2P1JA

Crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRFVEMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase III polC-type
publication title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.140 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p1jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p1jA01
4LY7A 3ULDA 1VSFA 3M8PA 3NF9A 3AVIA 1K6YA 4DU1A 4FZXC 3QIOA 1YVUA 4LD0A 4W5OA 5HP1A 3HT3A 1QS4A 1S1XA 2D0BA 1C0TA 4H8KA 3VQ9A 2XO7A 3OYDA 3KLHA 4CF2A 2X6NA 4DTOA 4B9NA 1VK0A 4J2BA 4FJ7A 4CJEA 1BI4A 1JLBA 3IS9A 4CEBA 3DLGA 4OPKA 3TAQA 3PV8A 3SV3A 3E01A 5CY4A 3NDKA 3U6FA 4DSIA 4KHSA 2Z1JA 4O0JA 1TAUA 3LAMA 3VQ8A 1RTHA 1S5JA 3H08A 3KD1E 1DLOA 2E4LA 2FBTA 2FC0A 4EZ6A 4DF8A 3OYBA 4ID5A 2HHUA 4CJFA 3IAYA 3AVHA 3QIPA 4RW6A 2X78A 4LSNA 3VQ7A 4MFBA 1BQMA 2NUBA 1NK7A 4CJSA 3OJUA 5KRSA 3V1RA 2HB5A 1DTTA 3TANA 3OYFA 1YTUA 5D3GA 1ZBFA 1RILA 3KKSA 1L3VA 3U3GA 3KD5E 4CGFA 3P1GA 2OZMA 3WNEA 4IG3A 4JRPA 4DQSA 1RDCA 4HCCA 4E7LA 1C0MA 3PO5A 4OLAA 1Q9XA 1EETA 3OS2A 1A5VA 1YTAA 1WSFA 4CK1A 1NK5A 1JL2A 3NAEA 1NKBA 2KFZA 2OYQA 3HPHA 1ASUA 1KVAA 1FKOA 5JS2A 4CEOA 4HHTA 4E0DA 4PUOA 3DLKA 2KW4A 4RW4A 2HHWA 1FXXA 3C6UA 3I0SA 3O4QA 3LP2A 1VSIA 3O3GA 4DSEA 4DS4A 1A5WA 4ZHRA 5HLFA 4CCHA 4J2DA 2O4IA 4MQ3A 3ZT3A 3NF7A 4OPJA 1QSYA 3NHGA 5J2QA 2OPRA 3V9UA 5J2PA 3V9ZA 4BDPA 4E7IA 3AVNA 3QEVA 1RBRA 2IOCA 3O4NA 3V9WA 3PX6A 4FJLA 2D5RA 1S6PA 3C6TA 4DFMA 4DTNA 5FRMA 3AVGA 4CK3A 1C1AA 1R0AA 3B6OA 2BGGA 4B3OA 4M3ZA 4BDYA 4FJHA 1VSEA 4BWMA 3V9XA 2G8FA 1SUQA 5E41A 2KZMA 4QCLA 2LSNA 4DG1A 1ZBIA 3V81A 4FJKA 3PO4A 4OLBA 1HNVA 2GUIA 4R5PA 3RMBA 4FCYA 1SL0A 3LANA 4CFBA 4ELTA 4FJ5A 3ASMA 3TAGA 2A1RA 3QINA 1J5OA 3S3NA 3M8QA 1XC9A 1BIUA 2YNFA 1X9WA 3AA2A 4N56A 4KHQA 2ATQA 4YNQA 3B6PA 1IKYA 4I2PA 3K2PA 3K5NA 4EP4A 1GOCA 1TKDA 2XY6A 4Z4IA 3DLEA 4BE0A 1X9MA 3ZSXA 3DM2A 2IS3A 3TARA 2EX3A 1VSLA 4CE9A 4EZ9A 3DLHA 3AO5A 4FLWA 4FLYA 1BQNA 4CF1A 4KV8A 2G8KA 4FZYA 2Q3SA 1LV5A 5HRNA 1Z25A 1JL1A 4GW6A 3SI6A 2G8IA 4RG8A 3VQ6A 3NGYA 2YNGA 3KK3A 3F73A 4O44A 1VSKA 4FJ9A 1JLQA 1U48A 3O3HA 1NOYA 1J54A 1EXQA 1YT3A 3HK2A 5KGWA 1RT5A 1HYSA 4W5TA 4DSLA 4CESA 3QETA 1NJZA 4CJUA 3U3YA 4C8LA 1ZBLA 2PAJA 1IKWA 2WOMA 2YV0X 5KI6A 4B9MA 1N6QA 2DTUA 4M42A 4CHYA 4KI4A 1C1BA 1I39A 4Z4FA 4B8CA 1LW0A 3O3FA 2F8SA 3QEXA 3C95A 3OVNA 4CJ4A 4AHTA 3NH0A 3MAQA 1RNHA 1DTQA 1BGXT 4CF9A 3V4IA 1KLNA 3CYMA 4FZZA 4AH9A 2HNDA 3NE6A 3HM9A 4F3TA 2X6SA 3DMJA 3VQCA 1HRHA 3C94A 1TK5A 3AVJA 5KTQA 1NJWA 3AVLA 1NKEA 1Y97A 4CFAA 4CEZA 1X9SA 3RWUA 4ID1A 4C8OA 3QLHA 3MXIA 1WSEA 3KIOA 2D0AA 3VQAA 4M3YA 3AVMA 1CXQA 1B92A 2D0CA 2RN2A 3AVFA 4ICLA 5DMRA 1GOBA 3D45A 4FK2A 2GV9A 1IO2A 2G8UA 4F4KA 1NOZA 4FK0A 1LW2A 1W0HA 4CGJA 4CGIA 4FLVA 2P1JA 4DLEA 3DOLA 4I2QA 1RT7A 1L3UA 1U04A 1U49A 4M3WA 4AHUA 1EP4A 3ZSVA 3D0PA 3RR7A 4CGGA 4FJIA 4FJXA 4LH4A 1UA1A 1TV6A 4CHPA 3L3UA 3EY1A 4CIGA 1TL3A 3QESA 3KLGA 1RBTA 1S9EA 3TAEA 4CGHA 3DI6A 4OKEA 4CF0A 4PA1A 3TAMA 1W9HA 4CJPA 4Z4GA 4FW1A 4OVLA 3RRHA 3MEGA 5C42A 1NJXA 1T8EA 4IBNA 1VSDA 2HHTA 4CJWA 4FVMA 4H4OA 4FM1A 4DQRA 2PZSA 4DTSA 1TKTA 4B08A 3K5LA 4EP5A 3NGZA 3MXMA 4E7KA 4CHZA 4KTZA 4J2EA 3KLFA 4N76A 4DSJA 4OKJA 1XI1A 4Z4HA 2GBZA 4KREA 3AVAA 4CEFA 3SPYA 2ZQBA 4RW9A 4RW7A 3JSMA 3M8RA 4FLXA 4DFKA 1UOCA 4DLGA 4BWJA 1B9DA 1ZYQA 1HJRA 3SUQA 4OJRA 1L3SA 4L8RB 1CZ9A 5SWMA 1HMVA 4I9LA 3M8SA 3RTVA 4Q0BA 3NBPA 4PY5A 1NKCA 1TVRA 3KTQA 4M45A 4Y1DA 3NFAA 4OKKA 1KLMA 1RT3A 5C24A 4FM2A 4AILC 3V6DA 4ZTJA 1S1WA 2KZZA 3OJSA 1C6VA 3OYIA 3SV4A 1QSSA 2G8HA 2E6LA 3DRRA 2A1SA 3HVRA 4B9SA 1HPZA 1HQUA 3IG1A 3HXMA 1X1PA 4C8KA 4DWIA 3OY9A 3OYCA 1TGOA 3SUNA 2HHXA 4RW8A 4DS5A 1XHZA 3RMCA 3KKRA 5SZTA 4KKOA 2F96A 3NH1A 2XY7A 1ITGA 3RR8A 2FBYA 3CM5A 4FJ8A 4B9TA 3I0RA 1BI4B 4KFBA 4I7FA 2P51A 4JLHA 3ZCMA 4HUGA 3CFOA 1XHXA 1O1WA 4E19A 4DQQA 2OPPA 2YKNA 1ZBHA 3KJVA 4JS4A 4TSXA 2BANA 4ZTFA 2VWJA 5EU7A 5HRRA 1LWEA 4FJMA 3SUPA 2VWKA 5DK5A 3WNGA 2YKMA 3NF8A 5CZ1A 3QO9A 3THVA 4CHQA 1SL2A 4I9QA 4KHWA 3WNFA 3VQ5A 4CHNA 4GMJB 4B8AB 1KFSA 4LSLA 3ZSRA 1VRUA 5K14A 3MECA 1JKHA 1JLCA 1F21A 1JLAA 2B4JA 1CLQA 1RBVA 4DU4A 1B9FA 4E1MA 4DFPA 4HVJA 1RT1A 2XRIA 1NK6A 4N41A 3ZSWA 2BE2A 3KLIA 3PX4A 1ASWA 3OS0A 1QQCA 3KK2A 4DTMA 4BE2A 3V9SA 2HW3A 4FJJA 4CECA 3P5JA 4BACA 1RDDA 2DFFA 3AO4A 2KFNA 3OYEA 2HHQA 3L2UA 4F2RA 1LWCA 1S1UA 4IG0A 4CEAA 4G1QA 3AA5X 1BL3A 1BIZA 3CFPA 4FLZA 3LZJA 1L5UA 3PUFA 4J2AA 1QE1A 2OPQA 3CG7A 4Y1CA 3QNNA 2HHSA 3LP3A 1NK8A 3AO2A 3ZT1A 2P5OA 4E7JA 1CZBA 2OPSA 3ZT2A 3QEWA 4M3TA 2YNIA 1ASVA 1D5AA 4BE1A 3DLRA 4AHVA 2G8VA 1REVA 4NCGA 4CJRA 3DLBA 3NH2A 4K8XA 3A2FA 3AVCA 3AO3A 3V1QA 4W5QA 1IKVA 3OYMA 5J2MA 2F8TA 1IKXA 1BCMA 3LP0A 4CIEA 3QEPA 3VQDA 4KI6A 3MEEA 4HUFA 3K58A 1JLFA 4HUEA 5CYQA 1A5XA 3TAFA 4CJKA 1TK0A 1EKEA 3LZIA 3VA3A 4DTXA 1IG9A 1LAVA 3MEDA 4C8NA 1I3AA 4FJGA 2Z1IA 1NK4A 2IDOA 3ZT0A 3ISNC 3AVKA 3IRXA 4DQIA 2YHBA 1TL1A 1WN7A 3AV9A 4NYFA 3VQPA 3K5MA 1SKSA 1T7PA 4KHUA 4Z0UA 4F8RA 4IFYA 1XWLA 4XIUA 3OYJA 3SQ4A 3HYFA 1EX4A 1FK9A 3ZT4A 4KB0A 1LWFA 3L2QA 5FDLA 4QAGA 5HRSA 3CQ8A 1C0UA 4BDZA 4O4GA 3V1OA 4PQUA 1J53A 4DTPA 3JYTA 1KSPA 4CEDA 2ZE2A 2DFEA 2PYLA 1VSMA 3MXJA 3VQBA 4CK2A 3RMAA 5HBMA 1RDAA 3L2RA 4B9LA 4IDKA 2XY5A 3SZ2A 2G8WA 2HMIA 3VN5A 3KK1A 3LAKA 1KVCA 1UA0A 1HQEA 4DMNA 1J9AA 2HNYA 2FBXA 3G10A 2RF2A 4O55A 5J1EA 3HJFA 3HP6A 4E7HA 4H4MA 5JS1A 5HROA 3OYNA 3L2WA 4DSFA 3QEIA 2PY5A 3SNNA 1QSLA 3HSTB 1HYZA 4KB1A 2QKKA 3EZ5A 3HPOA 1SKWA 4M41A 1TKXA 1HNIA 2R7YA 2AJQA 2KQ2A 3I8DA 3L2VA 4Q5VA 3SCXA 1S9GA 1S1TA 4JRQA 4W5NA 2YNHA 1KVBA 4CJLA 4CFDA 3SPZA 3OYGA 3OYHA 3L3VA 3TR8A 4DTJA 4KHYA 4E1NA 2B5JA 2Y1IA 3TI0A 1T03A 3AO1A 4DTUA 4DU3A 1KRPA 2JLEA 4CIFA 1RCHA 3ZSQA 4CF8A 2ITGA 1Z26A 3VA0A 4E3SA 4KTQA 2IAJA 4CJ3A 4HTUA 1RT2A 