2P1JA

Crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRFVEMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords DNA polymerase III polC-type
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.140 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p1jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p1jA01
3L2VA 2B5JA 4LH4A 4J2BA 4PUOA 2HNZA 3K5LA 3DLGA 2PYJA 3OVNA 4FCYA 1BHLA 4E7HA 1T7PA 3SZ2A 1UWBA 3AVHA 3TI0A 4IG0A 3AVGA 4DSFA 4DMNA 4Z4IA 1VSEA 4LH5A 3DYAA 4DTPA 1NJYA 4F8RA 2O4GA 4KHWA 3LZIA 4FM2A 3RRGA 4M42A 3VQQA 4CIGA 3BDPA 1GOBA 3BGRA 3VA0A 1CXUA 3B6PA 4B8CA 3LP2A 3ULDA 3ZSRA 4BDZA 4E7LA 4DTOA 3TAQA 1XHZA 1BI4A 4KB0A 4RW7A 4OKEA 4DG1A 4NCAA 1ZBHA 2YNGA 1CXQA 1JL1A 3HP9A 5KI6A 4ID1A 3VQ5A 1TKDA 1BCOA 4R5PA 4ELUA 4OGEA 4WE1A 4KB1A 5DMRA 2HHQA 1TK8A 3QINA 4LD0A 4F3OA 1HNVA 3QESA 3OYNA 1HYVA 2DY4A 1NK4A 1VSDA 2FBYA 2KQ2A 4CHZA 3NGZA 1VSJA 1TL1A 2OZSA 4DS5A 1I3AA 1NK6A 4K8ZA 3K57A 3S3OA 3LAMA 3QO9A 2XY5A 1S5JA 2QXFA 3VQPA 4FJ5A 1U04A 4NCGA 4I2PA 3OYEA 3V9ZA 3SJJA 1U45A 1BL3A 3NCIA 1Q8IA 4CF2A 3KKRA 2HMIA 1HRHA 4O44A 1D8YA 2P5GA 3QNNA 3QERA 3IAYA 3SV3A 3V9UA 3AVNA 2QKBA 2BE2A 3V1OA 2HHUA 1RT4A 1NK5A 4JS4A 2P5OA 3MXJA 1Q9YA 2ZQBA 4AHCA 4G1QA 4CJ5A 2NUBA 3JYTA 1NJWA 3HM9A 4RG8A 3DLEA 4M45A 2HHTA 2PAJA 4CFCA 4BE0A 1B9FA 1YTAA 1RT3A 4FVMA 3I0RA 3LANA 1XC9A 1C0UA 4LSLA 1NKEA 4ICLA 1NJXA 4CJEA 3OY9A 4AH9A 3DRRA 4E7KA 3SPZA 2AJQA 2YNFA 3S3NA 2F8TA 1D5AA 2BGGA 4FXDA 4I7FA 3OYIA 4E1NA 3VQAA 1NK9A 4M3UA 3CFOA 2PY5A 3C95A 3DLBA 2X74A 4DFJA 2Y1IA 1R0AA 1NK7A 4FJJA 4DQPA 3L3UA 4I2QA 4GW6A 5KRTA 5FRNA 4JRPA 3MAQA 4KHUA 3CM5A 3HYFA 1KVAA 1BISA 3ZT1A 2DFHA 4JRQA 2XRIA 3S3MA 4DFKA 2YNIA 3TAFA 2KZMA 3TR8A 4CJWA 4F3TA 2KZZA 4CE9A 4HCBA 3B6OA 4FW1A 3KLGA 2ITGA 2G8UA 1TV6A 3F9KA 3AVMA 2HHSA 1IO2A 1KVCA 3NF8A 5HBMA 3ZT3A 4I9QA 4FJ7A 2EHGA 5T7BA 1RBVA 4Z4HA 3QEPA 4Z4EA 1RDCA 4W5NA 1ASUA 3L3VA 3SQ4A 1S6QA 4CJFA 1TK5A 4HCCA 4DFMA 3SUPA 5J2MA 3SPYA 3PUFA 1EKEA 3AVJA 2F96A 3HO1A 1HQEA 3DLKA 2B6AA 3C6UA 1RDAA 2KFNA 3M8RA 2Z1JA 1GOCA 2YKNA 3HPGA 4FLWA 1S1UA 5FRMA 1RCHA 1RT5A 3V6DA 4CJUA 4CGDA 3EY1A 4DLGA 4BE2A 3KD1E 3CQ8A 4JLHA 3ZCMA 3C6TA 1RNHA 4M3XA 3RMBA 1TAUA 1TVRA 2YKMA 1B9DA 2G8VA 3WNFA 2G8IA 4B3OA 2EX3A 4CFAA 4EP4A 1EP4A 2JGUA 4CGIA 3PX6A 3LALA 4FM0A 1EXQA 4AHVA 2RPIA 1U4BA 3OYFA 4HUFA 4O55A 1SL0A 1WSFA 4LY7A 4FK0A 3NF9A 1HYZA 2B4JA 5C24A 1JKHA 4CF0A 3O3FA 4DU4A 3HP6A 2G8FA 1JLCA 5J2QA 1RTDA 4CJSA 5KRSA 3L2WA 3G10A 2XHBA 3P83D 1S1TA 1TAQA 1ITGA 3AVIA 4HVJA 4ZTJA 2G8WA 3JSMA 4ELTA 4M3TA 2HVIA 1RDBA 4C8OA 2D5RA 3EZ5A 4OKJA 1VRTA 3VQ6A 2O4IA 4DSKA 3DM2A 1VRUA 2KW4A 4EZ9A 3OJUA 4ZHRA 3ZSZA 3T19A 1NK8A 1TGOA 4CEQA 3KLFA 3OYGA 1U49A 5SWMA 1WNSA 4DQIA 1QSSA 1HJRA 4CHOA 4B9SA 1WSHA 2HNDA 1IKYA 3AO3A 4FM1A 3AA2A 3MEDA 2BANA 4E7JA 4FZYA 3ZT2A 4B9TA 4M3WA 1ZBFA 2A1SA 4GMJB 2IOCA 1BQNA 