2P1JA

Crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
b'TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRFVEMM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase III polC-type
publication title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.140 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p1jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p1jA01
1VSJA 4H8KA 4HUFA 1UOCA 1TAQA 4B8CA 1Q9YA 3LP3A 1NOZA 4BE2A 3LDSA 2YHAA 5SZTA 4M41A 2KQ2A 4KAZA 5J1EA 5J2MA 4Z4FA 5HRRA 4ELTA 4CIFA 1SUQA 3DRRA 3SQ1A 3K5NA 1ZYQA 1L3SA 3P1GA 4N56A 3WNEA 4PA1A 4OPKA 4JS4A 5CYQA 4OKJA 3SUNA 2PY5A 2O4IA 4OVLA 3PX4A 4FJNA 3MXJA 1LW0A 3K5LA 4FJ8A 1KVAA 3TWHA 1U4BA 3O4NA 4FZZA 1JXEA 2HHQA 3KJVA 4FZYA 3TAEA 2QKKA 4LSNA 3OYKA 4DSKA 3S3MA 1JLAA 4CEFA 3VA3A 4IKFA 3T3FA 5KI6A 1BIUA 4IG3A 3HP9A 1WSHA 5EU7A 1JL1A 1QQCA 3CM6A 4CFAA 2HMIA 1LAWA 4RW8A 3OYIA 2JLEA 5HRPA 4Q5VA 5DMRA 4J2BA 2NUBA 4DS4A 1Q8IA 3A2FA 3RMAA 1YT3A 3OJSA 3V9WA 4KTWA 2FBXA 2BANA 3O3FA 4OGEA 3OYEA 3QETA 3SNNA 3BDPA 3VN5A 1JLGA 4F2SA 1JLQA 1TL1A 1SKWA 4KTQA 1SV5A 3SUQA 4KHQA 1S1TA 3AVFA 3C95A 4KPYA 4H4MA 4FLZA 3QLHA 3OS0A 2ZE2A 1NK9A 2X78A 5K14A 5HROA 4QOZB 1U49A 3OY9A 4DTPA 2G8UA 1D5AA 3L3VA 2Z1GA 3LWMA 1KVCA 4EZ9A 2R7YA 1A5XA 1NOYA 2FC0A 2VWJA 1RTIA 3QNOA 4KI4A 4ID5A 3S3OA 2RF2A 1WSFA 3OYAA 3F73A 1IKXA 3D0PA 3DLBA 3ZT4A 4CFDA 4CF1A 3RR7A 1J5OA 4PY5A 1LAVA 3QEIA 2Z1JA 3DMJA 5HBMA 2OYQA 4FVMA 4DQSA 3QEPA 4FCYA 4DSEA 3OYHA 3EYZA 4FJXA 2QXFA 1RILA 3OYMA 4E3SA 4J2DA 1VRUA 1FKPA 2E4LA 4CGIA 2E6LA 1U45A 1KSPA 4E7LA 4Y1CA 3HPGA 3L2RA 4PWDA 4B3OA 3OYNA 2KFNA 5I42A 3LAMA 3LALA 4O4GA 4Z0UA 3H08A 4CJWA 2XY8A 5HRNA 3UIQA 4O44A 4CFCA 2HHTA 1VSHA 2OPPA 3AO4A 4O0IA 3SCXA 1A5VA 4CJ4A 1XC9A 3SV3A 3V9XA 4DTMA 2G8HA 3RR8A 1RT4A 4HUEA 3PO4A 1C6VA 3TAGA 3IRXA 2KFZA 1HQEA 5CZ1A 4HTUA 4CGFA 1QSLA 4CJRA 3LP1A 3ZSWA 2EX3A 3ZSRA 4Z4CA 4FJLA 2XO7A 4B9TA 4FLYA 4C8LA 1UA0A 2HHUA 3AV9A 3VQDA 3LANA 5FRMA 4KREA 2RN2A 4DFKA 3ZSVA 4J2AA 1TV6A 1LWEA 2VG5A 4I2PA 4B9MA 4M45A 4AHUA 4DU1A 2W42A 1SL0A 2PAJA 4LD0A 4FK0A 3D45A 4CF8A 1LWFA 5HP1A 4E7IA 1XI1A 3KD1E 2HNZA 3SQ2A 4CF2A 4J2EA 4Z4EA 3JYTA 4Y1DA 2QKBA 3AVNA 2ZQBA 1I3AA 2OPQA 4KFBA 2ATQA 2RPIA 4CECA 2E6MA 4DTSA 4IFVA 1NJZA 4CEEA 1TVRA 4F8RA 4FW1A 4IBNA 4R5PA 3VQ5A 4B08A 4FM1A 4N76A 4QCLA 4N47A 3ALYA 4DTNA 4CHYA 1NK0A 4CF0A 4FK4A 4GVMA 3U6FA 3PY8A 4DTXA 3NF8A 4W5RA 2OA8A 3M8SA 3MAQA 1G15A 1KFSA 2OZMA 4DSJA 1RT5A 2B6AA 2FBVA 3HVRA 1KCFA 1S1UA 3OYBA 4OJRA 3JSMA 1S6PA 3O3HA 4DTUA 3SPZA 1KTQA 4DTJA 3DLRA 1S1VA 5FDLA 4CK1A 3AVKA 4YFUA 4DS5A 4FZXC 3TI0A 1BIZA 1WAFA 3VQ7A 2IAJA 5C42A 3O3GA 3HPOA 1IKWA 2Y1IA 4KHSA 2XY6A 4LSLA 1XHXA 1L3TA 2WONA 4FK2A 4DU4A 4CK2A 1YVUA 4M42A 4NYNA 3TARA 3AVJA 4DLEA 4CFBA 3AA4A 3LPTA 1NJYA 4IG0A 4M3XA 4LH4A 3ZSQA 3IS9A 3ZSOA 3AA5X 4CHPA 3SJJA 1RT6A 4ELVA 3ZT2A 4JRPA 3L2UA 2XHBA 1QE1A 3I0SA 3VQAA 4E7KA 3OYCA 3G0ZA 1T03A 2DTUA 2D0AA 4KRFA 4H4OA 4B9UA 2OPSA 4CJ5A 2Z1HA 1JLFA 1F21A 3VQBA 4CEQA 3K57A 4HCBA 4KB1A 3S3NA 3AVMA 3ZT0A 1QSYA 3KK3A 5HRSA 1WSEA 5CZ2A 2EHGA 3KTQA 2BGGA 3DOKA 2IC3A 4BDPA 4F3TA 3KLEA 4CJVA 4B8AB 4DQPA 1EP4A 2X6NA 1KFDA 1R0AA 3P5JA 4I9LA 3NGYA 3NH0A 1VSLA 3EY1A 5HLFA 1S9EA 3V6DA 3V1QA 3KLHA 1KLMA 3NHGA 2FBTA 4FLTA 3LPUA 4AH9A 4NCAA 1ASWA 3VQCA 1QSSA 1HYSA 1VK0A 3VQ9A 3HM9A 1RBUA 3CFOA 3M8PA 1BGXT 4C8NA 4CJEA 3SQ4A 1IO2A 3L3UA 2HHWA 4CERA 1RDCA 3K5OA 1QS4A 4CEBA 5SWMA 3DLEA 1T7PA 4C8KA 4G1QA 1L5UA 1L3VA 1WNSA 2YV0X 3AO3A 3AO1A 3QIPA 1TKXA 4CJPA 5E41A 1A5WA 4O55A 4DG1A 3L2QA 3SZ2A 3SI6A 1HPZA 1X9SA 4FM0A 3WNHA 4FLUA 4E7JA 1HRHA 3ITHA 3C6TA 1Y97A 3CG7A 3KIOA 4E89A 4M3TA 4Z4HA 1BCMA 4E0DA 3KKRA 3CFRA 1UAXA 2ITGA 3RRHA 4EZ6A 2KZMA 3AVCA 3KLGA 2JGUA 4F2RA 3NH1A 4FJJA 4E19A 1YTUA 5T7BA 4NCGA 5JS1A 4CJTA 3TR8A 2F8SA 3KKSA 2P51A 3OVNA 3NAEA 4JS5A 4K8XA 1C1CA 1RBVA 2RKIA 2VG6A 2ZD1A 1NK7A 1EKEA 4CGGA 3RRGA 1ZBHA 1RT3A 3CYMA 2YHBA 1IKVA 1JL2A 2HB5A 3HSTB 3QIOA 3BGRA 5C24A 4E1NA 4M3YA 4F4KA 2HHXA 1JLBA 3OS2A 4Z4IA 2YNIA 2X6SA 3OS1A 3OYJA 4ELUA 3VQ8A 1VSDA 3MECA 4CE9A 4GMJB 1B9FA 3ZSXA 4JRQA 4DFMA 3THVA 4KHWA 4DSFA 1K6YA 1W9HA 2GUIA 2GV9A 3V1RA 4L8RB 4FYDA 4CJSA 1D9DA 3AO5A 1XWLA 1J54A 3NFAA 4BE0A 4DSLA 4CHOA 4FJMA 3HP6A 1VSIA 1BISA 3KK2A 3SQ0A 2PZSA 4M3UA 1ASVA 4XIUA 3HT3A 3TANA 4FLVA 1BHLA 4E1MA 4JLHA 3TAMA 4DTOA 3DI6A 3ULDA 3OYGA 3VA0A 4C8OA 4BE1A 3QNNA 1ZBLA 3U3GA 3VQPA 1BCOA 1IG9A 4FJ9A 1RCHA 2G8IA 2HVHA 3V81A 4DQIA 2PYJA 2WOMA 3VQ4A 3AVAA 1TK0A 3HK2A 4IFYA 4CHQA 5I3UA 2YNFA 3E01A 1LWCA 5KTQA 3WNFA 4DWIA 2YNHA 1QHTA 3L2WA 3DRSA 4N5SA 1DTTA 3DLGA 3NGZA 4AILC 4RG8A 5JS2A 4DFPA 4KI6A 4CJKA 1NK6A 1TKZA 4ID1A 3I8DA 4PQUA 1Q9XA 3CM5A 4CJQA 4BWJA 2DFHA 1REVA 3AVIA 4HCCA 1RTHA 1NK5A 4DSIA 1HQUA 5DK5A 3NH2A 3HJFA 4UQGA 4OKEA 3MXIA 3NGIA 1FKOA 2B5JA 3LWLA 3RMBA 1MU2A 1SKSA 4EP4A 2D5RA 1S9GA 1RDDA 1KVBA 1UWBA 1ZBUA 3HVTA 3LP2A 2GBZA 1Z26A 3KK1A 3RWUA 1WAJA 3SPYA 4CIGA 2XY5A 4PUOA 2P5OA 2Z1IA 2F8TA 2Q3SA 4MQ3A 2ETJA 4MFBA 4LH5A 3U3YA 4DQRA 4ZTFA 2HHVA 3KLFA 3PV8A 1Z25A 4FW2A 3PX0A 3HL8A 3V4IA 1X9WA 1JXBA 1TKTA 3PX6A 3OYLA 3T19A 3L2VA 3HXMA 4AHCA 3OYFA 1TAUA 5KGWA 1NK8A 2XRIA 1WLJA 5C25A 1JKHA 1LV5A 3KD5E 2OPRA 3V9ZA 1T05A 3DLHA 3LAKA 1SKRA 1HNIA 1RTJA 2G8WA 4W5TA 4FJ7A 1TGOA 4OPJA 1L3UA 4CCHA 3RMDA 1C1BA 1S1WA 2B4JA 1X1PA 4O5BA 4F3OA 1RNHA 1RT1A 1VRTA 1NKCA 4I7FA 2IOCA 1S5JA 1U04A 3AA2A 1SL1A 3QINA 4CGJA 3AVHA 3QEWA 1EX4A 1GOBA 1TK8A 4DFJA 2G8FA 3V1OA 3IG1A 4RW4A 4OLBA 1WSIA 4KV8A 1S6QA 1ZBIA 3AVGA 4OGCA 3FFIA 4AHVA 4KTZA 4CESA 2A1SA 2G8VA 4FXDA 1XHZA 1BQMA 1CXQA 4I2QA 3ZSZA 3AVLA 1FXXA 3K2PA 1WSGA 3C6UA 1J9AA 3C94A 1U48A 1HYVA 2KZZA 1NJWA 1HNVA 2YNGA 2BDPA 4CHZA 5FRNA 2X74A 1RTDA 2HHSA 1B92A 4AHRA 3NF6A 1C0UA 3LP0A 4I9QA 3L8BA 