2P1JA

Crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRFVEMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase III polC-type
publication title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.140 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p1jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p1jA01
1IKYA 4HCCA 5KRSA 5CZ2A 1J5OA 3CYMA 1BCOA 4OPKA 1Z26A 4FM1A 3PO4A 1VSDA 4ELTA 3C95A 2F8TA 4CK1A 2GBZA 4RG8A 3DLBA 3ISNC 2FBXA 4DTXA 4M3UA 1DTTA 3LZIA 1HYSA 2PZSA 4M3RA 2YHAA 2G8VA 1I39A 1RTIA 1WSFA 1TK0A 1NKBA 4C8OA 3RTVA 1ASVA 1WLJA 3C94A 1QHTA 4OKEA 4CHOA 4FJJA 3C6UA 4LH5A 2HHXA 4PUOA 4DMNA 3OYLA 5C24A 2XY7A 1SL0A 2G8KA 4I9QA 1VSJA 4KTZA 3L2WA 4F8RA 4J2EA 4NCAA 1ITGA 2W42A 2O4IA 3LP3A 3V6DA 4O44A 5HRPA 1L3SA 1VSLA 3MECA 4CGJA 5J2MA 4YNQA 3OYCA 2FBVA 3M8SA 1KRPA 3FFIA 4AHVA 1BQMA 2WOMA 1A5XA 1HRHA 4I9LA 5HBMA 4HTUA 1RDBA 1WSJA 2VG5A 5CZ1A 1JLFA 3LPTA 4C8NA 4KB1A 4N41A 4CJWA 3WNGA 3PX6A 1TGOA 2EX3A 4B9MA 4GW6A 3VQAA 4DSJA 3HSTB 4E89A 1J9AA 4CJQA 4IFVA 3V1OA 3L3UA 4IFYA 3CFPA 4CJTA 1QS4A 3U3YA 3BGRA 1NK5A 4M3ZA 2HHWA 4CESA 3NGIA 4Z4EA 3I8DA 1QSLA 4CJ3A 3VN5A 4I7FA 4DTPA 4NYFA 3QNOA 1TAQA 4KTWA 4LSNA 3TAMA 3VQBA 3L2VA 1Q9XA 2HVHA 2O4GA 1JL2A 2OPQA 1S6PA 3NF6A 1BIUA 3K58A 2FBYA 5DK5A 4FJ8A 4O5BA 1FKPA 1W9HA 4DSFA 1VSHA 3VQCA 4Z4HA 1HQEA 3DRSA 4JS4A 4ELVA 1BI4A 3AVGA 3WNFA 3EY1A 1NOYA 1HMVA 4AHCA 3G0ZA 4H4OA 3SPZA 4CCHA 1C0MA 1X1PA 4DLGA 4HUGA 1JLEA 4I2PA 3HPGA 2ZD1A 4E7HA 3SQ2A 2RN2A 2X6NA 3AVFA 3CFOA 5KRTA 2F8SA 4KB0A 1VRTA 3ASMA 1DLOA 4AH9A 4E1NA 2VWJA 2G8IA 4BE0A 3QEVA 1C1AA 4KV8A 1Q9YA 1ZBHA 2D5RA 4FLWA 4DTMA 2XO7A 1ZBIA 1XHXA 2KQ2A 1T05A 3AA2A 3KD5E 3OYKA 1F21A 4CGHA 1W0HA 3UIQA 4RW7A 1U4BA 1BIZA 3PY8A 1S9GA 3M8RA 3KLEA 3P83D 3E01A 3MEDA 4N56A 2E6LA 1UA0A 4CEEA 1L3TA 1Q8IA 1YVUA 1LAVA 3KKSA 2A1SA 3DLGA 2DY4A 1TVRA 3V9UA 2HHVA 1ASUA 4AHSA 1NJXA 1EP4A 3ULDA 3RMDA 4C8KA 2BE2A 3DOLA 3KIOA 2Z1HA 3DLRA 4CJPA 3TANA 4PQUA 4JRQA 1UWBA 3RR8A 2HNDA 3RMCA 4E3SA 1BL3A 4CEZA 3DLEA 3SCXA 3S9HA 3THVA 3RR7A 3ZSQA 3QESA 3TAFA 1WAJA 3L2UA 3LP0A 1XI1A 5KGXA 1CXQA 1L3UA 5FRMA 1KFDA 3SQ1A 1R0AA 5D3GA 2HNYA 4CHYA 1U45A 5I3UA 3QEWA 3V9SA 3QERA 3OY9A 4LY7A 3OS0A 4JS5A 2YV0X 2DTUA 1LV5A 1O1WA 2Z1JA 1JLAA 2HHTA 3T19A 5K14A 2YNHA 1U47A 2DFEA 3KTQA 4FJHA 4DFPA 2ETJA 4Z4IA 4B9NA 4O0IA 4FLXA 2XY6A 1CXUA 3TR8A 4AHUA 1RNHA 4K8ZA 4CJEA 4LSLA 1SKWA 2D0AA 2FBTA 4B9UA 1SL1A 1NOZA 2P5GA 1D9DA 1ASWA 4FLYA 4J2DA 5SZTA 4KPYA 3OYMA 1D5AA 3DOKA 4N47A 4CEFA 3NAEA 4KAZA 1IKVA 3S3NA 3SZ2A 4F2RA 3HYFA 3NH2A 1A5VA 1L5UA 1RT2A 3KK3A 4O4GA 1N5YA 2RKIA 3KKRA 3ZT0A 3AO5A 3OYBA 2IS3A 3T1AA 4KHQA 3CG7A 2PAJA 4QAGA 4DWIA 4NCBA 1SUQA 4QOZB 3T3FA 3HVTA 3V81A 4CF9A 1BISA 1JKHA 4KI4A 3VQ4A 3K5MA 1C0TA 1VSKA 4DTNA 4Z4GA 4KHUA 1U04A 3HK2A 4CIFA 4KHSA 4CFCA 4FK4A 1JLGA 3QLHA 4KHYA 2ZE2A 3MAQA 4KHNA 3AV9A 4DSIA 3AVAA 4FW1A 3OYEA 4E7JA 4M41A 3SV4A 3NDKA 1KLNA 4PY5A 2KFZA 3PUFA 2HB5A 1Y97A 3O3GA 3OS1A 1RILA 2LSNA 3QETA 4IKFA 4ZTFA 4OKKA 1X9MA 1DTQA 4N5SA 4HCBA 5I42A 4W5QA 1FXXA 5J1EA 3SJJA 1VSMA 3TARA 4CEQA 4FK0A 3NF8A 2ATQA 2VG7A 4IDKA 3DMJA 3L2QA 3NF7A 4JLHA 1RT4A 3DRPA 4DQRA 4BDZA 3TWHA 1T8EA 4C8MA 3AVNA 3VQDA 4CIGA 1EKEA 3K57A 2KZZA 4M42A 1NK7A 1IG9A 2A1RA 4CJUA 2Q3SA 3SUOA 3MXMA 1C0UA 3AVMA 3TAEA 1I3AA 4MQ3A 4BWJA 1SKRA 2OZSA 1RBRA 3QO9A 3V1RA 4OJRA 4CECA 3V9XA 4DSEA 1U49A 3HP9A 1HQUA 4B9TA 3I0SA 4JRPA 4E0DA 5SWMA 2D0BA 3AVBA 1KVAA 1YTAA 3S3MA 4FYDA 5C25A 1QTMA 1VK0A 2PYLA 3WNEA 3NE6A 1NK0A 1GOCA 2P5OA 3OYHA 4DF8A 4DFJA 1UOCA 2RPIA 5HRNA 4G1QA 3D0PA 3RMBA 3VQ9A 4HVJA 1RTDA 4FJ7A 4YFUA 3V9WA 4FM2A 1XHZA 4HHTA 4DSLA 4ICLA 1RT5A 1VSEA 4DS5A 1JLCA 2Y1JA 1TAUA 4DS4A 4FJLA 2QKKA 4ELUA 3AA3A 3DM2A 3OVNA 3G10A 4BE2A 1RDAA 3HPOA 1CZ9A 1TKDA 4RW4A 5J2PA 3VQPA 3HJFA 2VWKA 4PWDA 3K2PA 4W5RA 1EETA 3LWLA 4F3OA 3QIOA 5HRRA 4E7KA 3AA4A 3F9KA 1A5WA 4KO0A 1KTQA 3SUNA 1LAWA 4FJ9A 3V1QA 3VQ8A 3K5OA 4CEDA 1KVBA 4ZTJA 1XC9A 3WNHA 1SKSA 3HO1A 3AVHA 3SQ4A 1QE1A 3ALYA 3KK1A 3TABA 1NKCA 2G8UA 3SV3A 2XHBA 1S1UA 1BI4B 3ZSRA 4CEBA 1K6YA 1WSHA 1KSPA 4J2AA 2XRIA 3AO3A 3ZT2A 5CY4A 5J2QA 4NCGA 2Z1IA 3NGYA 3QEPA 4OLAA 3AO1A 2YHBA 3ZCMA 5KTQA 4Y1CA 4OLBA 4KHWA 2G8HA 4CHZA 3O4NA 4IG0A 4CFAA 4FLTA 1ZBLA 3EYZA 3B6PA 1RDCA 3HT3A 1HYVA 4DU3A 3OJSA 3K5LA 4LH4A 3ZT4A 1JXEA 3QIPA 4DTJA 4CJFA 1KLMA 4IG3A 1TV6A 4EZ6A 4OGEA 2AJQA 1TL3A 3HXMA 4R5PA 2I5JA 2OA8A 1GOBA 3SQ0A 3IG1A 3LAKA 2RF2A 1S9EA 3JSMA 4E7LA 1WAFA 3MXIA 4CK3A 4LD0A 1RBVA 5KGWA 1IH7A 2DFHA 4AHTA 4KRFA 3DYAA 1BQNA 1REVA 1T03A 4E7IA 3P1GA 3PX4A 5JS1A 1WNSA 3CM5A 1QQCA 4Q0BA 4B08A 4EP5A 1IKXA 4ID5A 4CEOA 3P5JA 5J2NA 3SNNA 2HMIA 4FJGA 1EXQA 1X9SA 1VRUA 1YT3A 3ITHA 4M3WA 2HHUA 4CHQA 2JGUA 4Y1DA 3NH0A 4FZXC 4BWMA 2YKMA 1RT1A 1JL1A 1LW0A 1S1TA 4GVMA 4TSXA 4CJ5A 4HUFA 3KLFA 3S3OA 1NJZA 1FK9A 1QSSA 2B6AA 1WSIA 4EZ9A 3ZSWA 1NK6A 1SV5A 2G8FA 1YTUA 3RMAA 3L8BA 1NK9A 4PA1A 1C6VA 1MU2A 4B9VA 4W5NA 3QEXA 4EP4A 3NCIA 1RT7A 4CF1A 3LDSA 1UAXA 2IC3A 4FW2A 3NH1A 1ZBUA 2YNIA 3O3HA 1TKXA 3OYFA 3TI0A 1TK5A 5CYQA 4Z0UA 3MEEA 4F2SA 2BGGA 1KVCA 3I0RA 4OGCA 4DTRA 4B9LA 4IBNA 2OPPA 4DTUA 2BDPA 3CM6A 2HNZA 4FJMA 1NJWA 4CFDA 4FLVA 4CFBA 4BE1A 2X6SA 4FJNA 3HL8A 4CE9A 3TAQA 2XY5A 5EU7A 3SYZA 4H4MA 3OYIA 3HVRA 1B9FA 1VSIA 3VQEA 3ZSVA 4M3YA 4M45A 3AA5X 1NJYA 2EHGA 3AVLA 3HM9A 3M8PA 2X74A 4CHNA 3KK2A 1QSYA 3L2RA 4DU1A 4FJ5A 4CGDA 4HUEA 3AVCA 2Z1GA 1U48A 1IKWA 5FDLA 3K59A 5JS2A 1J53A 4CGGA 3LPUA 1EX4A 5DMRA 3OYJA 4FK2A 3AO2A 2IGIA 4CJ4A 1TKTA 3V9ZA 2YKNA 4FJIA 4FZZA 2OPRA 4CJRA 4DFMA 3PO5A 3OS2A 5E41A 4GMJB 1WN7A 1S1XA 4M3XA 2R7YA 4CF0A 4DU4A 4DF4A 4M3TA 1L3VA 4C8LA 2YNGA 1KCFA 2DFFA 4BACA 3KLHA 3TAGA 2G8WA 3VQQA 3SPYA 4DQPA 4DG1A 5HROA 4O55A 1D8YA 1JLBA 1G15A 1HJRA 2GUIA 2KW4A 