3LDSA 4Z4GA 4FLVA 2G8KA 1QHTA 3NGYA 1N6QA 4FLXA 4E1MA 4CJLA 3L2QA 4IG3A 1REVA 3OYLA 3RMCA 1X9SA 1X9MA 4FZZA 3DRPA 3SUOA 3ZSQA 1UA0A 1KSPA 1D9DA 4KHQA 3V1QA 4W5QA 1TK0A 4FLTA 3MEGA 3ZSWA 4DQSA 3SQ0A 4ZTFA 5HROA 4CEZA 3CM6A 3ZT4A 3AVLA 3AO2A 1L3SA 2Z1IA 3A2FA 4W5OA 4KFBA 3SV4A 1HQUA 1XHXA 4KTWA 1RBUA 3ASMA 4AHTA 4HHTA 4N5SA 4KTZA 5CYQA 2ATQA 3F73A 3L8BA 3VQEA 3SNNA 1N5YA 1JLEA 1VSMA 4CJKA 2R7YA 3MXMA 4YNQA 3KK3A 4CFDA 3KD5E 2HHWA 3OYMA 4CERA 1BCMA 4OVLA 3AA5X 2RN2A 4B9LA 3V1RA 4CECA 3AVKA 4PWDA 1SKWA 3O3HA 3MECA 2OPRA 2YHBA 3RR7A 4CK1A 4DTRA 2WOMA 1FK9A 1Q9XA 3ZSXA 3OYBA 4ELVA 4BDYA 4FJMA 2FBTA 3QEWA 2QK9A 3AV9A 4GVMA 1S1WA 2Q3SA 3DMJA 3HT3A 2A1RA 3LP0A 5DK5A 3HPOA 3HPHA 3PO4A 2X6SA 2HW3A 1A5VA 4HTUA 1S1XA 4FYDA 4FLUA 3DOKA 4CJQA 1ZBIA 3D45A 3WNHA 4O5BA 3RRHA 4C8NA 4B8AB 4CHNA 1NKBA 2GBZA 1L3UA 4RW8A 1A5WA 3PV8A 2PYLA 1LWCA 2Y1JA 2ZE2A 3T3FA 3AO4A 3KK1A 4OKKA 3LPTA 2VWKA 4DSLA 1LW2A 1Z26A 4H4MA 3V9WA 4QOZB 3PX0A 4NCBA 4QCLA 2ETJA 4FJXA 5KTQA 1SUQA 5HRNA 3QEIA 3NGIA 1SL2A 4CHYA 3QIOA 2LSNA 1RTHA 1RBTA 4O4GA 1WAFA 3OYAA 4KTQA 4FJ8A 4CEFA 1NKCA 5C42A 1DLOA 1RT1A 2WONA 4FK2A 4CGGA 5HRPA 3SUQA 4B9VA 4DTJA 3KTQA 5J1EA 4DLEA 2E4LA 1I39A 5E41A 3UIQA 1LV5A 1LAWA 2D0CA 1ASWA 1TKTA 3TAMA 3KK2A 3LWLA 4AHSA 1SKSA 3CG7A 4H8KA 4LSNA 2E6MA 2F8SA 3AVCA 1LAVA 4NYFA 3DI6A 3HVRA 3TAPA 2VWJA 1C6VA 3ISNC 1SKRA 3VQBA 1EETA 1ZBUA 4O0JA 1QSYA 4DF8A 1NJZA 1EX4A 2YV0X 3AO5A 4KRFA 4IDKA 3O4QA 4B08A 4FLYA 4DTNA 3PX4A 2IS3A 3K5MA 3M8PA 1JL2A 3OS0A 1JLAA 1A5XA 3AA3A 3KLHA 4F4KA 1KRPA 1IKVA 1WSGA 1D9FA 1CLQA 5I42A 2I5JA 1TKXA 2ZD1A 1QSLA 4CGFA 4L8RB 1CZBA 4RW6A 1X9WA 4EP5A 4CESA 2YHAA 4CK3A 3TARA 4F2SA 3NE6A 3IS9A 3VQ8A 4KV8A 4J2EA 4KKOA 1TKZA 1RTJA 2VG5A 1VSHA 3QLHA 3LZJA 3M8SA 2Z1HA 1VSKA 1X1PA 1WAJA 3NBPA 2HHVA 1ASVA 1RDDA 1YVUA 3E01A 3IG1A 1S1VA 4DSEA 1BQMA 4FJKA 1KLNA 3DLRA 2XY6A 1DTTA 1BGXT 5HRSA 2HB5A 1JLGA 1HNIA 1FXXA 3I8DA 4KHYA 1HMVA 1JLQA 4FJLA 2DFFA 4HUGA 4DSIA 3QNOA 1IG9A 3LPUA 4DQQA 1SL1A 4CIFA 4DU1A 5K14A 4O0IA 3NH2A 3D0PA 4CEEA 3K2PA 4BDPA 1J9AA 4KO0A 1VSLA 4Y1DA 1UA1A 5FDLA 1WSEA 3DOLA 3CYMA 2RF2A 3P5JA 4E0DA 2P51A 1RT7A 1KLMA 3OS1A 1RILA 4CEDA 3PO5A 4FJGA 4PQUA 1QTMA 3CFRA 1QS4A 1XWLA 4IFVA 3THVA 4KHNA 3I0SA 4Y1CA 5J2PA 2YNHA 1VK0A 4J2AA 1WSIA 1T03A 1VSFA 3LP1A 2FC0A 3M8QA 4MQ3A 3OYCA 4H4OA 2X6NA 4RW4A 3LWMA 2IC3A 1UOCA 4N76A 1J53A 4Z4FA 1IKWA 3TAEA 1NK0A 4HUEA 3VA3A 4M3ZA 3ALYA 4B9NA 4Q0BA 1S6PA 2IGIA 5FROA 4CHQA 1Y97A 3O3GA 4ID5A 3VN5A 4CJ4A 2E6LA 1QQCA 3AVAA 1RTIA 1JXEA 3KKSA 4CJRA 4OPKA 5J2NA 3OJSA 2DFEA 4OPJA 1G15A 1TL3A 5C25A 4M3YA 4DTSA 2QKKA 4CHPA 4CFBA 1BIUA 4DU3A 5CY4A 1NOYA 3U3GA 2FBXA 3VQ9A 2D0AA 4CIEA 1FKPA 1L3VA 5D3GA 3V4IA 1L5UA 3H08A 3TABA 4C8KA 1IH7A 1SV5A 5HRRA 3MXIA 5JS2A 1LW0A 1WLJA 4OJRA 1DTQA 1RT6A 4Z0UA 4FLZA 1S9GA 3RTVA 4E19A 4DQRA 4I9LA 1J5OA 2OA8A 4AILC 4KAZA 