3ALYA 3ZSOA 4CERA 4NYNA 4UQGA 1RT4A 4IFVA 1NK0A 1D8YA 3NGIA 3FFIA 4AHSA 1RBUA 3LALA 4HCBA 1WSHA 3SYZA 1GOAA 3TWHA 3HP9A 4O0IA 1UAXA 3TAPA 3DOKA 1JLGA 1SL1A 1Q9YA 4DTRA 3PY8A 1TAQA 4K8ZA 3BDPA 3LWMA 3DRSA 1RDBA 3LDSA 3P83D 2HNZA 4N5SA 3PX0A 3RRGA 2YHAA 3KLEA 4QOZB 4AHCA 3VQ4A 2W42A 3T3FA 4FM0A 3HPGA 2FBVA 3NCIA 4PWDA 1G15A 1HYVA 3CM6A 1U4BA 2I5JA 1Q8IA 4O5BA 2VG5A 1NK9A 3NF6A 5I42A 1L3TA 3F9KA 3DRPA 4IKFA 1BISA 1BCOA 1D9DA 4M3XA 4FXDA 2JGUA 1JLEA 1U45A 1KFDA 3RMDA 1RTJA 3LWLA 3ZSYA 3S3MA 3HVTA 3T19A 4DSKA 1LAWA 5HRPA 3SUOA 1T05A 4LH5A 3K59A 4E89A 3OYAA 4FJNA 1S6QA 1KTQA 5I3UA 4NCAA 3LPTA 3L8BA 3K5OA 2XHBA 3VQEA 1WSGA 3T1AA 4CJ5A 1D9FA 2KTQA 4CEQA 3UIQA 3DYAA 5FROA 1SV5A 2WONA 4F2SA 1JXEA 2Y1JA 4ELUA 4B9VA 4M3RA 3S3OA 1SKRA 4WE1A 3TABA 2IC3A 3OYLA 2QKBA 2E6MA 2OZSA 4ELVA 2VG6A 5C25A 1IH7A 1RT6A 2VG7A 4OGEA 3OS1A 3G0ZA 3SQ0A 4CGDA 1ZBUA 5FRNA 1BHLA 1N5YA 3HO1A 2QXFA 3BGRA 1QHTA 4B9UA 4Z4EA 1WAJA 1QTMA 5KGXA 4FLUA 4CHOA 4C8MA 4W5RA 3CFRA 4KRFA 3QERA 3LP1A 1U47A 2IGIA 4KAZA 5T7BA 2DY4A 4FYDA 2PYJA 2EHGA 3HL8A 1RTIA 2X74A 1S1VA 4KHNA 4GVMA 4AHRA 2BDPA 2RPIA 1TKZA 2O4GA 1KCFA 3LPUA 3QNOA 2P5GA 4DQPA 1NJYA 3SQ2A 4F3OA 2ZD1A 4CEEA 1VRTA 1WSJA 3SJJA 4M3UA 3K57A 2DFHA 3OYKA 3WNHA 1MU2A 4YFUA 1FKPA 1WAFA 1WSIA 2Z1GA 4CJVA 3AA3A 4N47A 1RBSA 4KTWA 2RKIA 5CZ2A 1CXUA 1UWBA 4DFJA 4DF4A 4FW2A 4CJQA 1TK8A 2HVIA 3ITHA 1WNSA 4FLTA 2HVHA 4CFCA 5J2NA 1JXBA 1VSJA 4OGCA 1C1CA 3AA4A 4Z4CA 2OA8A 5CYMA 3AVBA 3EYZA 4CJTA 1WLJA 2XY8A 3ZSZA 3S9HA 1RTDA 4KPYA 4NCBA 5KRTA 2HHVA 3SQ1A 3VQQA 2ETJA 4FK4A 4JS5A 1VSHA 2QK9A 2B6AA 4KO0A 2Z1HA
chains in the Genus database with same CATH superfamily
2OYIB 4M3LA 4LY7A 4A5AA 3ULDA 2HBKA 5GAHP 2FFDA 3MN9A 3NF9A 3M1FA 4FZXC 3ULEB 1VQ5N 4W5OA 2XU6A 1RFQA 1FZCB 2XO7A 4CF2A 4FJ7A 5CHXA 3G71P 2YI1A 3IS9A 4BRQA 1L0NE 4JI7K 4CEBA 3FZHA 3TAQA 2WPRA 1SQPE 3E01A 5CY4A 1QL1A 1J2JB 1K8AQ 2Z1JA 2QM1A 3H08A 1U7MA 4JKCA 1DLOA 3L74G 2E4LA 3OYBA 3L4FA 1VQ4P 2HHUA 4ASWA 4LGDE 3FE1A 3SAGA 3O6WA 4HYTB 1TUUA 2X78A 3VQ7A 3CERA 2V52B 3VERA 5C0YA 1BQMA 2NUBA 4JK8A 4CJSA 4LF6K 1VQ8P 4DV5K 1SQXJ 3OYFA 2IYPA 2VQFK 1T8ZA 2HBMA 1Q90D 1YITP 1W5CE 1T2KD 4XH1A 3WNEA 3TYYA 4JI3K 1NAYA 2Y0DA 1E4FT 3WXLA 4L74A 1IV0A 2D2CC 1X3NA 1A5VA 4ASVA 1WSFA 3WQUA 3NAEA 2FYZA 5AVZB 3HPHA 5BRHA 1FKOA 5JS2A 4CEOA 5AZIA 3L4QA 3O1BA 4U7JA 3DLKA 1PPJG 4RW4A 5AQTA 1FXXA 3C6UA 4RWTA 3HE5A 3O3GA 3K5BA 5HLFA 4DS4A 2O4IA 1PZQA 2Q31A 4ILHA 3ZT3A 1SQXD 3A3YB 1JCGA 2F9TA 1IFJA 3NHGA 3ID8A 2WSCJ 1Y64A 5KPZA 2ZGYA 3KPEA 2IOCA 3AE9C 3O4NA 2E74D 2KOGA 3EL2A 1S6PA 4DTNA 3TU5A 4CK3A 1R0AA 1I94K 5C10A 4A5BA 4FJHA 3HD7A 1GMJA 1LTJA 3CC2N 2LSNA 4FJKA 1KV4A 2WPVB 4B1XB 4OLBA 4R5PA 1SL0A 3SWFA 4FCYA 5AQLA 4JKDA 3JCUH 1ZV8A 4JF7A 1GK4A 3S3NA 1XC9A 2YNFA 4DR1K 3B6PA 1IKYA 1OVYA 2UYTA 2P9KA 4R79A 5GIPA 1GOCA 1VQLN 5AVQB 1FZBA 1N7SB 2IYOA 3CJ9A 2EX3A 3DLHA 3L35A 3AO5A 2G8KA 4CF1A 5APTA 1Y8AA 2W83C 5C39A 3L71J 1IJDB 4JQ0D 5E79H 3WU2E 4RG8A 1N34K 2NPSD 3KK3A 3F73A 5AW4B 4KH5A 3O3HA 4BRGA 4EFHA 2O8BB 5JVGL 5KAIH 3IUCA 4U3FG 1MWMA 2WQYC 4W5TA 4DSLA 1RF1C 2W6LA 4BRYA 1RY3A 3A5LC 4CJUA 3CCEP 2R32A 4MN4C 1LP1A 4M42A 3H32B 4CZLA 2K1AA 3ZDMA 5B8HA 3OVNA 4BREA 3NH0A 5FRNA 1VPCA 1BE3E 1DTQA 4CBXA 3RL0B 1VAZA 4AH9A 1NGBA 1KILB 2JJLA 1AVYA 3C94A 1TK5A 3TDKA 1NJWA 3AVLA 1NKEA 3AGRA 4CFAA 4CEZA 3OJAB 1BDCA 4C8OA 3QLHA 1WSEA 2ZJSE 4M3YA 4Y99B 5AQJA 2WSFJ 3N7NA 1N36K 1SFCA 3L37A 2D0CA 4ICLA 3AVFA 4KT0J 1VQON 2GV9A 2NLXA 1AV1A 1IO2A 3OBWA 2G8UA 5ADXA 1FZAA 3DOLA 4I2QA 3VMZA 1RT7A 2J58A 1JO5A 4YOUA 2CGKA 1L3UA 1GLFO 4N6JA 3H3OB 4FJIA 4CHPA 3EY1A 3ZYYX 3SK3A 3QESA 3KLGA 4YOWA 1NGMB 2K88A 3GBTA 4PA1A 3TAMA 2W6BA 4OVLA 3RRHA 4AQRD 1NJXA 1P84I 4NXNK 4G9ZA 1JMBA 1T3UA 3SMPA 4H13B 2NRHA 3BY5A 1VQ7N 2PZSA 1M1KO 1BA1A 3K5LA 3NGZA 3H1IG 4B1VA 2R3SA 4N76A 2K37A 1HUXA 4OPHA 3AVAA 1VQPN 2DPNA 4UB6E 2W41A 1P84E 2O01H 4BWJA 2POHA 1HKGA 1NTZE 1HJRA 4OJRA 4A61A 3AY9A 4Q0BA 1SQBG 3EFFK 4PJ0E 1YJWP 4B3RK 1FAVA 4Y1DA 1BG3A 1KLMA 4OKKA 4FM2A 4AILC 4ZTJA 1NO4A 5H2FE 3FGUA 5KLIC 3OYIA 2W6AA 4HTLA 5AQOA 1QSSA 2K3RA 2A1SA 2WT7B 2CPBA 2YHXA 2QEXN 1HQUA 5JMVA 4QMAA 4H44D 4GKGA 1TGOA 2HHXA 3O6QB 3D71A 2ZT9B 3KKRA 5SZTA 5KLVG 1NKZB 1ITGA 2XKMA 4ZMDA 4B9TA 4KHPK 1JEKA 2KXPB 4L75A 1BI4B 2OTKE 3CFOA 3T97A 1XHXA 1ZBHA 2OPPA 2YKNA 3KJVA 4PKGA 2QJYC 2BANA 3JAMO 1Q82Q 3THYA 1YBKA 2JWAA 4I7ZB 2GWKA 2OTLN 3L70G 5CZ1A 3HRNA 3H1HJ 1HNWK 3WNFA 3VQ5A 3L73G 2KSEA 4GMJB 4LSLA 5C12A 5K14A 2YX6A 4N78E 3WT0A 1JLAA 1CLQA 1SQBK 1T6AA 2YXRB 5CCGC 1RT1A 2XRIA 4FWLA 3KLIA 1PGOA 1ASWA 1HUCA 3TNUB 5L8RJ 4DTMA 4F9OA 2VYPA 4BE2A 4FJJA 3P5JA 1QX8A 4WFNL 3AO4A 3H1HD 1NBWA 3AECC 3L2UA 2B87A 4RESB 4LF4K 4IG0A 2WUSA 3QBWA 3AA5X 1BL3A 4G1QA 4FLZA 1SVFA 5GTHH 1L5UA 1ZN5A 1QE1A 1PGPA 2OPQA 5KLVK 2HHSA 3H1LG 5AQIA 3ZT2A 1W2BO 2G8VA 1QZ5A 3DLRA 2UUBK 5LJWA 4NCGA 2E88A 3A2FA 3OYMA 4OGQB 3V1QA 3CCQP 3I33A 5M1FA 1RF1A 1HJBA 3KDPB 1HJOA 1SZ2A 1BCMA 5BREA 3VQDA 1SQQJ 4LF9K 1YJ9N 1TU3F 2P10A 1NGEA 2L5GB 5E26A 1FC2C 4O5FA 2FKWB 3LZIA 3VA3A 2IFMA 3MEDA 1I3AA 1LJ2A 1ZRTE 3H25A 2FXMA 3MD0A 3AE3C 3AVKA 3IRXA 4O8KA 2YHBA 1TL1A 3VQPA 3K5MA 3F5HA 4YXDC 2HODB 3FZLA 1NH4A 1SQQD 5FPEA 5GADP 1XWLA 4CZHA 2QWOA 4DUZK 3ZT4A 1OX3A 3H1KD 1G99A 5HRSA 1QEXA 2PGDA 3E9OA 4NPDA 3SSUA 2IZ0A 3C7NB 2QTDA 4CEDA 3MHVA 2PYLA 5JLHA 3MXJA 2JP3A 3O08A 3P8MC 2G8WA 3AE5C 1ZXOA 4BRIA 5BPNA 3ENHA 3LAKA 4OWFA 4BR9A 2FLOA 1UA0A 1KQSM 4DMNA 3RK3C 2KKZA 1GLLO 3G10A 4O55A 1A02F 3RK2B 2BASA 2JO1A 4FO0A 4H4MA 1MKMA 3CMAN 3L2WA 3E9LA 3O9RA 1E3MA 5LL6Z 1YTZI 1KC8Q 4IOXA 3HSTB 3CX5E 3BCCG 2E76D 4KB1A 2FYUG 2KB7P 4H0LD 1HNIA 4U67L 2P9PB 1NLVA 3WMM0 1KMIZ 1WBBA 2IBZG 2R5DA 4CJLA 1KVBA 2XZRA 1OVVA 1LTBC 2CPSA 3L3VA 2B5JA 4WY4B 