1HPZA 3HPHA 3KLIA 5KI6A 3F73A 3LZJA 4DFKA 1TK8A 3DLHA 4FZYA 2NUBA 1Z25A 4CHPA 1JLQA 4NYNA 3OYDA 2XY8A 4W5TA 1IO2A 4DSKA 3ZT3A 3KLGA 4ZHRA 3RRGA 3LP2A 3C6TA 2FC0A 1N6QA 3NFAA 4MFBA 1D9FA 3VQ7A 1BCMA 4CERA 4N76A 4AILC 3NGZA 5HRSA 3NF9A 1XWLA 1NK4A 4FVMA 4ID1A 2QXFA 4O0JA 4FLUA 3VQ6A 4B3OA 2D0CA 1KFSA 1RT3A 4BDYA 3MXJA 2B5JA 2GV9A 4WE1A 3ZT1A 3PV8A 4KI6A 1BGXT 2YNFA 3IRXA 2E4LA 1C1BA 1VSFA 3RRHA 3VQ5A 3RWUA 1RBUA 3ZSXA 3PX0A 3K5NA 3CQ8A 1TL1A 4L8RB 2P1JA 1S1WA 1GOAA 3CFRA 3MEGA 1JXBA 1RBSA 3V4IA 3NHGA 3ZSZA 4J2BA 4FCYA 5C42A 1CZBA 4CF2A 1C1CA 4B8CA 3L3VA 4FM0A 3VA0A 2OYQA 4FJXA 1WSGA 2OPSA 5FROA 3QNNA 3D45A 3DLKA 2KFNA 4CJKA 4F4KA 4FJKA 3SI6A 1RCHA 1RDDA 4OVLA 3IS9A 4RW6A 4FXDA 1S6QA 2PY5A 1RTHA 1WSEA 1NK8A 2Y1IA 3KD1E 1FKOA 5T7BA 2QKBA 3OJUA 3LANA 4CGIA 4KREA 4UQGA 3SUQA 2X78A 1LWCA 3AVJA 3NBPA 4RW9A 4AHRA 3OYGA 5FRNA 2HHSA 4K8XA 4E1MA 5CYMA 1TKZA 4CIEA 1LW2A 4F3TA 4CEAA 3AO4A 4CF8A 3LWMA 1NKEA 1T7PA 3LALA 3VA3A 1RT6A 1LWFA 3QINA 4I2QA 4CGFA 2BANA 3JYTA 3B6OA 2WONA 2ZQBA 2P51A 4DTSA 3KJVA 4CJVA 4DLEA 3QEIA 2PYJA 4OPJA 4BDPA 4W5OA 3OYNA 1RTJA 4OKJA 3EZ5A 4KTQA 5HP1A 1RBTA 3DRRA 1J54A 4DQSA 3HP6A 2QK9A 3U6FA 2HW3A 1B9DA 3A2FA 1LWEA 1HNVA 4CJLA 3SUPA 4FLZA 3BDPA 3IAYA 2KTQA 1ZBFA 3DI6A 5HLFA 2HHQA 4H8KA 2IDOA 4QCLA 4B9SA 2JLEA 3U3GA 4CJSA 2F96A 3O3FA 4CK2A 1UA1A 1S5JA 4KFBA 1HYZA 4KKOA 2KZMA 1X9WA 1B92A 4Z4FA 1BHLA 3ZSOA 2E6MA 2IAJA 1HNIA 4DQIA 3ZSYA 4E19A 3LP1A 1SL2A 2B4JA 1CLQA 3M8QA 3AVIA 4Q5VA 4XIUA 3O4QA 2ITGA 3AVKA 3LAMA 2IOCA 2OZMA 2HVIA 4B8AB 4RW8A 4Z4CA 3H08A 3OYAA 3TAPA 4DQQA 1ZYQA 4DTOA 2VG6A 1S1VA
chains in the Genus database with same CATH superfamily
3THWA 4NXNK 1USEA 1BWFO 1R5LA 4OH8B 3FWLA 3W67A 1L0LE 3ZDMA 3PO4A 5CCHC 4RG8A 3DLBA 1NGBA 2ZT9B 4DTXA 1DTTA 1HYSA 1KILA 2PZSA 1D7MA 1YVNA 4CZLA 4FJJA 4CHOA 2KOGA 3M0AA 4LH5A 1SL0A 3OYLA 1WBDA 4I9QA 4FSVA 1ITGA 3PP5A 4HKZH 5B66E 4ISFA 4OPHA 1I94K 4NB4A 4O44A 3T69A 1VSLA 4CGJA 5DJUB 5J2MA 3OYCA 3M8SA 3UB5A 1KRPA 3P8MC 3FFIA 4AHVA 2AXTE 3B71A 1ZR2A 2A06D 3LM9A 5HBMA 1RDBA 4WY4D 3THWB 2GELA 2KNCB 1JUNA 5M1FA 3KDPB 3VQAA 4EI2A 3HSTB 4E89A 3A0HE 2AP1A 1J9AA 1GMJA 3UKRA 2C9LY 4IFVA 3V1OA 4IFYA 5KAFE 3CFPA 1XNQK 3HE5B 3U3YA 3FGUA 4CESA 2F4VK 3I8DA 1QSLA 2NRGA 4JPZB 1NTKK 5KLVE 2P7JA 3QNOA 4LSNA 2ZWHA 2O4GA 1BIUA 1R8EA 2Q3EA 4C1NI 1FKPA 4DSFA 3G71P 1HLUA 1FAVA 3VQCA 4Z4HA 1HQEA 3DRSA 3VOVA 4FWKA 5AW7B 1T6CA 4JS4A 1XUPO 2C0XA 5AQHA 2BEZF 1LT9C 3G0ZA 5C2FA 4NPDA 4I7ZB 4BRAA 2W90A 2F8SA 2H3GX 2XDJA 1IFNA 2D2CB 3H1HD 1T44A 3ASMA 4WB4A 3VERA 3JAMO 1NMNA 2VWJA 1C1AA 4KV8A 3UKRB 4DR1K 4FLWA 3HE4A 5M1BA 4FWNA 3FFKB 4WCEL 3KQGA 4DTMA 1ZBIA 1XHXA 2JWKA 1T05A 1QX8A 1F21A 1BE3J 3T97A 1RE3A 1ZXGA 3PY8A 1M7LA 4BVOA 2AXCA 2HF4A 5CCHA 4DUZK 3P83D 3AE5C 3MEDA 1L3TA 2E6LA 4CEEA 3MD0A 1OFCX 3KKSA 5AW4B 2A1SA 2P10A 2DY4A 3G3ZA 1TVRA 3M1FA 3DJCA 1EP4A 3CMEN 3JXUA 4C8KA 3CCQP 3KIOA 5KJ7C 3GHGB 3D7EO 4FPBA 1JY3O 4CJPA 4YOYA 1SQQD 1NTKG 4JRQA 1UWBA 3MIWA 3RR8A 2H89C 4FWRA 1KN7A 1BL3A 4EYYQ 3AEEC 1K8KA 5BRFA 5APQA 3RR7A 2GWJA 2Q97A 2QI2A 3VEWA 1SQBE 3R4YA 3TAFA 2B9BA 1XI1A 3HE4B 5AVXB 3I56P 3ULEA 4A5AA 1L3UA 5B5EH 1R0AA 4BC3A 2ZYAA 5AQTA 3H1JD 3QEWA 3V9SA 1VQ5N 3ATUA 3CCEP 1S5LH 3H25A 5BRDA 5EOYA 2UU9K 2WMMA 2DFEA 4FJHA 2ETJA 4Z4IA 2RMZA 4EOTA 2XY6A 1CXUA 2ITAA 1RNHA 2D0AA 2FBTA 2P5GA 1D9DA 4JI8K 1EZVE 3OYMA 2JWAA 1YHQN 3RK2C 1IKVA 3O9QA 4CZIA 2EWSA 5AQPA 4K25A 4F2RA 2LR2A 1K8KB 2A06G 1L5UA 1RT2A 3KK3A 1SQXD 3ZT0A 3AO5A 2IPPA 2FFDC 3ULEB 5M1OA 4NCBA 1SUQA 3BCCE 2KB7P 1LTGC 1LT9A 3VMAA 1QVGM 1XTGB 1VQLP 4DTNA 2YHXA 1U04A 4FK4A 1JLGA 5A2QO 3TSPA 1SQQK 5AQZA 1FW6A 4KHNA 2QWPA 5APVA 5EXWA 1NNEA 3OYEA 4E7JA 4PY5A 1KLNA 1HKGA 3PUFA 1RQUA 1YBKA 3V2QA 1RILA 2LSNA 1OXZA 4OPAA 1Q7YQ 3HUSB 2AEJA 5M1KA 4BWNA 2O8EA 4WFNL 1FXXA 1HKCA 4TLFA 4U3FE 4CEQA 1OVQA 2N9BA 1FE6A 3SLCA 3L2QA 3SMPA 3CIPA 1RT4A 3TSIA 3H1HG 4XH5A 4BDZA 5KJ7A 4PL8A 2B89A 2ZGYA 1T8EA 4BRMA 4CIGA 2D1KA 3L71D 1MUUA 1NK7A 4H0LD 1IG9A 1N32K 4DV1K 2BCCD 3ID8A 1K05A 2E8AA 3MXMA 3VP8A 4I2LC 1SKRA 3Q5RA 3MTUE 4MQ3A 3F2KA 3FZMA 1HQUA 4BRYA 1K8AQ 3S3MA 1T3VA 3V2PA 4H5RA 1QTMA 1SQXK 1NTMJ 4CD3A 1YJWN 1NK0A 5KLIC 1G2CA 1GOCA 2GUVA 1A02F 3OYHA 2P5OA 4DF8A 4DFJA 2HOEA 2O8EB 4C7RA 3C0BA 1HR0K 1SQQG 5HRNA 4FJ7A 2YXRB 4PL7A 4YFUA 2FXOA 2J5UA 3V9WA 3OA9A 4FM2A 5JMVA 1OIPA 4DSLA 1P84E 1RT5A 3B8AX 3KZIE 1JLCA 2OARA 2NRVA 4RW4A 2VWKA 2Q7CA 4PWDA 1PPJE 1RGIA 3E7KA 2H43A 2W40A 1EETA 3H1JG 4WQ5C 4F3OA 1USDA 1LNQA 2IVNA 2YX6A 3CI5A 4PD4I 1E79H 1GLBG 2FFDA 4U67L 1KTQA 1LCUA 1VF5C 3MK6A 3HTVA 4FJ9A 3VQ8A 1SKSA 4B1UB 1GLAG 3HRGA 3KK1A 1G2CB 1VQ4N 3L75D 3VF6A 4FO0A 3SV3A 1GW4A 1BI4B 4CEBA 1KSPA 4J2AA 2XRIA 5CHXA 5KTBA 2A5XA 1ZRTE 5CY4A 5J2QA 3NMUA 2YHBA 2KHOA 3ZCMA 5KTQA 4Y1CA 4JKHA 5KPRA 1SQXG 2QWNA 4IG0A 3JS6A 4CFAA 4KJMA 4IEIA 4YORA 3HT3A 3RK2B 1Y9BA 1L4AC 4LH4A 3K5LA 4YY3K 1ZW0A 1KLMA 1NWKA 1T6AA 3WUUA 3V4QA 4HB1A 1RF1C 4R5PA 2FFDB 1WRGA 3DLLL 1S9EA 3JSMA 4E7LA 3L4FA 3L72G 4BREA 2UXDK 1QL2A 3MN5A 4GODA 3RL0B 3CMAP 4AHTA 3CWBJ 4JKCA 4KRFA 3KHUA 3DYAA 4LF9K 1KMIZ 4RESB 3SMSA 4Q0BA 4BRNA 4C1NK 2O8FA 4BVPA 4X62K 3KHYA 1Q7YO 1WUAA 1YT3A 4CHQA 3AEDC 2A6AA 3E9LA 4DV7K 4Y1DA 1N34K 4O8UA 2WTYA 1JCFA 1RT1A 1NJZA 2LXBA 3C7NA 1FK9A 3QB0A 3S41A 4A59A 4EZ9A 4WVZA 1NU1J 3MUDC 1XMQK 3L8BA 1OVRA 5AVYB 2WT7A 3QEXA 4YDUC 3WMM0 3ENOA 3NCIA 3Q1MA 3KPEA 1RT7A 2BCCG 1IFIA 2IC3A 4CF1A 3LDSA 2YNIA 3P4IA 3CD6N 1TKXA 3WUHA 3OYFA 2BGGA 3CC7P 1GW3A 4DTRA 3GLMA 3BF3A 3MWPA 4B9LA 4O8KA 2HBLA 5KQ8A 1NJWA 2QXLA 3KK7A 2POHA 4WWIA 4BROA 1MV8A 1N7SD 4MLHA 1QVFM 2X6SA 4FJNA 3HL8A 4WQ5A 3H1KE 3TAQA 4NLCA 5EU7A 2XY5A 3SYZA 3L70D 5LJWA 1B9FA 3HVRA 3VQEA 1ILYA 4M45A 2QA4P 5LMNK 3H1VX 1RH5B 2EHGA 3AVLA 4JAXA 5LMUK 