2DTUA 1JXBA 4KREA 2HNYA 3NH0A 4BWMA 1C1CA 4DWIA 5KGXA 1QE1A 4FW2A 4BWJA 2VG7A 1KFSA 1UAXA 3KJVA 3HSTB 3FFIA 3NDKA 3U3YA 4BACA 4DS4A 2OPSA 3HL8A 4B9MA 4N41A 3O4NA 2XO7A 4W5RA 4FK4A 1T05A 1RBSA 3NF7A 1Z25A 4C8MA 4DTXA 4CEBA 4TSXA 4RW9A 2HVHA 3NFAA 4E3SA 3RMAA 3LAKA 4EZ6A 3EYZA 2BDPA 4N56A 3U6FA 3SCXA 4NYNA 3QEXA 3DRSA 3VQCA 2OYQA 4KI6A 1RBRA 4CJ3A 2G8HA 3ZSVA 3ZSOA 2HHXA 3AO1A 3OYKA 2JLEA 1T8EA 4KHSA 3OYHA 1B92A 2GV9A 4CJVA 1XI1A 3RR8A 3HK2A 3ZT0A 3RMDA 1C0TA 3LP3A 2PZSA 3K59A 3V9SA 1YT3A 2OPPA 3OS2A 2X78A 1GOAA 3T1AA 4AHUA 3HXMA 1LWFA 4MFBA 1YTUA 4CJPA 3QEVA 2OPQA 4DF4A 1CZ9A 3S9HA 2RKIA 4Z4CA 4FJHA 1L3TA 4CEOA 3QETA 4XIUA 1VSIA 3TAGA 2XY8A 4JS5A 5EU7A 4IBNA 1K6YA 4IKFA 1KCFA 1C0MA 5SZTA 3ZSYA 2OZMA 5CZ1A 1KFDA 1BIZA 3NAEA 4C8LA 3L2RA 1HYSA 3WNGA 3OYDA 1ZBLA 1W0HA 3SQ1A 3SYZA 1JLBA 3V9XA 4OLAA 2IDOA 1RT2A 1J54A 4CF8A 1F21A 3L2UA 4QAGA 3AVFA 1W9HA 1HPZA 4DSJA 5CYMA 3TANA 2P1JA 3AVBA 4CF1A 4FJ9A 2KFZA 5I3UA 4B9UA 3HVTA 1WN7A 1JLFA 3NH1A 3NHGA 3PY8A 3AA4A 4N47A 4CEAA 5JS1A 3MEEA 5CZ2A 4M41A 4CCHA 4UQGA 2Z1GA 4PY5A 3VQ7A 3DLHA 3SUNA 3G0ZA 1S9EA 4IFYA 4M3RA 1KVBA 1KTQA 3C94A 4J2DA 1BI4B 3CFPA 1C1BA 4CF9A 5HP1A 1ZYQA 3K5NA 2XY7A 3K5OA 4CK2A 4CJTA 1IKXA 2W42A 4K8XA 1LWEA 2FBVA 4PA1A 3K58A 3P1GA 1NOZA 4BE1A 3NF6A 3V81A 3SQ2A 4FZXC 3WNEA 4F2RA 2GUIA 4FJIA 4KPYA 4OLBA 4E89A 3OYJA 3VQDA 4YFUA 3SI6A 3KLIA 3KLEA 4CGJA 3KIOA 4CGHA 4DFPA 4OGCA 3VQ4A 2IAJA 1C1AA 5HLFA 4W5TA 2D0BA 4KI4A 1MU2A 3IRXA 2KTQA 2VG6A 3TWHA 1U47A 1FKOA 3RWUA 4Q5VA 4DTMA 3HJFA 3ITHA 4FJNA 4AHRA 3QIPA 4E7IA 4DTUA 1WSJA 5KGWA 1O1WA 1U48A
chains in the Genus database with same CATH superfamily
3KZIE 3K5LA 2PYJA 1T7PA 3JCUE 3HTKA 3AVHA 1W7AA 3EEQA 2ZYDA 3CQYA 1MFZA 2ZT9C 4DTPA 1KAXA 2O4GA 4FM2A 4JI8K 4OX9K 1D4XA 3SMSA 5KLIB 3VQQA 1RDWX 3BGRA 3OHRA 3VA0A 3B6PA 1JY2N 1S3XA 5KQDA 1KAZA 4DTOA 1ZRTE 2FYUE 1H8AA 1EDJA 1BI4A 1BGYE 1RE4A 1YI2N 1S9KE 1N73B 4NPDA 3AE6C 4H0XB 1AFOA 1HGVA 3CPWO 4X65K 4R5PA 4OGEA 1YJWN 4JK7A 4KB1A 1IZNB 1VF5B 4LD0A 3WQUA 2UXCK 1LCUA 3F9MA 2DY4A 4BR2A 1HKBA 1FW6A 2A45I 1KYOI 1TL1A 2OZSA 1HBWA 4K8ZA 3S3OA 3H46O 3J80O 3LAMA 3KWGA 1RY3A 3H1JE 3KYQA 2QXFA 4NXMK 3VQPA 4FJ5A 3SJJA 2HMIA 3O1BA 1JY2O 1ZLLA 2OYIA 1HRHA 2OYHA 4B86A 2P5GA 3QERA 3SV3A 2E74D 2WVRA 3AVNA 3VMZA 2HHUA 1JOCA 1BDCA 2P9KA 1Q9YA 4AHCA 4CJ5A 1BU6O 1NKNA 1NTMJ 3L72E 3DLEA 1IV0A 2PAJA 4DV1K 1YTAA 2NZTA 1RT3A 3LANA 1FZCC 3LM2A 3OY9A 3DRRA 4BR0A 4FXDA 3E7KA 3D6RA 1JNMA 1DH3A 4PL8A 5DM7L 4RJTA 1SQVE 1S72P 3L36A 4M3UA 1GMJA 1OIPA 1NGHA 3K0SA 1ZV8A 3DLBA 1NK7A 4LF5K 3CXHH 2R5DA 4H0OA 5GINA 2OTLP 5LY3A 1L4AD 1KVAA 1BISA 2QWOA 2DPNA 4JRQA 2XRIA 2E5YA 3TAFA 3TK1A 1DKGD 3UKRA 2VGNA 1HJOA 1VQ4P 3E9LA 2I8DA 2H3GX 3GHGA 2ITGA 5HBMA 4I9QA 4DR6K 2RKLA 3ZT3A 2OYOA 2XU6A 4FJ7A 5KQ8A 1S5LX 3QEPA 4Z4EA 1IFPA 4RO0A 1RDCA 4BRIA 4W5NA 3L3VA 1LWUC 1HUXA 1ZXGA 