4ZTJA 3NF9A 1QTMA 4DU3A 4OKKA 1C1AA 3MEEA 4M3RA 3CQ8A 4FJKA 3QEVA 4N41A 1DTQA 4FJHA 4KKOA 3T1AA 5FROA 4DF4A 4BDYA 3VQQA 2P1JA 3O4QA 1CXUA 3DM2A 3QEXA 3QO9A 1HJRA 1BL3A 1EETA 1RDAA 1TK5A 4C8MA 4W5QA 2DFEA 3ZT1A 1YTAA 3K58A 4B9LA 4RW7A 3I0RA 1RBTA 4CJFA 1B9DA 3TAPA 4Z4GA 3M8QA 4QAGA 1HMVA 4CF9A 4YNQA 4W5NA 4CJUA 3ASMA 4CHNA 4FLXA 3K5MA 4AHTA 5J2PA 1VSMA 4RW9A 2F96A 4EP5A 2XY7A 3TABA 3WNGA 2IS3A 2D0BA 3PUFA 4M3WA 4CEDA 2IGIA 2I5JA 1WSJA 1UA1A 4ICLA 4CJLA 1D9FA 3HO1A 4FLWA 4M3ZA 2KW4A 3VQ6A 4DMNA 3V9UA 1IKYA 4RW6A 3LZIA 1VSKA 1RDBA 1LW2A 3TAQA 2HVIA 1NKEA 4FM2A 2G8KA 3ZT3A 5KGXA 2FBYA 3ZSYA 1NJXA 1WN7A 3HYFA 2D0CA 5J2NA 2YKMA 3NF7A 3HPHA 3NBPA 4KO0A 1C0MA 3B6OA 3TAFA 3DRPA 3B6PA 4CEOA 1NK4A 4FJIA 1NKBA 4TSXA 5KRSA 3DYAA 4DF8A 3MEGA 1N5YA 1KLNA 2IDOA 3RTVA 1VSEA 1ZBFA 1RT2A 3MXMA 1C0TA 3IAYA 1HYZA 2HNDA 3DOLA 2P5GA 3AA3A 1U47A 4Q0BA 1N6QA 4FJ5A 2VG7A 4B9SA 3AO2A 4KHUA 4K8ZA 2DY4A 1I39A 3SUPA 1D8YA 1RT7A 3EZ5A 3ZCMA 4HVJA 2YKNA 3OJUA 3NDKA 1W0HA 4LY7A 5KRTA 3RMCA 3KLIA 1X9MA 1KRPA 1RBRA 3OYDA 4O0JA 1BI4B 3NCIA 3CFPA 4B9NA 3QESA 4WE1A 3MEDA 4BWMA 3LZJA 3QERA 1JLEA 5J2QA 2HNYA 1TKDA 4FJGA 3DLKA 1CLQA 4IDKA 1VSFA 1S1XA 1IH7A 3S9HA 1EXQA 4DTRA 4NYFA 3PO5A 2KTQA 1JLCA 3SV4A 4BDZA 3SUOA 4KHYA 3ISNC 3G10A 1CZ9A 1GOCA 4E7HA 3AVBA 4KB0A 2HW3A 2DFFA 2O4GA 3P83D 4CK3A 3VQEA 4W5OA 2AJQA 4CGDA 4DQQA 2A1RA 1TL3A 2Y1JA 4HHTA 1RBSA 4CEAA 2BE2A 1BI4A 4CJ3A 3NE6A 3SYZA 4GW6A 1DLOA 1O1WA 4CIEA 4ZHRA 2OZSA 3K59A 4HUGA 4B9VA 4BACA 1ASUA 2PYLA 3F9KA 1CZBA 5CY4A 1J53A 4KHNA 1FK9A 1BQNA 4DLGA 4CEZA 1SL2A 2LSNA 1ITGA 1GOAA 4CGHA 4NCBA 5D3GA 2QK9A 4OLAA 5CYMA 3M8RA 4AHSA 3V9SA 2VWKA 1T8EA
chains in the Genus database with same CATH superfamily
4MDAA 2FFDB 4HUFA 3PIPL 2XNXA 3R1XA 1VQNP 3CCUN 3SBGA 2GUVA 3CQYA 4IFDK 3SQ1A 3CCQP 3MGNA 3L0QA 1OW6A 3PX4A 2KLUA 4FJNA 1RF1A 1P84D 3AE8C 4FJ8A 1WB9A 1BSNA 2QRXA 2FFDA 2QJKB 4GOEA 4HWIA 2QKKA 3OYKA 3G3ZA 3N4XA 3VPZA 1JLAA 4CEFA 3MUDC 3HM8A 2H43A 1S2EA 3EFGA 3HP9A 4BR4A 3AEBC 5EU7A 4CZKA 1QQCA 2OTKE 4OVNF 2HMIA 4J2BA 3TSQA 2R3CA 3H1IE 3A2FA 3BCCE 1BE3G 1NKZB 2WSEJ 3E9LA 2BANA 1BDDA 2WWWA 3FLCO 5BR9A 4OGEA 3WXMB 3QETA 3IFMA 1OVYA 4BRIA 2E76D 5M1BA 1JLQA 1TL1A 3ENHA 1KILC 2D0OA 3H6EA 3SUQA 1S1TA 3C95A 4KPYA 3QLHA 1N33K 5HROA 4QOZB 1H88A 2KZIA 1D5AA 2QJYC 2SPZA 1FZFA 3EKSA 1HUXA 3TU5A 2R7YA 4WBAA 2JJLA 1RTIA 2FC0A 5ADXA 3ABVC 3MN7A 3OYAA 1WMKA 3D0PA 3DLBA 5AZIB 3H32B 4CBUA 3M9QA 3RR7A 1ZXOA 1JCDA 1VF5C 3DMJA 2EWSA 4FVMA 3QEPA 3PSIA 1GLLO 3OYHA 4BG8A 2A45I 1RILA 2FYUJ 4W7ZA 3H1LD 2WSSH 5GAGP 4E3SA 1VQKP 1S5LH 1TUUA 2D2CC 1DEEG 3L2RA 4PWDA 1SQBD 2HBLA 2KFNA 5APQA 3Q3DA 4O44A 5AZIA 2VRSA 3H32A 2HHTA 3E1RA 1HNXK 2QE7H 4O0IA 1IJDB 4H13C 4PV1C 2RH0A 4DTMA 1USDA 3M3ZA 1RT4A 2KUBA 3TAGA 5IWAK 3O9UA 1HQEA 2R5BA 5CZ1A 4HTUA 5KPRA 3Q7BA 3EEQA 2P58A 2A41A 1T3UA 2W83C 3LP1A 4DB3A 3L70E 1W97L 5KLVG 2CGKA 4ILHA 3ZSRA 4FJLA 4B9TA 3I56N 1VAZA 3AV9A 1VQ7N 5FRMA 1ZOYC 1Z56A 1SQXJ 3B5NC 4I2PA 4PKHA 4B9MA 4AHUA 4DU1A 3R4YA 4JD2B 4FK0A 4U7JA 3WXIA 2CK3H 3A5OC 4E7IA 3MD0A 2HNZA 5H2FH 2ZYDA 4GIFA 4DV7K 1KAYA 2FYUE 4DR2K 3JYTA 3VYIA 4KFBA 1P84H 2RPIA 1IFDA 2AXTE 1EXIA 2RE2A 1NJZA 4IFVA 3V6IA 4IBNA 2E2OA 3FWNA 3FGUA 2Z5HA 4CF0A 4JI7K 4FK4A 3CMAP 4GVMA 2UUAK 3PY8A 2Y0EA 3F89A 4JD2A 3BZKA 5AVQB 5C2FA 4DSJA 4EI2A 1VQMP 1SVFA 3U1CA 4DTUA 3QFPA 1S6PA 2FKWB 3F5HA 3SPZA 1KTQA 5CCGD 4YFUA 4DS5A 5AQNA 2UXCK 3P8CD 3O3GA 1IKWA 4MLHA 4KHSA 2XY6A 5CJ0A 4BC2A 3KZIH 4FK2A 1AQ5A 2WONA 1DD3A 1YAGA 2HSTA 2NRXA 1KZUB 4BRHA 3N4PA 4CFBA 3AA4A 1M1JB 3L75G 4BRYB 4IG0A 4M3XA 1SQXE 3VF6A 3ZSOA 4Z94A 3CCMN 5JLHA 1KMIZ 2XHBA 3VQAA 3G0ZA 2DTUA 2D0AA 4KRFA 4CI6A 1WT6A 4H4OA 4B9UA 4GKJK 4CEQA 1F21A 4UB6E 5KJ7A 2E74C 2BCCG 5AQLA 3L4QA 5CHIA 4HCBA 3ZT0A 3KK3A 3VOVA 3H6PA 1KB9D 5AW8B 2EHGA 1G99A 1M1JA 3KLEA 4IL6E 4BRYA 2P9KB 2WITA 1EP4A 1KFDA 1KN7A 4GKGA 3WMM0 3NGYA 4ASVA 3NH0A 1KAXA 3WU2H 1VSLA 3PIOL 3I55P 1GLFO 2WUSA 1FDIA 1S9EA 1VQPP 3V6DA 5AW2B 2WQYC 1KLMA 2FBTA 5AW4B 4CW7B 1X3MA 5BREA 4FLTA 2OTLN 1HYSA 2I1KA 3HM9A 1QVFO 1BGXT 2KOGA 4LF5K 2F7TA 1YQ3C 1RF0C 2WMMA 3R3LA 4G1QA 3CC2N 2IVOA 1K8KB 2P9KA 3AO3A 3HSCA 3IKMA 3L2QA 3SZ2A 3SI6A 3UKRB 3WNHA 2A40A 4FWLA 4YOYA 4E7JA 1OVVA 3C6TA 3CG7A 1NGBA 4ILJA 3PTZA 4DV2K 3TSIA 1UAXA 4NLBA 1ZV8A 4RKUJ 2V7YA 4BRPA 4F2RA 1JOCA 3EE9A 3LL3A 4I7ZB 1PGQA 4K25A 2ZM6K 4UB8H 2ZJPL 3GF7A 3H3OB 1BE3D 1GL2D 3KKSA 5FPDA 2O01N 3O1BA 1K8KA 2D0PA 3NAEA 2W8ZA 1NK7A 1TU3F 2RKIA 3RRGA 2KZZA 2MKVA 3UKRA 5CCHD 2YHBA 3B4SA 2Z4EA 1PP9G 1JL2A 2PAVA 4PHTX 4Z4IA 4ELUA 3O9TA 1EDJA 3VGMA 2PBDA 4EYYQ 1B9FA 3TYYA 2GUIA 3QDKA 3ULEB 4CJSA 3RL0C 3AO5A 1IFMA 5JICA 2UUCK 2FYUK 3SQ0A 3VF2A 3KK2A 4H44D 4A59A 4XIUA 3HT3A 1ZRTE 1N8RQ 1FZCB 4FLVA 2WFBA 3TAMA 4C8OA 3H1JG 1NGHA 4A7PA 1SAZA 3QICA 3OYGA 1FC2C 5LMUK 3VA0A 1ZBLA 1FOSF 2CPBA 3GW6A 3CCEN 2B87B 4AUWA 2WOMA 3M91A 1VQ9P 3N4QA 4WQ5C 1TK0A 3NXSA 3ULEA 1S5LE 4WY4B 3WNFA 4DWIA 4YORA 4XA4A 4WWIA 1NYHA 4N5SA 2K9YA 3BP8A 3DLGA 3MCAB 1CW5A 4I6MB 5BPLA 1FZCA 1TKZA 2HBMA 4WFBL 3O4WA 1IO4A 3GHGC 1Q90D 4QS7A 4BWJA 2XKMA 1YF5L 4H0VB 3MN9A 3H1HG 3FZLA 1SZ2A 1X22A 4EAHD 1NK5A 2B87A 1KB9H 1NGJA 1KAZA 3HD7B 2NRVA 3NH2A 4DSIA 3Q7CA 1SQXK 2P9PB 3NGIA 1PPJG 3CJ9A 3LWLA 1MU2A 2BEQD 1SKSA 4EP4A 4WY4A 2D5RA 1KD1O 5KKZC 5KLVD 2G3AA 3KK1A 1L4AC 4I6MA 3EFFK 2XY5A 4JEPA 2Z1IA 4IOIH 1VQ8P 4CZEA 1P8ZA 4MQ3A 1YIJN 2ETJA 3SWYA 4IDHA 4LH5A 1K9MQ 5AQOA 3U3YA 3FXEA 1Z25A 3HD7A 4FW2A 4YDUA 2QG4A 5H2FE 3HL8A 4JYAK 2P9PA 2QWLA 3VMFB 2GELA 3OYLA 3VEYA 2KKZA 1P84E 3OYFA 5AVYB 4XH5A 4CD3A 1YJNN 1WLJA 1UIIA 1OMIA 2HODB 1JKHA 5AQIA 1IBLK 1AFOA 2WVRA 1OVUA 3LAKA 2POHA 3RGUA 4FJ7A 3WXLA 1J2JB 2R32A 5AW3B 3RMDA 4CCHA 4F3OA 4QS8A 3CCRN 1JCCA 2M3BA 4B1YB 2R3SA 2W6LA 4I7FA 