2W6LA 3C7NB 4KHUA 1G1IA 2Z1GA 2XU6A 3P38A 3HI0A 5BPMA 2FLOA 3VMFB 4FK2A 3LPUA 2KS1A 5DMRA 2NPSB 4BQLA 5FPMA 2WT7B 3V9ZA 4FJIA 4Y99C 2OPRA 3CCJN 4DFMA 2WSFJ 3PO5A 4GMJB 1WN7A 2ZYGA 4DF4A 5C0YA 4M3TA 2YNGA 3TAGA 5AR0A 4DG1A 2GTDA 2DW3A 1L4AA 1JY2N 1D8YA 2KLAA 2IIRA 2GUIA 3TGUE 4AF1A 1OH5A 4B3RK 4L73A 3L75G 4FZYA 1RF1A 4X65K 2JKVA 1HUCA 1J1EC 3ZT3A 1VF5B 3KLGA 3BUZB 1Y8AA 1PP9E 1L0LJ 3WXJA 1NGEA 1IJDB 1PIXA 1WOQA 5HRSA 2KS1B 3FWNA 1RQVA 3MCAB 3H1ID 4O0JA 4FLUA 3VQ6A 2E1ZA 2D0CA 1KFSA 3ZT1A 4WE1A 4DQ8A 4KI6A 5TJHA 3WXMB 2YIUC 4IOAL 2HFED 4DV3K 3CCSP 3PX0A 3CQ8A 3LIDA 1OH6A 2P1JA 4BC2A 5BN9A 3MEGA 1JXBA 2QW9A 3CCRP 1GD2E 3V4IA 3MUDA 4J2BA 1SFCD 3FLCO 1NTZE 2Q3IA 5GTIH 1JY2O 3H1LE 4NPFX 4YDUA 4LFCK 2QWMA 1KB9E 1L0NE 1BG3A 3L0QA 2NRXA 2OPSA 3QNNA 5AQRA 2KFNA 2OANA 5KPZA 3IS9A 4RW6A 4PD4D 2PY5A 3KD1E 3TYYA 4B1YB 5T7BA 2ASMA 5AQIA 1IC2A 4UQGA 4AQRD 2O8CB 2X78A 3OYGA 1O13A 1IZNB 5KAIH 1EDKA 4CZFA 5IT9O 4WY4C 5K5GB 2K9JB 2BASA 1VQOP 4ILHA 2ZXEB 4BRHA 4FWOA 1GK4A 2P9UA 3VA3A 1RT6A 1HNWK 2UYTA 3FZLA 4I2QA 1LTTC 4CGFA 4FOIA 3JYTA 3PSFA 5AQUA 1XNRK 3VOPA 2WONA 3QICA 5IWAK 4CJVA 3QEIA 4OPJA 2E75B 3L73E 4BDPA 3RGUA 3M3ZA 4M7YA 3C8VA 3DRRA 1KAYA 1S22A 3HP6A 3U6FA 2ZF5O 1LWEA 3E1YA 3SUPA 3L70G 1U57A 5BPNA 3BDPA 5E79H 2HHQA 5APUA 3VN0A 2M3BA 4PD4H 3RK3D 1IV0A 2Y0EA 4B9SA 1KQGB 3U3GA 1DH3A 3O3FA 5CBNA 1EQ7A 2KZMA 1X9WA 5C12A 1B92A 3A5NC 1URQD 2E6MA 4Y28J 1HJBA 1HNIA 3PLAA 3IUCA 5APSA 2B4JA 2P9UB 3AGKA 2XNDH 2KSEA 2GUPA 2YO3A 4PKGA 2ZJRL 1YQ4C 4AUWA 4B8AB 1NKZB 3H08A 3TAPA 1LP1A 4DQQA 3AE7C 4HCCA 2UXCK 2Z4EA 3AARA 3CYMA 4XA4A 2VWBA 2IDBA 3KYQA 1S2EA 3C95A 2F8TA 4CK1A 3W0LA 3CPEA 2FBXA 4M3RA 2G8VA 1I39A 4DJGA 2OYHB 1RTIA 1VQPP 1NKBA 2HSTA 2IX7C 1SQBJ 1ASVA 1QHTA 4OKEA 2VYPA 4DCHA 1EDJA 2HHXA 1IBMK 5C24A 2G8KA 3H1IG 2NLXA 3L2WA 4NCAA 2W42A 3V6DA 3EO3A 2FF6A 3PSIA 5HRPA 2L5GB 4UB8E 2FBVA 4DR6K 2O1KA 1YTZT 3W68A 1LP1B 1BQMA 2WOMA 1S72N 1DKGD 4WY4A 4MDBA 3BRVB 2YXQB 3M0DC 4HTUA 1YITN 1FDMA 4KB1A 1BCCG 2JO1A 4CJWA 3WNGA 1TGOA 2EX3A 2K9YA 4DSJA 1TYQA 1ZV8A 4OWFA 1BOTO 4K41A 2J59M 1K73Q 3B5NC 3FE1A 1QS4A 1LWUC 3VENA 1OW8A 4AYCA 1NK5A 1ZN5A 4ASWA 3IMXA 3NGIA 3BCCJ 1T6DA 4NYFA 3SSUA 1Q9XA 2HVHA 3E9OA 1LJ2A 1E5WA 3T7ZA 4A61A 1JL2A 2OPQA 3E1IA 4O5BA 1VSHA 1NTMD 1RDWX 2NZTA 2JWLA 3AEGC 3H3OB 3AVGA 3IF4A 4CZEA 5LJVA 5AQQA 3SBGA 3SPZA 3D6ZA 4WY4B 4CCHA 1C0MA 1Q2NA 1A02J 4HUGA 1XC3A 2ZD1A 4GOEA 3R6MA 3CJCA 2MKVA 3AVFA 2OTLN 1VRTA 1DLOA 2PP6A 1HH0A 3ZX2A 4BE0A 3CCVN 2CPBA 4U3FJ 2XO7A 2ITMA 4CPGA 2KQ2A 3AA2A 3GG4A 4KH4A 4CZMA 4H5TA 4RW7A 3AE3C 3O9TA 3VPZA 1U4BA 5AW9B 2KP8A 3GG2A 2I1JA 3KLEA 1HX1A 3E01A 3CCRN 1NTKE 4LC1A 1Q8IA 1YVUA 1E4FT 3NTNA 3V9UA 1NJXA 4CD1A 3RMDA 2UWJE 4KH6A 4UB6E 4YOTA 2FYUE 1NAYA 3TK1A 5AQFA 4H0LC 2WSEJ 1HPMA 2V7ZA 2PFUA 4PQUA 2HG5D 1QL1A 1WMKA 2QM7A 3O4WA 5TKWA 2HNDA 2CK3H 5AW3B 3DLEA 3QESA 1WAJA 4JV5K 5FRMA 1KFDA 2YO2A 1X9JA 4D6TG 3QERA 3M0DA 5AW1B 5CCGC 1NTMK 4LY7A 1NVOA 4BC5A 1KAZA 1LV5A 2Q1NA 3LDPA 1O1WA 4BR2A 1JLAA 3T19A 3L74E 1X79B 2YNHA 1U47A 1FZFA 3KTQA 2CH5A 4B1WB 5JLFA 4DR5K 3O80A 5AJ3K 4LF7K 2HBMA 2V4HA 2A06E 3B5NA 2WC9A 3P8CD 3S9OA 1U2VA 3B4SA 4LSLA 1YAGA 1SKWA 1LWUA 1W97L 3G6EN 1SL1A 1ASWA 4DV6K 3G25A 4AQYK 4J2DA 1PFIA 3I55P 2O8DB 1D5AA 3NAEA 3CCUP 5JICA 3S3NA 3CC4N 2P9IA 3HYFA 5AW8B 1BDDA 3KKRA 3M9QA 1EC5A 3T1AA 3CG7A 4DHYA 1VQ6N 3R9PA 3AEAC 4DWIA 1NOHA 3GF7A 2WPSA 3HVTA 4IL6H 4JF7A 1JCCA 4Z4GA 1VSKA 3CCMP 1Z6RA 2HBJA 3TSUA 1K73O 1VPCA 1BO5O 4KHSA 2P9PB 3TPQA 5MLCQ 2HODB 4JBZA 5AQKA 3EE9A 4GOFA 3AV9A 2E2QA 3OW2M 4FW1A 3B5NB 4M41A 3SV4A 1X9VA 1T3UA 2KFZA 1Y97A 4BC4A 3OS1A 1NTMG 2YHWA 3QETA 4IKFA 2O3JA 4PV1B 4OKKA 3H1HE 2P9IB 1R5SA 5J1EA 2IZ1A 3SJJA 4K0KK 1KORA 4JK8A 3ZETA 4BRGA 5BPLA 3DMJA 2V7QJ 3NF7A 1DEBA 4DQRA 4JI2K 5BREA 2I8DA 3CPWO 4C8MA 4N78D 4BRQA 2KZZA 3A2AA 1V4SA 1KYOE 1KILB 1NGDA 1EZVI 4M42A 3SUOA 3AVMA 3TAEA 1I3AA 2RH0A 4BWJA 2OZSA 4IFFA 3FXDA 4OJRA 4A2AA 4BGBA 3V9XA 3HP9A 4E0DA 2H8PD 2QWOA 1MWMA 3ZLJA 3AVBA 4OGQC 1KVAA 1ATNA 5KKZC 1VK0A 3WNEA 3UIAA 5CCGA 3OJAB 4H44B 1YI2P 1JY3N 3A3YB 1UOCA 4J8FA 3O1BA 4G1QA 4EIJA 3D0PA 5I9EB 2HR3A 2OTJP 2VQFK 3S1KA 4HH2A 3ZETB 4N3YB 4XH4A 5CR4A 5HOOA 1XHZA 3MN6A 3H1KJ 1VSEA 5AZIA 4DS5A 1BSNA 4JYAK 4ELUA 4B3SK 3AA3A 3DM2A 1TKDA 1VQNN 3HPOA 3VTHA 3HBTA 1CI6A 1N7SC 1RE4C 3QH9A 1D4XA 3VF2A 1SQKA 2WSFH 4W5RA 3CC2P 3DXMA 3R1XA 5HRRA 3JCUE 3AY9A 3EKSA 3O08A 1A5WA 1LAWA 4JHDA 2E74D 3V1QA 1XC9A 3PRJA 2FF3B 3AVHA 3SQ4A 3TABA 1NKCA 1SQXE 2XHBA 1WSHA 4BR9A 3FX0A 1NGJA 2NRTA 4IOCL 1J1DB 2IBZG 1NJIQ 4DR3K 4W7ZA 1FS0E 4JKDA 3TGUJ 1FJGK 5AZIB 1KILE 1YQ3C 1NGAA 2FSNA 4M63C 4FLTA 1DEJA 1LTAC 1UIIA 3B6PA 2QEXN 3L72E 2IYPA 1HYVA 2F9TA 4XEIA 5ADXH 1NGIA 5GINA 3OJSA 1JXEA 4CJFA 4YOVA 1PP9J 3DXMB 1TV6A 3T97B 3CXHI 2FSKA 4OGEA 1TL3A 1VHXA 3MWTA 3P39A 4YOWA 1CZQA 3IG1A 1ATRA 2WITA 2RF2A 3MXIA 1JMBA 1P84I 3V6IA 5B66H 1MWKA 2E2OA 2YI1A 3D70A 4JHDB 2Q5UA 3WXKA 5AVUB 1EQYA 1SQPJ 3ENHA 5AVQB 1REVA 3G4SN 3D2FA 4E7IA 3P1GA 2V52B 1WNSA 3CM5A 1QQCA 4GY2B 4B08A 5JLHA 4ID5A 3SNNA 2AXTH 3H46O 1EXQA 3CF5L 2HHUA 1J2JB 3MHVA 4FPAA 3A0BE 1NTZJ 3H1LJ 1L0NJ 2YKMA 4TSXA 3RSEA 4BRDA 4CJ5A 4HUFA 4IJAA 2FXPA 1YIJP 1QSSA 2B6AA 3A0HH 1W2EA 1NGMB 2GX9A 3ZSWA 1VQKN 1SFCC 2G3AA 1DEEG 1SV5A 2G8FA 5KAFH 1MU2A 4AM7A 5M1QA 4EIAA 4EP4A 1UAXA 3NH1A 2HMIA 1SQVJ 1ZBUA 3CX5E 3C65A 3KVGA 1JTHA 4RJTA 5CYQA 3TI0A 4DB3A 2XNXA 4IL6X 4ZMDA 4OGCA 4JK7A 3HRNA 4IBNA 1GLJO 1QLED 2BDPA 2HNZA 4FJMA 1K9MQ 1N7SA 3PJSK 5AFUH 1RE4A 1N73C 3D2FB 5FPNA 4BE1A 1OH7A 1FZCC 3QFUA 3J7YP 2RE2A 1YYCA 3OYIA 3VMZA 1PV3A 4JKEA 3THXA 1FDOA 3O6QA 3ZSVA 2YMYA 2KK7A 4R4MA 4M7XA 5BU8B 4OGQB 1NJYA 3RSEB 3M8PA 2X74A 3EKUA 4CHNA 3KK2A 3L2RA 1SQBD 3AVCA 2LKMA 4DOJA 1C0FA 5FDLA 