3R6MA 4JKAA 2BCCG 3F5TA 2BH1A 2KFNA 1XTCC 2O8FB 1E79H 1SFCC 2A06G 2HBJA 4FLWA 1YJ9P 1S1UA 3V6DA 4CZIA 2E5TA 3EY1A 4DLGA 3BZCA 3ZCMA 3C6TA 3CJ9A 1B9DA 1QL2A 2JGUA 4JAXA 3CWBG 2KSEA 5C39A 5A2QO 3LALA 1GLEG 1SQVD 3H25A 2I1KA 2ASMA 4JK9A 3R8EA 2WSEH 3OYFA 4UY8O 4H13D 4XH5A 4KH4A 3NF9A 2G8FA 2CPSA 5AQZA 1JLCA 2P9UB 4MO5A 1RTDA 1VQ5N 4B1YB 2OTJN 3KZBA 1EZVI 1S1TA 1ITGA 4H5NA 1BGYJ 2AXTH 1SQQK 4A61A 1EC5A 2QJPB 3C8VA 3H32B 4XEIA 4JI0K 1G2CA 2IBZD 4CI6A 4GY2B 2Q7CA 3CD6P 1NBWA 3L73J 3L74E 2HLOA 4FVUA 3JC22 1GTWA 2LR2A 3GOIA 1WNSA 3Q7CA 2YO2A 3AE4C 1IKYA 2K9JB 3ZX2A 2HOEA 5AVQB 2RHKA 1TUYA 3C6HA 4UB6E 4FWMA 1N32K 1TUUA 4IJAA 2HBMA 4MLEA 2G8KA 1QHTA 4FLXA 2O8DA 1L0NE 4ZKUA 3MCPA 1LOTB 2GUPA 4IG3A 4CBUA 3RMCA 1KSPA 1D9DA 3CCVP 3PRJA 1PPJG 5APVA 4EAHD 1VQ9N 2PFUA 1TK0A 1NO4A 1BE3E 2YO3A 3RBXA 2O8DB 1VQ4N 4CEZA 3D2FB 1EQYA 2Z1IA 1ZMEC 2FYUG 3NMDA 2O8CB 1KYOD 4KTWA 2DW3A 1DEEG 4HHTA 3PLAA 1K9MQ 4H44D 1EXJA 1OVQA 4KTZA 4N5SA 1SQXJ 2W6AA 3TSPA 1K73O 1VQLN 1VSMA 3CI5A 3WU2H 1VQMP 3KK3A 4CFDA 3RK2D 3OYMA 1BCMA 4MO4A 3V5BA 4OVLA 1ILYA 4RESB 3GE1A 4IXCA 3H1HG 3TU5A 3DXKA 3MECA 2OPRA 4CK1A 4DTRA 3CCEN 1FK9A 1GLCG 3ZSXA 4AM7A 1PV3A 2IBZE 2QRXA 1URQD 3EN9A 3ZEUB 3AV9A 3P31A 5KLVK 2IYPA 5ELZA 3HT3A 3O1WA 3RK3D 4HTUA 4CJQA 4A2AA 5GTIH 3WNHA 4AUWA 2E2PA 2B87A 2V7YA 3RRHA 3O9TA 4JI3K 4RW8A 2E88A 2OGUA 2Y1JA 3W67A 2Q2RA 4O9BA 3HE4A 1GU5A 3AO4A 2UU9K 1OZHA 3CX5D 5BU5A 1Z26A 3V6IA 1GLJO 4QOZB 3PX0A 4NCBA 4FJXA 1AVOA 4KJMA 3QEIA 3NGIA 4H13B 4CHYA 5GTHH 3NMUA 4FJ8A 4W80A 4CEFA 3THXA 5KPZA 5GAGP 1PP9J 5AW7B 1RT1A 3H1QA 4CGGA 3J7ZO 2L5GB 5KAFH 3L4FA 3VTPC 3SWYA 5J1EA 4W7YA 3I56P 4I6MB 5BPLA 3HD7B 5E41A 2H43A 5AZIB 3TAMA 1SKSA 3LWLA 4AHSA 1N33K 2ZT9D 1HLUA 1S5LE 2P9LB 5AVUB 3TAPA 3HM8A 1MA9B 1C6VA 3ISNC 4GV6A 3B8AX 1ZBUA 3L37A 2ASOA 4YY3K 1VQMN 4DF8A 1IFIA 1BWFO 2HODA 3FZHA 1X9JA 4FLYA 1T2KD 4QS8A 3K5MA 2QEXP 4CBXA 1JL2A 3KLHA 1A5XA 2UXBK 5JVHL 2ZYGA 1IKVA 2UUCK 1QSLA 1VQ9P 1TKXA 1L0LG 1X3NA 3IUCA 4L8RB 4RW6A 1SQQD 3FE1A 3JS6A 2O8CA 1NGEA 2I7PA 3NE6A 3IS9A 3TGUD 1RTJA 2VG5A 3QLHA 5C2DA 1EDKA 3LZJA 2Z1HA 1ZR2A 1N86A 3IG1A 4H0LC 4FPBA 4DT0A 3SBGA 1H0TB 5B8HA 2XY6A 2A42A 5HRSA 2H7HA 1JLGA 1HNIA 4BRMA 3I8DA 1EZVD 3CWBD 4FWQA 4K41A 2MKVA 4DSIA 3MDQA 1IG9A 3LPUA 2ZF5O 3VGLA 3RK2C 2GELA 5CJ0A 3LM9A 3EE9A 4L3QA 4CIFA 2I7NA 3C65A 3R3LA 5KAFE 1ZN5A 1VSLA 4Y1DA 2FYUK 1WSEA 3P5JA 2RF2A 5AW1B 4LLHA 3L71E 2P2UA 3OS1A 4FJGA 3T97B 4PQUA 1RQUA 2A45G 1QTMA 1QS4A 4IFVA 1L0LE 2M5AA 4OWFA 2YNHA 5AQYA 3LP1A 3VMXA 3M8QA 4N78D 2QXLA 3SK3A 3OYCA 2IBZG 4H4OA 1UOCA 5APYA 1HF9A 3F2KA 2ITAA 1J53A 1NK0A 3VF4A 1S6PA 2FYUJ 4YXDC 4RKUJ 4GOEA 4FPAA 5EX5A 4DUYK 3QDKA 3B5NB 5BN8A 4CJRA 2KNCB 5GTIE 3L75J 1VDFA 1S9KD 1XQSC 1YIJN 1S1CX 4DTSA 2QKKA 4CHPA 4DUZK 3Q7BA 4DU3A 2JWDA 2FBXA 4CIEA 1EDLA 3FZMA 1NGMB 3EKUA 3TABA 4N6JA 3MXIA 2P9IA 5JS2A 