  2XO7 A;  4J2D A;  5KGW A;  3AA3 A;  4CHY A;  2PY5 A;  3AO4 A;  3OYK A;  1C0U A;  4CGG A;  3NFA A;  3OY9 A;  1QHT A;  4M3W A;  3ZSV A;  1T7P A;  2E4L A;  4CK2 A;  4H4M A;  3ULD A;  4E1M A;  4BDP A;  1KVB A;  4AHU A;  2BGG A;  5I3U A;  4CGD A;  5HRO A;  3WNE A;  2ZE2 A;  1VSJ A;  3LAK A;  2KW4 A;  1J9A A;  2QXF A;  4CEB A;  2HVI A;  1TGO A;  4FJN A;  1IKX A;  4CJR A;  4BAC A;  4E7J A;  4NCA A;  1RDC A;  3LPT A;  2X6S A;  4FJG A;  1TKZ A;  4FJ7 A;  3KK1 A;  3ZT0 A;  1BIU A;  3HO1 A;  5CZ1 A;  1U4B A;  4CCH A;  4DMN A;  3DLB A;  3SQ1 A;  2FBV A;  1BHL A;  3LPU A;  4UQG A;  1EP4 A;  1WN7 A;  5FRN A;  1TKD A;  2DFE A;