5JS2A 1S9KD 4RO0A 1J53A 1OW6A 2I7NA 5EX5A 4CJ4A 1LT9B 2YKOA 2HLOA 1VQ9P 2FY8A 4Y0WA 1JTHB 4JYCA 1Q81Q 1W7AA 5DJTB 4ISEA 3T1HK 4M3XA 3L75E 1QZ6A 4DU4A 4C8LA 3RK3C 1FZEA 3WUVA 3SPYA 4BRFA 2WSSH 3AE2C 4JK9A 2LXCB 1G15A 1HJRA 2K88A 2KW4A 2OCEA 3KLIA 5KI6A 4CZKA 1URQC 1EZVD 4DFKA 1Q18A 3DLHA 1FC2C 3O6QB 1JLQA 4NYNA 2D2CD 2YJFA 1W2BM 2Q1KA 4K3AA 2WUSA 4ISGA 1E4GT 4ZHRA 2YCHA 3NVMA 4EFHA 3CJ9A 4MFBA 1NJIO 1D9FA 2HPCA 3BF1A 4N76A 2E76C 2ZJPL 2FXMA 2Q0RA 1EWQA 3MXJA 2B5JA 2GV9A 1NLVA 2YNFA 1KC8Q 1C1BA 5E26A 3RWUA 1RBUA 3G71N 3ZX0A 1HJ0A 1YI2N 1GOAA 3CFRA 1JCDA 4DT0A 1RFQA 1SFCA 1RBSA 3NHGA 3ZSZA 4BRYB 5AQXA 4FCYA 5C42A 1DD3A 4XE5B 4FM0A 3VA0A 1SQBK 1WSGA 5AQWA 5F2RA 3D45A 1NO4A 3N4PA 4CJKA 4F4KA 3SI6A 4GV9A 1RDDA 4YPCA 4U3FD 3C6HA 1S6QA 5C2DA 2Y1IA 2QSIA 3OJUA 3LANA 4CGIA 1N73A 3TTCA 5EFWB 1FZCA 1LWCA 3NBPA 4RW9A 4AHRA 2HHSA 3M06A 5H2FE 2QG4A 1BGYD 4K8XA 4E1MA 4GNIA 2ZJQL 5CCHD 5CJ4A 2YNYA 4CIEA 1LW2A 1HGVA 4CEAA 1FU1A 3AO4A 3LWMA 1T7PA 3LALA 2WTUA 1EDLA 1H1VA 1FDIA 3CCQN 2ZQBA 3L70E 1SFCB 3EE8A 4FWMA 4FWSA 4DLEA 3TDKA 2PYJA 4V19S 1CW5A 2QJPC 3OYNA 4OKJA 1K9MO 4WYBA 4DQSA 2HW3A 4CJLA 4RKUJ 4FLZA 3CXHD 4IDHA 3I56N 3IAYA 4H8KA 4QS8A 1N73B 1P84D 2W6JH 4CK2A 1UA1A 3CCEN 4DR4K 2VRSA 1URQA 5EY4A 3W3DA 1KB9I 4DQIA 4GKKK 5ELZA 4LF8K 1YJNP 3ZSYA 3L71G 1MKMA 4JI3K 4XIUA 3AVKA 5M1PA 4DV5K 3VGMA 1Q81O 4RW8A 4Z4CA 2WSEH 1HVVA 1NTKJ 1GU4A 2R44A 5BU5A 4K42A 4DTOA 1IKYA 1L2PA 4GIFA 4IJNA 5KRSA 3E9PA 4PJ0E 2H7HA 2QJKC 1BCOA 2FYUJ 4FM1A 1VSDA 2O8FB 4ELTA 5AQNA 3CXHH 3H6PA 2XKMA 3RK3B 3H1IE 3ISNC 4M3UA 3L4IA 1GZLA 3TNUA 3LZIA 4JKAA 1BSHA 1VQLN 1P84H 4HYTB 1TK0A 3KZIH 1ZXOA 3RTVA 1KZUB 2ZVOB 3DWLA 2HF3A 1URQB 3C94A 5KLIB 2OTKE 5LY3A 2M0BA 1ZLLA 1NKNA 3AAQA 4PUOA 4DMNA 2XY7A 2W41A 4F8RA 4J2EA 2YKPA 3IN6A 1BCCE 3LW5J 4H13D 1L3SA 2W83C 3MECA 3L74J 3OAKA 3J8AA 3WU2E 1KC8O 4R79A 2E76B 2FSJA 3A8YA 1A5XA 4A57A 2W27A 1HRHA 1JEKA 2D0PA 1RHZB 5H1SQ 5CZ1A 1Y64A 1JLFA 3LPTA 4C8NA 1AQTA 4N41A 2XV5A 3PX6A 4GW6A 2WZ7A 1T2KC 2WSCJ 4GVEA 3TNUB 4U3FG 4X66K 3R2PA 4CJTA 1VL2A 1OVVA 4BY9C 4M3ZA 2HHWA 4H03B 1BGYG 1TAQA 4KTWA 2E88A 5APYA 3VQBA 4JI7K 3M5RA 4IO8A 3K58A 4FJ8A 1W9HA 1P8ZA 1FOSE 2P9SA 3CCLP 3U59A 4ELVA 2BEQD 1Q82Q 1NOYA 5BVZA 2NRWA 2PAVA 3LM2A 4AHCA 4CBUA 1L4AB 1X1PA 2QVAA 4B1VA 3RK3E 3MMVA 5AQMA 3AECC 3H1KD 4ASVA 2V7QH 3SQ2A 2X6NA 3QMLA 2W6AA 1RF1B 4KB0A 3BY5A 3BVHA 3QEVA 2D5RA 2Y9YA 5AQGA 2J58A 4HWIA 5BRHA 2V51B 3EEQA 3RK2D 2QJPB 3KD5E 3D6RA 3FGAD 1BE3D 1PGJA 4CGHA 1W0HA 5BR8K 1XQSC 3AGRA 4GV3A 1GLDG 1S9GA 3M8RA 2WFBA 2Y0DA 1UA0A 4A5BA 1LAVA 1VQ7P 4LLHA 1YF5L 3H32A 2HHVA 3RL0D 1ASUA 4AHSA 2P9SB 1N86A 3EZWA 2P9LA 2BE2A 5KLVJ 3MGNA 3O8MA 1OX3A 3PIPL 1WB9A 4QS9A 3U9ZA 1LOTB 3RMCA 4D6TE 3TGUD 4CEZA 3S9HA 1SVFA 3HM8A 2HBKA 2KUBA 2YHYA 3LP0A 1CXQA 4CHYA 1U45A 5I3UA 3THYA 1PP9D 2O01J 4BG9A 4CBWA 4EHTA 2YV0X 2CPSA 2QJKB 2Z1JA 1GL2D 4JI1K 1T3JA 5GTHE 3Q2YA 4B3MK 4DFPA 1MFZA 3H32B 2K1AA 3CMAN 4FLXA 3TR8A 1SQPD 4AHUA 1EDIA 4K8ZA 1WT6A 2L91A 3CHWA 4IFDK 3VP9A 4FLYA 3Q3DA 5SZTA 4KPYA 3DOKA 4N47A 2YMKA 4GDOA 4CEFA 4RWTA 5DM7L 3J81O 3H1QA 3SJHA 1NTZD 3SZ2A 3H1LD 3NH2A 1S3JA 4Y99B 1M56D 1KB9D 2KXPB 3IFMA 2NRHA 5C39A 1N5YA 1SQXJ 3OYBA 2IS3A 1V4TA 2PAJA 4QAGA 2E74C 2GM4A 5HL7L 3HOTA 4QOZB 2NPSD 1JKHA 3THYB 3K5MA 1OMIA 3CI9A 3HK2A 4CFCA 5TISE 1SQVD 1ZMEC 3USSA 4W80A 1IJJA 3QLHA 3CC7N 3J7ZO 1JOCA 3L72J 2QJYC 3CETA 1J1EB 1NH4A 1IG8A 2A45H 4K35A 3O9UA 3NDKA 1KQSO 1AV1A 3FZFA 1NBWA 3KXDA 3J80O 1X9MA 1DTQA 4HCBA 5I42A 1H0TA 1DT9A 4RTFD 1Q82O 1OWAA 2QA4N 2NRRA 4FK0A 1KB9H 3NF8A 2ATQA 5GAHP 2VG7A 1NG9A 4CI6A 3D2EA 2YIUB 4JLHA 3DRPA 1PZQA 4L3QA 2C9NY 4Z94A 3KZBA 3TWHA 3MN7A 3VQDA 3OBYA 1ZOYC 1SQPK 3A5OC 4MDAA 5BR9A 2A1RA 1LTJC 2I7PA 2Q3SA 4IO9L 1BE3G 4DV2K 1C0UA 3FXEA 3QO9A 3V1RA 1AQ5A 4DSEA 2P9KA 3I0SA 2ZAEB 4BG8A 1AVOA 1NTZK 1ZBSA 3L37A 1L0NK 1ZR4A 3VEOA 1NM1A 1S3XA 2PYLA 3NE6A 4WBAA 3HTKA 3TU5A 4LFBK 3N4XA 3VTPC 1H0TB 4PKIA 5AVRB 1CZAN 4HVJA 1RTDA 5L8RJ 3GL1A 1JB0J 4HHTA 4B86A 3D2EB 1SQVK 4WF9L 3S4RA 2B87A 3CQXA 3OW2O 3V4WA 1U6ZA 1TYQB 4H5VA 1TAUA 2YJEA 4BE2A 3G10A 1CZ9A 5APWA 2UXBK 4YXDC 3P8CE 1PP9G 3I5CA 3M9BA 3CCSN 3CCLN 3LZJA 2P9KB 2Q9IA 3F9KA 1AFOA 3SUNA 2OYOA 2IBZE 3A7OA 1NGHA 3K5OA 3CJBA 4CEDA 1XMOK 2Q6QA 2E75D 3HO1A 1SQPG 3N7NA 1K04A 3L75J 1KYOI 3SFEC 2IZ0A 1S1UA 3H45C 3ZSRA 4JI5K 1K6YA 4PHTX 3CJ7A 3ZEUA 3H6EA 3PIOL 2WWWA 5DM6L 1N8RQ 3ZT2A 1RY3A 1NTZG 2P67A 3H1LG 3NGYA 4CZHA 1HGZA 3AO1A 2B87B 4OLBA 4KHWA 2G8HA 3O4NA 2MJZA 2Y9ZA 3ID6A 4JKGA 1RDCA 4H0YB 1VQON 4IFMA 3ZT4A 4DTJA 3R3LA 4IG3A 1VQ5P 2RN0A 4N6JA 1SQVG 2D2CC 2I5JA 4IOXA 2OA8A 3SQ0A 1IK9A 1WAFA 2E74B 1OVUA 2KIKA 1RBVA 4LC9B 5KGWA 1IH7A 3CWBD 2SPZA 3BZCA 2FYZA 1BQNA 1T03A 3IFRA 3PX4A 1HWTC 1LTJA 5JS1A 2BTFA 4CEOA 2UUCK 5J2NA 1BDGA 3ZEUB 1X9SA 4M3WA 2QJYB 4HTLA 4N78E 2JGUA 4CVNE 3NH0A 4FZXC 1IFMA 1JL1A 1S1TA 4GVMA 4BRCA 1GLEG 3KLFA 4ZNCA 2Q36A 3GHGC 4JKGB 3NVKA 2FYNC 1NK6A 1NU1D 3RMAA 4A2BA 4PA1A 1Q90D 1C6VA 2DPNA 1FZGA 5AQSA 2Z5HA 2E42A 4FW2A 1TK5A 1IBLK 3B8EB 2KZJA 4JYBA 2VGMA 4F2SA 5APTA 3ITKA 3AEFC 2O8BA 1KVCA 3CQYA 3ENBA 1M1KQ 1VAZA 4DTUA 4KHPK 4CFDA 2G8YA 1U2VB 4BXLA 4CFBA 1LTJB 1LWUB 1RE3C 2N1TD 4CE9A 2FYUD 2KNCA 3SFDC 3L70J 4M3YA 3AA5X 4C46A 1C0GA 5B5EE 3FZHA 4M3LA 1GTWA 1GDTA 3HM9A 3HE5A 1FZBA 1HBWA 2FBWC 1VQPN 1QSYA 3EQ2A 4FJ5A 4BRPA 1U48A 3K59A 1S5LE 4CGGA 1QQMA 4JKFA 3VTIA 3OYJA 1NGGA 4IEEA 2YKNA 2KLVA 3AE6C 4FZZA 3VGKA 1ATSA 4W7YA 5E41A 2I1KA 1H8AA 4MO5A 3L74D 4IOIH 1S1XA 2R7YA 2O8BB 3WEEA 4KH5A 1NU0A 4BGAA 4BACA 2G8WA 2M5AA 3KLHA 4DUYK 1SQQE 3A5MC 4DQPA 2W8ZA 5AW5B 4O55A 3F73A 1X22A 2CH6A 4UB6H 1YJWP 1LGHB 1QVGO 1TK8A 2NUBA 1LTSC 1Z25A 1NU1K 4CHPA 1WBBA 4DCKA 2XY8A 3MZWB 3BASA 1AJYA 3CX5I 2JP3A 4OVNF 2VGNA 2FC0A 