1LW0A 1WLJA 1RT6A 1EZVE 2DTUA 1T3UA 1Z56A 3L74G 4AILC 3MN6A 3L4IA 4BWMA 1C1CA 1EWQA 1QE1A 3WU2E 3H1VX 4BRPA 2MJZA 1UAXA 1SQVK 3BATA 5BVZA 2YHWA 2OPSA 3ULEA 4ILJA 3VEXA 4B9MA 2WQYC 5B66E 4B3SK 2HSTA 4CEBA 5FPEA 3A8YA 4E3SA 2KUBA 3H6PA 1X3MA 4MLHA 3T7ZA 4EZ6A 4N56A 3A0IX 2N9YB 1NTZJ 3QEXA 3L75D 1N8RO 4DV0K 5CJ4A 5EY4A 5BU8B 3W68A 3OYKA 2Q9IA 3NVMA 3GBTA 5HOOA 1ZR4A 3ZT0A 2KNCA 1M7LA 2E75B 1C0TA 4JV5K 3LP3A 2NPSD 3K59A 3V9SA 2X78A 3C7NB 2AXTE 1FAVA 3QBWA 4YDUC 4CJPA 1QZ6A 1VQON 4DF4A 3CCQN 1CZ9A 3TSQA 3VGKA 1IFDA 1JCGA 4CEOA 4EFHA 1P84E 4XIUA 3O9RA 4WY4B 3P8MC 4PV1D 4BROA 1XTGB 3DWLA 1TYQB 1KCFA 4JYBA 2O01N 3CXHD 4JHDA 1XMQK 4C8LA 4CZLA 5ADXH 4NO7A 1W2BM 3WNGA 1W0HA 3RL0B 3HOTA 2N9BA 4J8FA 3SYZA 1FZCA 3E1IA 2CGJA 1DGKN 3RL0C 2P10A 3AVBA 4B9UA 3CCQP 1WN7A 3J7YP 2W6BA 3ENOA 4N47A 1P84H 4Y28J 1Y64A 1XMOK 2UWJE 1WOQA 4B9QA 1RGIA 1YUWA 3CJ1A 4PY5A 5E84A 3THWA 1HNWK 3SUNA 5CHIA 3I5CA 1J1EB 1KVBA 2HF4A 1SQQG 2PBDA 3KHYA 2QM7A 1BI4B 3CIPA 4GODA 4CF9A 1IJJA 5HP1A 3VP8A 2V7QJ 1HTLC 3AE7C 4DR7K 2XY7A 4IL6H 1IKXA 3B8EB 1VQNN 1E4FT 4RTFD 3AAQA 4PA1A 3V81A 3AGRA 4KPYA 4EHTA 2QM8A 1QVFM 3VQDA 3C9IA 3KLEA 1S72N 2KXPB 1NTMD 1JEKA 4DV2K 4KI4A 3B5NC 3GG2A 1MU2A 2VG6A 1GLDG 2LKMA 2K9JA 3QIPA 4PD4D 3CXHE 1R8EA 3R9PA 2B5JA 4J2BA 3EFFK 3GHGB 2NRZA 1IK7A 4WF9L 2WITA 1T3VA 1RH5B 4FCYA 4FOEA 2RN0A 4HTLA 1JO5A 5KJ7C 1BGYD 1K8KB 1Q90D 5AR0A 1BG3A 4LH5A 4LF7K 2CH5A 1E3MA 3UIAA 1LTSC 5E26A 5AZJA 2GM4A 2E8AA 1VQOP 3HI0A 3T1YK 3BDPA 4L74A 1CXUA 3G4SN 2YIUC 3QH9A 4WFAL 3ZSRA 4E7LA 1X8YA 4EIAA 1QGKB 4BRQA 1SZ2A 4B3MK 1V4SA 4NCAA 1LNQA 3CHWA 1SS1A 1FZGA 1NMNA 3VMYA 2F9TA 3FZLA 2WSEJ 3QINA 2QG4A 3CCJP 1A02F 1FU1A 1NTZK 3OYNA 1NK4A 1RE3C 3GLMA 2YXQB 2NZ2A 4B1ZA 1G1JA 1I3AA 2IX7C 1NK6A 2KZJA 1KILC 1PGPA 3IFMA 5AVTB 3QFUA 4YDUA 2Q0RA 5APWA 4NCGA 1BL3A 3NCIA 2N1TB 1E4GT 2Z5IA 3WXMB 1D8YA 4C7NA 3IAYA 2FSKA 1JY3O 2IFMA 1Q86Q 1Z05A 2BE2A 1CZAN 1RT4A 3QMLA 1NK5A 2HYNA 3WUUA 4Z1MH 5FPMA 5LJWA 2ZJPL 3SJHA 1VQ6N 2NUBA 3JYTA 1NJWA 4C7NB 4RG8A 2QIWA 2PRRA 3HSCA 3I8BA 2YI1A 3L0QA 4BE0A 2XNDH 3V2NA 4LSLA 5C10A 1JCEA 3CCUN 2QA4P 1RF1A 2F8TA 1D5AA 2HR3A 1JM0A 3CCSP 3OYIA 4E1NA 4X62K 4BXLA 4JI4K 4LFBK 3MX2A 3VQAA 1NK9A 3NXSA 2PY5A 5AQWA 2X74A 1R0AA 4M3LA 3TSIA 4FJJA 4DQPA 4NB4A 4I2QA 5KRTA 4JRPA 3CD6N 3CI9A 1KTMA 2JWAA 5M1BA 3THWB 4CJWA 4F3TA 3CERA 4CE9A 3EFGA 2QVAA 3CX5I 4HCBA 4A5AA 1NOHA 2W6KA 4IOCL 3CCRP 4FW1A 1BCCG 3F9KA 2HHSA 3AVMA 4BGBA 4BVPA 4KHXA 1IO2A 2BEQD 3RL0D 2EHGA 1EXIA 3AEDC 5AW4B 4YOXA 1N7LA 3V2RA 2Q3IA 1ASUA 4HCCA 2JEEA 4CJFA 1TK5A 4DFMA 3AE3C 3SPYA 1J5EK 4BQLA 3PUFA 2F96A 2E76D 2FXUA 1NNEA 3LIDA 3M8RA 4FWPA 5KLVD 1GOCA 2JDIH 2KSJA 3J8AA 5FRMA 1IJDB 1RT5A 4PKIA 1RNHA 4A59A 3RMBA 2FBWC 1N8RQ 3WMM0 3VF6A 2O8FA 2VRSA 2EX3A 2E75D 1LGHB 3PX6A 2NPSC 2R32A 4TT3H 1WSFA 2NRXA 3M6GA 2D2CB 3MIWA 3O3FA 1M1JC 1RE4C 1KAYA 