4BRGA 5EX5A 1SQBJ 4BR2A 2V52B 4CVNE 2G8FA 3AECC 1EX4A 3D2FB 3IG1A 4RW4A 4IWVA 1S1CX 1YTZI 4FWPA 3AVGA 3CCLN 1S4XA 3VERA 1AVOA 3KPEA 2YKQA 2HODA 1R5LA 3KZIE 3R9PA 1XHZA 3K9JA 3A5MC 1BQMA 1CXQA 4FVUA 3L36A 1BA0A 3L75D 2A3ZA 1HYVA 4I2LC 4GT1A 2YNGA 5FPMA 2HHSA 4GODA 1CSBA 1G1JA 3NF6A 4BGBA 3AARA 4JKAA 1KC8O 1MZ9A 1QQNA 3L8BA 4I9QA 4A57A 1D7MA 4K35A 3D2FA 2O1JA 3QEVA 4LLHA 2BCCD 1EC5A 4JV5K 4BDYA 1WUAA 3O4QA 3DM2A 2RN0A 2CGLA 2FBWC 1RDAA 3KZBA 1Q81Q 5AQVA 1IV0A 3CCSN 4BVOA 5APVA 4BQLA 3G25A 2NRGA 3CMEN 5B66H 4B9LA 1XMOK 4XH4A 1JMBA 1Y47A 4QAGA 4WB4A 1LCUA 4OO1J 4CF9A 4ZKPA 4YNQA 2KNCB 5LJVA 3WU2E 4CHNA 4H5TA 3R6MA 2WSCH 4RW9A 3VEOA 1SQBE 3TABA 3PUFA 1EZVG 1D9FA 2BEZF 2KW4A 3EO3A 1W2EA 1IKYA 2GWJA 2ZJSE 5AQFA 1RDBA 3LZIA 3V9UA 3Q5PA 3MX2A 4NXNK 4FM2A 2FBYA 3ZSYA 4U7BA 4H0OA 3JXUA 2D0CA 4IO9L 5APUA 4I1LA 1OW7A 3L73G 2KNCA 4BC5A 1C0FA 3ZX0A 4CZGA 1IFJA 4WCEL 3AEAC 2H3GX 3HOTA 3RTVA 1VSEA 1RT2A 4FWNA 1C0TA 5KQ8A 5FPEA 2HNDA 4IFMA 2FXMA 4UB8E 4A2BA 3WUTA 1PIXA 1U47A 1CI6B 1HGVA 1BU6O 1ATRA 5M1NA 1XC3A 3R2PA 4K8ZA 1PP9D 3OBWA 3SUPA 2JO1A 1T3JA 2WPVB 2D1KA 5KRTA 2YHXA 1HR0K 1X9MA 1KRPA 1RBRA 4JKDA 5B5EE 3CFPA 3QESA 4WE1A 1KTMA 4BWMA 3LZJA 3FX0A 1YXQA 1C0GA 2HNYA 5J2QA 3QERA 2O8FB 2GUSA 1CLQA 2LXBA 2YJEA 1IH7A 2E5LK 4DTRA 3P38A 1CI6A 1FBMA 3TF5A 1RF1C 4BDZA 1UIXA 3SV4A 3SUOA 4N78D 4BRLA 2O4GA 3P83D 3H1JD 4HJGH 4CK3A 2C9LY 2A1RA 1TL3A 3OTOK 1YJWP 3RK3C 1NAFA 3P8CE 4CEAA 2F9TA 3SYZA 5AVRB 4GW6A 2DW3A 1GLEG 3K59A 1NNEA 2O8FA 5LY3A 3F9KA 4DCHA 4X65K 3EL2A 4DLGA 4OLAA 1QVGM 1GOAA 3OA7A 2P9LB 4DV1K 1NLVA 2VWKA 1T8EA 4KHPK 2QWMA 3IDHA 4FWSA 5DM6L 3WXJA 2IFNA 3IFRA 2QJKC 1TAQA 1UOCA 3CQXA 3ID6A 3L6QA 3H1HD 1HVVA 2YHAA 5SZTA 4KAZA 5HRRA 1ZLLA 3KDPB 4ELTA 3DRRA 1ZYQA 2MJZA 1KB9E 1L3SA 1PPJD 2Q97A 1BE3J 4PA1A 3SUNA 4B3TK 2PY5A 4OKJA 2ITAA 2O4IA 1NGDA 3DXKB 2KP8A 2LXCB 2YCHA 3A7OA 1NGAA 4BQZA 1U4BA 2P9LA 1NGCA 4FZZA 3KJVA 4FZYA 5JLFA 3CJ1A 4JKHA 3G4SP 1YHQP 1QZ5A 4DSKA 3PRJA 4IKFA 3W0LA 5KI6A 4DOJA 1BIUA 1Q18A 2YO3A 3VTHA 1JL1A 4CFAA 2PGDA 1RGIA 5HRPA 5DM7L 4Q5VA 1NMDA 1GW4A 3DXKA 1Q8IA 4ZNCA 1RDUA 2VCPA 3OJSA 3SMSA 4KTWA 2O01H 3V4WA 4JNEA 1SQBK 3THYB 1KYOI 3BDPA 3VN5A 4DUZK 4KTQA 1NMNA 1SV5A 2E43A 2E1YA 4H4MA 3U9ZA 2ZE2A 2OYHA 5K14A 4JF7A 1N7SC 3QH9A 1U49A 2WSCJ 4PJ0H 1LTAC 4DTPA 3PLNA 4MN4C 5M1PA 1J1DB 4EZ9A 1A5XA 4DR6K 2QWRA 1BE3E 3QNOA 2NZ2A 4KI4A 4ID5A 2XDJA 1WSFA 2ZAEB 3F73A 1IKXA 3L35A 3THYA 1OXZA 4CFDA 2P9NB 4NB4A 3QEIA 1URQB 2OYQA 5C15A 2O3JA 3L37A 1X9VA 2QXFA 1WBDA 2P67A 2HR3A 1KSPA 4C7NB 4CGIA 1FAVA 5KLVJ 4Y1CA 4CZHA 1S72N 1N34K 4B3OA 1GMJA 4B1WB 4XE5B 3OYNA 5I42A 1VQ6P 4BXLA 4Z0UA 3CPWO 5F0XA 2UXDK 3FGAD 2FF6A 2PFXA 3M0DA 2P9NA 3AO4A 5C0YA 4IEIA 3SCXA 1A5VA 1URQA 3V9XA 3UKUB 3VGLA 1IJJA 4PL8A 3IMXA 1VQLN 5B66E 1C6VA 5AW7B 1SFCC 1FE6A 3D70A 4C7NA 3CJBA 1QSLA 2GM4A 1EQ7A 2NRHA 3O6WA 3ID8A 4FPAA 4WY4D 1M90Q 2V4HA 1LOTB 3THWB 4RESB 4R4LA 1EZVD 1VDFA 5CMZA 3BF1A 1NTMJ 1M7LA 2B88A 4RO0A 3LANA 2QA4N 2V7QH 2NRTA 3U9DA 1LWEA 2VG5A 5DJUB 3GL1A 1ZW0A 4FWMA 3UKUA 1SL0A 2VYPA 2PAJA 4LD0A 2C9NY 4J2EA 1XI1A 3SQ2A 3CI9A 3L73D 3HD7D 2FXUA 3SFDC 1LWUB 3CC7P 4A61A 3QBWA 4FWRA 3HUSC 2QWOA 2OPQA 1DD4A 5KLVE 2ATQA 3THWA 5KJ7C 1T3VA 3VGKA 3E9OA 3VOPA 4DTSA 4CEEA 3L75J 4QCLA 1DX7A 3CETA 3GOIA 4B08A 4N76A 1NK0A 3FZKA 4FPBA 3G9RA 4FOEA 4W5RA 2AA4A 3MAQA 1VQ4N 1KFSA 3HVRA 2FBVA 1KCFA 1ZP0C 1JO5A 1S1UA 5BPMA 4BGAA 3OYBA 1LWUA 4DT0A 3ZETB 3JSMA 1RFQA 3KWIA 4H0LC 3A0HH 3TI0A 1BIZA 1WAFA 5C42A 2ASMA 1HJBA 2OTLP 3USSA 4DU4A 1MUUA 3V2RA 4NYNA 3TARA 4DLEA 2L91A 5CBNA 1MV8A 1RE4A 1T6AA 1NJYA 1IG8A 3BF3A 3D6ZA 1LT1A 3ZSQA 3IS9A 4CHPA 1S22A 3CC2P 1RT6A 4YOVA 4D6TG 3I0SA 1T03A 3JCUH 3ZETA 2E75B 3F2KA 2M0BA 4U3FG 4CJ5A 1JLFA 5ELZA 4IL6X 3K57A 2M3EA 5AVXB 3AVMA 3S3NA 3V5BA 4CZFA 1AJYA 3T1YK 2GUPA 3L75E 3J7AP 5AQPA 4B8AB 2O01J 4BWNA 2X6NA 5M1FA 1ZMEC 3P5JA 2ZGYA 5HLFA 2KSJA 1KQGB 1AV1A 3JSVC 3KLHA 5AQZA 3NHGA 3VP8A 1T2KC 2YKOA 3E7KA 3LPUA 2BCCE 1QSSA 1VK0A 3VQ9A 4CJEA 3SQ4A 1SQKA 3Q5SA 4QMAA 5E26A 2P10A 3L3UA 4H0TB 5SWMA 4CEBA 5AVTB 1PGPA 2KLVA 1PP9J 3TSUA 3AO1A 4PY5A 3J7YP 2YJFA 1RHZB 2QSIA 1HPZA 3OHRA 3ITHA 4GNIA 4M3TA 1FZEA 3RRHA 1N32K 3AVCA 3KLGA 4JYCA 2ZT9C 3RK2D 4ZKUA 2JGUA 4OX9K 2WTYA 5T7BA 4CJTA 3H1JJ 2FYNB 3OVNA 2ZD1A 1ZBHA 4EFHA 1IKVA 3QIOA 4E1NA 2JP3A 3W68A 4M7YA 3Q2YA 3OW2M 1JLBA 1YUWA 2HBJA 3OYJA 3CCJN 4H0XB 1VSDA 3A5NC 2Z5IA 3MECA 3E9PA 4K43A 4DFMA 3GDQA 4L8RB 2GV9A 1W2BM 1GU4A 1J1EB 4PJ0E 4CZJA 1D9DA 5AQUA 2IVPA 4PD4D 1HNWK 4DSLA 1GTWA 4CHOA 4TT3H 4FJMA 1JY3P 3HP6A 1VSIA 1P84I 1BISA 3A0IX 2ZWHA 4C7RA 2V7QJ 5KLVK 1PP9E 3H1HJ 1BDGA 1BHLA 4JHDB 3ZEUB 3QNNA 5AVVB 3VQPA 1BCOA 1S5LX 2N9BA 5AQSA 1IG9A 4L74A 4JI3K 3V81A 4LF9K 2PYJA 3VQ4A 4CBXA 2R44A 3HK2A 4BR9A 2E5YA 4BRCA 5A2QO 4CHQA 5I3UA 3L2WA 1ATSA 1QHTA 2IZ0A 3LDPA 4N78E 2Q2RA 1DTTA 3S41A 4BRAA 3H1JE 1YJNP 1HGZA 4JHDA 1NK6A 3ZEUA 1Q9XA 2QJPB 4LF8K 3FZHA 1BCCJ 2KS1B 2K9JB 5EOYA 3AVIA 4H5NA 4HCCA 1NTMG 1NTMK 5DK5A 5AFUH 1OVRA 4Y0WA 2B5JA 4O9BA 2WZ7A 1RQUA 1S9GA 1X8YA 5AVSB 3T97B 1QL1A 2HF3A 1KVBA 1V4SA 3LP2A 2QXLA 1Z26A 4H0YB 3MZWB 1YJ9P 4PUOA 2P5OA 5AW9B 3A5LC 4L76A 4B3MK 1LTBC 3H1HE 2KS1A 2K9JA 2Q1KA 5C12A 4ZTFA 2HHVA 3KLFA 3PV8A 3TK1A 1PPJE 3PX0A 1M8OB 3V4IA 2NRZA 1N73B 1LTJB 1X9WA 1AQTA 1TKTA 3RVCA 1KQSM 3L2VA 3T97A 2K37A 5KGWA 1TYQB 1O13A 3AE9C 5C25A 2NPSB 2QWQA 3SK3A 3GE1A 3V9ZA 3C7NB 1K04A 1KORA 1R5SA 3CX5D 1HNIA 1GLAG 1RTJA 2A5XA 3QFUA 4WQ4C 3NFQA 4W5TA 5BN8A 3R8EA 1NKCA 3V2PA 3AGRA 3WT0A 3L72G 3AA2A 5TJHA 3CJ7A 1N73A 1LTJA 3O9RA 1KFMA 4DFJA 2HYNA 3V1OA 2E76C 1CZQA 3A0HE 4AQYK 5APSA 3FFIA 1TYQA 3BEXA 2QEXN 5KAIH 4C46A 4CESA 2NPSA 1NBWA 3GBTA 3AVLA 3C7NA 1HF9A 1NVOA 1WSGA 3C6UA 1LNQA 1U48A 1HNVA 4H03B 4CHZA 5FRNA 2X74A 