3NFAA 1N8RO 3H1JE 1SP4A 4L74A 3RBZA 1KD1Q 1L0LD 1BCMA 1W5CE 3HUSC 1DX7A 2E43A 4DV4K 5F1XA 2E5TA 3NF9A 1XWLA 1NK4A 4FVMA 3H1IJ 4C7NA 4ID1A 4B3OA 2Z5IA 4H0LB 5AQOA 4GV6A 5AW2B 1RT3A 1OW7A 3PV8A 3OA7A 3IRXA 2H88C 4A7PA 2E4LA 1VSFA 3LW5H 3VQ5A 4BR4A 1M90Q 2FYUK 3RRHA 4DZOA 2JEEA 3K5NA 3WEEB 2JWDA 4K43A 3GHGA 2M5AB 3NXSA 2M3EA 2Y0CA 2W6KA 3LDOA 1Y47A 1CZBA 4CF2A 3CWBG 2A42A 1BCCJ 1C1CA 5AVSB 2M8RA 3L3VA 4B8CA 2QWLA 3HD7D 1VQ4P 3R8EA 1X8YA 4FWQA 3L6QA 2Q2RA 2WSCH 1RCHA 4OVLA 5AZJA 1YUWA 4FXDA 1CSBA 4RCHA 4H13C 1QQOA 1RTHA 1WSEA 2VCPA 1NK8A 4KREA 2HHHK 3LDNA 2P58A 4ZKUA 3SUQA 4C7NB 5EVZA 3U4LA 1XTCC 1NU1G 1CI6B 3WUTA 5CYMA 1KYOD 4WQ4C 4F3TA 1FJPA 4CF8A 1W2BO 3QINA 3BZKA 3M9HA 5B8HA 3B6OA 5KLVD 2P51A 2FYNB 3KJVA 4DTSA 4JEPA 1M1KO 4JD2A 4W5OA 1RTJA 3VEVA 4BRKA 1L0LK 1AVYA 1KFMA 5HP1A 2K3RA 1JJ2M 5AW6B 2FYUG 2RKLA 1B9DA 2CGLA 3A2FA 1HNVA 5AZJB 3O1WA 2VQEK 1S9KE 5HLFA 1QEXA 2IDOA 4BR0A 3L71E 2ZT9D 2JLEA 4CJSA 2BCCE 3MN9A 1S5JA 3ABVC 1HYZA 4KKOA 3SWYA 3ZSOA 2IAJA 1H88A 1KYOH 5AVZB 3PLNA 1SL2A 1CLQA 3M8QA 3CD6P 3B5ND 3O4QA 3CPWM 2IOCA 2OZMA 2HVIA 3L74G 3HUSA 3A5LC 3I55N 3OYAA 1QGKB 4PV1D 4LFAK 3CCUN 4JD2B 2YKQA 3ATVA 1NGFA 5CZ2A 1J5OA 1PL5A 4OPKA 1GLLO 1Z26A 2N9YB 1HJOA 3BRTB 2CGJA 2GBZA 1PGQA 3RL0C 3L73J 1ZC6A 4D6TJ 1YJ9P 1EXJA 2GA1A 2O01H 2YHAA 3K9KA 1WSFA 1KILD 1NHLA 3CCMN 5KKZB 4C8OA 1WLJA 1L0LG 5GADP 3K5BA 5KLVK 3C6UA 1KD1O 5F0XA 3TTFA 3L72D 1BA0A 1VDFA 1VSJA 4KTZA 2KZIA 3J7AP 3CCJP 3FZKA 2O4IA 2WPRA 3LP3A 2BUPA 4JI0K 4L75A 1KAXA 3JCUH 3E66A 4B1ZA 4YNQA 1M90O 4H44D 4JKBA 1FJKA 2E20A 1N7SB 4I9LA 4WQ4A 1JY2P 1LTBC 2VG5A 1WSJA 3CL3D 1GL2C 2QE7H 3IR9A 1HF9A 5KPTA 2PRRA 4EAHD 3THXB 4B9MA 2R32A 1OKJA 2E1YA 1BGYE 1BUPA 4CJQA 3L3UA 4QS7A 4ILJA 1TU3F 3BGRA 4Z4EA 4DR7K 4CJ3A 3VN5A 3BCCD 1QVFO 4I7FA 1IO4A 4L76A 1VQMP 3TAMA 4DTPA 3L2VA 1S6PA 3NF6A 4H13B 2FBYA 5DK5A 4BRLA 4CJ7A 3CX5D 4JQ0D 5CE3A 5CCGD 4JNEA 5AVWB 1BI4A 3WNFA 3EY1A 5KLVG 2NPSC 4MLEA 4EHUA 3SK3A 1HMVA 3CXHE 2OGUA 3P32A 4H4OA 3JSVC 2A41A 3HOSA 2OTJN 4DLGA 4JI6K 4MO4A 1JLEA 2Q0UA 3HPGA 4I2PA 4E7HA 3F9MA 2KSJA 2RN2A 3CFOA 4CW7B 1IK7A 5KRTA 4E1NA 2G8IA 1U7MA 4AH9A 4BRIA 3Q5PA 3A0BH 1Q9YA 1ZBHA 2F7TA 3SWFA 2QWRA 1Z56A 3CJ1A 3JC22 3OYKA 2JJLA 2HPCB 3CC2N 1SS1A 3UIQA 1Q86Q 1BIZA 2V7YA 4N56A 1HKBA 4XH1A 3CERA 2NNWA 3DLGA 3CX5H 3QFPA 4WFBL 3ULDA 3DOLA 2Z1HA 3DLRA 3TANA 3O8ZA 4KHXA 1QQNA 3GF3A 5AQVA 4IXCA 2KYVA 2K37A 4H0XB 5AQJA 4YHHK 4E3SA 3A5TA 2WPQA 4X64K 3SCXA 3THVA 1KQLA 3ZSQA 5GIPA 1NAFA 3GE1A 3L2UA 2A45I 1YXQA 5KGXA 2PFXA 3U9DA 5GAEP 3SQ1A 4NLBA 5D3GA 2HNYA 3AEBC 2QRXA 4BR5A 3OY9A 3OS0A 4LF6K 4JS5A 2DTUA 1GL2A 1FZCB 3F5TA 2HHTA 1SQBG 1JM0A 5K14A 3DAWA 1VQ8P 4JI4K 4Z1MH 1SS6A 1PPJD 4B9NA 1M8OB 1G1JA 4O0IA 1S5LX 4CJEA 3VMXA 5GTIE 4B9UA 5JVHL 2C0WA 1NOZA 1RF0C 2IFMA 5CHIA 2OYIC 1KV4A 2CGKA 2D4WA 2IYOA 4KAZA 3ZYYX 5AVTB 4I6MC 1N7LA 3RL0g 1IFPA 1A5VA 4FWLA 4O4GA 3F89A 4OGQD 2RKIA 1YIJN 4A62A 1DGKN 1EZVG 2R5DA 1N2DC 4TT3H 5CMZA 3SAHA 4KHQA 1EO1A 1ZRTD 5KAIE 2NPSA 2E75C 1OZHA 2P2UA 4FL9A 3T3FA 4CF9A 3V81A 1BISA 4BQZA 4KI4A 3VQ4A 1C0TA 2ZVNB 4H5NA 4CIFA 1GL2B 1M1JC 1FBMA 4KHYA 4IZ9A 3SBTA 2WQYC 2ZE2A 3MAQA 3K9JA 2F9WA 2ZXXA 3BCCG 1TUYA 4DSIA 3AVAA 2A40A 3WXLA 3IKMA 3CXCM 2HB5A 3RVCA 1HNXK 2ZFCA 3O3GA 1K8AO 1NGCA 3D6YA 2R5BA 4ZTFA 3T1YK 1S72P 4N5SA 1LTIC 4W5QA 1OVYA 1X0TA 2XZRA 3HSCA 1VSMA 5E79E 3TARA 1YITP 4PD4E 1YJ9N 3PTZA 5BN8A 4IDKA 1EWRA 2IFNA 1BE3E 2NZ2A 3Q5SA 3EWKA 2PBDA 1KQFB 4FVUA 5KJ7D 3AVNA 1EKEA 3K57A 2JDIH 2R3SA 1VQ9N 1JCEA 3TTDA 1T8ZA 4CJUA 3VF4A 4R4LA 4GKGA 3HZ6A 3QBWA 1IFDA 1HNZK 5H2FH 1RBRA 4CECA 2QM1A 1U49A 1Q86O 4B9TA 4BR7A 4JRPA 4NPEA 5SWMA 2D0BA 2AEFA 3II6A 1YTAA 3H3NO 4FYDA 4E1JA 2OYHC 3VGLA 5C25A 5AQYA 3V5BA 1G99A 5C10A 4U7BA 3F5HA 2RHKA 5CJ0A 5M1NA 3QDKA 1SLQA 2RPIA 1GLCG 3RMBA 3VQ9A 3QBXA 2WVRA 2R3CA 4ICLA 3O5BA 2OTLP 3H1HJ 2O8CA 2Y1JA 1RF0A 4DS4A 5GAGP 1MA9B 3WQTA 3CCVP 2OYIA 3I8BA 3OVNA 2QKKA 4FJLA 1VQMN 1RDAA 3RBXA 4KT0J 2K9JA 4YTPC 5J2PA 2N1TC 1NMDA 3VQPA 3HJFA 3K2PA 4I6MA 3AE1C 1SQPE 1PGPA 3LWLA 3QIOA 2IVPA 3NMDA 4E7KA 1ESVA 3AA4A 3LDQA 4KO0A 1Z05A 3OHRA 3I33A 1YTZI 3EFGA 3OBWA 1PPJG 1KVBA 4ZTJA 3WNHA 3U1CA 3P31A 1BCCD 2E2PA 1QE1A 3ALYA 2G8UA 1M1JA 2E5LK 3UKUA 2ZYDA 4ILGB 3C6AA 3VYIA 1SQQJ 1FOSF 4H0OA 1S4XA 4ZKPA 3AO3A 3L4QA 4MN4C 4U7JA 3D71A 4NCGA 2Z1IA 4PJ0H 3QEPA 4OLAA 4CHZA 1SQVE 5AVVB 2OYIB 3MX5A 1ZBLA 3EYZA 1E3MA 2IVOA 4DU3A 4JN4A 4OO1J 3KWIA 2PGDA 3LDLA 3QIPA 3V2RA 4I6MB 4OX9K 3H1JJ 4IWVA 5LL6Z 4DKWA 3PHLA 4EZ6A 2AJQA 2KLUA 3HXMA 4CZGA 5GIOA 1GOBA 3LAKA 1KFNA 4CK3A 4LD0A 4H0PA 3GDQA 2DFHA 3U8XA 1MDUB 5TKYA 1BA1A 2B88A 1GK6A 3WU2H 3G6EP 4GKJK 1M1JB 2P9LB 4EP5A 3UKUB 1IKXA 4H0TB 5AW0B 4FJGA 3P5JA 2O1JA 3L36A 5E84A 3GMAA 1VRUA 3ITHA 3CC4P 3AE9C 2NRZA 3N4QA 3CLQA 4BWMA 1L0ND 1LW0A 3GOIA 3MCPA 3S3OA 2OYHA 3VEXA 4FOEA 2IBZI 5JVGL 2JR8A 2QIWA 1WSIA 1VQ6P 3L35A 4I1LA 1YTUA 1NK9A 1VQ8N 5KQDA 4B9VA 4W5NA 4NO7A 1YJNN 3HD7C 4CBXA 1GU5A 3VMYA 4WFAL 3O3HA 4O9BA 4LF4K 1U7JA 1NTME 4Z0UA 3MEEA 4HJGH 3I0RA 1ZP0C 2E76D 3AE4C 2OPPA 1JO5A 2QTDA 3FR0A 3CM6A 4FLVA 3U1AA 2N1TA 1P90A 2GUSA 3KWGA 4O5FA 2ZM6K 4H4MA 5FPEA 1VSIA 4B9QA 4F9OA 3L73D 1DD4A 3WXIA 2P9NA 4D6TD 2W6BA 1VF5D 5APXA 2QWQA 1MZ9A 3O6WA 4DU1A 3H1KG 3VETA 4CGDA 4HUEA 2UUBK 3BEXA 1IKWA 3GBTA 4YOXA 1EX4A 3WT0A 3AAPA 2IGIA 3AO2A 3O9SA 1TKTA 3L71J 1EXIA 3M91A 1X3NA 4CJRA 3MP7B 2BCCJ 1H89A 3Q7BA 4KBOA 3OS2A 3VESA 1N36K 3GW6A 2KI7B 4CF0A 1N33K 1L3VA 4XFJA 5CBOA 1KCFA 2DFFA 4DV0K 2ZT9C 3VQQA 2N1TB 5HROA 1JLBA 1L4AD 3HPHA 1HPZA 1PGOA 2GWKA 3K0SA 1HUXA 1GLFO 3E1RA 3UE5A 4H5WA 1JY3P 4EDFA 3OYDA 1UIXA 3O9RA 4FWPA 1SZ2A 1IO2A 4W5TA 4DSKA 3EL2A 2P9NB 3RRGA 2OQQA 3LP2A 3C6TA 1N6QA 4IL6E 3TGUG 2FXUA 3VQ7A 2AA4A 4GT1A 4CERA 4PV1C 