3KZBA 4DU3A 2NRWA 1M56D 4CZKA 2HPCB 3VOPA 2BTFA 4CF8A 1Z26A 4E3SA 2J4RA 3U59A 5APVA 1H0TA 3SBTA 3E9PA 2P9IB 3C1LA 1HWTC 5AQKA 3ZSOA 4CERA 3QFUA 2M5AA 1Q18A 2QA4P 3FFIA 1NGFA 1U2VB 4XFJA 1KN7A 2AXTH 4E1JA 2ZJRL 1WSHA 1MUUA 4MLHA 4EOTA 1UAXA 4Z4IA 4BR0A 4K8ZA 3PY8A 1IFPA 2OTJN 3BDPA 3P83D 1BWFO 3MWTA 3RRGA 2H88C 2HF4A 2Q97A 4AHCA 3T3FA 1YQ3C 1N8RQ 5AQGA 4A2AA 2YCHA 1QZ6A 3CXHD 4PV1C 3CM6A 1VDFA 1Q8IA 1RHZB 3NF6A 3A0IX 3VMFB 3PSIA 3VTPC 2NZTA 1MFZA 3CC7P 3B8EB 1EZVD 1BCOA 1ILYA 1U45A 3BZCA 1RTJA 5APUA 2IDBA 1KB9D 3H1JJ 4IO9L 2WTUA 3SUOA 4YY3K 3K59A 2JWKA 1JY3N 4JKBA 4NCAA 1L0NG 3LPTA 3DLLL 2HR3A 4LFBK 5CHIA 3QB0A 3UIQA 1SQPG 2V7YA 3WXJA 1SV5A 2P9LA 5BU8B 3K9KA 5AZJB 1HNXK 5CCGA 1VQ5P 4ELUA 3U8XA 4B9VA 2V51B 4M3RA 3S3OA 4WE1A 3SQ0A 2VG7A 3OS1A 3Q2YA 2FYNC 3M9BA 1N33K 1IJJA 4OPAA 5BN9A 2GUSA 2A06D 1EDIA 1URQC 2QXFA 1L4AB 1JCEA 3U9DA 3SAHA 4Z4EA 5KGXA 5BRDA 1YYCA 4CHOA 4FLUA 3I8BA 5FPMA 3CFRA 1J5EK 4KRFA 1HKCA 5KJ7C 1USEA 2K9JB 5B5EH 1MA9B 2E75B 5T7BA 1AJYA 1VQMP 4H0PA 1IK7A 3TTCA 1RTIA 3UKUA 4KHNA 1XUPO 3SFDC 4JKGA 4CEEA 1LTTC 3L72D 4FWPA 3PIOL 1HPMA 2Q1KA 3P31A 3OYKA 3TSIA 1WAFA 2QJPC 2W40A 2Z1GA 1NU1E 4N3YB 1L0LJ 1GTWA 3I55N 1NOHA 1LTAC 5CZ2A 1NMNA 1OMIA 3A5TA 4DF4A 1TK8A 1BDDA 3KXDA 2HVIA 1E4GT 1CI6A 1L0NK 2HVHA 4CFCA 1SQPK 3CI9A 3AA4A 2OA8A 3KVGA 2O8CB 4JK7A 3CCLP 4PKHA 3ZSZA 1S72N 2P67A 4RJTA 4DQ8A 3G6EP 3SQ1A 5KPRA 3L70E 3Q5PA 2RN0A 3DXMA 3B4SA 1L0LD 2QWPA 1XTGB 2HG5D 3EFGA 1ATRA 2O8DA 5AVVB 5GAGP 1YVUA 4ISGA 2AEFA 3HT3A 3CWBD 1C0TA 3L75J 4DTOA 3KLHA 2KS1B 3CCRP 5IWAK 1JCCA 4DV6K 3THWA 5DJUB 3VMXA 3DLGA 3RBXA 3L6QA 4C1NI 4KH4A 3PV8A 3SV3A 1YTZT 2ZFCA 3NDKA 5BVZA 1YVNA 1NTKE 3HE4B 3JS6A 3VQ8A 1S5JA 2QM8A 4NB4A 4DF8A 4ID5A 4CJFA 3IAYA 3AVHA 3L75D 1YF5L 3QFPA 4RW6A 2D0OA 4LSNA 4EIJA 3MK6A 4DR4K 1N7SD 2KK7A 1VQKN 3AE8C 1M7LA 3CPWO 1M1JC 1DTTA 2WSEH 1RGIA 2W6JH 5FPDA 1YTUA 1J1DC 1ZBFA 3KKSA 4RKUJ 2HMPA 3U3GA 2IVPA 4CGFA 4B3MK 3P1GA 3GMAA 1LWUB 3CJCA 2OZMA 4IG3A 1GL2C 5AJ3K 4HCCA 3O4WA 3PO5A 1BE3G 3OS2A 1YTAA 1BDGA 5CE3A 3FZFA 1NKBA 4HHTA 1ASUA 3PTZA 1NTMG 4E0DA 2HHWA 2KW4A 2PRRA 2P9UA 3O4QA 2NNWA 2YKQA 3CCMP 4K25A 1SQVJ 4CCHA 4J2DA 3B5NB 1W2BM 4BRHA 3NF7A 2O8EB 4OVNF 1USDA 1Q82O 4C23A 4K3AA 1GZLA 1U57A 3W0LA 2FXOA 3GF7A 4DFMA 2W6KA 2WZ7A 4ILJA 2R44A 3RL0D 2W8ZA 1DGKN 2AA4A 1VSEA 3V9XA 3L4IA 1SUQA 1KILD 1EDLA 4DG1A 1SQVD 3PO4A 3CL3D 1HNVA 3RL0C 4PHTX 1L2PA 5GTIE 3ZX0A 1KILC 1OW7A 3S9OA 1X9WA 3H1VX 1GLEG 4KHQA 4I6MB 2KNCB 4N56A 4YNQA 2IBZI 2F4VK 3K2PA 3H1JE 1TKDA 3LIEA 2XY6A 4BE0A 4WFBL 1H8AA 3ZSXA 1BCCD 2IS3A 3BCCE 3TARA 1VSLA 2FYUE 4EZ9A 2C9LY 4FZYA 4FLWA 2NRGA 3CC4N 3HOSA 1Z25A 3O9SA 2IBZE 4GW6A 3VF2A 3ZEUB 3VQ6A 3S1KA 3J81O 2G8IA 1JLQA 3P7KA 1MWKA 1U48A 2E1YA 4FPBA 3G4SN 1FZFA 2E5TA 2Y9ZA 1BU6O 1YT3A 2P9SB 3A8YA 4ISEA 5KGWA 1LNQA 3BZKA 2NRVA 1URQA 2M3BA 1RT5A 4FWQA 2XNXA 3U3YA 2KP8A 1ZBLA 3CCJP 2WOMA 5KJ7A 2YV0X 5KI6A 4B9MA 5IT9O 1S9KE 4H13D 3HI0A 1X9JA 1BUPA 3WUUA 4CHYA 4KI4A 1C1BA 1I39A 3ID6A 1LW0A 3O3FA 3R2PA 2PP6A 4H13C 2E2PA 4CJ4A 1ZR2A 1Y9BA 4CF9A 1KLNA 3UKRB 4FZZA 4B3TK 4TLFA 2Q3EA 2V7QH 3V5BA 2X6SA 1X79B 2E5LK 1ZBSA 1HRHA 5KTQA 1FW6A 2HSTA 4UY8O 3FZKA 1X9SA 3RWUA 1NJIQ 4ID1A 3MXIA 4YORA 4IFFA 4JAXA 3J80O 2N1TC 1OH5A 5JVHL 4H0XB 1B92A 3D45A 4FK2A 1HVVA 3HUSC 3N4PA 3NMUA 1NOZA 1G1IA 4FK0A 1LW2A 4CGIA 3GDQA 4CGJA 4FLVA 3THXB 4LF8K 1NTZK 2ZT9D 3ABVC 2H7HA 3M9QA 5AW8B 1Z05A 4AHUA 3D0PA 1PP9D 3WXMB 1UA1A 1YJNP 3R6MA 2Q36A 2RH0A 4NLCA 3TAEA 2H89C 2W90A 3FXDA 3GG2A 2NZ2A 3OA9A 1W9HA 3FFKB 4DUYK 2HHTA 3TGUD 1T8EA 1VSDA 4DV7K 2KHOA 5AVRB 4AF1A 1FJKA 4A62A 1SQKA 3BVHA 4EDFA 3KK7A 1QQNA 5EXWA 1CZAN 4DSJA 3L71G 2P7JA 1XI1A 1Q81Q 4KREA 2ZQBA 4RW7A 3D70A 4D6TE 1ZYQA 4A57A 4I2LC 3P8CE 5SWMA 1NG9A 3WU2H 3IDHA 3Q3DA 3IFRA 3KQGA 3NBPA 3RVCA 2C0XA 2GUPA 3V6DA 1T2KC 3NFAA 5C24A 1K9MO 1M1JA 3PSFA 1NVOA 4BY9C 1C6VA 4ISFA 2C0WA 1QVFO 2E6LA 2G8HA 3P4IA 3GOIA 1GL2A 3HVRA 2QG4A 4YOYA 4Y28J 4B9SA 3THYB 3IG1A 1XQSC 3WQTA 2FFDB 4W7ZA 3MTUE 3OYCA 5EY4A 3CPEA 4RW8A 1KQSO 5AVXB 2F7TA 4OGQD 4KKOA 4X62K 1P84D 2F96A 3HZ6A 3Q5RA 3SWKA 1NTZD 2ZF5O 3CM5A 4FJ8A 5C2DA 1KQLA 3I0RA 2E74C 2P51A 4DQQA 2YKOA 4AYCA 2VWJA 3BRVB 2KI7B 4FJMA 5H1SQ 5AQUA 3WNGA 3NF8A 4JI2K 5HL7L 4I9QA 3IF4A 4KHWA 4Y0WA 1ZW0A 3LDNA 2E8AA 4CHNA 1KFSA 3CCUN 3CCSP 1NWKA 3E7KA 1JLCA 2JKVA 3VEXA 1RBVA 3D2EA 2ZYAA 3V2PA 1B9FA 4E1MA 1KILA 2KSJA 4N41A 5BPLA 2WPSA 3ZSWA 4JYBA 3OS0A 4JI0K 2O8FA 4NPFX 2KZIA 4IFEA 4BR7A 3LW5H 1S4XA 3V9SA 1KTMA 3U9ZA 2HYNA 2O01J 1RDDA 2DFFA 1SLQA 2HHQA 4F2RA 1NGDA 1S1UA 2P9NA 2QRXA 2NPSC 2Q0RA 3WEEA 1WT6A 1PFIA 1BIZA 3EQ2A 1M90Q 5AZIB 3CFPA 3LZJA 5DM7L 3PUFA 2ZGZA 3ATVA 4BC2A 3QNNA 1NKNA 1FBMA 2EWSA 3EO3A 3ZT1A 4PY5A 2OPSA 4BC3A 5F0XA 1ASVA 3RK2D 4N78D 1NU0A 1HLUA 2F8TA 3AVCA 2KUBA 3AO3A 3D7EO 4M7YA 1PGQA 4UB6H 3LP0A 1P84H 3NXSA 5KKZC 1NTME 4BGBA 3HD7B 3H45C 4CJKA 3TAFA 3L74D 1LTJB 4PJ0H 1RQVA 2F9WA 4WY4D 1IG9A 1DH3A 5KAFE 1WRGA 3CETA 3JXUA 5H2FH 3FX0A 3C8VA 5M1PA 1DEBA 1WN7A 3CPWM 2NRXA 1NMDA 4IO8A 2P9KB 1ATSA 3I56P 3OYJA 3SQ4A 3IFMA 1AFOA 3HYFA 4L3QA 4KB0A 2MJZA 2AEJA 4X65K 4K0KK 3CQ8A 1HGZA 4CBUA 4EHUA 1C0UA 2N1TA 2HF3A 1T3JA 1WOQA 3V1OA 3V2NA 1J53A 3JYTA 3E1IA 2Q3IA 1PPJD 3HUSA 2ZE2A 4YXWH 1YIJP 3QDKA 3AARA 3VGLA 4CK2A 3ZLJA 4GV9A 5I9EB 1JUNA 3VOVA 2FSNA 2Q5UA 1ZRTD 4IDKA 1KVCA 4BRYB 4AQYK 4OX9K 4ZNCA 4LC1A 3FGAD 4IFMA 1VQ6P 2ZWHA 3MN7A 5J1EA 3HJFA 4DV2K 2Q2RA 2YHYA 5HROA 3PJSK 1LP1B 2YXQB 3R1XA 1VQNN 3QEIA 1HYZA 1TYQA 5E84A 2QKKA 3HPOA 1SKWA 3ENOA 2R7YA 1YHQN 1OIPA 4ILGB 1S1CX 4CD3A 3HOTA 1N32K 4W5NA 1KAYA 1DEEG 4JRQA 4JKEA 3TTDA 3OBYA 3SPZA 4FL9A 3OYGA 3TR8A 4KHYA 3FZMA 4E1NA 3TI0A 5DJTB 4BC5A 1KRPA 5BRFA 4U3FJ 1SQXE 4KTQA 4GKKK 4HTUA 1RT2A 2NRZA 1SFCB 4GT1A 