1RTDA 1DEBA 4D6TD 3CXHI 1N8RO 2HF4A 2L5GB 3MP7B 1C0UA 3LP0A 4PD4H 3MMVA 2RHKA 3NF9A 1QTMA 1N2DC 4JKFA 3JCUE 4U3FD 3MEEA 5BN9A 3T7ZA 2JDIH 4FJKA 4BVPA 1DTQA 1YI2P 3SSUA 2P1JA 2ASOA 1NTZG 3VQQA 3QO9A 2KI7B 3HRNA 1HJRA 4AM6A 5AW0B 1BL3A 1URQD 4E1JA 3CCQN 4ISGA 3WUVA 4JI8K 3AEEC 3L73J 1YTAA 2ZXEB 1EQYA 1Y64A 3TAPA 5L8RJ 3M8QA 5AQQA 4CJUA 1Q7YQ 3M9BA 4FLXA 3EZWA 2H7HA 1Q2NA 5J2PA 1VSMA 4EP5A 3WNGA 4JI6K 1NTKG 4HH2A 4M3WA 1QX8A 4YY3K 1WSJA 1VQOP 3RSEB 3VEZA 5B5EH 4OPAA 3VMYA 1KILB 2BASA 3KHUA 5AW1B 4YOUA 3VQ6A 3MUDA 1VSKA 2G8KA 4WF9L 1ZN5A 4R79A 2QJYB 3HYFA 4DR5K 1EWQA 2CH6A 3HOSA 3B6OA 4Y99C 4FJIA 1NKBA 1K9MO 3SAHA 1ZR4A 2Y0DA 1EZVE 5GTHH 3VMXA 4TSXA 5KRSA 1N5YA 2P2UA 3RSEA 1GLJO 2IDOA 2Q3IA 2E2PA 1VF5B 2W6AA 2ZYGA 1KB9I 3IAYA 1Y8AA 3AA3A 3NMUA 4DV3K 2VG7A 2W41A 4HB1A 2D2CB 3L73E 2DY4A 3CD6P 3EZ5A 3NDKA 5FLXO 1USEA 2P9IB 1FU1A 4JK8A 3RL0g 3KLIA 3AEFC 1FOSE 1NG9A 3NCIA 1H89A 3MWPA 4B9NA 1TKDA 2Q9IA 1SLQA 4A5BA 4H13B 4PV1B 3CX5H 3CCVP 2GX9A 5JVGL 1S1XA 1GW3A 3S9HA 1VQKN 1D4XA 4LFBK 2N1TC 5CCGC 3ISNC 3A0BH 3CERA 3B8EB 4X64K 1GOCA 3AVBA 2HW3A 1M1KQ 3I5CA 2DFFA 5LL6Z 1IBKK 4C1NK 1R59O 2O8EB 3S9OA 2AJQA 4CGDA 2P9IA 5TKYA 3BASA 4HHTA 4CJ3A 3IF4A 1O1WA 4ZHRA 2OZSA 3F9MA 3UIAA 3B5NB 1KV4A 3CWBG 4YXWH 2PYLA 1BCCG 4ZMDA 5CY4A 2Q5UA 4KHNA 1BQNA 4CEZA 4TLFA 1ITGA 4NCBA 1PV3A 5BU5A 3J7ZO 5CYMA 3M8RA 4IOXA 2JWKA 2Q36A 4AHSA 2ZJRL 3PJSK 3V9SA 3UB5A 3J81O 1Q9YA 2O8EA 3HTKB 2E75D 1NOZA 3IR9A 1JMMA 3BUZB 3LDSA 4DR1K 3L4FA 1NTMD 2IIRA 5J2MA 2OYHC 4CIFA 1SUQA 3O08A 3K5NA 3P1GA 4N56A 3WNEA 2IVNA 2IBZG 1X79B 3B5NA 3P31A 5CYQA 4JS4A 1MFZA 1S3JA 2A42A 4OPHA 3V2NA 3MXJA 3K5LA 3CI5A 1KVAA 1J6ZA 2FSJA 3TWHA 5KLIC 3SAGA 1JXEA 3U4LA 3W3DA 2YX6A 1OIPA 2P9SB 4M63C 2HHQA 4MO4A 3TAEA 4LSNA 3S3MA 4BR0A 3AE2C 5F1XA 3VA3A 3CMAN 3SWKA 3CM6A 3JAMO 1LAWA 1YQ4C 5EVZA 2JLEA 3J80O 3OYIA 2NUBA 1VQMN 2Q0UA 4DS4A 2ZF5O 3MTUE 1DGKN 3KVGA 3RMAA 4DR7K 3M6GA 3SFEC 2GA1A 3C9IA 3V9WA 2G8YA 4JKCA 5KPZA 4L75A 4RCHA 3M0DC 3OYEA 1IBMK 5C39A 2RMZA 1KD1Q 2P9SA 1JLGA 3SNNA 1FJGK 1SKWA 5AFUA 2WPRA 2ZVOB 2W6JH 2E74B 3I8BA 2ZGZA 3AVFA 5JVHL 1GL2C 3OS0A 2X78A 5APWA 3G71P 3SMPA 3L72D 1SQVJ 3KWGA 5KTBA 4DV4K 3L3VA 2YO2A 3LM9A 3LWMA 5CCHC 1NOYA 2VGMA 3OJAB 3S3OA 5BRFA 2UUBK 1E79H 3WXKA 1IFPA 3M06A 1ILYA 4BRFA 4CF1A 5KAIE 3RK2B 1GLBG 3MDQA 1J5OA 1LAVA 2KHOA 2Z1JA 2A6AA 4IFEA 4DSEA 3EYZA 4FJXA 3P39A 5KPTA 4LF7K 2FY8A 3OYMA 1X9JA 1VRUA 2E4LA 4H44C 2KZJA 3VN0A 5BVZA 4PD4E 1SS6A 3HPGA 3LW5H 3MN5A 4E7LA 3I55N 1TUYA 2V7ZA 1VQPN 1NGIA 3LALA 4CJWA 4W80A 1NTZD 3H1KG 1BGYG 4KBOA 4CFCA 2JEEA 1VSHA 1JY2N 3LIEA 2OPPA 4FWQA 4YOTA 4BRDA 4CJ4A 2J5UA 2YXQB 3RR8A 2R5DA 3CJAA 4EIAA 4HUEA 3H45C 1H1VA 3RBXA 2ZYAA 2I1JA 4OWFA 3IRXA 2KFZA 3WUHA 4CGFA 1LWUC 3IN6A 3MN6A 1NJIQ 5IT9O 3C0BA 1NTKD 4CJRA 2XU6A 3ZSWA 5GADP 4FSVA 2EX3A 2OTJP 3TTDA 4Z4CA 1E4FT 2XO7A 2UU9K 4FLYA 1T6DA 4BY9C 1HX1A 1UA0A 3VQDA 3CCUP 3O8MA 2RN2A 1AVYA 4DFKA 4HKZH 4JK9A 1JB0J 5EY4A 1BOTO 4B3SK 2O1KA 2Q1NA 2A45G 3D45A 4CF8A 1LWFA 1S9KD 4YPCA 3C6AA 4DCKA 3RL0B 4FOIA 3BATA 3EWKA 4Y1DA 2FFDC 3AGKA 3AVNA 4Z4EA 4CECA 2YXRB 5GTHE 1KYOD 2QTDA 3VQ5A 4FM1A 3ALYA 4DTNA 4PL7A 2HPCB 3U6FA 2Y9ZA 1FZAA 4D6TJ 5BRDA 3NF8A 3M8SA 4ASWA 2O8DB 1G15A 2OZMA 1NAYA 4U3FJ 1RT5A 2B6AA 2QW9A 2N9YB 2QM7A 4OJRA 2H89C 4DV0K 3AE3C 4LF6K 4DTJA 3DLRA 1NH4A 1K73Q 1Z6RA 2Y1IA 1HNZK 3VQ7A 2YIUB 3HPOA 1VQ5N 3P4IA 3LIDA 2NPSD 1RY3A 3GHGB 4M42A 3KQGA 3CX5E 3PP5A 2HPCA 1A02F 1VQ9N 4YOXA 4LH4A 4DHYA 5EFWB 4WQ5A 3AA5X 4K0KK 3A0BE 2O8DA 4AQRD 2CGJA 1QE1A 4E7KA 2IZ1A 3P7KA 4OGQD 5KKZB 3OYCA 2HLOA 3VESA 1VPCA 2JWAA 2OPSA 4A5AA 2FYZA 1Q82Q 3VQBA 4KB1A 1L4AB 1YTZT 1K8AO 5KAFH 3B8AX 4WFNL 3CWBD 3H25A 3GHGA 1BCCD 5CZ2A 2BGGA 3DOKA 1H0TB 1FZGA 4JKEA 4BRMA 4DQPA 3W67A 5AQTA 3CL3D 1R0AA 2E42A 3LDLA 4I9LA 1QEXA 4D6TE 4X66K 3BY5A 4JAXA 3AE5C 3EY1A 2AXCA 4EHUA 1L0NG 1OFCX 4U3FE 2OYIB 4AH9A 4NCAA 4NPDA 4IEEA 1ASWA 1FDMA 2ASPA 3VQCA 3VMAA 4NXMK 3OAKA 1VQ8N 1L4AA 5AVZB 3S4RA 1RBUA 4C8NA 4DUYK 2IBZD 1IO2A 1PZQA 1SQQG 5C2DA 2YI1A 1M90O 1RDCA 1T7PA 1QS4A 1H0TA 1MKMA 3DLEA 2LR2A 4C8KA 1WNSA 2YV0X 5APTA 3QIPA 4CJPA 1TKXA 1GK4A 1A5WA 4O55A 4DG1A 2I8DA 4FM0A 1DIPA 1HRHA 4E89A 1Q86Q 1JY2O 3D7EO 2OYIA 5AQKA 3KKRA 3I56P 3CFRA 1WRGA 2ITGA 1VQ7P 4YTPC 2YKPA 1T2KD 3LW5J 1G1IA 1KILD 1PFIA 4V19S 5JS1A 4BC3A 3TR8A 2BUPA 2E2NA 2P51A 2AP1A 1CZAN 4JS5A 4K8XA 1SQVG 3CHWA 4FO0A 1SQVK 1RBVA 1EKEA 2LKMA 3O9SA 4B1VA 4XFJA 3JC22 1BA1A 2HB5A 3A5TA 3BGRA 5GTIH 5C24A 4BG9A 3LDNA 4XH1A 3MX5A 4F4KA 1FDOA 4M3YA 2HHXA 3OS2A 2YNIA 3T69A 1KYOH 1LTGC 3GF3A 2OGUA 4R4MA 3ZSXA 1MWMA 1VF5D 1K6YA 4ISEA 4DV6K 3A8YA 2ZJQL 1XWLA 1J54A 2OCEA 5GIOA 4IJAA 3VENA 2PZSA 2JWLA 2D2CD 3VEXA 3U3GA 4H0PA 1LTIC 4KH5A 4FJ9A 1RCHA 3M9HA 1PL5A 1EDLA 2NRRA 5AVUB 4IFYA 4H13D 4PV1D 2OANA 2W27A 3LM2A 1LWCA 2YNHA 3CCMP 1Z05A 3DRSA 3G6EN 3H1KD 4BREA 1W5CE 1BGYD 5CE3A 5JS2A 2Q6QA 3VMZA 3TTCA 4DFPA 2WSFJ 4KI6A 1OKJA 3I8DA 3E1YA 4IJNA 1E5WA 3CM5A 4CJQA 2DFHA 2QIWA 3OA9A 1DT9A 1M1JC 1U7MA 1JEKA 1RTHA 1HQUA 3H3NO 3HJFA 4OKEA 3MXIA 4H5RA 3B5ND 1N73C 1LTJC 3RMBA 3M0AA 3HTVA 5HOOA 1RDDA 3ATVA 1ZBUA 1UWBA 3HVTA 1JNMA 2GBZA 2AEFA 3JS6A 3SPYA 2E20A 4CIGA 2JKVA 1LT9B 1J5EK 2QEXP 2F8TA 3U8XA 1SQPG 3L72J 2E2QA 4MFBA 1NTME 1H8AA 4DQRA 1L0LG 3H1IJ 4L3QA 1BSHA 3O6QB 1IZNB 4CBWA 3KHYA 2RKLA 1NU1G 4JI2K 1JXBA 3PX6A 1OX3A 1WBBA 3HXMA 4O8KA 4M7XA 4AHCA 3T1HK 2XRIA 3FR0A 1FJKA 1LV5A 1GZLA 2OPRA 3DLLL 1YITN 3DLHA 1LT9A 3RK3B 4FWKA 1SKRA 1OH6A 3QBXA 5LJWA 1TGOA 3BZCA 4BC4A 1QVGO 4OPJA 1L3UA 1C1BA 2B4JA 1X1PA 4O5BA 1RNHA 1RT1A 2KLAA 1QVFM 2P9UB 4IOAL 3O6QA 2IOCA 3O1WA 1S5JA 3VTPC 1SL1A 3QINA 4CGJA 3QEWA 1TAUA 1TK8A 1NTZJ 4GOFA 1WSIA 3PLAA 4BR5A 5APXA 1S6QA 1BDCA 1EZVI 2K3RA 3D6YA 1WOQA 4AHVA 1YJWN 