4AILC 3NGZA 1KTMA 1VQNP 5ADXA 1J5EK 2QXFA 1NWQA 3SAFA 4BDYA 1IFJA 2E2NA 2WPVB 1BGXT 3EFFK 3CWBE 2HMPA 2ZGZA 4AM6A 3VEYA 3ZSXA 3P7KA 1QZ5A 1QHAA 5FLXO 4L8RB 5GTHH 1TL1A 1TUUA 4CZJA 1S1WA 3EN9A 1IBKK 2WBNA 3DXKA 3PH0A 2AEMA 3SWKA 1KILC 3A0IX 2A45G 1BU6O 3HD7A 3CMEP 5AQLA 4PKHA 2OYQA 3HTKB 3MDQA 1X3MA 4B1XB 4FJXA 3NFQA 5FROA 1HTLC 2A3ZA 3DLKA 3ZX3A 4DR2K 4B3TK 4FJKA 1S1CX 1JNMA 3LL3A 1NU1E 2ASPA 1R59O 1FKOA 1JMMA 3TSQA 1NYHA 2QKBA 4YXWH 1L0NG 4UY8O 4H44C 1AA0A 3AVJA 5FRNA 4H0VB 2GEMA 1BGYJ 2QEXP 2E5YA 4I7ZC 1JCGA 2HYNA 1TKZA 3BP8A 1VQ7N 1J6ZA 1NKEA 5TISH 3SAGA 4IFEA 1LWFA 1FZAA 2BANA 1LT1A 1SAZA 4NXMK 3DXKB 4C23A 2O8DA 3LIEA 3MX2A 5AFUA 2J4RA 1M57D 3HD7B 1OH8A 3G4SP 2UUAK 3G9RA 3EZ5A 4KTQA 4UB8H 1RBTA 3QWOC 1J54A 3VEZA 2QK9A 1BDCA 1YHQP 1KQSM 4LF5K 1ZBFA 3DI6A 3M6GA 2KTQA 3C1LA 3OTOK 3BATA 3L73G 4QCLA 2F96A 3Q7CA 4KFBA 2FKWB 2D0OA 4QMAA 2P9PA 2HODA 1VQKP 4Z4FA 1BHLA 1J1DC 4LGDE 1MFTA 3V2NA 1KXPA 3IDHA 3WQUA 3C9IA 2O01N 4E19A 5C15A 3LP1A 2ZJSE 1T2KD 3AVIA 4G9ZA 4Q5VA 1RDUA 2ASOA 4YOUA 2ITGA 3LAMA 3IAOA 5FPDA 2BH1A 1DIPA 2IBZD 1NTKD 2Q31A 2KKZA 1ZYQA 2QM8A 3TF5A 3CJAA 2VG6A 1S1VA 3AE8C
chains in the Genus database with same CATH topology
4OH8B 3PO4A 5CCHC 4RG8A 3DLBA 4DTXA 1DTTA 1HYSA 1KILA 2PZSA 4FJJA 4CHOA 2KOGA 3M0AA 4LH5A 1SL0A 3OYLA 4I9QA 1ITGA 3PP5A 4O44A 1VSLA 4CGJA 5J2MA 3OYCA 3M8SA 1KRPA 3P8MC 3FFIA 4AHVA 1ZR2A 5HBMA 1RDBA 4WY4D 1JUNA 3KDPB 3VQAA 3HSTB 4E89A 1J9AA 2C9LY 4IFVA 3V1OA 4IFYA 3CFPA 3HE5B 3U3YA 4CESA 3I8DA 1QSLA 1NTKK 2P7JA 3QNOA 4LSNA 2O4GA 1BIUA 1FKPA 4DSFA 1FAVA 3VQCA 4Z4HA 1HQEA 3DRSA 4JS4A 5AW7B 2C0XA 1LT9C 3G0ZA 2F8SA 2XDJA 1IFNA 3ASMA 2VWJA 4WB4A 1C1AA 4KV8A 4FLWA 3HE4A 4DTMA 1ZBIA 3KQGA 1XHXA 1T05A 1F21A 3T97A 1RE3A 3PY8A 1M7LA 5CCHA 3P83D 3MEDA 1L3TA 2E6LA 4CEEA 3MD0A 3KKSA 5AW4B 2A1SA 2DY4A 3G3ZA 1TVRA 1EP4A 4C8KA 3KIOA 5KJ7C 3GHGB 1JY3O 4CJPA 4JRQA 1UWBA 3MIWA 3RR8A 1BL3A 3RR7A 5APQA 3TAFA 1XI1A 3HE4B 5AVXB 1L3UA 1R0AA 3QEWA 3V9SA 2DFEA 4FJHA 2ETJA 4Z4IA 4EOTA 2XY6A 1CXUA 1RNHA 2D0AA 2FBTA 2P5GA 1D9DA 3OYMA 3RK2C 1IKVA 4F2RA 1L5UA 1RT2A 3KK3A 3ZT0A 3AO5A 2IPPA 2FFDC 4NCBA 1SUQA 2KB7P 1LTGC 1LT9A 1XTGB 4DTNA 1U04A 4FK4A 1JLGA 1SQQK 4KHNA 5APVA 3OYEA 4E7JA 4PY5A 1KLNA 3PUFA 3V2QA 1RILA 2LSNA 1OXZA 3HUSB 1FXXA 4CEQA 2N9BA 3L2QA 1RT4A 3TSIA 4BDZA 5KJ7A 1T8EA 4CIGA 1MUUA 1NK7A 1IG9A 3MXMA 3VP8A 4I2LC 1SKRA 3MTUE 4MQ3A 1HQUA 3S3MA 3V2PA 1QTMA 1SQXK 1NK0A 1G2CA 1GOCA 2GUVA 1A02F 3OYHA 2P5OA 4DF8A 4DFJA 4C7RA 5HRNA 4FJ7A 4YFUA 3V9WA 4FM2A 4DSLA 1RT5A 1JLCA 2OARA 4RW4A 2VWKA 2Q7CA 4PWDA 2H43A 1EETA 4F3OA 2FFDA 1KTQA 4FJ9A 3VQ8A 1SKSA 3KK1A 1G2CB 3SV3A 1GW4A 1BI4B 4CEBA 1KSPA 4J2AA 2XRIA 5CHXA 5KTBA 5CY4A 5J2QA 2YHBA 3ZCMA 5KTQA 4Y1CA 4IG0A 4CFAA 3HT3A 3RK2B 1L4AC 4LH4A 3K5LA 1KLMA 3V4QA 1RF1C 4R5PA 2FFDB 1WRGA 1S9EA 3JSMA 4E7LA 3L4FA 1QL2A 3RL0B 4AHTA 4KRFA 3DYAA 4RESB 4Q0BA 1YT3A 4CHQA 4Y1DA 2WTYA 1RT1A 1NJZA 1FK9A 4EZ9A 3L8BA 5AVYB 2WT7A 3QEXA 3WMM0 3NCIA 1RT7A 3KPEA 4CF1A 3LDSA 1IFIA 2IC3A 2YNIA 1TKXA 3OYFA 2BGGA 1GW3A 4DTRA 4B9LA 1NJWA 2POHA 1MV8A 1N7SD 2X6SA 4FJNA 3HL8A 3TAQA 2XY5A 5EU7A 3SYZA 3HVRA 1B9FA 3VQEA 4M45A 2EHGA 3AVLA 4KHUA 1G1IA 2Z1GA 2XU6A 4FK2A 3LPUA 5DMRA 2NPSB 2WT7B 3V9ZA 4FJIA 4Y99C 2OPRA 4DFMA 3PO5A 4GMJB 1WN7A 4DF4A 4M3TA 2YNGA 3TAGA 4DG1A 1L4AA 1JY2N 1D8YA 2GUIA 4FZYA 1RF1A 1HUCA 1J1EC 3ZT3A 3KLGA 1IJDB 5HRSA 4O0JA 4FLUA 3VQ6A 2D0CA 1KFSA 3ZT1A 4WE1A 4KI6A 2HFED 3PX0A 3CQ8A 3LIDA 2P1JA 3MEGA 1JXBA 3V4IA 1GD2E 4J2BA 3MUDA 1SFCD 2Q3IA 1JY2O 2OPSA 3QNNA 2KFNA 3IS9A 4RW6A 2PY5A 3KD1E 3TYYA 5T7BA 1IC2A 4UQGA 4AQRD 2X78A 3OYGA 4WY4C 2BASA 2ZXEB 1GK4A 3VA3A 1RT6A 4I2QA 1LTTC 4CGFA 3JYTA 3VOPA 2WONA 4CJVA 3QEIA 4OPJA 4BDPA 3DRRA 3HP6A 3U6FA 1LWEA 3SUPA 3BDPA 2HHQA 5APUA 3VN0A 2M3BA 3RK3D 4B9SA 3U3GA 1DH3A 3O3FA 1EQ7A 2KZMA 1X9WA 1B92A 1URQD 2E6MA 1HJBA 1HNIA 5APSA 2B4JA 2YO3A 4AUWA 4B8AB 1NKZB 3H08A 3TAPA 4DQQA 4HCCA 2Z4EA 3CYMA 4XA4A 3KYQA 3C95A 2F8TA 4CK1A 2FBXA 4M3RA 2G8VA 1I39A 2OYHB 1RTIA 1NKBA 2IX7C 1ASVA 1QHTA 4OKEA 2HHXA 5C24A 2G8KA 3L2WA 4NCAA 2W42A 3V6DA 5HRPA 2L5GB 2FBVA 2O1KA 1YTZT 1BQMA 2WOMA 4WY4A 3BRVB 3M0DC 4HTUA 1FDMA 4KB1A 4CJWA 3WNGA 1TGOA 2EX3A 4DSJA 1ZV8A 2J59M 3B5NC 1QS4A 1LWUC 4AYCA 1NK5A 1ZN5A 3NGIA 4NYFA 1Q9XA 2HVHA 1E5WA 1JL2A 2OPQA 3E1IA 4O5BA 1VSHA 3AVGA 3SPZA 4WY4B 4CCHA 1C0MA 1A02J 4HUGA 2ZD1A 3AVFA 1VRTA 1DLOA 2PP6A 1HH0A 4BE0A 2CPBA 2XO7A 2KQ2A 3AA2A 4RW7A 1U4BA 5AW9B 2KP8A 2I1JA 3KLEA 3E01A 4LC1A 1Q8IA 1YVUA 3NTNA 3V9UA 1NJXA 3RMDA 3TK1A 4PQUA 2HG5D 1QL1A 2QM7A 2HNDA 5AW3B 3DLEA 3QESA 1WAJA 5FRMA 1KFDA 2YO2A 3QERA 3M0DA 5AW1B 5CCGC 1NTMK 4LY7A 1LV5A 1O1WA 1JLAA 3T19A 1X79B 2YNHA 1U47A 1FZFA 3KTQA 3B5NA 3P8CD 1SKWA 4LSLA 1LWUA 1SL1A 1ASWA 4J2DA 1PFIA 1D5AA 3NAEA 3S3NA 3HYFA 5AW8B 3KKRA 3M9QA 3T1AA 3CG7A 4DWIA 1NOHA 2WPSA 3HVTA 4JF7A 1JCCA 4Z4GA 1VSKA 1VPCA 4KHSA 2HODB 3AV9A 4FW1A 3B5NB 4M41A 3SV4A 1X9VA 1T3UA 2KFZA 1Y97A 3OS1A 3QETA 4IKFA 4OKKA 5J1EA 3SJJA 3DMJA 3NF7A 1DEBA 4DQRA 4C8MA 2KZZA 4N78D 3A2AA 4M42A 1KILB 3SUOA 3AVMA 3TAEA 1I3AA 4BWJA 2OZSA 4IFFA 4OJRA 4E0DA 3V9XA 3HP9A 2H8PD 3AVBA 1KVAA 1VK0A 3WNEA 3UIAA 5CCGA 3OJAB 1JY3N 3A3YB 1UOCA 4G1QA 4EIJA 3D0PA 4HH2A 4N3YB 1XHZA 1VSEA 4DS5A 4ELUA 3AA3A 3DM2A 1TKDA 3HPOA 1CI6A 1N7SC 1RE4C 4W5RA 2WSFH 5HRRA 1A5WA 1LAWA 3V1QA 1XC9A 3AVHA 3SQ4A 3TABA 1NKCA 2XHBA 1WSHA 1J1DB 4W7ZA 4FLTA 1LTAC 3B6PA 1HYVA 3OJSA 1JXEA 4CJFA 1TV6A 4OGEA 1TL3A 1CZQA 3IG1A 2WITA 2RF2A 3MXIA 2Q5UA 5AVUB 5AVQB 1REVA 4E7IA 3P1GA 1WNSA 3CM5A 1QQCA 4B08A 4ID5A 3SNNA 1EXQA 2HHUA 1J2JB 2YKMA 4TSXA 4HUFA 4CJ5A 1QSSA 2B6AA 1W2EA 3ZSWA 1SFCC 1SV5A 2G8FA 1MU2A 4EP4A 1UAXA 3NH1A 2HMIA 1ZBUA 3TI0A 1JTHA 5CYQA 2XNXA 4OGCA 3HRNA 4IBNA 2BDPA 2HNZA 4FJMA 