4NYNA 4V19S 3MCPA 4DR7K 2K9YA 2GTDA 1Z6RA 3A2AA 1L4AD 1NU1G 4JI8K 3T1HK 3LALA 1GU4A 4IFDK 3DAWA 3SYZA 3EN9A 1NGAA 1SL1A 2IVNA 4H44C 3HP9A 3U1AA 1JLGA 2E75D 2G3AA 3LWMA 3LDSA 4KJMA 1RDBA 3DXKA 2YMYA 2HNZA 4BR4A 3AEEC 4U3FD 3PX0A 2JWLA 3IMXA 1FJGK 2W42A 5AQXA 1OFCX 2Q9IA 2FBVA 3I55P 1YQ4C 1G15A 4O5BA 2VG5A 5I42A 2Q1NA 3F9KA 2IPPA 3CQXA 1BISA 5FPNA 5BR9A 5M1BA 2A6AA 2YJFA 4FXDA 3PH0A 2UXDK 1VQ9P 3ZSYA 2ZYGA 4WYBA 3ZETA 1YI2P 4O8UA 5CJ0A 5HRPA 3OYAA 1N7LA 4UB8E 1S6QA 4JEPA 5I3UA 1VF5B 2WSFH 3HRGA 4H0OA 2XHBA 3M5RA 1D9FA 3D6YA 3MN5A 5AQZA 2WONA 1NTKG 1JXEA 1R5SA 2GWJA 4IDHA 1GDTA 1SKRA 1HBWA 1NU1K 3OYLA 2QKBA 1DT9A 2E5YA 5EOYA 4X66K 2VG6A 1RT6A 4GVEA 4OGEA 5AVYB 2QJKB 3G0ZA 1VQ4N 3L71E 2B9BA 1FOSE 4BRKA 1N5YA 2D2CB 3H1IJ 1QTMA 4LF5K 2UXCK 2NPSA 4A59A 1HJ0A 1VQ8N 1N73C 4W5RA 3C7NA 3CX5H 2VGMA 4BRNA 2FF3B 1U47A 1CSBA 1YITN 1MV8A 1GU5A 2PYJA 2A45G 2E2QA 3CHWA 3HBTA 3H1KJ 4TT3H 1S1VA 2LXCB 3CJ7A 3ENBA 2RPIA 5AQWA 4AHRA 3LPUA 1SQBJ 4QOZB 3D2FB 3P32A 1NJYA 2E2OA 4M3UA 1LCUA 3F89A 3SJJA 1Q86Q 1VHXA 3KWGA 4BRDA 1IK9A 1MU2A 1FU1A 1M8OB 4YFUA 1FKPA 1D7MA 3H1ID 1WSIA 1R59O 3AA3A 3ATUA 4U7BA 1NJIO 4KTWA 2OYHC 2RKIA 1EZVG 1NWQA 4CJQA 3W68A 1K8KA 4FOEA 4XH4A 1K73O 3RSEA 1GW3A 4IOIH 4B1UB 2I8DA 3AE4C 1SQBD 1JY3O 3VMAA 1OW6A 1NTKK 5KTBA 1JXBA 4GY2B 4EIAA 3AVBA 3CIPA 1RTDA 2XY8A 1LT9C 3LM9A 3S9HA 3UIAA 5MLCQ 4CZGA 1QVFM 2M8RA 4PKIA 4JS5A 2QK9A 4C1NK 1OZHA 4CZJA 4L73A 1KAXA 1NM1A 2B87B 2O01N 5AVTB 3CX5I 3B5ND 4NLBA 2L91A 3AVIA 1K6YA 3QIOA 3AEGC 1K8AO 3L73J 1QS4A 5TISE 2D0BA 3H1JG 5KLVD 3VQ9A 5JLFA 2FF6A 2FSKA 2X6NA 1OXZA 2M3EA 4J2BA 3HTVA 1JLBA 3LL3A 5APSA 1OH6A 3GHGC 4OPKA 4DV0K 1KFMA 2W27A 2ZAEB 2QI2A 3U6FA 5AVWB 1Q81O 4Z94A 2E76C 4KHSA 4GV6A 2UWJE 4O0JA 2QWMA 1TAUA 4H0LC 1RTHA 2FC0A 3L73D 1Q7YQ 3K9JA 3QIPA 3CCEN 4BRLA 3A0HE 1KXPA 3A0BE 2V7ZA 4WVZA 3OJUA 5KRSA 5CBNA 3H1LJ 3KZIE 3TANA 3F2KA 2WVRA 5AW2B 2BCCJ 4BC4A 1L3VA 2UXBK 3MX2A 4JRPA 2D1KA 1QGKB 2ZVNB 1R8EA 3K0SA 3U1CA 4CK1A 5APWA 4YOTA 1KVAA 2IX7C 4PUOA 3CCVP 3GE1A 4JKFA 3I0SA 3LP2A 5K5GB 2AXCA 1XTCC 5AW3B 4ZHRA 3H1LD 4PD4I 3V2QA 2BCCD 1WB9A 1QSYA 5J2QA 1GLAG 2GUVA 2OPRA 3VF6A 3OW2O 3V9UA 2FYUK 2I1JA 5AFUA 5J2PA 2A42A 1EQ7A 4E7IA 3QEVA 2P2UA 5CCHD 1RBRA 4BDPA 3PX6A 4FJLA 2I7NA 2VQEK 1Y47A 5FRMA 3AVGA 3AE7C 4B3OA 3B6OA 3A5OC 3VMYA 4PD4E 4BDYA 1NHLA 4BWMA 2G8FA 2KZMA 1GW4A 4QCLA 4CPGA 3R3LA 3V81A 3H1HE 2GUIA 2Y0CA 3LANA 4B1ZA 4ELTA 2Q7CA 3ASMA 3TAGA 2RKLA 3QINA 5TKYA 3CMEN 3IAOA 3M8QA 2O3JA 3I5CA 1BIUA 2PFUA 3AA2A 2Z5HA 5B66E 2A41A 4EP4A 5JICA 1HF9A 1X9MA 1H0TB 3DM2A 3L72J 3HTKA 1MFTA 4CE9A 1E5WA 1KAZA 2OYIC 1M90O 1JY2N 3H46O 4KV8A 3ZX2A 2Q3SA 5HRNA 2M5AB 4EAHD 3AAPA 3SI6A 1D8YA 1SAZA 3WUTA 2WSEJ 2YO3A 3NGYA 2YNGA 2KZJA 4D6TG 5KLIB 4C46A 1FZCC 4B1YB 2ASPA 1EXQA 4JD2A 3HK2A 4CZMA 1XMOK 1NGJA 1NYHA 1YJWN 2FBWC 3QETA 2Y0EA 1N73A 1NNEA 1H1VA 1G2CA 3NVMA 5AR0A 3IR9A 3GF3A 1N6QA 2WBNA 2H8PD 1FE6A 1NGIA 2BUPA 1SQQE 3BCCD 4B8CA 2F8SA 3QEXA 3J7ZO 3C95A 3MAQA 2QJYB 3V4IA 1RNHA 2ZM6K 1BGXT 2CH5A 4A2BA 5AW7B 3CYMA 4QS8A 2A45H 4F3TA 3CWBJ 3DMJA 1NGCA 5ELZA 4IOCL 2WSSH 4IWVA 3MMVA 4JBZA 2O1KA 4DZOA 1Y97A 1OH7A 2OYHA 2GELA 3RK3E 4X64K 3Q5SA 4OO1J 3KIOA 2D0AA 3VQAA 4C7NA 3R4YA 2WC9A 2ASOA 2KLAA 2P9LB 1CXQA 1BGYJ 2RN2A 4GOEA 1S9KD 1KFNA 1GOBA 1LT9A 2C9NY 4F4KA 4ZKUA 4YHHK 1K04A 5BN8A 2E42A 3N4QA 4RO0A 3T7ZA 4AM6A 4DB3A 1EP4A 4FJXA 3CC2P 3RR7A 1GLJO 4LH4A 3NFQA 3SFEC 4QS7A 4CIGA 4M63C 4CJ7A 3VP9A 1S9EA 4FVUA 1VL2A 4CGHA 1BGYD 1L0NJ 1BOTO 4OKEA 4CF0A 1PGJA 3UKUB 4Z4GA 1IO4A 4FW1A 5GTIH 5C42A 1VQLP 1SQPJ 4IBNA 4CJWA 4H4OA 4JKGB 5A2QO 4B1WB 2A45I 3GHGA 2KIKA 4O9BA 4DV3K 1EWRA 1T6CA 4B08A 2N9BA 2E20A 3MXMA 4CHZA 4KTZA 4J2EA 4OKJA 4Z4HA 4CEFA 3SPYA 3L36A 3MP7B 4KH6A 3JSMA 3CXHI 4DFKA 4FLXA 1UOCA 4DLGA 1B9DA 1N7SC 3RGUA 3CCQN 1L0ND 1CZ9A 1GD2E 4R4LA 3RTVA 1NAFA 2E1ZA 1NKCA 1SQPD 1EZVI 1TVRA 3KTQA 2IFNA 4M45A 1RT3A 5KQ8A 2V7QJ 2QWLA 3CXHE 2DW3A 5M1QA 3OJSA 1KB9I 1X9VA 1FZEA 3SV4A 3AE6C 1RH5B 3DRRA 3DXMB 1HPZA 4WF9L 1EWQA 3HXMA 4DWIA 4C8KA 1EZVE 2O8DB 2UUCK 1KYOI 2LR2A 3SUNA 4BRAA 2YJEA 4K35A 1LTGC 1S2EA 1XHZA 1KB9E 1S22A 5TKWA 1CZQA 3RR8A 2FBYA 1BCCJ 3P8CD 4I7FA 4JLHA 3LDPA 4E19A 1O1WA 3THWB 1KYOE 3HD7D 3VESA 1C0FA 4TSXA 4YDUC 3RK3B 2CK3H 4DV1K 5HRRA 4W80A 2JR8A 5M1OA 5DK5A 4J2AA 2UU9K 1VQOP 3SLCA 3QO9A 3FWNA 4CHQA 1S5LX 3THVA 4B8AB 4XH5A 3ZSRA 1VRUA 2Q6QA 1WMKA 1ZP0C 2R3CA 3UKRA 2B4JA 4Y99C 4J8FA 3CJBA 4HVJA 1EDKA 1NK6A 1S5LE 1NTMK 3USSA 1QQCA 4GODA 4L76A 1V4TA 1RF0C 4DOJA 4A7PA 4BACA 4JHDA 4DHYA 2KFNA 1C0GA 4KBOA 3E1RA 2OYIA 2FXPA 1VQ7P 3EE9A 3UB5A 3ULEA 2P9UB 4Y1CA 5AQYA 1YXQA 4LFCK 2D0PA 2P58A 4IEEA 1NOYA 3LP3A 1FZCA 1SQXG 1CZBA 1RE3C 4M3TA 1VQPP 1D5AA 4BE1A 4BRMA 1EDJA 4AHVA 1REVA 4H0VB 4CJRA 3VEVA 3NH2A 1Q86O 4K8XA 5AQNA 1IKVA 3CI5A 2QWNA 1SS6A 2GA1A 2QA4N 5LMNK 3BP8A 3GL1A 4HUFA 1FDIA 4PV1B 5CYQA 1A5XA 4YPCA 4BG8A 1BE3J 4FSVA 3MIWA 1EKEA 3LIDA 1M57D 1PP9J 1JTHB 1L0LE 1LAVA 3MDQA 3J8AA 3M91A 2LKMA 3OAKA 2QEXP 2IDOA 3ISNC 3BEXA 1N86A 4DQIA 4NYFA 4KHUA 3NTNA 4C7RA 4Z0UA 1SFCD 4IL6X 4F8RA 4H5RA 3TGUJ 4IFYA 1BSNA 3CC7N 3O5BA 3L2QA 1X8YA 1BE3D 3MUDC 2CGJA 1QQOA 4PQUA 2WFBA 4O4GA 4RTFD 1KSPA 2KYVA 5M1KA 2ZT9C 4IL6E 2DFEA 2FYNB 2OTLP 1KC8O 3VQBA 4EYYQ 1SQXK 1RDAA 3VEOA 3LW5J 3BF1A 5KPTA 3L2RA 4BVOA 2XY5A 1URQB 3OW2M 4PL7A 5AW6B 3SZ2A 3VN5A 3L75E 3KK1A 1HQEA 2HNYA 3M0AA 4E7HA 1OVQA 2GEMA 5JS1A 4I7ZC 3ZX3A 3OYNA 4OH8B 3CJ1A 1Q7YO 5AQVA 3EZ5A 2AJQA 1TKXA 4H5WA 2KQ2A 2MKVA 1J1EB 3I8DA 4FWRA 3SCXA 1S1TA 2QIWA 1OWAA 2I1KA 3TPQA 2YNHA 4CFDA 1VF5D 3AE2C 1VQMN 1Q2NA 2QJPB 4JI1K 4AUWA 3OYHA 2Y1IA 1NTZJ 3AO1A 3VGKA 4H5TA 4MO4A 2JLEA 3C0BA 4CIFA 1RCHA 1VF5C 3HM8A 2ITGA 3VA0A 1N7SA 1J6ZA 2IAJA 3LDQA 4CJ3A 1QVGO 5DM6L 1Z56A 4NO7A 2JWDA 