1NGGA 4KTZA 4FXDA 4I2QA 3ZSZA 4I7ZC 1FXXA 3TNUB 2E74D 2VQFK 1NJWA 3UE5A 4YXDC 3TSPA 2BDPA 1RE3A 4NO7A 1B92A 3L72E 4MDBA 4BRQA 2P9UA 1NTKJ 3IUCA 4GY2B 5GAEP 3MHVA 4OKKA 5E84A 4DU3A 1C1AA 4M3RA 4RJTA 2VGNA 3QWOC 3H46O 4KKOA 2M8RA 1HPMA 4DF4A 2I7PA 3PHLA 2XV5A 1VL2A 5KAFE 5I9EB 4B1UB 3BRTB 3CCEP 4C8MA 4W5QA 2DFEA 1TK5A 4NLCA 1HJ0A 1PGJA 3V2QA 3TNUA 2HHHK 2PFUA 4BRKA 5AQHA 4Z4GA 3O8ZA 3MK6A 3L70J 4W5NA 3CXCM 3ASMA 3K5MA 1L0ND 2IYOA 3SBTA 1FZCC 4AHTA 2XY7A 3CC4N 1MFTA 3G4SN 1IK9A 1YHQN 2IGIA 3GG4A 2I5JA 2NZTA 3TGUG 1NTZE 5AQRA 4CJLA 4A2AA 4B9QA 3H1QA 1SQQD 5JMVA 1LGHB 4FLWA 4DR3K 4DMNA 1K05A 3S1KA 2HVIA 5AJ3K 4DQ8A 1NKEA 4WY4C 3ZT3A 1N7SB 5KGXA 3HE5B 1NJXA 1LJ2A 5J2NA 5GIPA 3NF7A 1JTHB 3NBPA 1NOHA 4I6MC 1C0MA 2E1ZA 4KO0A 4ISFA 2A06E 3TAFA 3DRPA 1ZC6A 3L74G 1NTKE 3B6PA 1NK4A 1XQSC 3K0SA 1HLUA 3DYAA 4KT0J 3MEGA 4DF8A 1FS0E 5AQXA 2OARA 3CIPA 3MXMA 1YIJP 3HD7C 1HYZA 4YDUC 4JI1K 1JCGA 1QQOA 2A45H 1SQVD 1N7SA 4B9SA 3HE5A 1S9KE 2KSEA 2QI2A 3Q1MA 1N86A 3BVHA 1HKGA 3RL0D 1RT7A 3ZLJA 1JTHA 2YKNA 1W0HA 4LY7A 4Z1MH 5GTIE 4JN4A 4DKWA 1ATNA 3OYDA 3CWBJ 1N36K 2E8AA 1BI4B 1KYOE 3ZDMA 3FXDA 3F5TA 3U59A 1JLEA 1ZR2A 4IDKA 3CCRP 4NYFA 5C10A 4DV5K 3CXHD 2KTQA 1SFCB 3G10A 3U1AA 3L4IA 4E7HA 2P7JA 2OQQA 1VQ6N 3ZYYX 1IFNA 4WFAL 3VQEA 3CCLP 4DQQA 3THXB 5EXWA 2H88C 3EKUA 2Y1JA 1EDIA 3L71J 4PKGA 1DEJA 1RBSA 2BE2A 1BI4A 1EXJA 1DLOA 3CF5L 3VEWA 4NPEA 3WEEB 4CIEA 1OH5A 1EDKA 3IAOA 5AQWA 1ASUA 1QLED 2JR8A 1FK9A 2KIKA 2CH5A 2LSNA 1SL2A 3HBTA 5D3GA 3C1LA 1SFCA 1HBWA 2QM1A 2N1TD 1DKGD 4CPGA 1VSJA 3HUSB 4H8KA 4B8CA 1V4TA 1L2PA 3LP3A 4BE2A 3THXA 1YVNA 4FWOA 4M41A 2KQ2A 5J1EA 4Z4FA 3M1FA 3C6HA 1XNRK 1L4AD 1U57A 1MWKA 5B8HA 1Q7YO 3CWBE 3CCSP 3WEEA 5AQYA 4OPKA 1BCCE 2Q3EA 5DJTB 5E79H 3CMEP 3GG2A 4OVLA 4PD4I 4OGQB 3CC7N 3H1IG 1LW0A 3BCCG 3P8MC 3O4NA 1HKBA 4JPZB 3HUSA 4H0LB 1SQPD 4B86A 4DZOA 3KYQA 2IPPA 3T3FA 1L0LD 4IG3A 1WSHA 3O80A 2IBZE 3L71E 4RW8A 2J58A 1NU1D 5DMRA 2KK7A 3SLCA 3P32A 1OH8A 1YT3A 3MCPA 2FBXA 1SS1A 1NGEA 3EN9A 3O3FA 4WYBA 1VQNN 4MO5A 3RK2C 1HWTC 1U6ZA 4F2SA 1NTZK 4JI0K 1JY2P 2E5TA 4KHQA 4FLZA 1NK9A 3EQ2A 1N7LA 3RBZA 2FSNA 3OY9A 2G8UA 5M1KA 1KILE 2Z1GA 1KVCA 4LF4K 3H1KJ 1GLDG 1BGYJ 2UYTA 2VWJA 5BRHA 4B1XB 1M57D 2A06G 2RF2A 1NTKK 5AW6B 3CLQA 3ZT4A 2ZFCA 2Q7CA 5HBMA 1MA9B 4DQSA 4FCYA 1BUPA 1LP1B 3FZFA 4CJ7A 1HJOA 1M1KO 5MLCQ 4J2DA 1FKPA 1U45A 1RDWX 2E6LA 4BROA 4RWTA 1Y9BA 2H8PD 2DPNA 3CXHH 5AQMA 3L70G 2XZRA 3LAMA 4O4GA 3H08A 2XY8A 5HRNA 2JWDA 3UIQA 3C65A 2QVAA 4B1ZA 1XC9A 3CX5I 3SV3A 1KILA 4RTFD 2AEJA 2G8HA 4H5WA 2FXOA 4GVEA 1KXPA 1LP1A 1HTLC 2ZT9B 2B89A 3PO4A 1OVQA 3A2AA 4N6JA 1HKCA 5AQGA 5K5GB 5M1QA 2FYUG 3OW2O 3LDOA 4IXCA 4AF1A 4LFAK 3TGUD 3H1KE 4C8LA 1BGYE 2HHUA 1W2BO 4KREA 1VQ5P 3MIWA 3ZSVA 4J2AA 3V4QA 1TV6A 4J8FA 3AEDC 5BU8B 1T8ZA 5AVWB 5AQJA 1LTTC 4M45A 2W42A 1NHLA 5HP1A 3KD1E 4GKKK 4CF2A 1OH7A 1JCEA 1IK7A 3L74D 2QKBA 4KHXA 3AEGC 2ZQBA 1I3AA 4IO8A 2Q31A 2YIUC 2UXBK 2E6MA 4F8RA 1TVRA 3DXMB 4FW1A 3NMDA 4R5PA 1YBKA 4N47A 4CHYA 2ZVNB 5TISH 3D2EB 4DTXA 4B3RK 1T6CA 2OA8A 1SQXG 1JY3N 2YMYA 3SJHA 4OH8B 4ILGB 4K3AA 3O3HA 4JI5K 4FZXC 5FDLA 1QGKB 1S1VA 4CK1A 3AVKA 1Q81O 2IAJA 4PKIA 4LSLA 2QM8A 1XHXA 3DXMA 2XNDH 3O5BA 3WQUA 5BPNA 4IFFA 1L3TA 4CK2A 1YVUA 4K41A 3AVJA 3KK7A 3CPEA 3TPQA 3RK3D 3LPTA 5GINA 3L71G 3D2EA 3E1IA 1L0NJ 1LTSC 3H1VX 3SJJA 4ELVA 3ZT2A 4LC1A 2OYOA 4JRPA 3L2UA 1NM1A 2M5AB 2OYIC 1SQQJ 3HTKA 2Z1HA 1JM0A 4AYCA 3E66A 3NVMA 4JKBA 4U67L 1QSYA 5HRSA 1RH5B 1WSEA 4KJMA 3J8AA 3H1LJ 3KTQA 2IC3A 4G9ZA 4BDPA 4F3TA 2NLXA 4CJVA 1KQSO 4WVZA 1J1DC 4AM7A 3VTIA 1GDTA 4KH4A 4X62K 1S72P 1QQMA 2YHYA 3V1QA 1YJ9N 4EIJA 1JJ2M 2M5AA 1GK6A 1URQC 1DH3A 2K1AA 3CFOA 3FFKB 3D71A 3M8PA 3DAWA 1NJIO 1U2VB 2HHWA 4CERA 3K5OA 5E79E 1VQLP 2QWNA 3H1ID 3BCCD 3CJCA 2ITMA 1L5UA 1L3VA 2F9WA 5E41A 4NPFX 5AW5B 3C8VA 1X9SA 4FLUA 1L0NE 3FE1A 2E76B 1Y97A 3KIOA 5TKWA 4Z4HA 1AA0A 1KFNA 1BCMA 4E0DA 1GD2E 4JK7A 1KQFB 2KZMA 4EZ6A 2YHWA 2YMKA 2FSKA 3QB0A 2FXPA 2QA4P 4EHTA 3N7NA 3CPWM 3NH1A 4FJJA 1SQQE 4E19A 1YTUA 4WQ4A 2C0WA 1R8EA 1U2VA 4NCGA 1ZBSA 4LFCK 4C23A 2F8SA 3H1LE 1W7AA 1N7SD 4YHHK 1C1CA 4Y28J 2VG6A 1SP4A 1NGFA 4CGGA 1RT3A 2J4RA 3CYMA 3G6EP 1JCFA 3HSTB 1XMQK 1BWFO 4DJGA 2X6SA 3OS1A 3VQ8A 3VF4A 4GV3A 3AE7C 4CE9A 4GMJB 4JRQA 4KHWA 1XUPO 3THVA 4DSFA 1W9HA 3V1RA 4FYDA 1IC2A 3PSFA 1K73O 1RF0A 1VQ4P 3NFAA 4BE0A 1GU5A 4JBZA 1SQVE 2A06D 2IFMA 4M3UA 1IFIA 1ASVA 4DR4K 3TANA 2F4VK 1FJPA 4E1MA 2IX7C 4JLHA 4DTOA 2FLOA 3DI6A 3ULDA 2ZXXA 1KC8Q 1YI2N 4BE1A 2PP6A 3SAFA 1I94K 1NO4A 2W6KA 4GV9A 3ENBA 1RE4C 2G8IA 2HVHA 4DQIA 2HOEA 1BG3A 3AVAA 4XEIA 2YNFA 1JY3O 2C0XA 3E01A 5KTQA 4K42A 3CXHE 3HI0A 1Q82O 4EDFA 3NVKA 4IOCL 3L70D 5H1SQ 1SFCD 4AILC 3ITKA 1SQPJ 3NGZA 2O8BB 4RG8A 1A02J 4Y99B 3EE8A 4CJKA 4ID1A 1LT9C 1VQON 1L0LJ 4PQUA 3MWTA 4IZ9A 1YITP 1REVA 3LDQA 4O5FA 2WSFH 3WUUA 1NU1J 4L73A 4UQGA 5CBOA 1NKNA 1FKOA 3VETA 2FYUD 3II6A 1YYCA 2E75C 3B71A 4BRNA 2GTDA 2HBKA 2KB7P 1OZHA 3RWUA 3AE4C 1X0TA 4MLEA 1WAJA 2O8BA 1M56D 2NRWA 1NU0A 5ADXH 2Q3SA 2HG5D 5KJ7D 2BTFA 3AE6C 3M5RA 1E4GT 3BRVB 1X3NA 1RE3C 2KYVA 4JKGB 5FPNA 1Q86O 1KQLA 1PGOA 4H5VA 2N1TB 3K9KA 3CD6N 2D4WA 1OWAA 2WBNA 3T19A 1VHXA 3ZX2A 1NK8A 3FWLA 3KD5E 1T05A 1ESVA 1SQPE 4H0LD 2G8WA 5TISE 2J59M 3CCVN 4JI4K 1L0LE 1SQXD 1S1WA 4LC9B 4YOWA 3ZX3A 1VRTA 2E88A 4JKGA 1NU1E 1U04A 3DJCA 3TTFA 4CD1A 5LMNK 3HO1A 2N1TA 3AVHA 2O8CB 2IDBA 1GOBA 3D6RA 3VEVA 5CCGA 2V51B 4OLBA 1L0NK 4KV8A 1ZBIA 4OGCA 2W6BA 5AR0A 3CC4P 2A1SA 2G8VA 1HUCA 4CZIA 2CPSA 4O8UA 3CCJP 3L71D 3K2PA 1J9AA 3C94A 1SQQK 2OYHB 3OBYA 3H1LG 2FYNC 1NWQA 3PH0A 4AHRA 4KH6A 4ZTJA 2O8CA 1QHAA 3TGUJ 3AAPA 3A3YB 2WPQA 2Q0RA 2W40A 1SQBG 2I7NA 5KLIB 4HTLA 3CQ8A 4FJHA 3T1AA 1S3XA 4N41A 5FROA 1CXUA 2WSEH 3QEXA 2Y0CA 5APYA 1JUNA 5GAHP 