3AE2C 1NU1E 3HP6A 5LMUK 1HWTC 4EOTA 1LT9C 2E74B 5TJHA 2XHBA 3CC4N 3H1HE 3P83D 5AQQA 1TAQA 4H0LD 4ZTJA 3N7NA 2G8WA 1OH6A 1ZW0A 4OKJA 1VRTA 5AQOA 5DJUB 1VRUA 2V7ZA 5ADXA 3CXCM 4QS9A 2Q6QA 3CWBJ 4ZHRA 5CBOA 3T19A 3O6QA 3OYGA 5BPNA 1Q86O 4JI7K 1QSSA 1SQBE 2XKMA 2WSFJ 4BY9C 2A3ZA 3MEDA 2YIUB 2BANA 4IJNA 4FZYA 4M3WA 2R3CA 1KILA 3DXKB 5AQIA 2IOCA 1BQNA 2W41A 3LDSA 4Z4GA 4ASWA 2P9SA 1BA1A 1N34K 3L2QA 3K5BA 1BCCD 1YHQP 3OYLA 3UKUB 1X9MA 4FZZA 3SUOA 3A3YB 4KHQA 1N7SC 3TDKA 4GNIA 4BR5A 2P9SB 2Q31A 4FLTA 3ZSWA 3BCCD 4DQSA 3SQ0A 2FYUD 5IWAK 4V19S 3CM6A 3JSVC 4W5OA 3FR0A 5APUA 4KFBA 4WQ4A 3VERA 3SV4A 3VEVA 2E76B 2HBKA 4CZHA 5CYQA 2AXCA 1NYHA 1NGGA 2EWSA 5APTA 2N1TC 3F89A 2E2NA 2VWBA 2W6LA 2R7YA 2V52B 2HHWA 4D6TE 1LTGC 4L76A 5AQTA 2RN2A 3E9OA 4B9LA 5C2FA 3CF5L 3AVKA 3RR7A 2CH6A 4GKJK 2WOMA 2J59M 3OYBA 4FJMA 3QEWA 3MUDC 2OTJP 4IZ9A 3H1JJ 2LXBA 1S1WA 5KTBA 2M0BA 2Q3SA 3BY5A 4ISGA 3HPHA 1KC8O 2W90A 1OKJA 1PGOA 4PD4I 3D45A 4C8NA 4B8AB 3TPQA 2GBZA 3EE8A 3GG4A 2QWRA 3HTKB 2PYLA 1IBKK 4B1WB 3T3FA 3KK1A 2KIKA 3O6WA 1CZQA 2VWKA 2QEXN 4DSLA 2Y0EA 1LW2A 4H4MA 2VQFK 3S41A 1NWKA 2ZVNB 3QIOA 2KKZA 4MDBA 3TYYA 1WAFA 1URQB 3A5MC 3OYAA 5GAEP 5C42A 1BO5O 2GA1A 2WONA 4JQ0D 3K9KA 4FK2A 1WB9A 4WWIA 4DTJA 3EO3A 3KTQA 5B5EE 3WXLA 1I39A 3LIEA 4BRNA 3L71J 1LV5A 3UIQA 1KORA 3EKSA 1TKTA 1IBLK 2GTDA 5JLFA 2H88C 1PIXA 3H3NO 4H8KA 2F8SA 3AVCA 4IEEA 3WXIA 1LTJA 4NYFA 1H1VA 3N4PA 2VWJA 1SKRA 4AQYK 1EETA 4O0JA 1VQ7P 2YV0X 3AO5A 3VP9A 3BASA 4IDKA 2HBLA 3H1KG 3PX4A 3H1HJ 3M8PA 1FDIA 1JLAA 4F4KA 1ZXOA 1BE3J 4BRYA 1SLQA 1QEXA 4F9OA 1KRPA 2GUSA 1SAZA 4EIJA 1RE3A 1CLQA 1KQFB 4CGFA 1W2EA 1CZBA 3BCCE 1HGZA 3K9JA 1N73C 3S1KA 4JD2B 3TARA 4BG9A 1WUAA 4KV8A 2F7TA 4YHHK 3L72G 4PKHA 1TKZA 3M8SA 4OGQB 3D70A 3V4WA 1VSKA 1WAJA 3NBPA 3O6QB 1RDDA 1JUNA 4DSEA 3ZETA 1BQMA 1KLNA 4D6TD 3Q5RA 1IC2A 3ZDMA 3L71D 1DTTA 3CLQA 1BGXT 4KHYA 1AVYA 2D2CD 1HH0A 5AQJA 1GK4A 2Q1NA 1OH5A 1IO4A 2P9PA 4DQQA 4IFEA 4DU1A 4BRCA 3CCLP 3CC7N 3D0PA 4CEEA 4U3FE 3K2PA 5KAIH 2KS1A 4PJ0E 2ZM6K 4GV9A 2P9NA 3DOLA 1K04A 4BWNA 2WC9A 1RT7A 3QBXA 3PO5A 3H1KJ 3ZYYX 2QWLA 2CPBA 5AJ3K 3THVA 3G9RA 4WQ4C 3I0SA 1JY3N 3IAOA 1CI6B 4J2AA 1WSIA 3IFRA 1T03A 1PGJA 4MQ3A 5CHXA 2B9BA 3LWMA 3B4SA 2VQEK 3MK6A 3THYA 4Q0BA 4B9NA 3DXMA 3VESA 2IGIA 4CHQA 4L73A 1LTAC 1Y97A 3O3GA 4RCHA 3ATUA 4ID5A 1PPJE 4I6MA 1E5WA 1QQCA 1NU1G 3Q1MA 3CC2P 1RTIA 3KKSA 1BOTO 4OPKA 5J2NA 1LTBC 3OJSA 4I6MC 2YJEA 1G15A 1OWAA 4LGDE 4CFBA 1KB9E 1BIUA 1KV4A 4BREA 3VQ9A 1HPMA 4DR1K 4CD3A 1FKPA 1QQOA 2GWJA 3V4IA 1SQBK 1DTQA 4Z0UA 4FLZA 4DQRA 4E19A 1VQ5P 4KBOA 3L73E 3L74J 2OYIB 2Q97A 4DWIA 4BWJA 1L0NK 3J81O 3HSTB 4JHDB 3U3YA 2P9NB 4B3RK 4BACA 3U8XA 3H1IG 3L70E 2FYNC 4K35A 1KD1Q 3II6A 5MLCQ 3O4NA 2XO7A 4FK4A 4JKEA 2WFBA 1RBSA 1M1JA 3OW2O 4LF9K 5KJ7D 1MFTA 2WZ7A 4RW9A 1OH8A 2HVHA 1J6ZA 2AEFA 3WUVA 4IFMA 3FFKB 1KILE 1SFCD 