3GG4A 1RT4A 1LTIC 4IFVA 1HH0A 1N8RO 2D2CD 4AHSA 1YJ9P 1RBUA 2QJKC 1GLDG 5ADXH 1QL2A 1GOAA 3TAPA 2OZSA 2DTUA 1KILE 5CMZA 1SQVE 2O8BA 4OGQC 4BGAA 3KLEA 1NGHA 1ATNA 3CCLN 2HLOA 4YOXA 2OYOA 1DD4A 3G6EN 3HPGA 4GOFA 1D4XA 5KAFH 5EX5A 3LM2A 2I5JA 1NK9A 3KYQA 4DJGA 2O1JA 5CJ4A 1JNMA 1U6ZA 3H32A 3DRPA 2A5XA 1BCCE 1IC2A 1AVOA 4BR2A 4NPEA 1KORA 4M3XA 4YDUA 1KFDA 3RMDA 3S3MA 3HVTA 5AQHA 1EXIA 2PBDA 4DSKA 1LAWA 1T05A 3PLAA 3M6GA 4LH5A 4LFAK 1GLBG 2OQQA 2QXLA 3TSPA 3CCRN 4FPAA 3RBZA 2HFED 2XDJA 2OARA 3S41A 4CEQA 2XNDH 4B86A 4F2SA 3CD6N 2AP1A 1M1JB 2OGUA 3PLNA 1S3XA 1R5LA 3TABA 2IC3A 1J1DB 3L74J 4WB4A 5EFWB 3HE5B 3CMAP 3PP5A 1EC5A 4IJNA 1GL2B 3CXCM 3KWIA 1AQ5A 1RF0A 1O13A 1XMQK 3HO1A 5M1NA 1HR0K 5AW1B 3VEWA 4HJGH 3Q7BA 2D4WA 3LP1A 3TTFA 1JMMA 2IGIA 3RK2C 4KAZA 4I1LA 2KLVA 2DY4A 2WPQA 3LDOA 4FYDA 4BR5A 1RE3A 3FXEA 4GVMA 1A02J 1LOTB 1KCFA 1TKZA 3C9IA 3SQ2A 3QBXA 1WSJA 1T44A 3WNHA 1HX1A 3CCMN 3MCAB 3NMDA 4WY4C 4K42A 3L71D 4N47A 4JKAA 2CGLA 3VENA 4EI2A 1UWBA 1IFDA 3V4QA 1H88A 4FLTA 2OTJP 5APXA 1FS0E 1PP9E 2A40A 3C6AA 3D2EB 3TSUA 3FLCO 1OKJA 1JCDA 1VSJA 5CYMA 3EYZA 4CJTA 4NCBA 1P8ZA 2O8FB 5KRTA 3SJHA 4GNIA 3JCUE 2HHVA 3VQQA 2ETJA 4WFAL 1VSHA 3H1HG 3TGUE 2WT7A 2WSCH 4KO0A 5J2MA 2P9NB 2LXBA 1VSFA 5FLXO 1UIIA 3MUDA 3WEEB 3M8PA 3SAFA 4DU1A 4DV4K 2YKPA 2B89A 4LD0A 3O6QA 5HP1A 2YIUB 3S4RA 1S1XA 4H8KA 3W67A 3OYDA 4B9NA 1VK0A 4CJEA 1BI4A 5E79E 1JY3P 5CR4A 3VTHA 3VETA 2AEMA 1BSHA 2BEZF 3CMEP 4UB8H 3TK1A 3MZWB 4DSIA 4WWIA 5KAIE 3LAMA 3KD1E 3N4XA 2FBTA 4EZ6A 4DT0A 1IFNA 4JNEA 2CH6A 1QLED 2OCEA 2E2NA 4M7XA 2BH1A 4H5NA 1JY2P 3MN6A 4FWNA 4MFBA 4CW7B 3CCJN 1NK7A 3BF3A 3B71A 3V1RA 2HB5A 5D3GA 1RILA 1SQQG 3KD5E 3TNUA 4BQZA 4MLEA 3PHLA 4LF7K 3CX5D 2VCPA 4DQSA 1RDCA 3H1KG 3EKSA 4IJAA 1C0MA 1QQMA 4E7LA 4OLAA 3A5NC 1Q9XA 1EETA 2UUAK 1L4AC 2H43A 2N1TB 5AW5B 1RDUA 1NK5A 1JL2A 2KFZA 4WQ4C 2OYQA 2ITMA 3H6PA 2VWBA 3BRTB 3HUSB 1DKGD 1V4SA 1FJPA 5LY3A 2E75C 1VSIA 4DSEA 1A5WA 3BUZB 3H1QA 4MQ3A 5EVZA 4YTPC 4OPJA 4BXLA 3IN6A 3V9ZA 3AVNA 3EZWA 3LDLA 3V9WA 3O9TA 2D5RA 4CVNE 3C6TA 4LC9B 1C1AA 1DD3A 2BGGA 3P38A 4M3ZA 4JKHA 4CD1A 5AW0B 1S72P 1TYQB 5HOOA 1JB0J 5APYA 5E41A 3D2FA 3G71N 1ZBIA 4CZFA 1YJNN 4HKZH 3RMBA 4H0TB 4PL8A 4CFBA 4EHTA 4FJ5A 2A1RA 2PAVA 1J5OA 3GLMA 4BWNA 3O8MA 2ATQA 3M06A 2HODA 1SQQK 4I2PA 3K5NA 5CCGD 2VGNA 3DLEA 1LT1A 3W3DA 5BPMA 5TISH 4K43A 4FLYA 1DX7A 1BQNA 1LV5A 1OW8A 1JL1A 4PD4D 2J5UA 3GW6A 4O44A 1VSKA 3A5MC 4FJ9A 3L74E 5F1XA 1J54A 1ESVA 3AAQA 2YO2A 4WCEL 3DXKB 3A7OA 1HYSA 3T97B 2FXUA 2H3GX 4JI4K 1IBKK 4HB1A 4CESA 1NJZA 4C8LA 2ASMA 3M3ZA 2PAJA 1IKWA 4QS9A 1KD1Q 1VQKP 4JYAK 1ZMEC 1JJ2M 2BCCG 3SBGA 3J7AP 3A0HH 3A0BH 3H3NO 2E74B 4Z4FA 3KZIH 5AFUH 2P9PA 1ZR4A 4AHTA 2HOEA 1G1JA 1NU1J 4JYCA 1EO1A 5AQFA 3NE6A 2HNDA 2ITAA 1X3MA 3HM9A 3D6RA 5KLVJ 1CW5A 3VQCA 3ZETB 4CBWA 1PPJE 3AVJA 4WY4A 4YOVA 2HPCA 1LWUC 3QWOC 1QVGM 4FWSA 3VGMA 4B3SK 1FOSF 3AVMA 5AVUB 2P9IA 1N2DC 3CLQA 4IZ9A 2J59M 3E1YA 5DMRA 2IZ1A 2PFXA 3L70J 5C15A 3JC22 3AEDC 1NU1D 1U2VA 4JN4A 3VTIA 1W0HA 3C65A 1JY2O 2P1JA 3CCSN 3B5NC 4DLEA 4FWKA 2A06G 3IKMA 1U04A 1U49A 5AQPA 4M3WA 3ZSVA 3II6A 4CGGA 2NPSB 1TV6A 4PD4H 3L3UA 1RF1B 2HHHK 4FOIA 1TL3A 4Z1MH 2QSIA 1RBTA 5KQDA 2G8YA 1XC3A 3DI6A 2YHWA 2WITA 3RK3D 4CJPA 3L70D 3O1WA 5GTHE 1NGGA 3MEGA 1OVRA 1JM0A 2IVOA 4FVMA 4LLHA 4FM1A 1NTKJ 3L72G 3WUVA 2Q0UA 2KLUA 2QWRA 4DQRA 5B66H 4DTSA 1TKTA 1PIXA 3G9RA 3VYIA 4EP5A 3CC4P 3F5TA 4E7KA 3PIPL 3KLFA 5KKZB 3O9UA 4MO5A 4I6MC 3F9MA 2GBZA 1HNZK 2B88A 2RHKA 4RW9A 2BEQD 3M8RA 1T6DA 1K8KB 3SUQA 1JOCA 3HSCA 5APQA 1W7AA 3G4SP 4ZKPA 5GIOA 1L3SA 4L8RB 1HMVA 4I9LA 3RSEB 3DWLA 3M8SA 4U3FE 5F2RA 5AZJA 2Z5IA 4BROA 1NTKD 4H0YB 2QWQA 4JK9A 3EEQA 3QMLA 1S1WA 2KZZA 4GKJK 1P90A 1JCFA 1L0LG 1X1PA 1L4AA 3OY9A 3V2RA 4WQ4A 4DS5A 4CI6A 3RMCA 3CWBG 2K9JA 1K9MQ 3I56N 3NH1A 4JV5K 5AW9B 2XY7A 5CCHC 4HH2A 3L0QA 4KFBA 5AVSB 4PV1D 3ZCMA 3R8EA 2V4HA 4HUGA 3OHRA 3G3ZA 4JS4A 4ZTFA 1X22A 5EU7A 1LWEA 4XA4A 3J7YP 1BGYG 1YIJN 3EKUA 4CZIA 3SUPA 2VWKA 1HGVA 2YKMA 3VEZA 1SL2A 1ZLLA 3L75G 1MDUB 2I7PA 1XNRK 4DR2K 2M0BA 3MECA 1JKHA 1RE4C 1F21A 3KHYA 1VQ6N 1QHAA 3O9QA 4DR3K 4DU4A 4DFPA 3FR0A 1KQFB 2A3ZA 2O8CA 2BE2A 4BRCA 4CZEA 3PX4A 1YAGA 3KK2A 3BCCJ 3WXIA 1OH8A 2FYUJ 2HW3A 4CECA 1L0LK 1KYOD 3NVKA 4AM7A 3OYEA 1LWCA 4CEAA 3G25A 3TSQA 1URQD 3CQYA 1IBMK 3H1IE 3CG7A 4H5VA 4JI5K 4GV3A 2YNYA 3H1JD 1NK8A 1PL5A 3AO2A 2P5OA 4E7JA 5KJ7D 3DJCA 4H44B 4WQ5C 2YNIA 3QEWA 4JPZB 3C6HA 2KS1A 3DLBA 2AXTE 5GINA 2FYUD 4W5QA 1AQTA 3H1KE 5LJVA 3MX5A 1IKXA 4CIEA 1SQBE 4IXCA 3QEPA 4KI6A 2IBZD 2E43A 3MEEA 3K58A 1JLFA 4HUEA 3HE4A 5AQQA 4MDAA 2YMKA 4BRFA 4FWMA 2QM7A 3VP8A 1TK0A 1J1EC 1SQVG 4DTXA 1GLCG 4C8NA 3CXHH 4FJGA 2Z1IA 2Z1HA 1NK4A 3ZT0A 1E79H 1ZOYC 3AV9A 1SKSA 1T7PA 3OTOK 4K41A 5KLVE 3M0DC 2HBJA 3CJAA 3O80A 4XIUA 1LWUA 1ZC6A 1HKBA 1LGHB 1BCCG 1EX4A 1FK9A 3HTKB 5AQSA 1LWFA 4BQLA 1KB9H 5FDLA 4QAGA 1X0TA 4GIFA 1VQ9N 4BVPA 2R5BA 2FFDC 5C2FA 4BDZA 2QE7H 3VN0A 1IG8A 4DTPA 2ZYDA 1YI2N 1KYOH 1VSMA 3RMAA 3UE5A 3B5NA 2N9YB 5HBMA 2ZJPL 3L73E 4JD2B 4B9LA 2O8EA 2HMIA 3CCUP 2OANA 1XNQK 1N73B 2NRRA 2Y9YA 1J9AA 2FBXA 2RF2A 1G2CB 3HP6A 3EWKA 4DSFA 2PY5A 3SNNA 1QSLA 3CF5L 1OVUA 2SPZA 2ZVOB 3AEBC 5B5EE 4M41A 1SQVK 1S5LH 1CI6B 1W97L 3L2VA 5AQMA 4Q5VA 1S9GA 2WWWA 3AEAC 1SP4A 1U7JA 3CD6P 4D6TJ 1M1KQ 4DTJA 3SMSA 1T03A 1HTLC 1T3VA 4I6MA 2KNCA 3MWPA 4DTUA 5TJHA 2OYHB 3ZSQA 3H1LE 4KPYA 5AQRA 2BCCE 1KZUB 2JEEA 3ALYA 2ZJQL 3QICA 4C7NB 4IOAL 2QW9A 1GL2D 3FWLA 4UQGA 1NK0A 1LT9B 4W7YA 3R9PA 4DCKA 3TF5A 3VF4A 3NGIA 3ZEUA 3B8AX 2ZXEB 1SS1A 4HCBA 4D6TD 2XV5A 1IBLK 3TWHA 1FDOA 4O0IA 1Q9YA 3DOKA 2P9SA 4DTRA 3U4LA 1TAQA 4KHXA 1PP9G 3DRSA 3EE8A 1PV3A 4DCHA 4N5SA 2YHAA 3VQ4A 1S3JA 5GAEP 4FM0A 2RE2A 3JSVC 3AEFC 1EXJA 3NCIA 2FSJA 4PWDA 