1EETA 3KXDA 1HH0A 3AY9A 4CZLA 4JYBA 1J1EC 3HZ6A 3ZT1A 3K58A 3HRGA 5AZJB 4HYTB 4RW7A 3I0RA 1RBTA 4CJFA 1B9DA 3L74J 1EWRA 1G2CB 1HMVA 4GDOA 1ZXGA 2IYPA 1BO5O 1XTCC 2F96A 2IS3A 2D0BA 3SWFA 3O9QA 4CEDA 3AE1C 3TDKA 1UA1A 3DWLA 4ICLA 2FF3B 1QL2A 2WTUA 4M3ZA 2NNWA 4EOTA 4RW6A 1NGMB 2WC9A 1LW2A 4QS9A 5F2RA 3TAQA 1GL2B 5AZJA 2GWKA 2ZT9D 1XTGB 1K8AQ 1WN7A 4W7YA 1FZBA 1G2CA 2W90A 2YKMA 4C1NI 3HPHA 4F9OA 5BR8K 1E3MA 4BR7A 4CEOA 1OW8A 2QJPC 2AXTH 2HMPA 4A62A 2VQEK 4JQ0D 3TGUE 3GLMA 5CHXA 1KLNA 3HE4B 1ZBFA 3Q5RA 3G71N 3DOLA 2UWJE 2P5GA 5KQDA 4Q0BA 1P90A 1N6QA 1GL2A 1GLCG 4FJ5A 4LGDE 5M1OA 1NWKA 3QMLA 4H44B 3AO2A 4KHUA 4UY8O 3AAQA 4CZMA 5CCHA 1ZRTD 1I39A 1D8YA 4GV6A 3ZCMA 4HVJA 3OJUA 3RMCA 3L74E 2YNYA 2Y9YA 3NTNA 2B9BA 4O0JA 2PRRA 3HE4A 3MEDA 5CJ4A 4FJGA 2IBZI 4FL9A 3DLKA 2QWPA 1QZ6A 3ENOA 1VSFA 1EXQA 1RQVA 3PO5A 2VWBA 1JLCA 2WT7B 1MDUB 4KHYA 1CZ9A 3GMAA 4KB0A 5HL7L 1XNQK 1EO1A 3ATUA 5CR4A 2HFED 2NPSC 4W5OA 1FW6A 4N3YB 4UB6H 2AEMA 2WPSA 2GEMA 2KXPB 1SQPK 3NE6A 3I33A 1T44A 4HUGA 3BCCJ 1L0LK 4B9VA 4BACA 3VP9A 3RK3E 4M3LA 4IL6H 3WQTA 3FZMA 3K5BA 4OGQC 1CZBA 2K88A 1J53A 1NU1K 1RF1B 2WT7A 4CGHA 2QK9A 1U7JA 2BCCJ 2BH1A 2OTJN
chains in the Genus database with same CATH topology
2FFDB 4HUFA 2XNXA 2GUVA 4IFDK 3SQ1A 3MGNA 3PX4A 4FJNA 1RF1A 4FJ8A 2FFDA 2QKKA 3OYKA 3G3ZA 3N4XA 1JLAA 4CEFA 2H43A 3EFGA 3HP9A 5EU7A 1QQCA 2HMIA 4J2BA 2R3CA 3A2FA 1NKZB 2BANA 2WWWA 4OGEA 3QETA 3IFMA 1JLQA 1TL1A 1KILC 3SUQA 1S1TA 3C95A 4KPYA 3QLHA 5HROA 4QOZB 1H88A 1D5AA 1FZFA 2R7YA 4WBAA 2JJLA 1RTIA 2FC0A 3OYAA 3DLBA 3D0PA 3H32B 3M9QA 3RR7A 1JCDA 3DMJA 4FVMA 3QEPA 3OYHA 2A45I 1RILA 4W7ZA 4E3SA 3L2RA 4PWDA 2KFNA 5APQA 4O44A 2VRSA 3H32A 2HHTA 4O0IA 1IJDB 4DTMA 1RT4A 3TAGA 1HQEA 2R5BA 5CZ1A 4HTUA 1T3UA 3LP1A 3ZSRA 4FJLA 4B9TA 3AV9A 5FRMA 1Z56A 3B5NC 4I2PA 4B9MA 4AHUA 4DU1A 4FK0A 4E7IA 3MD0A 2HNZA 4GIFA 3JYTA 3VYIA 4KFBA 2RPIA 1IFDA 1NJZA 4IFVA 4IBNA 2Z5HA 4CF0A 4FK4A 4GVMA 3PY8A 5AVQB 4DSJA 1SVFA 3U1CA 4DTUA 1S6PA 2FKWB 3SPZA 1KTQA 5CCGD 4YFUA 4DS5A 3P8CD 3O3GA 1IKWA 4KHSA 2XY6A 5CJ0A 4FK2A 1AQ5A 2WONA 1KZUB 4CFBA 3AA4A 1M1JB 4IG0A 4M3XA 3ZSOA 2XHBA 3VQAA 3G0ZA 2DTUA 2D0AA 4KRFA 1WT6A 4H4OA 4B9UA 4CEQA 1F21A 4HCBA 5KJ7A 3ZT0A 3KK3A 3H6PA 5AW8B 2EHGA 1M1JA 3KLEA 2WITA 1EP4A 1KFDA 4GKGA 3WMM0 3NGYA 3NH0A 1VSLA 1S9EA 3V6DA 5AW2B 1KLMA 2FBTA 5AW4B 4FLTA 1HYSA 2I1KA 3HM9A 1BGXT 2KOGA 1RF0C 4G1QA 3AO3A 3L2QA 3SZ2A 3SI6A 3WNHA 4E7JA 3C6TA 3CG7A 3TSIA 1UAXA 1ZV8A 4F2RA 1JOCA 3KKSA 1GL2D 3NAEA 3RRGA 1NK7A 2RKIA 2KZZA 5CCHD 2YHBA 1JL2A 2Z4EA 4Z4IA 4ELUA 1B9FA 3TYYA 2GUIA 4CJSA 3RL0C 3AO5A 1IFMA 2FYUK 3SQ0A 3KK2A 4XIUA 3HT3A 4FLVA 1FZCB 3TAMA 4C8OA 3VA0A 3OYGA 1ZBLA 1FOSF 2CPBA 4AUWA 2WOMA 3M91A 1TK0A 3NXSA 4WY4B 3WNFA 4DWIA 4XA4A 4N5SA 3DLGA 1CW5A 1FZCA 1TKZA 1IO4A 3GHGC 4BWJA 2XKMA 1NK5A 4DSIA 3NH2A 3HD7B 1SQXK 3NGIA 3LWLA 1MU2A 1SKSA 4EP4A 4WY4A 2D5RA 3KK1A 1L4AC 2XY5A 2Z1IA 4MQ3A 2ETJA 3SWYA 4LH5A 3U3YA 1Z25A 3HD7A 4FW2A 3HL8A 3OYLA 3OYFA 5AVYB 1WLJA 2HODB 1JKHA 1AFOA 3LAKA 2POHA 4FJ7A 1J2JB 2R32A 5AW3B 3RMDA 4CCHA 4F3OA 1JCCA 2M3BA 4I7FA 2G8FA 1EX4A 3IG1A 4RW4A 1YTZI 3AVGA 3KPEA 2YKQA 2HODA 1XHZA 1BQMA 1CXQA 3L36A 1HYVA 4I2LC 4GT1A 2YNGA 2HHSA 1CSBA 1G1JA 3NF6A 4I9QA 1MZ9A 3L8BA 2O1JA 3QEVA 4LLHA 4BDYA 3O4QA 3DM2A 1RDAA 5APVA 4B9LA 4QAGA 4WB4A 4CF9A 4ZKPA 4YNQA 4CHNA 2WSCH 4RW9A 3TABA 3PUFA 1D9FA 2KW4A 3V9UA 1W2EA 1IKYA 3LZIA 1RDBA 4FM2A 2FBYA 3ZSYA 2D0CA 5APUA 4I1LA 1IFJA 3RTVA 1VSEA 1RT2A 1C0TA 2HNDA 4IFMA 2FXMA 1U47A 1CI6B 1HGVA 3R2PA 4K8ZA 3SUPA 1T3JA 5KRTA 1X9MA 1KRPA 1RBRA 3CFPA 3QESA 4WE1A 4BWMA 3LZJA 3QERA 5J2QA 2HNYA 2GUSA 1CLQA 1IH7A 4DTRA 1CI6A 1FBMA 1RF1C 4BDZA 3SV4A 3SUOA 4N78D 2O4GA 3P83D 4CK3A 2C9LY 2A1RA 1TL3A 3RK3C 1NAFA 3P8CE 4CEAA 3SYZA 5AVRB 4GW6A 3K59A 3F9KA 4DLGA 4OLAA 1GOAA 3OA7A 2VWKA 1T8EA 2IFNA 1UOCA 1TAQA 1HVVA 2YHAA 5SZTA 4KAZA 5HRRA 1ZLLA 3KDPB 4ELTA 3DRRA 1ZYQA 2MJZA 1L3SA 4PA1A 3SUNA 2PY5A 4OKJA 2O4IA 2KP8A 3A7OA 1U4BA 4FZZA 3KJVA 4FZYA 4DSKA 4IKFA 5KI6A 4DOJA 1BIUA 2YO3A 1JL1A 4CFAA 5HRPA 4Q5VA 1GW4A 1Q8IA 3OJSA 4KTWA 2O01H 3V4WA 1SQBK 3BDPA 3VN5A 4KTQA 1SV5A 2E43A 4H4MA 2ZE2A 2OYHA 5K14A 4JF7A 1N7SC 1U49A 4DTPA 1LTAC 1J1DB 4EZ9A 1A5XA 3QNOA 4KI4A 4ID5A 2XDJA 1WSFA 3F73A 1IKXA 3L35A 1OXZA 4CFDA 3QEIA 1URQB 2OYQA 3L37A 1X9VA 2QXFA 2P67A 1KSPA 4C7NB 4CGIA 1FAVA 4Y1CA 4B3OA 4XE5B 3OYNA 5I42A 4Z0UA 3M0DA 3AO4A 3SCXA 1A5VA 1URQA 3V9XA 1C6VA 5AW7B 1SFCC 4C7NA 1QSLA 2GM4A 1EQ7A 4WY4D 4RESB 1VDFA 5CMZA 3LANA 1M7LA 1LWEA 2VG5A 1SL0A 2PAJA 4LD0A 2C9NY 4J2EA 1XI1A 3SQ2A 3CI9A 3HD7D 1LWUB 3HUSC 2OPQA 2ATQA 5KJ7C 4DTSA 3VOPA 4CEEA 4QCLA 1DX7A 4B08A 4N76A 1NK0A 4W5RA 3MAQA 1KFSA 3HVRA 2FBVA 1KCFA 1JO5A 1S1UA 3OYBA 3JSMA 1LWUA 3TI0A 1BIZA 1WAFA 5C42A 1HJBA 4DU4A 1MUUA 3V2RA 4NYNA 3TARA 4DLEA 1MV8A 1RE4A 1NJYA 3ZSQA 3IS9A 4CHPA 1RT6A 3I0SA 1T03A 4CJ5A 1JLFA 3K57A 5AVXB 3AVMA 3S3NA 3V5BA 4B8AB 2X6NA 3P5JA 5HLFA 2KSJA 3KLHA 3NHGA 3VP8A 1T2KC 2YKOA 3LPUA 1QSSA 1VK0A 3VQ9A 4CJEA 3SQ4A 3L3UA 5SWMA 4CEBA 5AVTB 2KLVA 3AO1A 4PY5A 1HPZA 3ITHA 4M3TA 1FZEA 3RRHA 3AVCA 3KLGA 4JYCA 3RK2D 4ZKUA 2JGUA 2WTYA 5T7BA 4CJTA 3OVNA 2ZD1A 1ZBHA 1IKVA 3QIOA 4E1NA 1JLBA 3OYJA 1VSDA 3MECA 2Z5IA 4DFMA 4L8RB 2GV9A 1GU4A 1J1EB 1D9DA 4DSLA 1GTWA 4CHOA 4FJMA 1JY3P 3HP6A 1VSIA 1BISA 4C7RA 5KLVK 1BHLA 3QNNA 5AVVB 3VQPA 1BCOA 2N9BA 1IG9A 3V81A 2PYJA 3VQ4A 3HK2A 4CHQA 5I3UA 3L2WA 1QHTA 4N78E 1DTTA 1HGZA 1NK6A 1Q9XA 3AVIA 4HCCA 1NTMK 5DK5A 2B5JA 4O9BA 2WZ7A 1S9GA 1X8YA 5AVSB 1QL1A 1KVBA 3LP2A 1Z26A 4PUOA 2P5OA 5AW9B 1LTBC 4ZTFA 2HHVA 3KLFA 3PV8A 3TK1A 3PX0A 3V4IA 1X9WA 1N73B 1LTJB 1TKTA 3L2VA 3T97A 5KGWA 5C25A 2NPSB 3V9ZA 1HNIA 1RTJA 4W5TA 3NFQA 1NKCA 3V2PA 3AA2A 1N73A 1LTJA 1KFMA 4DFJA 2HYNA 3V1OA 1CZQA 