1N7SA 1RE4A 1N73C 4BE1A 1FZCC 1YYCA 3OYIA 3VMZA 3ZSVA 2YMYA 5BU8B 1NJYA 3M8PA 2X74A 4CHNA 3KK2A 3L2RA 3AVCA 2LKMA 4DOJA 5FDLA 5JS2A 1S9KD 1J53A 4CJ4A 1LT9B 2YKOA 2HLOA 1JTHB 4JYCA 4M3XA 4DU4A 4C8LA 3RK3C 1FZEA 3SPYA 1G15A 1HJRA 2KW4A 3KLIA 5KI6A 3LZJA 1URQC 4DFKA 3DLHA 1JLQA 4NYNA 4ZHRA 4MFBA 1D9FA 2HPCA 4N76A 2FXMA 3MXJA 2B5JA 2GV9A 2YNFA 1C1BA 3RWUA 1RBUA 1GOAA 3CFRA 1JCDA 1SFCA 1RBSA 3NHGA 3ZSZA 4FCYA 5C42A 4XE5B 4FM0A 3VA0A 1SQBK 1WSGA 3D45A 1NO4A 4CJKA 4F4KA 3SI6A 1RDDA 1S6QA 2Y1IA 3OJUA 3LANA 4CGIA 1N73A 1FZCA 1LWCA 3NBPA 4RW9A 4AHRA 2HHSA 3M06A 4K8XA 4E1MA 5CCHD 5CJ4A 4CIEA 2YNYA 1LW2A 1HGVA 4CEAA 1FU1A 3AO4A 3LWMA 1T7PA 3LALA 2ZQBA 1SFCB 4DLEA 2PYJA 1CW5A 3OYNA 4OKJA 4DQSA 2HW3A 4CJLA 4FLZA 3IAYA 4H8KA 1N73B 4CK2A 1UA1A 2VRSA 1URQA 4DQIA 3ZSYA 4XIUA 3AVKA 4RW8A 4Z4CA 2WSEH 1HVVA 1GU4A 5BU5A 4DTOA 1IKYA 4GIFA 5KRSA 2H7HA 1BCOA 4FM1A 1VSDA 4ELTA 3H6PA 2XKMA 3RK3B 3ISNC 4M3UA 1GZLA 3TNUA 3LZIA 4HYTB 1TK0A 3RTVA 1KZUB 3C94A 1URQB 1ZLLA 1NKNA 4PUOA 4DMNA 2XY7A 4F8RA 4J2EA 2YKPA 1L3SA 3MECA 3OAKA 1A5XA 2W27A 1HRHA 5CZ1A 1JLFA 3LPTA 4C8NA 4N41A 2XV5A 3PX6A 4GW6A 2WZ7A 1T2KC 3TNUB 3R2PA 4CJTA 4M3ZA 2HHWA 1TAQA 4KTWA 5APYA 3VQBA 3K58A 4FJ8A 1W9HA 1FOSE 3U59A 4ELVA 1NOYA 5BVZA 4AHCA 1L4AB 1X1PA 3SQ2A 2X6NA 2W6AA 1RF1B 4KB0A 3BVHA 3QEVA 2D5RA 2J58A 3RK2D 3KD5E 4CGHA 1W0HA 1S9GA 3M8RA 1UA0A 1LAVA 4LLHA 3H32A 2HHVA 3RL0D 1ASUA 4AHSA 1N86A 2BE2A 3MGNA 3RMCA 4CEZA 3S9HA 1SVFA 3LP0A 1CXQA 4CHYA 1U45A 5I3UA 2YV0X 2CPSA 2Z1JA 1GL2D 1T3JA 4DFPA 1MFZA 3H32B 4FLXA 3TR8A 4AHUA 4K8ZA 1WT6A 4IFDK 3VP9A 4FLYA 4KPYA 5SZTA 3DOKA 4N47A 4CEFA 3SZ2A 3NH2A 4Y99B 3IFMA 1N5YA 3OYBA 2IS3A 2PAJA 4QAGA 2GM4A 4QOZB 2NPSD 1JKHA 3K5MA 3CI9A 3HK2A 4CFCA 3QLHA 4W80A 1JOCA 1J1EB 1NH4A 2A45H 3NDKA 1X9MA 1DTQA 4HCBA 5I42A 1OWAA 4FK0A 3NF8A 2ATQA 2VG7A 4JLHA 3DRPA 2C9NY 3TWHA 3VQDA 1SQPK 2A1RA 1LTJC 2Q3SA 1C0UA 3QO9A 3V1RA 1AQ5A 4DSEA 3I0SA 1NTZK 3L37A 1L0NK 1ZR4A 2PYLA 3NE6A 4WBAA 3HTKA 3N4XA 3VTPC 5AVRB 4HVJA 1RTDA 4HHTA 4B86A 1SQVK 3V4WA 1TAUA 4BE2A 3G10A 1CZ9A 5APWA 3P8CE 3I5CA 3M9BA 2Q9IA 3F9KA 1AFOA 3SUNA 3A7OA 3K5OA 4CEDA 3HO1A 3N7NA 1S1UA 3ZSRA 1K6YA 2WWWA 3ZT2A 1RY3A 2P67A 3NGYA 1HGZA 3AO1A 4OLBA 4KHWA 2G8HA 3O4NA 2MJZA 1RDCA 4IFMA 3ZT4A 4DTJA 4IG3A 4N6JA 2I5JA 2OA8A 3SQ0A 1IK9A 1WAFA 1RBVA 5KGWA 1IH7A 2FYZA 1BQNA 1T03A 3PX4A 1HWTC 1LTJA 5JS1A 4CEOA 5J2NA 1X9SA 4M3WA 4N78E 2JGUA 3NH0A 4FZXC 1IFMA 1JL1A 1S1TA 4GVMA 3KLFA 3GHGC 1NK6A 3RMAA 4PA1A 1C6VA 1FZGA 2Z5HA 2E42A 4FW2A 1TK5A 3B8EB 4JYBA 4F2SA 5APTA 1KVCA 4DTUA 4CFDA 4CFBA 1LTJB 1LWUB 1RE3C 2N1TD 4CE9A 4M3YA 3AA5X 4C46A 4M3LA 1GTWA 1GDTA 3HM9A 3HE5A 1FZBA 1HBWA 1QSYA 4FJ5A 3EQ2A 1U48A 3K59A 4CGGA 3OYJA 2YKNA 2KLVA 4FZZA 4W7YA 5E41A 2I1KA 1H8AA 1S1XA 2R7YA 4BACA 2G8WA 3KLHA 4DQPA 5AW5B 4O55A 3F73A 1LGHB 1TK8A 2NUBA 1LTSC 1Z25A 1NU1K 4CHPA 2XY8A 3BASA 2FC0A 3NFAA 1SP4A 1BCMA 3HUSC 1DX7A 2E43A 3NF9A 1XWLA 1NK4A 4FVMA 4C7NA 4ID1A 4B3OA 2Z5IA 5AW2B 1RT3A 3PV8A 3OA7A 3IRXA 2E4LA 1VSFA 3LW5H 3VQ5A 3RRHA 2FYUK 4DZOA 2JEEA 3K5NA 3GHGA 3NXSA 1CZBA 4CF2A 1C1CA 5AVSB 2M8RA 3L3VA 4B8CA 3HD7D 1X8YA 2WSCH 1RCHA 4OVLA 4FXDA 1CSBA 1RTHA 1WSEA 1NK8A 4KREA 4ZKUA 3SUQA 4C7NB 1XTCC 1CI6B 5CYMA 4F3TA 1FJPA 4CF8A 3QINA 3M9HA 3B6OA 2P51A 4DTSA 3KJVA 4W5OA 1RTJA 1L0LK 1KFMA 5HP1A 5AW6B 1B9DA 3A2FA 1HNVA 1S9KE 5HLFA 2IDOA 2JLEA 4CJSA 1S5JA 1HYZA 4KKOA 3SWYA 3ZSOA 2IAJA 1H88A 5AVZB 1SL2A 1CLQA 3M8QA 3B5ND 3O4QA 2IOCA 2OZMA 2HVIA 3HUSA 3OYAA 2YKQA 5CZ2A 1J5OA 4OPKA 1Z26A 3BRTB 2GBZA 3RL0C 2O01H 2YHAA 1WSFA 1KILD 1NHLA 4C8OA 1WLJA 5KLVK 3C6UA 1VDFA 1VSJA 4KTZA 2O4IA 2WPRA 3LP3A 4YNQA 1FJKA 1N7SB 4I9LA 1JY2P 1LTBC 2VG5A 1WSJA 3CL3D 1GL2C 3IR9A 4B9MA 2R32A 4CJQA 3L3UA 3BGRA 4Z4EA 4CJ3A 3VN5A 4I7FA 4DTPA 1IO4A 3TAMA 3L2VA 1S6PA 3NF6A 2FBYA 5DK5A 5CCGD 5AVWB 1BI4A 3WNFA 3EY1A 2NPSC 1HMVA 3P32A 4H4OA 4DLGA 1JLEA 4I2PA 3HPGA 4E7HA 2KSJA 2RN2A 3CFOA 5KRTA 4E1NA 2G8IA 4AH9A 1Q9YA 1ZBHA 3SWFA 1Z56A 3OYKA 2JJLA 2HPCB 3UIQA 1BIZA 4N56A 3DLGA 3ULDA 3DOLA 2Z1HA 3DLRA 3TANA 3O8ZA 4KHXA 2KYVA 4E3SA 3A5TA 2WPQA 3SCXA 3THVA 1KQLA 3ZSQA 1NAFA 3L2UA 2A45I 5KGXA 3SQ1A 5D3GA 2HNYA 3OY9A 3OS0A 4JS5A 2DTUA 1GL2A 1FZCB 2HHTA 5K14A 4B9NA 1G1JA 4O0IA 4CJEA 3VMXA 4B9UA 2C0WA 1NOZA 1RF0C 2IFMA 2OYIC 4KAZA 5AVTB 4I6MC 1N7LA 1A5VA 4O4GA 2RKIA 2R5DA 4KHQA 1N2DC 5CMZA 2NPSA 2P2UA 3T3FA 3V81A 4CF9A 1BISA 4KI4A 3VQ4A 1C0TA 4CIFA 1GL2B 1M1JC 1FBMA 4KHYA 2ZE2A 3MAQA 4DSIA 3AVAA 2HB5A 2ZFCA 3O3GA 4ZTFA 2R5BA 4N5SA 1LTIC 4W5QA 2XZRA 1VSMA 3TARA 4IDKA 2IFNA 5KJ7D 3AVNA 1EKEA 3K57A 1T8ZA 4CJUA 4GKGA 1IFDA 1RBRA 4CECA 1U49A 4B9TA 4JRPA 5SWMA 2D0BA 3II6A 1YTAA 4FYDA 5C25A 2OYHC 3V5BA 5CJ0A 1SLQA 2RPIA 3RMBA 3VQ9A 2R3CA 4ICLA 2Y1JA 1RF0A 4DS4A 4FJLA 2OYIA 2QKKA 3OVNA 1RDAA 5J2PA 2N1TC 3VQPA 3HJFA 3K2PA 3LWLA 3QIOA 3NMDA 4E7KA 3AA4A 4KO0A 1YTZI 3EFGA 4ZTJA 1KVBA 3WNHA 3U1CA 1QE1A 3ALYA 2G8UA 1M1JA 3VYIA 1FOSF 4ZKPA 3AO3A 4NCGA 2Z1IA 3QEPA 4OLAA 4CHZA 5AVVB 2OYIB 1ZBLA 3EYZA 4DU3A 3QIPA 3V2RA 4EZ6A 2AJQA 3HXMA 1GOBA 3LAKA 1KFNA 4CK3A 4LD0A 2DFHA 1GK6A 1M1JB 4EP5A 1IKXA 5AW0B 4FJGA 3P5JA 2O1JA 3L36A 1VRUA 3ITHA 3CLQA 4BWMA 3S3OA 1LW0A 2OYHA 1WSIA 3L35A 4I1LA 1YTUA 1NK9A 4B9VA 4W5NA 3HD7C 1GU5A 3VMYA 3O3HA 4O9BA 4Z0UA 3MEEA 3I0RA 2OPPA 1JO5A 3CM6A 4FLVA 2N1TA 3U1AA 2GUSA 4H4MA 1VSIA 2W6BA 5APXA 1MZ9A 4DU1A 4CGDA 4HUEA 1IKWA 1EX4A 3AO2A 2IGIA 1TKTA 3M91A 4CJRA 1H89A 3OS2A 4CF0A 1L3VA 1KCFA 2DFFA 3VQQA 2N1TB 5HROA 1JLBA 1L4AD 3HPHA 1HPZA 1JY3P 3OYDA 4W5TA 1IO2A 4DSKA 3RRGA 3LP2A 3C6TA 1N6QA 3VQ7A 4GT1A 4CERA 4AILC 3NGZA 2QXFA 1NWQA 4BDYA 1IFJA 1BGXT 3ZSXA 3P7KA 4L8RB 1TL1A 1S1WA 1KILC 2A45G 3HD7A 2OYQA 3HTKB 4FJXA 3NFQA 5FROA 1HTLC 3DLKA 4FJKA 1JNMA 1FKOA 1JMMA 2QKBA 3AVJA 5FRNA 