1U4BA 1HYVA 4RCHA 1GK6A 3HD7C 5CCHA 3TGUG 1LTJC 1DIPA 1L3TA 4XE5B 4IKFA 1W2EA 3GHGB 1D9DA 2A06E 2JGUA 4DKWA 1JLEA 3BATA 1FZGA 2NRTA 5BR8K 2E76B 3LWLA 4H03B 1AA0A 1WBDA 4H0LB 3T19A 3T1YK 4NXMK 2QVAA 4WBAA 4E89A 4FJNA 1JTHA 2ZXXA 1KTQA 3L8BA 3WUHA 3K5OA 1IZNB 4IL6H 3VQEA 1WSGA 3T1AA 4BRPA 1RE4A 4CJ5A 4DR5K 2KTQA 3DYAA 5FROA 3L72E 2Y1JA 3M9HA 3Q1MA 1TUYA 1ZXGA 3O8ZA 1H89A 4GDOA 2E6MA 4ELVA 5C25A 1IH7A 3V6IA 2FY8A 3VPZA 2WMMA 1VQNP 3PRJA 3THXA 1BA0A 1ZBUA 4CGDA 1BHLA 3RL0g 1FDMA 3BGRA 1UIXA 3ITKA 1QHTA 2IIRA 4IEIA 1YHQP 2Z4EA 1WAJA 4B9UA 3QH9A 1KD1O 4C8MA 2GM4A 3QERA 2YIUC 3E66A 1EQYA 3OA7A 1NTZG 1K05A 3AE1C 3MGNA 2EHGA 3HL8A 3VEYA 2X74A 4WQ5A 2BDPA 3QNOA 2O4GA 2P5GA 4DQPA 4B9QA 1IFIA 4XEIA 2VRSA 4DR6K 4F3OA 2ZD1A 1VRTA 3K57A 2DFHA 1LTSC 1NTMJ 3D6ZA 3KHUA 4FWOA 3AGKA 3CCVN 4HWIA 3Q7CA 4MDBA 3T69A 4BG9A 3BASA 4CJVA 1IFMA 3H6EA 1RBSA 3CWBE 1CXUA 2GX9A 4DFJA 4FW2A 1YUWA 5CBOA 1WNSA 3ITHA 1RQUA 5J2NA 1SFCC 4R4MA 4OGCA 1C1CA 4Z4CA 2WTYA 3V4WA 1RDWX 1WLJA 1DEJA 3P39A 3WXKA 1NTMD 2JDIH 1BGYE 2N1TD 1KQGB 4JI6K 3M0DA 2RMZA 4FK4A 2HBLA 5BU5A 1WUAA 5LMUK 1BO5O 4JHDB 3SWYA 1MZ9A 2B6AA 1K73Q
chains in the Genus database with same CATH topology
2OYIB 4M3LA 4LY7A 3ULDA 2FFDA 3NF9A 4FZXC 4W5OA 2XU6A 1FZCB 2XO7A 4CF2A 4FJ7A 5CHXA 3IS9A 4CEBA 3TAQA 2WPRA 3E01A 5CY4A 1QL1A 1J2JB 2Z1JA 3H08A 1DLOA 2E4LA 3OYBA 3L4FA 2HHUA 4LGDE 4HYTB 2X78A 3VQ7A 1BQMA 2NUBA 4CJSA 3OYFA 1T8ZA 1T2KD 3WNEA 3TYYA 1A5VA 1WSFA 3NAEA 2FYZA 5AVZB 3HPHA 1FKOA 5JS2A 4CEOA 3DLKA 4RW4A 1FXXA 3C6UA 3HE5A 3O3GA 5HLFA 4DS4A 2O4IA 3ZT3A 3A3YB 1IFJA 3NHGA 3KPEA 2IOCA 3O4NA 2KOGA 1S6PA 4DTNA 4CK3A 1R0AA 4FJHA 3HD7A 1LTJA 2LSNA 4FJKA 4OLBA 4R5PA 1SL0A 3SWFA 4FCYA 1ZV8A 4JF7A 1GK4A 3S3NA 1XC9A 2YNFA 3B6PA 1IKYA 1GOCA 5AVQB 1FZBA 1N7SB 2EX3A 3DLHA 3L35A 3AO5A 2G8KA 4CF1A 5APTA 1IJDB 4RG8A 2NPSD 3KK3A 3F73A 5AW4B 3O3HA 4W5TA 4DSLA 1RF1C 1RY3A 4CJUA 2R32A 4M42A 3H32B 3OVNA 5FRNA 3NH0A 1VPCA 1DTQA 3RL0B 4AH9A 1KILB 2JJLA 3C94A 1TK5A 1NJWA 3AVLA 1NKEA 4CFAA 4CEZA 3OJAB 4C8OA 3QLHA 1WSEA 4M3YA 4Y99B 3N7NA 1SFCA 3L37A 2D0CA 4ICLA 3AVFA 2GV9A 1IO2A 2G8UA 1FZAA 3DOLA 4I2QA 3VMZA 1RT7A 2J58A 1JO5A 1L3UA 4N6JA 4FJIA 4CHPA 3EY1A 3QESA 3KLGA 4PA1A 3TAMA 2W6BA 4OVLA 3RRHA 4AQRD 1NJXA 1T3UA 2PZSA 3K5LA 3NGZA 4N76A 3AVAA 2O01H 4BWJA 2POHA 1HJRA 4OJRA 4Q0BA 1FAVA 4Y1DA 4OKKA 1KLMA 4FM2A 4AILC 4ZTJA 1NO4A 3OYIA 1QSSA 2W6AA 2A1SA 2WT7B 2CPBA 1HQUA 4GKGA 1TGOA 2HHXA 3KKRA 5SZTA 1NKZB 1ITGA 2XKMA 4B9TA 1BI4B 3CFOA 3T97A 1XHXA 1ZBHA 2OPPA 2YKNA 3KJVA 2BANA 5CZ1A 3HRNA 3WNFA 3VQ5A 4GMJB 4LSLA 5K14A 4N78E 1JLAA 1CLQA 1SQBK 5CCGC 1RT1A 2XRIA 3KLIA 1ASWA 1HUCA 3TNUB 4DTMA 4BE2A 4FJJA 3P5JA 3AO4A 3L2UA 4RESB 4IG0A 4G1QA 3AA5X 1BL3A 4FLZA 1SVFA 1L5UA 1ZN5A 1QE1A 2OPQA 5KLVK 2HHSA 3ZT2A 2G8VA 3DLRA 4NCGA 3A2FA 3OYMA 3V1QA 1RF1A 1HJBA 3KDPB 1BCMA 3VQDA 2L5GB 2FKWB 3LZIA 3VA3A 2IFMA 3MEDA 1I3AA 2FXMA 3MD0A 3AVKA 3IRXA 2YHBA 1TL1A 3VQPA 3K5MA 2HODB 1NH4A 1XWLA 3ZT4A 5HRSA 4CEDA 2PYLA 3MXJA 3P8MC 2G8WA 3LAKA 1UA0A 4DMNA 3RK3C 4O55A 3G10A 1A02F 3RK2B 2BASA 4H4MA 3L2WA 1YTZI 3HSTB 4KB1A 2KB7P 1HNIA 3WMM0 2R5DA 4CJLA 1KVBA 2XZRA 1LTBC 2CPSA 3L3VA 2B5JA 4WY4B 4DU3A 2HPCB 3VOPA 4CF8A 1Z26A 4E3SA 3U59A 5APVA 1HWTC 3ZSOA 4CERA 3FFIA 1WSHA 1MUUA 4EOTA 1UAXA 4Z4IA 4K8ZA 3PY8A 3BDPA 3P83D 3RRGA 4AHCA 3T3FA 3CM6A 1VDFA 1Q8IA 3NF6A 3VTPC 1MFZA 3B8EB 1BCOA 1U45A 1RTJA 5APUA 3SUOA 3K59A 1JY3N 4NCAA 3LPTA 3UIQA 1SV5A 5BU8B 5CCGA 4ELUA 4B9VA 4M3RA 3S3OA 4WE1A 3SQ0A 2VG7A 3OS1A 3M9BA 2GUSA 2QXFA 1URQC 1L4AB 4Z4EA 5KGXA 4FLUA 1YYCA 4CHOA 3CFRA 4KRFA 5KJ7C 5T7BA 1RTIA 4KHNA 4CEEA 1LTTC 3OYKA 3TSIA 1WAFA 2Z1GA 4N3YB 1GTWA 1NOHA 1LTAC 5CZ2A 3A5TA 4DF4A 1TK8A 2HVIA 1CI6A 1L0NK 2HVHA 4CFCA 3CI9A 1SQPK 3AA4A 2OA8A 3ZSZA 2P67A 3SQ1A 1XTGB 2HG5D 3EFGA 5AVVB 1YVUA 3HT3A 1C0TA 4DTOA 3KLHA 1JCCA 3VMXA 3DLGA 3PV8A 3SV3A 1YTZT 2ZFCA 3NDKA 5BVZA 3HE4B 3VQ8A 1S5JA 2QM8A 4DF8A 4ID5A 4CJFA 3IAYA 3AVHA 4RW6A 4LSNA 4EIJA 1N7SD 1M7LA 1M1JC 1DTTA 2WSEH 1YTUA 1J1DC 1ZBFA 3KKSA 3U3GA 4CGFA 3P1GA 2OZMA 1LWUB 4IG3A 1GL2C 4HCCA 3PO5A 3OS2A 1YTAA 1NKBA 4HHTA 1ASUA 4E0DA 2HHWA 2KW4A 3O4QA 2YKQA 4J2DA 4CCHA 3B5NB 3NF7A 1GZLA 4DFMA 2WZ7A 3RL0D 1VSEA 3V9XA 1SUQA 1KILD 4DG1A 3PO4A 3CL3D 1HNVA 3RL0C 1KILC 1X9WA 4KHQA 4N56A 4YNQA 3K2PA 1TKDA 3LIEA 2XY6A 4BE0A 1H8AA 3ZSXA 2IS3A 3TARA 1VSLA 4EZ9A 2C9LY 4FZYA 4FLWA 1Z25A 4GW6A 2G8IA 3VQ6A 1JLQA 3P7KA 1U48A 1NOYA 1FZFA 1YT3A 5KGWA 1URQA 2M3BA 1RT5A 2XNXA 3U3YA 2KP8A 1ZBLA 2WOMA 5KI6A 5KJ7A 2YV0X 4B9MA 1S9KE 4CHYA 4KI4A 1C1BA 1I39A 1LW0A 3O3FA 3R2PA 2PP6A 4CJ4A 1ZR2A 4CF9A 1KLNA 4FZZA 3V5BA 2X6SA 1X79B 1HRHA 5KTQA 1X9SA 3RWUA 4ID1A 3MXIA 4IFFA 2N1TC 1B92A 3D45A 4FK2A 1HVVA 3HUSC 1NOZA 1G1IA 4FK0A 1LW2A 4CGIA 4CGJA 4FLVA 1NTZK 2H7HA 3M9QA 5AW8B 4AHUA 3D0PA 1UA1A 3TAEA 1W9HA 2HHTA 1T8EA 1VSDA 5AVRB 1FJKA 3BVHA 4DSJA 2P7JA 1XI1A 4KREA 2ZQBA 4RW7A 1ZYQA 4I2LC 3P8CE 5SWMA 3KQGA 3NBPA 2C0XA 3V6DA 1T2KC 3NFAA 5C24A 1M1JA 1C6VA 2C0WA 2G8HA 2E6LA 1GL2A 3HVRA 4B9SA 3IG1A 2FFDB 4W7ZA 3MTUE 3OYCA 4RW8A 5AVXB 4KKOA 2F96A 3CM5A 4FJ8A 1KQLA 3I0RA 2P51A 4DQQA 2YKOA 4AYCA 2VWJA 3BRVB 4FJMA 3WNGA 3NF8A 4I9QA 4KHWA 4CHNA 1KFSA 1JLCA 1RBVA 3V2PA 1B9FA 4E1MA 1KILA 2KSJA 4N41A 2WPSA 3ZSWA 4JYBA 3OS0A 3LW5H 3V9SA 2HYNA 1RDDA 2DFFA 1SLQA 2HHQA 4F2RA 1S1UA 2NPSC 1WT6A 1PFIA 1BIZA 3EQ2A 3CFPA 3LZJA 3PUFA 3QNNA 1NKNA 1FBMA 3ZT1A 4PY5A 2OPSA 1ASVA 3RK2D 4N78D 2F8TA 3AVCA 3AO3A 3LP0A 3NXSA 3HD7B 3TAFA 4CJKA 1LTJB 4WY4D 1IG9A 1DH3A 1WRGA 1DEBA 1WN7A 3OYJA 3SQ4A 3IFMA 1AFOA 3HYFA 4KB0A 2MJZA 3CQ8A 1HGZA 1C0UA 2N1TA 1T3JA 3V1OA 3V2NA 1J53A 3JYTA 3E1IA 2Q3IA 3HUSA 2ZE2A 4CK2A 1JUNA 2Q5UA 4IDKA 1KVCA 4LC1A 4IFMA 5J1EA 3HJFA 5HROA 3QEIA 1HYZA 2QKKA 3HPOA 