5APSA 3FFIA 4CESA 4C46A 2NPSA 3AVLA 1WSGA 3C6UA 1U48A 1HNVA 4CHZA 5FRNA 2X74A 1RTDA 1DEBA 2L5GB 1C0UA 3LP0A 3NF9A 1QTMA 1N2DC 3MEEA 4FJKA 1DTQA 3VQQA 2P1JA 3QO9A 3HRNA 1HJRA 5AW0B 1BL3A 1URQD 1YTAA 2ZXEB 3TAPA 3M8QA 4CJUA 3M9BA 4FLXA 2H7HA 5J2PA 1VSMA 4EP5A 3WNGA 4M3WA 4HH2A 1WSJA 3VMYA 1KILB 2BASA 5AW1B 3VQ6A 3MUDA 1VSKA 2G8KA 1ZN5A 3HYFA 3B6OA 4Y99C 4FJIA 1NKBA 3VMXA 1ZR4A 4TSXA 5KRSA 1N5YA 2P2UA 2IDOA 2Q3IA 2W6AA 3IAYA 3AA3A 2VG7A 2DY4A 3EZ5A 3NDKA 1FU1A 3KLIA 1FOSE 3NCIA 1H89A 4B9NA 1TKDA 2Q9IA 1SLQA 1S1XA 1GW3A 3S9HA 2N1TC 5CCGC 3ISNC 3B8EB 1GOCA 3AVBA 2HW3A 2DFFA 3I5CA 2AJQA 4CGDA 3BASA 4HHTA 4CJ3A 1O1WA 4ZHRA 2OZSA 3UIAA 3B5NB 2PYLA 5CY4A 2Q5UA 4KHNA 1BQNA 4CEZA 1ITGA 4NCBA 5BU5A 5CYMA 3M8RA 4AHSA 3V9SA 1Q9YA 3HTKB 1NOZA 3IR9A 1JMMA 3LDSA 3L4FA 5J2MA 2OYHC 4CIFA 1SUQA 3K5NA 3P1GA 4N56A 3WNEA 1X79B 3B5NA 4JS4A 5CYQA 1MFZA 3V2NA 3MXJA 3K5LA 1KVAA 3TWHA 1JXEA 2HHQA 3TAEA 4LSNA 3S3MA 3VA3A 3CM6A 1LAWA 3OYIA 2JLEA 2NUBA 4DS4A 3MTUE 3RMAA 3C9IA 3V9WA 3OYEA 3M0DC 3SNNA 1JLGA 1SKWA 2WPRA 3AVFA 1GL2C 3OS0A 2X78A 5APWA 5KTBA 3L3VA 2YO2A 3LWMA 5CCHC 1NOYA 3OJAB 3S3OA 3M06A 4CF1A 3RK2B 1J5OA 1LAVA 2Z1JA 4DSEA 3EYZA 4FJXA 3OYMA 1VRUA 2E4LA 3VN0A 5BVZA 4E7LA 3HPGA 3LW5H 3LALA 4CJWA 4W80A 4CFCA 2JEEA 1VSHA 1JY2N 3LIEA 2OPPA 4CJ4A 3RR8A 2R5DA 4HUEA 3IRXA 2I1JA 2KFZA 4CGFA 1LWUC 4CJRA 2XU6A 3ZSWA 2EX3A 4Z4CA 2XO7A 4FLYA 1UA0A 3VQDA 2RN2A 4DFKA 2O1KA 2A45G 3D45A 4CF8A 1LWFA 1S9KD 3RL0B 3BATA 4Z4EA 4Y1DA 2FFDC 3AVNA 4CECA 3VQ5A 4FM1A 3ALYA 4DTNA 2HPCB 3U6FA 1FZAA 3NF8A 3M8SA 1G15A 2OZMA 1RT5A 2B6AA 4OJRA 2QM7A 4DTJA 3DLRA 1NH4A 2Y1IA 3VQ7A 3HPOA 3LIDA 2NPSD 1RY3A 3GHGB 4M42A 3KQGA 3PP5A 2HPCA 1A02F 4LH4A 3AA5X 4AQRD 1QE1A 4E7KA 3P7KA 3OYCA 2HLOA 1VPCA 2OPSA 2FYZA 3VQBA 4KB1A 1L4AB 1YTZT 3GHGA 5CZ2A 2BGGA 3DOKA 1FZGA 4DQPA 3CL3D 1R0AA 2E42A 4I9LA 3EY1A 2OYIB 4AH9A 4NCAA 1ASWA 1FDMA 3VQCA 3OAKA 1L4AA 5AVZB 1RBUA 4C8NA 1IO2A 1T7PA 1RDCA 1QS4A 3DLEA 4C8KA 1WNSA 2YV0X 5APTA 3QIPA 4CJPA 1TKXA 1GK4A 1A5WA 4O55A 4DG1A 4FM0A 1HRHA 4E89A 1JY2O 2OYIA 3KKRA 3CFRA 1WRGA 2ITGA 2YKPA 1T2KD 1G1IA 1KILD 1PFIA 5JS1A 3TR8A 2P51A 4JS5A 4K8XA 1SQVK 1RBVA 1EKEA 2LKMA 2HB5A 5C24A 3A5TA 3BGRA 4M3YA 4F4KA 2HHXA 3OS2A 2YNIA 1LTGC 3ZSXA 1K6YA 1XWLA 1J54A 2PZSA 3U3GA 1LTIC 4FJ9A 1RCHA 3M9HA 5AVUB 4IFYA 2W27A 1LWCA 2YNHA 3DRSA 5JS2A 4DFPA 3VMZA 4KI6A 3I8DA 1E5WA 3CM5A 4CJQA 2DFHA 1M1JC 1RTHA 1HQUA 3HJFA 4OKEA 3MXIA 3B5ND 1N73C 1LTJC 3RMBA 3M0AA 1RDDA 1ZBUA 1UWBA 3HVTA 1JNMA 2GBZA 3SPYA 4CIGA 1LT9B 2F8TA 4MFBA 1H8AA 4DQRA 1JXBA 3PX6A 3HXMA 4AHCA 2XRIA 1FJKA 1LV5A 1GZLA 2OPRA 3DLHA 1LT9A 3RK3B 1SKRA 1TGOA 4OPJA 1L3UA 1C1BA 2B4JA 1X1PA 4O5BA 1RNHA 1RT1A 2IOCA 1S5JA 3VTPC 1SL1A 4CGJA 3QINA 3QEWA 1TAUA 1TK8A 1WSIA 5APXA 1S6QA 4AHVA 4KTZA 4FXDA 4I2QA 3ZSZA 1FXXA 3TNUB 1NJWA 2BDPA 1RE3A 1B92A 4DU3A 4OKKA 1C1AA 4M3RA 4KKOA 2M8RA 4DF4A 2XV5A 3BRTB 1TK5A 4W5QA 4C8MA 2DFEA 3V2QA 3TNUA 4Z4GA 3O8ZA 4W5NA 3ASMA 3K5MA 1FZCC 4AHTA 2XY7A 1IK9A 2IGIA 2I5JA 4CJLA 4FLWA 1LGHB 4DMNA 2HVIA 1NKEA 4WY4C 3ZT3A 1N7SB 5KGXA 3HE5B 1NJXA 5J2NA 3NF7A 1JTHB 3NBPA 1NOHA 4I6MC 1C0MA 4KO0A 3TAFA 3DRPA 3B6PA 1NK4A 3DYAA 4DF8A 3MEGA 2OARA 3MXMA 3HD7C 1HYZA 2A45H 1N7SA 4B9SA 3HE5A 1S9KE 1N86A 3BVHA 3RL0D 1RT7A 1JTHA 2YKNA 1W0HA 4LY7A 3OYDA 1BI4B 3U59A 1JLEA 1ZR2A 4IDKA 4NYFA 2KTQA 1SFCB 3G10A 3U1AA 4E7HA 2P7JA 1IFNA 3VQEA 4DQQA 2Y1JA 1RBSA 2BE2A 1BI4A 1DLOA 4CIEA 1ASUA 1FK9A 1SL2A 2LSNA 5D3GA 1SFCA 1HBWA 2N1TD 1VSJA 3HUSB 4H8KA 4B8CA 3LP3A 4BE2A 4M41A 2KQ2A 5J1EA 4Z4FA 1L4AD 4OPKA 4OVLA 1LW0A 3P8MC 3O4NA 3HUSA 4B86A 4DZOA 3KYQA 2IPPA 3T3FA 4IG3A 1WSHA 4RW8A 2J58A 5DMRA 3P32A 1YT3A 2FBXA 3O3FA 3RK2C 1HWTC 4F2SA 1NTZK 1JY2P 4KHQA 4FLZA 1NK9A 3EQ2A 1N7LA 3OY9A 2G8UA 2Z1GA 1KVCA 2VWJA 2RF2A 1NTKK 5AW6B 3CLQA 3ZT4A 2ZFCA 2Q7CA 5HBMA 4DQSA 4FCYA 4J2DA 1FKPA 1U45A 2E6LA 2H8PD 3LAMA 2XZRA 4O4GA 3H08A 2XY8A 5HRNA 3UIQA 1XC9A 3SV3A 1KILA 2G8HA 1HTLC 3PO4A 3A2AA 4N6JA 4C8LA 2HHUA 4KREA 3MIWA 3ZSVA 4J2AA 3V4QA 1TV6A 5BU8B 1T8ZA 5AVWB 4M45A 1LTTC 2W42A 1NHLA 5HP1A 3KD1E 4CF2A 2QKBA 4KHXA 2ZQBA 1I3AA 2E6MA 4F8RA 1TVRA 4FW1A 3NMDA 4R5PA 4N47A 4CHYA 4DTXA 2OA8A 1JY3N 2YMYA 4OH8B 3O3HA 4FZXC 5FDLA 1S1VA 4CK1A 3AVKA 2IAJA 4LSLA 2QM8A 1XHXA 1L3TA 4IFFA 4CK2A 1YVUA 3AVJA 3RK3D 3LPTA 3E1IA 1LTSC 3SJJA 4ELVA 3ZT2A 4LC1A 4JRPA 3L2UA 2OYIC 3HTKA 2Z1HA 4AYCA 1QSYA 5HRSA 1WSEA 3KTQA 2IC3A 4BDPA 4F3TA 4CJVA 1J1DC 1GDTA 3V1QA 4EIJA 1GK6A 1URQC 1DH3A 3CFOA 3M8PA 2HHWA 4CERA 3K5OA 1L5UA 1L3VA 5E41A 5AW5B 1X9SA 4FLUA 3KIOA 1Y97A 4Z4HA 1KFNA 1BCMA 4E0DA 1GD2E 2KZMA 4EZ6A 3N7NA 3NH1A 4FJJA 4E19A 1YTUA 2C0WA 4NCGA 2F8SA 1N7SD 1C1CA 2VG6A 1SP4A 4CGGA 1RT3A 3CYMA 3HSTB 2X6SA 3OS1A 3VQ8A 4CE9A 4GMJB 4JRQA 4KHWA 3THVA 4DSFA 1W9HA 3V1RA 4FYDA 1IC2A 1RF0A 4BE0A 3NFAA 1GU5A 2IFMA 4M3UA 1IFIA 1ASVA 3TANA 1FJPA 4E1MA 2IX7C 4JLHA 4DTOA 3DI6A 3ULDA 4BE1A 2PP6A 1NO4A 1RE4C 2G8IA 2HVHA 4DQIA 3AVAA 2YNFA 1JY3O 2C0XA 3E01A 5KTQA 1SFCD 4AILC 3NGZA 4RG8A 1A02J 4Y99B 4CJKA 4ID1A 1LT9C 4PQUA 1REVA 2WSFH 4UQGA 1NKNA 1FKOA 3II6A 1YYCA 2KB7P 3RWUA 1WAJA 2Q3SA 2HG5D 5KJ7D 3BRVB 1RE3C 2KYVA 1KQLA 2N1TB 1OWAA 3T19A 1NK8A 3KD5E 1T05A 2G8WA 2J59M 1S1WA 1VRTA 1U04A 3HO1A 2N1TA 3AVHA 1GOBA 5CCGA 4OLBA 1L0NK 4KV8A 1ZBIA 4OGCA 2W6BA 2A1SA 2G8VA 1HUCA 2CPSA 3K2PA 1J9AA 3C94A 1SQQK 2OYHB 1NWQA 4AHRA 4ZTJA 3A3YB 2WPQA 3CQ8A 4N41A 4FJHA 3T1AA 5FROA 1CXUA 2WSEH 3QEXA 5APYA 1JUNA 1EETA 1HH0A 4JYBA 1J1EC 3ZT1A 3K58A 4HYTB 4RW7A 3I0RA 1RBTA 4CJFA 1B9DA 1G2CB 1HMVA 1XTCC 2F96A 2IS3A 2D0BA 3SWFA 4CEDA 1UA1A 4ICLA 1QL2A 4M3ZA 4EOTA 4RW6A 1LW2A 3TAQA 1GL2B 1XTGB 1WN7A 4W7YA 1FZBA 1G2CA 2YKMA 3HPHA 4CEOA 5CHXA 1KLNA 3HE4B 1ZBFA 3DOLA 2P5GA 4Q0BA 1N6QA 1GL2A 4FJ5A 4LGDE 3AO2A 4KHUA 5CCHA 