4CZMA 3U6FA 2BDPA 4IOXA 5AQHA 2YMYA 3DAWA 3DRSA 4LF8K 4KI6A 1DEJA 1YTZI 3ZSOA 2HHXA 5TISH 2JLEA 4ZMDA 1B92A 2GV9A 4HKZH 1R5LA 2KLAA 3QB0A 3HK2A 3VPZA 2IVOA 2ZT9B 3OJAB 1NTKE 2O1KA 1FBMA 3HZ6A 2PZSA 1NU1K 3OS2A 4OPAA 5AVVB 1GOAA 2WTUA 3HXMA 3L75E 4BRYB 1Q81Q 1OVRA 1CI6A 3S9HA 3A2AA 4LC1A 4YPCA 1RFQA 1NTKJ 1NM1A 4W7ZA 3KDPB 3H1IE 3O08A 3O5BA 3CCEP 2YMKA 3HUSB 3QETA 2D0PA 1ZRTD 1VQKP 3VEZA 3D6ZA 4BQZA 3IF4A 1C0MA 2HHVA 2XV5A 1YF5L 3G6EN 1EZVG 3NFQA 3VTHA 1HYSA 5GADP 1WBBA 5EXWA 1HR0K 1H88A 2IDOA 3Q3DA 1TYQA 5AQMA 1N7SD 4CF8A 1W9HA 3C0BA 3M0DC 5CYMA 2QJPC 5C15A 2N1TA 2KFZA 3P7KA 2ITMA 5AZJB 4M41A 4O8KA 4GOFA 1W5CE 1FDOA 3QFPA 1SQQE 2A5XA 4IFYA 1KTQA 1WRGA 2ZJRL 3C94A 1KD1O 4FOIA 1OW8A 3H3OB 3CCMN 1XC3A 2IIRA 1NTKD 3VMFB 1K8KA 4FWNA 1JCDA 3SAGA 2OANA 1U7MA 3M91A 3K5OA 1VQPN 2OCEA 1LWEA 2FBVA 4K8XA 2VGMA 3V2QA 3VEOA 4BE1A 4FZXC 3WNEA 4FJIA 3MN5A 3L71G 4E89A 4IEIA 1BDDA 1TU3F 4YFUA 3B71A 1XUPO 4CGHA 4DFPA 4OGCA 3VQ4A 2IAJA 2QM1A 2HFED 3IRXA 2KTQA 5E79H 1U47A 1FKOA 4IO9L 4DTMA 1YQ4C 1AJYA 3ITHA 4BC5A 4DTUA 1WSJA 4XFJA 5J2PA 2CK3H 1O1WA 4CZGA 3MN9A 4HJGH 4LH4A 4PUOA 4TLFA 1GLLO 3DLGA 3OA7A 1SQPE 3HRGA 1Q81O 1BHLA 3FXDA 1GD2E 1UWBA 2K1AA 5BREA 1SFCA 4DMNA 4N78E 4Z4IA 3GF3A 4CBWA 1OW7A 3DYAA 3MWPA 3O9UA 5AQXA 4F8RA 1BSHA 1S3JA 1LTJC 3LZIA 4PD4E 4GV3A 1Y9BA 4M42A 3A5NC 4CIGA 4AM6A 1LT9A 3CCSN 1GOBA 4K43A 3VTIA 4DR5K 4PV1B 3TGUG 2QWMA 1DD4A 3N4XA 3JCUH 3LP2A 4BDZA 4KB0A 4FWOA 2IFNA 5BPMA 3TAQA 4AYCA 4DG1A 1ZBHA 4JYCA 2HMPA 2YNGA 4BR7A 1Y8AA 2N1TD 1CXQA 3P4IA 4CZEA 2G8YA 3HP9A 1AA0A 5LL6Z 1TKDA 2E5LK 4JPZB 1BCOA 4ELUA 3C1LA 2O3JA 2K88A 1YITN 1HNVA 5KPRA 1GU4A 3QESA 2FYNB 1X9VA 3HTVA 5AQPA 5BR8K 4BRAA 1VSDA 5AW3B 2FBYA 2M3BA 1L0NJ 4CHZA 1VSJA 5BRDA 4K3AA 3D2EA 4UB8H 3BCCJ 2B87B 1S5JA 2IDBA 1P84I 5I9EB 1T2KC 1U04A 1NGBA 4ILGB 3U59A 4R79A 1Q8IA 4CF2A 3GMAA 4O44A 4X66K 1S5LH 1OVVA 1OXZA 1SQPD 2QKBA 3V1OA 1R5SA 3HUSA 1KQSO 3WUHA 4JS4A 3MXJA 3Q5PA 2ZQBA 1VHXA 3BCCG 3AE9C 3FLCO 4LF4K 4WQ5A 3HM9A 3I56N 2HHTA 4CFCA 1B9FA 2Q1KA 2A41A 3P39A 1J1EC 3I0RA 1L0LK 1NKEA 1VQ8N 4ICLA 4CJEA 4YOUA 1KB9I 2YHYA 3S3NA 3RL0g 3MD0A 2C9NY 1LTIC 1NU1J 3KPEA 1D7MA 4JBZA 5AW2B 2RE2A 3PTZA 5M1QA 4DFJA 5GTHE 1L0ND 1FC2C 3G6EP 4KHUA 3CM5A 2QSIA 4GT1A 1DIPA 2JWKA 3ZT1A 5E79E 3RVCA 2DFHA 2FY8A 4DFKA 4WB4A 3CL3D 2O8BA 4CPGA 1FOSE 3KK7A 4C7RA 2KK7A 2IZ0A 1AV1A 3AY9A 3B6OA 3CCJN 4Y99B 1IFNA 3KLGA 3ENHA 2HG5D 1KVCA 3NF8A 1EDIA 3RK2B 1NAYA 1RBVA 4Z4HA 1HJBA 4DV6K 4JD2A 1PP9G 1Q18A 1S6QA 4PHTX 5DM6L 3SUPA 5CCHA 2QE7H 5J2MA 1QVGO 1UIIA 3LDPA 3G3ZA 1EKEA 2YJFA 2WPRA 3AVJA 4PL7A 3HO1A 3ZEUA 2B6AA 1Q82Q 4Y0WA 4BRFA 2FXPA 3PIOL 3MTUE 1RDAA 1M1KO 1YXQA 4GKKK 2NRGA 3ATVA 1CSBA 2XZRA 1HKCA 1NU1D 1SVFA 1RCHA 1A02J 4CJUA 2QWQA 4CGDA 4JLHA 3VN0A 5CMZA 3H1HD 4M3XA 1TVRA 2G8IA 4WVZA 3WNFA 1SP4A 1JB0J 4CFAA 1BE3D 2RMZA 1EP4A 4CGIA 3CCVN 