1SKWA 2R7YA 4W5NA 4JRQA 3SPZA 3OYGA 3TR8A 4KHYA 4E1NA 3TI0A 1KRPA 4KTQA 4HTUA 1RT2A 1SFCB 4GT1A 4NYNA 3A2AA 1L4AD 3LALA 1GU4A 4IFDK 3SYZA 1SL1A 3HP9A 3U1AA 1JLGA 3LWMA 3LDSA 1RDBA 2YMYA 2HNZA 3PX0A 2W42A 2Q9IA 2FBVA 1G15A 4O5BA 2VG5A 5I42A 3F9KA 2IPPA 1BISA 4FXDA 3ZSYA 5CJ0A 5HRPA 3OYAA 1N7LA 1S6QA 5I3UA 2WSFH 2XHBA 1D9FA 2WONA 1JXEA 1GDTA 1SKRA 1HBWA 1NU1K 3OYLA 2QKBA 2VG6A 1RT6A 4OGEA 5AVYB 3G0ZA 1FOSE 1N5YA 1QTMA 2NPSA 1N73C 4W5RA 1U47A 1CSBA 1MV8A 1GU5A 2PYJA 2A45G 1S1VA 4QOZB 4AHRA 2RPIA 3LPUA 3P32A 1NJYA 4M3UA 3SJJA 1IK9A 1MU2A 1FU1A 4YFUA 1FKPA 1WSIA 3AA3A 4KTWA 2OYHC 2RKIA 1NWQA 4CJQA 1GW3A 1JXBA 1JY3O 5KTBA 1NTKK 3AVBA 1RTDA 2XY8A 1LT9C 3S9HA 3UIAA 2M8RA 4JS5A 2QK9A 5AVTB 3B5ND 3AVIA 1K6YA 3QIOA 1QS4A 2D0BA 3VQ9A 2X6NA 1OXZA 4J2BA 1JLBA 5APSA 3GHGC 4OPKA 1KFMA 2W27A 3U6FA 5AVWB 4KHSA 4O0JA 1TAUA 1RTHA 2FC0A 3QIPA 3OJUA 5KRSA 3TANA 5AW2B 1L3VA 4JRPA 3U1CA 4CK1A 5APWA 1KVAA 2IX7C 4PUOA 3I0SA 3LP2A 5AW3B 1XTCC 4ZHRA 3V2QA 1QSYA 5J2QA 2GUVA 2OPRA 3V9UA 5J2PA 2FYUK 2I1JA 4BDPA 1EQ7A 4E7IA 3QEVA 2P2UA 5CCHD 1RBRA 3PX6A 4FJLA 5FRMA 3AVGA 4B3OA 3B6OA 3VMYA 4BDYA 1NHLA 4BWMA 2G8FA 2KZMA 1GW4A 4QCLA 3V81A 2GUIA 3LANA 4ELTA 2Q7CA 3ASMA 3TAGA 3QINA 3M8QA 3I5CA 1BIUA 3AA2A 2Z5HA 4EP4A 1X9MA 3DM2A 3HTKA 4CE9A 1E5WA 2OYIC 1JY2N 4KV8A 2Q3SA 5HRNA 3SI6A 2YO3A 3NGYA 2YNGA 4C46A 1FZCC 1EXQA 3HK2A 3QETA 1N73A 1G2CA 3IR9A 1N6QA 2H8PD 4B8CA 2F8SA 3QEXA 3C95A 3MAQA 3V4IA 1RNHA 1BGXT 5AW7B 3CYMA 2A45H 4F3TA 3DMJA 2O1KA 4DZOA 1Y97A 2OYHA 3KIOA 2D0AA 3VQAA 4C7NA 1CXQA 2RN2A 1S9KD 1KFNA 1GOBA 1LT9A 2C9NY 4F4KA 4ZKUA 2E42A 1EP4A 4FJXA 3RR7A 4LH4A 3NFQA 4CIGA 3VP9A 1S9EA 4CGHA 4OKEA 4CF0A 4Z4GA 1IO4A 4FW1A 5C42A 4IBNA 4CJWA 4H4OA 2A45I 3GHGA 4O9BA 4B08A 2N9BA 3MXMA 4CHZA 4KTZA 4J2EA 4OKJA 4Z4HA 4CEFA 3SPYA 3L36A 3JSMA 4DFKA 4FLXA 1UOCA 4DLGA 1B9DA 1N7SC 1CZ9A 1GD2E 3RTVA 1NAFA 1NKCA 1TVRA 3KTQA 2IFNA 4M45A 1RT3A 3OJSA 1X9VA 1FZEA 3SV4A 3DRRA 1HPZA 3HXMA 4DWIA 4C8KA 3SUNA 1LTGC 1XHZA 1CZQA 3RR8A 2FBYA 3P8CD 4I7FA 4JLHA 4E19A 1O1WA 3HD7D 4TSXA 3RK3B 5HRRA 4W80A 5DK5A 4J2AA 3QO9A 3THVA 4CHQA 4B8AB 3ZSRA 1VRUA 2R3CA 2B4JA 4Y99C 4HVJA 1NK6A 1NTMK 1QQCA 1RF0C 4DOJA 4BACA 2KFNA 2OYIA 4Y1CA 3LP3A 1FZCA 1CZBA 4M3TA 1RE3C 1D5AA 4BE1A 4AHVA 1REVA 4CJRA 3NH2A 4K8XA 1IKVA 4HUFA 5CYQA 1A5XA 3MIWA 1EKEA 3LIDA 1JTHB 1LAVA 3M91A 2LKMA 3OAKA 2IDOA 3ISNC 1N86A 4DQIA 4NYFA 4KHUA 3NTNA 4C7RA 4Z0UA 1SFCD 4F8RA 4IFYA 3L2QA 1X8YA 4PQUA 4O4GA 1KSPA 2KYVA 2DFEA 3VQBA 1SQXK 1RDAA 3L2RA 2XY5A 1URQB 3SZ2A 5AW6B 3VN5A 3KK1A 1HQEA 2HNYA 3M0AA 4E7HA 5JS1A 3OYNA 4OH8B 3EZ5A 2AJQA 1TKXA 2KQ2A 3I8DA 1J1EB 3SCXA 1S1TA 1OWAA 2I1KA 2YNHA 4CFDA 3OYHA 4AUWA 2Y1IA 3AO1A 2JLEA 4CIFA 1RCHA 3VA0A 2ITGA 1N7SA 2IAJA 4CJ3A 1Z56A 1RT4A 1LTIC 4IFVA 1HH0A 4AHSA 1RBUA 1QL2A 1GOAA 3TAPA 2OZSA 2DTUA 5CMZA 3KLEA 2HLOA 3HPGA 2I5JA 1NK9A 3KYQA 2O1JA 5CJ4A 1JNMA 3H32A 3DRPA 1IC2A 4M3XA 1KFDA 3RMDA 3S3MA 3HVTA 4DSKA 1LAWA 1T05A 4LH5A 2HFED 2XDJA 2OARA 4CEQA 4B86A 4F2SA 1M1JB 3TABA 2IC3A 1J1DB 4WB4A 3HE5B 3PP5A 1GL2B 1AQ5A 1RF0A 3HO1A 5AW1B 3LP1A 1JMMA 2IGIA 3RK2C 4KAZA 4I1LA 2KLVA 2DY4A 2WPQA 4FYDA 1RE3A 4GVMA 1A02J 1TKZA 1KCFA 3C9IA 3SQ2A 1WSJA 3WNHA 3NMDA 4WY4C 4N47A 1UWBA 1IFDA 3V4QA 1H88A 4FLTA 5APXA 1VSJA 1JCDA 5CYMA 3EYZA 4CJTA 4NCBA 5KRTA 2HHVA 3VQQA 2ETJA 1VSHA 2WT7A 2WSCH 4KO0A 5J2MA 1VSFA 3MUDA 3M8PA 4DU1A 2YKPA 4LD0A 5HP1A 1S1XA 4H8KA 3OYDA 4B9NA 1VK0A 4CJEA 1BI4A 1JY3P 3TK1A 4DSIA 3LAMA 3KD1E 3N4XA 2FBTA 4EZ6A 1IFNA 1JY2P 4MFBA 1NK7A 3V1RA 2HB5A 5D3GA 1RILA 3KD5E 3TNUA 4DQSA 1RDCA 4E7LA 1C0MA 4OLAA 1Q9XA 1EETA 1L4AC 2H43A 2N1TB 5AW5B 1NK5A 1JL2A 2KFZA 2OYQA 3H6PA 3BRTB 3HUSB 1FJPA 1VSIA 4DSEA 1A5WA 4MQ3A 4OPJA 3V9ZA 3AVNA 3V9WA 2D5RA 3C6TA 1C1AA 2BGGA 4M3ZA 5AW0B 5APYA 5E41A 1ZBIA 3RMBA 4CFBA 4FJ5A 2A1RA 1J5OA 2ATQA 3M06A 2HODA 1SQQK 4I2PA 3K5NA 5CCGD 3DLEA 4FLYA 1DX7A 1BQNA 1LV5A 1JL1A 4O44A 1VSKA 4FJ9A 1J54A 2YO2A 3A7OA 1HYSA 4CESA 1NJZA 4C8LA 2PAJA 1IKWA 4Z4FA 1ZR4A 4AHTA 1G1JA 4JYCA 3NE6A 2HNDA 3HM9A 3VQCA 1CW5A 3AVJA 4WY4A 2HPCA 1LWUC 1FOSF 3AVMA 5AVUB 1N2DC 3CLQA 2J59M 5DMRA 1W0HA 1JY2O 2P1JA 3B5NC 4DLEA 1U04A 1U49A 4M3WA 3ZSVA 3II6A 4CGGA 2NPSB 1TV6A 3L3UA 1RF1B 1TL3A 1RBTA 3DI6A 2WITA 3RK3D 4CJPA 3MEGA 4FVMA 4LLHA 4FM1A 4DQRA 4DTSA 1TKTA 3VYIA 4EP5A 4E7KA 3KLFA 4I6MC 2GBZA 4RW9A 3M8RA 3SUQA 1JOCA 1L3SA 5APQA 4L8RB 4ZKPA 1HMVA 4I9LA 3M8SA 2Z5IA 1S1WA 2KZZA 1X1PA 1L4AA 3OY9A 3V2RA 4DS5A 3RMCA 3NH1A 5AW9B 2XY7A 5CCHC 4HH2A 4KFBA 5AVSB 3ZCMA 4HUGA 3G3ZA 4JS4A 4ZTFA 5EU7A 1LWEA 4XA4A 3SUPA 2VWKA 1HGVA 2YKMA 1SL2A 1ZLLA 3MECA 1JKHA 1RE4C 1F21A 4DU4A 4DFPA 2BE2A 3PX4A 3KK2A 2HW3A 4CECA 1L0LK 3OYEA 1LWCA 4CEAA 1URQD 3CG7A 2YNYA 1NK8A 2P5OA 3AO2A 4E7JA 5KJ7D 3QEWA 2YNIA 3DLBA 4W5QA 1IKXA 4CIEA 3QEPA 4KI6A 2E43A 3MEEA 3K58A 1JLFA 4HUEA 3HE4A 2QM7A 3VP8A 1TK0A 1J1EC 4DTXA 4C8NA 4FJGA 2Z1IA 1NK4A 3ZT0A 3AV9A 1SKSA 1T7PA 3M0DC 4XIUA 1LWUA 1LGHB 1EX4A 1FK9A 3HTKB 1LWFA 5FDLA 4QAGA 4GIFA 2R5BA 2FFDC 4BDZA 3VN0A 4DTPA 1VSMA 3RMAA 3B5NA 5HBMA 4B9LA 2HMIA 1N73B 1J9AA 2FBXA 2RF2A 1G2CB 3HP6A 4DSFA 2PY5A 3SNNA 1QSLA 4M41A 1SQVK 1CI6B 3L2VA 4Q5VA 1S9GA 2WWWA 1SP4A 4DTJA 1T03A 1HTLC 4DTUA 2OYHB 3ZSQA 4KPYA 1KZUB 2JEEA 3ALYA 4C7NB 1GL2D 4UQGA 1NK0A 1LT9B 4W7YA 3NGIA 1D8YA 2ZXEB 4HCBA 2XV5A 3TWHA 4O0IA 1Q9YA 3DOKA 4DTRA 1TAQA 4KHXA 3DRSA 4N5SA 2YHAA 3VQ4A 4FM0A 3NCIA 4PWDA 1U4BA 1HYVA 1GK6A 3HD7C 5CCHA 1L3TA 1LTJC 4XE5B 4IKFA 1W2EA 3GHGB 1D9DA 2JGUA 1JLEA 3BATA 1FZGA 3LWLA 3T19A 4WBAA 4E89A 4FJNA 1JTHA 1KTQA 3L8BA 3K5OA 3VQEA 1WSGA 3T1AA 4CJ5A 1RE4A 2KTQA 3DYAA 5FROA 2Y1JA 3M9HA 3O8ZA 1H89A 2E6MA 4ELVA 5C25A 1IH7A 4CGDA 1ZBUA 1BHLA 1FDMA 3BGRA 1QHTA 4B9UA 2Z4EA 1WAJA 4C8MA 2GM4A 3QERA 3OA7A 3MGNA 2EHGA 3HL8A 