1I39A 1D8YA 3ZCMA 4HVJA 3OJUA 3RMCA 2YNYA 3NTNA 4O0JA 3HE4A 3MEDA 5CJ4A 4FJGA 3DLKA 1VSFA 1EXQA 3PO5A 1JLCA 2WT7B 4KHYA 1CZ9A 4KB0A 2HFED 2NPSC 4W5OA 4N3YB 2WPSA 3NE6A 1SQPK 4HUGA 4B9VA 1L0LK 4BACA 3VP9A 4M3LA 1CZBA 1J53A 1NU1K 1RF1B 2WT7A 4CGHA 2QK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSJ A;  4H8K A;  4HUF A;  1UOC A;  1TAQ A;  4B8C A;  1Q9Y A;  3LP3 A;  1NOZ A;  4BE2 A;  3LDS A;  2YHA A;  5SZT A;  4M41 A;  2KQ2 A;  4KAZ A;  5J1E A;  5J2M A;  4Z4F A;  5HRR A;  4ELT A;  4CIF A;  1SUQ A;  3DRR A;  3SQ1 A;  3K5N A;  1ZYQ A;  1L3S A;  3P1G A;  4N56 A;  3WNE A;  4PA1 A;  4OPK A;  4JS4 A;  5CYQ A;  4OKJ A;  3SUN A;  2PY5 A;  2O4I A;  4OVL A;  3PX4 A;  4FJN A;  3MXJ A;  1LW0 A;  3K5L A;  4FJ8 A;  1KVA A;  3TWH A;  1U4B A;  3O4N A;  4FZZ A;  1JXE A;  2HHQ A;  3KJV A;  4FZY A;  3TAE A;  2QKK A;  4LSN A;  3OYK A;  4DSK A;  3S3M A;  1JLA A;  4CEF A;  3VA3 A;  4IKF A;  3T3F A;  5KI6 A;  1BIU A;  4IG3 A;  3HP9 A;  1WSH A;  5EU7 A;  1JL1 A;  1QQC A;  3CM6 A;  4CFA A;  2HMI A;  1LAW A;  4RW8 A;  3OYI A;  2JLE A;  5HRP A;  4Q5V A;  5DMR A;  4J2B A;  2NUB A;  4DS4 A;  1Q8I A;  3A2F A;  3RMA A;  1YT3 A;  3OJS A;  3V9W A;  4KTW A;  2FBX A;  2BAN A;  3O3F A;  4OGE A;  3OYE A;  3QET A;  3SNN A;  3BDP A;  3VN5 A;  1JLG A;  4F2S A;  1JLQ A;  1TL1 A;  1SKW A;  4KTQ A;  1SV5 A;  3SUQ A;  4KHQ A;  1S1T A;  3AVF A;  3C95 A;  4KPY A;  4H4M A;  4FLZ A;  3QLH A;  3OS0 A;  2ZE2 A;  1NK9 A;  2X78 A;  5K14 A;  5HRO A;  4QOZ B;  1U49 A;  3OY9 A;  4DTP A;  2G8U A;  1D5A A;  3L3V A;  2Z1G A;  3LWM A;  1KVC A;  4EZ9 A;  2R7Y A;  1A5X A;  1NOY A;  2FC0 A;  2VWJ A;  1RTI A;  3QNO A;  4KI4 A;  4ID5 A;  3S3O A;  2RF2 A;  1WSF A;  3OYA A;  3F73 A;  1IKX A;  3D0P A;  3DLB A;  3ZT4 A;  4CFD A;  4CF1 A;  3RR7 A;  1J5O A;  4PY5 A;  1LAV A;  3QEI A;  2Z1J A;  3DMJ A;  5HBM A;  2OYQ A;  4FVM A;  4DQS A;  3QEP A;  4FCY A;  4DSE A;  3OYH A;  3EYZ A;  4FJX A;  2QXF A;  1RIL A;  3OYM A;  4E3S A;  4J2D A;  1VRU A;  1FKP A;  2E4L A;  4CGI A;  2E6L A;  1U45 A;  1KSP A;  4E7L A;  4Y1C A;  3HPG A;  3L2R A;  4PWD A;  4B3O A;  3OYN A;  2KFN A;  5I42 A;  3LAM A;  3LAL A;  4O4G A;  4Z0U A;  3H08 A;  4CJW A;  2XY8 A;  5HRN A;  3UIQ A;  4O44 A;  4CFC A;  2HHT A;  1VSH A;  2OPP A;  3AO4 A;  4O0I A;  3SCX A;  1A5V A;  4CJ4 A;  1XC9 A;  3SV3 A;  3V9X A;  4DTM A;  2G8H A;  3RR8 A;  1RT4 A;  4HUE A;  3PO4 A;  1C6V A;  3TAG A;  3IRX A;  2KFZ A;  1HQE A;  5CZ1 A;  4HTU A;  4CGF A;  1QSL A;  4CJR A;  3LP1 A;  3ZSW A;  2EX3 A;  3ZSR A;  4Z4C A;  4FJL A;  2XO7 A;  4B9T A;  4FLY A;  4C8L A;  1UA0 A;  2HHU A;  3AV9 A;  3VQD A;  3LAN A;  5FRM A;  4KRE A;  2RN2 A;  4DFK A;  3ZSV A;  4J2A A;  1TV6 A;  1LWE A;  2VG5 A;  4I2P A;  4B9M A;  4M45 A;  4AHU A;  4DU1 A;  2W42 A;  1SL0 A;  2PAJ A;  4LD0 A;  4FK0 A;  3D45 A;  4CF8 A;  1LWF A;  5HP1 A;  4E7I A;  1XI1 A;  3KD1 E;  2HNZ A;  3SQ2 A;  4CF2 A;  4J2E A;  4Z4E A;  3JYT A;  4Y1D A;  2QKB A;  3AVN A;  2ZQB A;  1I3A A;  2OPQ A;  4KFB A;  2ATQ A;  2RPI A;  4CEC A;  2E6M A;  4DTS A;  4IFV A;  1NJZ A;  4CEE A;  1TVR A;  4F8R A;  4FW1 A;  4IBN A;  4R5P A;  3VQ5 A;  4B08 A;  4FM1 A;  4N76 A;  4QCL A;  4N47 A;  3ALY A;  4DTN A;  4CHY A;  1NK0 A;  4CF0 A;  4FK4 A;  4GVM A;  3U6F A;  3PY8 A;  4DTX A;  3NF8 A;  4W5R A;  2OA8 A;  3M8S A;  3MAQ A;  1G15 A;  1KFS A;  2OZM A;  4DSJ A;  1RT5 A;  2B6A A;  2FBV A;  3HVR A;  1KCF A;  1S1U A;  3OYB A;  4OJR A;  3JSM A;  1S6P A;  3O3H A;  4DTU A;  3SPZ A;  1KTQ A;  4DTJ A;  3DLR A;  1S1V A;  5FDL A;  4CK1 A;  3AVK A;  4YFU A;  4DS5 A;  4FZX C;  3TI0 A;  1BIZ A;  1WAF A;  3VQ7 A;  2IAJ A;  5C42 A;  3O3G A;  3HPO A;  1IKW A;  2Y1I A;  4KHS A;  2XY6 A;  4LSL A;  1XHX A;  1L3T A;  2WON A;  4FK2 A;  4DU4 A;  4CK2 A;  1YVU A;  4M42 A;  4NYN A;  3TAR A;  3AVJ A;  4DLE A;  4CFB A;  3AA4 A;  3LPT A;  1NJY A;  4IG0 A;  4M3X A;  4LH4 A;  3ZSQ A;  3IS9 A;  3ZSO A;  3AA5 X;  4CHP A;  3SJJ A;  1RT6 A;  4ELV A;  3ZT2 A;  4JRP A;  3L2U A;  2XHB A;  1QE1 A;  3I0S A;  3VQA A;  4E7K A;  3OYC A;  3G0Z A;  1T03 A;  2DTU A;  2D0A A;  4KRF A;  4H4O A;  4B9U A;  2OPS A;  4CJ5 A;  2Z1H A;  1JLF A;  1F21 A;  3VQB A;  4CEQ A;  3K57 A;  4HCB A;  4KB1 A;  3S3N A;  3AVM A;  3ZT0 A;  1QSY A;  3KK3 A;  5HRS A;  1WSE A;  5CZ2 A;  2EHG A;  3KTQ A;  2BGG A;  3DOK A;  2IC3 A;  4BDP A;  4F3T A;  3KLE A;  4CJV A;  4B8A B;  4DQP A;  1EP4 A;  2X6N A;  1KFD A;  1R0A A;  3P5J A;  4I9L A;  3NGY A;  3NH0 A;  1VSL A;  3EY1 A;  5HLF A;  1S9E A;  3V6D A;  3V1Q A;  3KLH A;  1KLM A;  3NHG A;  2FBT A;  4FLT A;  3LPU A;  4AH9 A;  4NCA A;  1ASW A;  3VQC A;  1QSS A;  1HYS A;  1VK0 A;  3VQ9 A;  3HM9 A;  1RBU A;  3CFO A;  3M8P A;  1BGX T;  4C8N A;  4CJE A;  3SQ4 A;  1IO2 A;  3L3U A;  2HHW A;  4CER A;  1RDC A;  3K5O A;  1QS4 A;  4CEB A;  5SWM A;  3DLE A;  1T7P A;  4C8K A;  4G1Q A;  1L5U A;  1L3V A;  1WNS A;  2YV0 X;  3AO3 A;  3AO1 A;  3QIP A;  1TKX A;  4CJP A;  5E41 A;  1A5W A;  4O55 A;  4DG1 A;  3L2Q A;  3SZ2 A;  3SI6 A;  1HPZ A;  1X9S A;  4FM0 A;  3WNH A;  4FLU A;  4E7J A;  1HRH A;  3ITH A;  3C6T A;  1Y97 A;  3CG7 A;  3KIO A;  4E89 A;  4M3T A;  4Z4H A;  1BCM A;  4E0D A;  3KKR A;  3CFR A;  1UAX A;  2ITG A;  3RRH A;  4EZ6 A;  2KZM A;  3AVC A;  3KLG A;  2JGU A;  4F2R A;  3NH1 A;  4FJJ A;  4E19 A;  1YTU A;  5T7B A;  4NCG A;  5JS1 A;  4CJT A;  3TR8 A;  2F8S A;  3KKS A;  2P51 A;  3OVN A;  3NAE A;  4JS5 A;  4K8X A;  1C1C A;  1RBV A;  2RKI A;  2VG6 A;  2ZD1 A;  1NK7 A;  1EKE A;  4CGG A;  3RRG A;  1ZBH A;  1RT3 A;  3CYM A;  2YHB A;  1IKV A;  1JL2 A;  2HB5 A;  3HST B;  3QIO A;  3BGR A;  5C24 A;  4E1N A;  4M3Y A;  4F4K A;  2HHX A;  1JLB A;  3OS2 A;  4Z4I A;  2YNI A;  2X6S A;  3OS