1TKZA 2HYNA 1NKEA 1LWFA 1FZAA 2BANA 3LIEA 3HD7B 3EZ5A 4KTQA 1RBTA 1J54A 2QK9A 2KTQA 1ZBFA 3DI6A 3BATA 4QCLA 2F96A 4KFBA 2FKWB 2HODA 4Z4FA 1BHLA 1J1DC 4LGDE 3V2NA 3C9IA 4E19A 3LP1A 1T2KD 3AVIA 4Q5VA 2ITGA 3LAMA 1ZYQA 2QM8A 2VG6A 1S1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKY A;  4HCC A;  5KRS A;  5CZ2 A;  1J5O A;  3CYM A;  1BCO A;  4OPK A;  1Z26 A;  4FM1 A;  3PO4 A;  1VSD A;  4ELT A;  3C95 A;  2F8T A;  4CK1 A;  2GBZ A;  4RG8 A;  3DLB A;  3ISN C;  2FBX A;  4DTX A;  4M3U A;  1DTT A;  3LZI A;  1HYS A;  2PZS A;  4M3R A;  2YHA A;  2G8V A;  1I39 A;  1RTI A;  1WSF A;  1TK0 A;  1NKB A;  4C8O A;  3RTV A;  1ASV A;  1WLJ A;  3C94 A;  1QHT A;  4OKE A;  4CHO A;  4FJJ A;  3C6U A;  4LH5 A;  2HHX A;  4PUO A;  4DMN A;  3OYL A;  5C24 A;  2XY7 A;  1SL0 A;  2G8K A;  4I9Q A;  1VSJ A;  4KTZ A;  3L2W A;  4F8R A;  4J2E A;  4NCA A;  1ITG A;  2W42 A;  2O4I A;  3LP3 A;  3V6D A;  4O44 A;  5HRP A;  1L3S A;  1VSL A;  3MEC A;  4CGJ A;  5J2M A;  4YNQ A;  3OYC A;  2FBV A;  3M8S A;  1KRP A;  3FFI A;  4AHV A;  1BQM A;  2WOM A;  1A5X A;  1HRH A;  4I9L A;  5HBM A;  4HTU A;  1RDB A;  1WSJ A;  2VG5 A;  5CZ1 A;  1JLF A;  3LPT A;  4C8N A;  4KB1 A;  4N41 A;  4CJW A;  3WNG A;  3PX6 A;  1TGO A;  2EX3 A;  4B9M A;  4GW6 A;  3VQA A;  4DSJ A;  3HST B;  4E89 A;  1J9A A;  4CJQ A;  4IFV A;  3V1O A;  3L3U A;  4IFY A;  3CFP A;  4CJT A;  1QS4 A;  3U3Y A;  3BGR A;  1NK5 A;  4M3Z A;  2HHW A;  4CES A;  3NGI A;  4Z4E A;  3I8D A;  1QSL A;  4CJ3 A;  3VN5 A;  4I7F A;  4DTP A;  4NYF A;  3QNO A;  1TAQ A;  4KTW A;  4LSN A;  3TAM A;  3VQB A;  3L2V A;  1Q9X A;  2HVH A;  2O4G A;  1JL2 A;  2OPQ A;  1S6P A;  3NF6 A;  1BIU A;  3K58 A;  2FBY A;  5DK5 A;  4FJ8 A;  4O5B A;  1FKP A;  1W9H A;  4DSF A;  1VSH A;  3VQC A;  4Z4H A;  1HQE A;  3DRS A;  4JS4 A;  4ELV A;  1BI4 A;  3AVG A;  3WNF A;  3EY1 A;  1NOY A;  1HMV A;  4AHC A;  3G0Z A;  4H4O A;  3SPZ A;  4CCH A;  1C0M A;  1X1P A;  4DLG A;  4HUG A;  1JLE A;  4I2P A;  3HPG A;  2ZD1 A;  4E7H A;  3SQ2 A;  2RN2 A;  2X6N A;  3AVF A;  3CFO A;  5KRT A;  2F8S A;  4KB0 A;  1VRT A;  3ASM A;  1DLO A;  4AH9 A;  4E1N A;  2VWJ A;  2G8I A;  4BE0 A;  3QEV A;  1C1A A;  4KV8 A;  1Q9Y A;  1ZBH A;  2D5R A;  4FLW A;  4DTM A;  2XO7 A;  1ZBI A;  1XHX A;  2KQ2 A;  1T05 A;  3AA2 A;  3KD5 E;  3OYK A;  1F21 A;  4CGH A;  1W0H A;  3UIQ A;  4RW7 A;  1U4B A;  1BIZ A;  3PY8 A;  1S9G A;  3M8R A;  3KLE A;  3P83 D;  3E01 A;  3MED A;  4N56 A;  2E6L A;  1UA0 A;  4CEE A;  1L3T A;  1Q8I A;  1YVU A;  1LAV A;  3KKS A;  2A1S A;  3DLG A;  2DY4 A;  1TVR A;  3V9U A;  2HHV A;  1ASU A;  4AHS A;  1NJX A;  1EP4 A;  3ULD A;  3RMD A;  4C8K A;  2BE2 A;  3DOL A;  3KIO A;  2Z1H A;  3DLR A;  4CJP A;  3TAN A;  4PQU A;  4JRQ A;  1UWB A;  3RR8 A;  2HND A;  3RMC A;  4E3S A;  1BL3 A;  4CEZ A;  3DLE A;  3SCX A;  3S9H A;  3THV A;  3RR7 A;  3ZSQ A;  3QES A;  3TAF A;  1WAJ A;  3L2U A;  3LP0 A;  1XI1 A;  5KGX A;  1CXQ A;  1L3U A;  5FRM A;  1KFD A;  3SQ1 A;  1R0A A;  5D3G A;  2HNY A;  4CHY A;  1U45 A;  5I3U A;  3QEW A;  3V9S A;  3QER A;  3OY9 A;  4LY7 A;  3OS0 A;  4JS5 A;  2YV0 X;  2DTU A;  1LV5 A;  1O1W A;  2Z1J A;  1JLA A;  2HHT A;  3T19 A;  5K14 A;  2YNH A;  1U47 A;  2DFE A;  3KTQ A;  4FJH A;  4DFP A;  2ETJ A;  4Z4I A;  4B9N A;  4O0I A;  4FLX A;  2XY6 A;  1CXU A;  3TR8 A;  4AHU A;  1RNH A;  4K8Z A;  4CJE A;  4LSL A;  1SKW A;  2D0A A;  2FBT A;  4B9U A;  1SL1 A;  1NOZ A;  2P5G A;  1D9D A;  1ASW A;  4FLY A;  4J2D A;  5SZT A;  4KPY A;  3OYM A;  1D5A A;  3DOK A;  4N47 A;  4CEF A;  3NAE A;  4KAZ A;  1IKV A;  3S3N A;  3SZ2 A;  4F2R A;  3HYF A;  3NH2 A;  1A5V A;  1L5U A;  1RT2 A;  3KK3 A;  4O4G A;  1N5Y A;  2RKI A;  3KKR A;  3ZT0 A;  3AO5 A;  3OYB A;  2IS3 A;  3T1A A;  4KHQ A;  3CG7 A;  2PAJ A;  4QAG A;  4DWI A;  4NCB A;  1SUQ A;  4QOZ B;  3T3F A;  3HVT A;  3V81 A;  4CF9 A;  1BIS A;  1JKH A;  4KI4 A;  3VQ4 A;  3K5M A;  1C0T A;  1VSK A;  4DTN A;  4Z4G A;  4KHU A;  1U04 A;  3HK2 A;  4CIF A;  4KHS A;  4CFC A;  4FK4 A;  1JLG A;  3QLH A;  4KHY A;  2ZE2 A;  3MAQ A;  4KHN A;  3AV9 A;  4DSI A;  3AVA A;  4FW1 A;  3OYE A;  4E7J A;  4M41 A;  3SV4 A;  3NDK A;  1KLN A;  4PY5 A;  2KFZ A;  3PUF A;  2HB5 A;  1Y97 A;  3O3G A;  3OS1 A;  1RIL A;  2LSN A;  3QET A;  4IKF A;  4ZTF A;  4OKK A;  1X9M A;  1DTQ A;  4N5S A;  4HCB A;  5I42 A;  4W5Q A;  1FXX A;  5J1E A;  3SJJ A;  1VSM A;  3TAR A;  4CEQ A;  4FK0 A;  3NF8 A;  2ATQ A;  2VG7 A;  4IDK A;  3DMJ A;  3L2Q A;  3NF7 A;  4JLH A;  1RT4 A;  3DRP A;  4DQR A;  4BDZ A;  3TWH A;  1T8E A;  4C8M A;  3AVN A;  3VQD A;  4CIG A;  1EKE A;  3K57 A;  2KZZ A;  4M42 A;  1NK7 A;  1IG9 A;  2A1R A;  4CJU A;  2Q3S A;  3SUO A;  3MXM A;  1C0U A;  3AVM A;  3TAE A;  1I3A A;  4MQ3 A;  4BWJ A;  1SKR A;  2OZS A;  1RBR A;  3QO9 A;  3V1R A;  4OJR A;  4CEC A;  3V9X A;  4DSE A;  1U49 A;  3HP9 A;  1HQU A;  4B9T A;  3I0S A;  4JRP A;  4E0D A;  5SWM A;  2D0B A;  3AVB A;  1KVA A;  1YTA A;  3S3M A;  4FYD A;  5C25 A;  1QTM A;  1VK0 A;  2PYL A;  3WNE A;  3NE6 A;  1NK0 A;  1GOC A;  2P5O A;  3OYH A;  4DF8 A;  4DFJ A;  1UOC A;  2RPI A;  5HRN A;  4G1Q A;  3D0P A;  3RMB A;  3VQ9 A;  4HVJ A;  1RTD A;  4FJ7 A;  4YFU A;  3V9W A;  4FM2 A;  1XHZ A;  4HHT A;  4DSL A;  4ICL A;  1RT5 A;  1VSE A;  4DS5 A;  1JLC A;  2Y1J A;  1TAU A;  4DS4 A;  4FJL A;  2QKK A;  4ELU A;  3AA3 A;  3DM2 A;  3OVN A;  3G10 A;  4BE2 A;  1RDA A;  3HPO A;  1CZ9 A;  1TKD A;  4RW4 A;  5J2P A;  3VQP A;  3HJF A;  2VWK A;  4PWD A;  3K2P A;  4W5R A;  1EET A;  3LWL A;  4F3O A;  3QIO A;  5HRR A;  4E7K A;  3AA4 A;  3F9K A;  1A5W A;  4KO0 A;  1KTQ A;  3SUN A;  1LAW A;  4FJ9 A;  3V1Q A;  3VQ8 A;  3K5O A;  4CED A;  1KVB A;  4ZTJ A;  1XC9 A;  3WNH A;  1SKS A;  3HO1 A;  3AVH