2X74A 2BDPA 3QNOA 2O4GA 2P5GA 4DQPA 1IFIA 2VRSA 4F3OA 2ZD1A 1VRTA 3K57A 2DFHA 1LTSC 3BASA 4CJVA 1IFMA 1RBSA 1CXUA 4DFJA 4FW2A 3ITHA 1WNSA 5J2NA 1SFCC 4OGCA 1C1CA 4Z4CA 2WTYA 3V4WA 1WLJA 2N1TD 3M0DA 4FK4A 5BU5A 3SWYA 1MZ9A 2B6AA 2Z1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LY7 A;  3ULD A;  1VSF A;  3M8P A;  3NF9 A;  3AVI A;  1K6Y A;  4DU1 A;  4FZX C;  3QIO A;  1YVU A;  4LD0 A;  4W5O A;  5HP1 A;  3HT3 A;  1QS4 A;  1S1X A;  2D0B A;  1C0T A;  4H8K A;  3VQ9 A;  2XO7 A;  3OYD A;  3KLH A;  4CF2 A;  2X6N A;  4DTO A;  4B9N A;  1VK0 A;  4J2B A;  4FJ7 A;  4CJE A;  1BI4 A;  1JLB A;  3IS9 A;  4CEB A;  3DLG A;  4OPK A;  3TAQ A;  3PV8 A;  3SV3 A;  3E01 A;  5CY4 A;  3NDK A;  3U6F A;  4DSI A;  4KHS A;  2Z1J A;  4O0J A;  1TAU A;  3LAM A;  3VQ8 A;  1RTH A;  1S5J A;  3H08 A;  3KD1 E;  1DLO A;  2E4L A;  2FBT A;  2FC0 A;  4EZ6 A;  4DF8 A;  3OYB A;  4ID5 A;  2HHU A;  4CJF A;  3IAY A;  3AVH A;  3QIP A;  4RW6 A;  2X78 A;  4LSN A;  3VQ7 A;  4MFB A;  1BQM A;  2NUB A;  1NK7 A;  4CJS A;  3OJU A;  5KRS A;  3V1R A;  2HB5 A;  1DTT A;  3TAN A;  3OYF A;  1YTU A;  5D3G A;  1ZBF A;  1RIL A;  3KKS A;  1L3V A;  3U3G A;  3KD5 E;  4CGF A;  3P1G A;  2OZM A;  3WNE A;  4IG3 A;  4JRP A;  4DQS A;  1RDC A;  4HCC A;  4E7L A;  1C0M A;  3PO5 A;  4OLA A;  1Q9X A;  1EET A;  3OS2 A;  1A5V A;  1YTA A;  1WSF A;  4CK1 A;  1NK5 A;  1JL2 A;  3NAE A;  1NKB A;  2KFZ A;  2OYQ A;  3HPH A;  1ASU A;  1KVA A;  1FKO A;  5JS2 A;  4CEO A;  4HHT A;  4E0D A;  4PUO A;  3DLK A;  2KW4 A;  4RW4 A;  2HHW A;  1FXX A;  3C6U A;  3I0S A;  3O4Q A;  3LP2 A;  1VSI A;  3O3G A;  4DSE A;  4DS4 A;  1A5W A;  4ZHR A;  5HLF A;  4CCH A;  4J2D A;  2O4I A;  4MQ3 A;  3ZT3 A;  3NF7 A;  4OPJ A;  1QSY A;  3NHG A;  5J2Q A;  2OPR A;  3V9U A;  5J2P A;  3V9Z A;  4BDP A;  4E7I A;  3AVN A;  3QEV A;  1RBR A;  2IOC A;  3O4N A;  3V9W A;  3PX6 A;  4FJL A;  2D5R A;  1S6P A;  3C6T A;  4DFM A;  4DTN A;  5FRM A;  3AVG A;  4CK3 A;  1C1A A;  1R0A A;  3B6O A;  2BGG A;  4B3O A;  4M3Z A;  4BDY A;  4FJH A;  1VSE A;  4BWM A;  3V9X A;  2G8F A;  1SUQ A;  5E41 A;  2KZM A;  4QCL A;  2LSN A;  4DG1 A;  1ZBI A;  3V81 A;  4FJK A;  3PO4 A;  4OLB A;  1HNV A;  2GUI A;  4R5P A;  3RMB A;  4FCY A;  1SL0 A;  3LAN A;  4CFB A;  4ELT A;  4FJ5 A;  3ASM A;  3TAG A;  2A1R A;  3QIN A;  1J5O A;  3S3N A;  3M8Q A;  1XC9 A;  1BIU A;  2YNF A;  1X9W A;  3AA2 A;  4N56 A;  4KHQ A;  2ATQ A;  4YNQ A;  3B6P A;  1IKY A;  4I2P A;  3K2P A;  3K5N A;  4EP4 A;  1GOC A;  1TKD A;  2XY6 A;  4Z4I A;  3DLE A;  4BE0 A;  1X9M A;  3ZSX A;  3DM2 A;  2IS3 A;  3TAR A;  2EX3 A;  1VSL A;  4CE9 A;  4EZ9 A;  3DLH A;  3AO5 A;  4FLW A;  4FLY A;  1BQN A;  4CF1 A;  4KV8 A;  2G8K A;  4FZY A;  2Q3S A;  1LV5 A;  5HRN A;  1Z25 A;  1JL1 A;  4GW6 A;  3SI6 A;  2G8I A;  4RG8 A;  3VQ6 A;  3NGY A;  2YNG A;  3KK3 A;  3F73 A;  4O44 A;  1VSK A;  4FJ9 A;  1JLQ A;  1U48 A;  3O3H A;  1NOY A;  1J54 A;  1EXQ A;  1YT3 A;  3HK2 A;  5KGW A;  1RT5 A;  1HYS A;  4W5T A;  4DSL A;  4CES A;  3QET A;  1NJZ A;  4CJU A;  3U3Y A;  4C8L A;  1ZBL A;  2PAJ A;  1IKW A;  2WOM A;  2YV0 X;  5KI6 A;  4B9M A;  1N6Q A;  2DTU A;  4M42 A;  4CHY A;  4KI4 A;  1C1B A;  1I39 A;  4Z4F A;  4B8C A;  1LW0 A;  3O3F A;  2F8S A;  3QEX A;  3C95 A;  3OVN A;  4CJ4 A;  4AHT A;  3NH0 A;  3MAQ A;  1RNH A;  1DTQ A;  1BGX T;  4CF9 A;  3V4I A;  1KLN A;  3CYM A;  4FZZ A;  4AH9 A;  2HND A;  3NE6 A;  3HM9 A;  4F3T A;  2X6S A;  3DMJ A;  3VQC A;  1HRH A;  3C94 A;  1TK5 A;  3AVJ A;  5KTQ A;  1NJW A;  3AVL A;  1NKE A;  1Y97 A;  4CFA A;  4CEZ A;  1X9S A;  3RWU A;  4ID1 A;  4C8O A;  3QLH A;  3MXI A;  1WSE A;  3KIO A;  2D0A A;  3VQA A;  4M3Y A;  3AVM A;  1CXQ A;  1B92 A;  2D0C A;  2RN2 A;  3AVF A;  4ICL A;  5DMR A;  1GOB A;  3D45 A;  4FK2 A;  2GV9 A;  1IO2 A;  2G8U A;  4F4K A;  1NOZ A;  4FK0 A;  1LW2 A;  1W0H A;  4CGJ A;  4CGI A;  4FLV A;  2P1J A;  4DLE A;  3DOL A;  4I2Q A;  1RT7 A;  1L3U A;  1U04 A;  1U49 A;  4M3W A;  4AHU A;  1EP4 A;  3ZSV A;  3D0P A;  3RR7 A;  4CGG A;  4FJI A;  4FJX A;  4LH4 A;  1UA1 A;  1TV6 A;  4CHP A;  3L3U A;  3EY1 A;  4CIG A;  1TL3 A;  3QES A;  3KLG A;  1RBT A;  1S9E A;  3TAE A;  4CGH A;  3DI6 A;  4OKE A;  4CF0 A;  4PA1 A;  3TAM A;  1W9H A;  4CJP A;  4Z4G A;  4FW1 A;  4OVL A;  3RRH A;  3MEG A;  5C42 A;  1NJX A;  1T8E A;  4IBN A;  1VSD A;  2HHT A;  4CJW A;  4FVM A;  4H4O A;  4FM1 A;  4DQR A;  2PZS A;  4DTS A;  1TKT A;  4B08 A;  3K5L A;  4EP5 A;  3NGZ A;  3MXM A;  4E7K A;  4CHZ A;  4KTZ A;  4J2E A;  3KLF A;  4N76 A;  4DSJ A;  4OKJ A;  1XI1 A;  4Z4H A;  2GBZ A;  4KRE A;  3AVA A;  4CEF A;  3SPY A;  2ZQB A;  4RW9 A;  4RW7 A;  3JSM A;  3M8R A;  4FLX A;  4DFK A;  1UOC A;  4DLG A;  4BWJ A;  1B9D A;  1ZYQ A;  1HJR A;  3SUQ A;  4OJR A;  1L3S A;  4L8R B;  1CZ9 A;  5SWM A;  1HMV A;  4I9L A;  3M8S A;  3RTV A;  4Q0B A;  3NBP A;  4PY5 A;  1NKC A;  1TVR A;  3KTQ A;  4M45 A;  4Y1D A;  3NFA A;  4OKK A;  1KLM A;  1RT3 A;  5C24 A;  4FM2 A;  4AIL C;  3V6D A;  4ZTJ A;  1S1W A;  2KZZ A;  3OJS A;  1C6V A;  3OYI A;  3SV4 A;  1QSS A;  2G8H A;  2E6L A;  3DRR A;  2A1S A;  3HVR A;  4B9S A;  1HPZ A;  1HQU A;  3IG1 A;  3HXM A;  1X1P A;  4C8K A;  4DWI A;  3OY9 A;  3OYC A;  1TGO A;  3SUN A;  2HHX A;  4RW8 A;  4DS5 A;  1XHZ A;  3RMC A;  3KKR A;  5SZT A;  4KKO A;  2F96 A;  3NH1 A;  2XY7 A;  1ITG A;  3RR8 A;  2FBY A;  3CM5 A;  4FJ8 A;  4B9T A;  3I0R A;  1BI4 B;  4KFB A;  4I7F A;  2P51 A;  4JLH A;  3ZCM A;  4HUG A;  3CFO A;  1XHX A;  1O1W A;  4E19 A;  4DQQ A;  2OPP A;  2YKN A;  1ZBH A;  3KJV A;  4JS4 A;  4TSX A;  2BAN A;  4ZTF A;  2VWJ A;  5EU7 A;  5HRR A;  1LWE A;  4FJM A;  3SUP A;  2VWK A;  5DK5 A;  3WNG A;  2YKM A;  3NF8 A;  5CZ1 A;  3QO9 A;  3THV A;  4CHQ A;  1SL2