2WSSH 4FM0A 1USDA 4HUFA 4ISFA 4LY7A 5AQFA 5KLVE 4FK0A 1PZQA 1URQA 2B4JA 5C24A 1JKHA 3H1JD 3RSEA 4CF0A 3U1CA 3MCAB 3SLCA 4DU4A 2NLXA 4CJSA 1USEA 5KRSA 3G10A 3L2WA 1SQKA 4DOJA 2IYOA 4NLBA 1Q7YO 3AVIA 2ASPA 4OGQD 2FYZA 1U7JA 5AVRB 3H1LD 4GIFA 1RDBA 4L75A 2D5RA 4D6TJ 4ZNCA 3VQ6A 2O4IA 3DM2A 2KW4A 5H2FE 1NGCA 1ZP0C 3SFDC 2RH0A 1RF1B 5AVWB 3VEYA 1TGOA 1LJ2A 5TISE 1FDMA 1U49A 5SWMA 3OA9A 2H8PD 1HJRA 4CHOA 2ZJQL 4B9SA 2Q5UA 4PV1C 1WSHA 4EYYQ 2HNDA 3PSIA 1X79B 2OYHC 3AA2A 3CJ7A 1VPCA 3ID8A 4FM1A 2P9PB 4GMJB 1HVVA 3H1KD 3USSA 1YI2P 2IVNA 1N6QA 4OO1J 4E1MA 3IDHA 1REVA 3MZWB 2UXDK 1KB9D 3DRPA 3LDOA 4FL9A 3V1QA 4JI6K 4W5QA 1SQBJ 2QJYB 1N7SA 3H32A 4ZTFA 3J7AP 1MWKA 1X0TA 2WPSA 2W40A 3HD7C 3G4SP 1L3SA 1H0TA 1HQUA 3ASMA 4AHTA 3E1YA 1QHAA 2WMMA 1T6CA 2ATQA 3F73A 3VQEA 4CJKA 3MXMA 3H1IJ 1JMMA 2E2OA 1HNZK 2YHXA 2QTDA 4FWSA 3L70D 3AA5X 4DZOA 2B89A 3BEXA 1KZUB 3H1LE 1NGJA 1JTHB 1OFCX 1KB9H 3O3HA 2YHBA 3FZKA 3A7OA 2YKOA 3IMXA 4MN4C 2D4WA 3BZKA 1Q9XA 2O8EA 5C12A 4BDYA 2QK9A 1MV8A 2FBTA 4BRLA 1K9MO 3T97A 3DMJA 3L74D 3LP0A 4YOTA 1MWMA 1KILD 1RF0C 1C0FA 1S1XA 4I1LA 3DOKA 3L4QA 1ATRA 4FLUA 1ZBIA 4O5BA 4CHNA 2M3EA 1NKBA 1L3UA 1Q7YQ 1L0NG 3PV8A 2UUAK 2YKQA 1L0LJ 2HODB 4OKKA 3V9WA 4NPEA 4H0LB 4LF6K 2PGDA 4QCLA 1VQKN 1T44A 4BRGA 1SL2A 1N2DC 4DR3K 1RTHA 3MMVA 2NPSB 1RBTA 3A0HH 2NRRA 1DLOA 4U3FJ 1YAGA 3H1ID 2GUVA 3A5LC 4CZJA 4B9VA 1NLVA 2JJLA 2OQQA 4JKHA 5BN9A 2NPSA 2E1YA 4DLEA 2E4LA 5HL7L 1KYOE 3T1HK 2D0CA 2KS1B 2FF6A 2E6MA 3I55N 4DV4K 1KFMA 2KB7P 2KI7B 3AGKA 1LAVA 3VQBA 2V4HA 5AVSB 3E9PA 1QSYA 2HHHK 1EX4A 5M1NA 3PLNA 2CGLA 4B08A 3A0HE 4JKFA 3VOVA 4DTNA 5AQKA 1GW3A 3JAMO 1NJIO 1N7SB 4U7BA 2R5BA 1WSGA 3V2PA 5I42A 5JICA 2ZD1A 4CJ7A 2WTYA 1ZOYC 3WUTA 1RDUA 4EP5A 4CESA 2WSCJ 2AA4A 3O8MA 4F2SA 5FPNA 2A40A 4J2EA 3WT0A 1N73A 2KHOA 1VSHA 1J1DB 4U3FD 4IFFA 3CCRN 4JF7A 1KC8Q 2CGKA 2NRWA 2P9LA 3CJAA 5AW5B 3E01A 4WCEL 1S1VA 3N4QA 1U2VA 3VOPA 3THYB 4U7JA 3CX5H 3DLRA 1U57A 1XNQK 2HB5A 3L73G 3AEBC 3RK3B 1HMVA 1JLQA 1LT1A 1GLFO 4PKGA 4HUGA 4U67L 5B5EH 5K14A 4O0IA 3NH2A 3WXJA 5AW0B 1ATSA 4B1VA 4WFBL 3H1JG 4AQRD 1J9AA 3ABVC 4I7ZB 4KO0A 1UA1A 5FDLA 1KYOH 2IPPA 3F5HA 4OH8B 3CYMA 3UE5A 4E0DA 3QICA 4IOIH 4CEDA 4JNEA 1P84D 2GEMA 1ZC6A 1QL1A 1SQXE 3M0AA 1VSFA 3O80A 2FC0A 2ZAEB 3C6AA 4RW4A 2IC3A 5AFUH 4A57A 4N76A 3CC4P 4Z4FA 3UB5A 4HUEA 3MUDA 3ALYA 3VA3A 1YJNN 4M3ZA 3L35A 2BTFA 5FROA 4DV3K 3AAPA 5KLVG 4B1UB 4B3TK 2E6LA 3A5OC 3L6QA 1HX1A 1Q82O 1JXEA 3IR9A 4OPJA 1IG8A 1FZAA 3SBTA 3CC7P 3CCLN 1M56D 2KLVA 4BR9A 1HUCA 4HH2A 1U2VB 2D0AA 1YBKA 1U6ZA 1L5UA 4XA4A 4R4LA 1BSNA 2YXRB 3H08A 1PPJD 2XDJA 1IH7A 1SV5A 2OARA 3PJSK 2NNWA 1FJGK 4JKGA 4OJRA 3VETA 4OPHA 3G71N 3RTVA 2OA8A 4H44B 4I9LA 2Y0CA 1SFCB 4KAZA 3CXHI 1EQ7A 3VF2A 4KREA 2HNYA 4YOWA 5KGXA 4FW2A 5BR9A 1KFSA 3NDKA 1HJ0A 3C7NA 1BUPA 5JLHA 3EZWA 3M9QA 2LXCB 4W5RA 4AF1A 3H6EA 3NF7A 1Z25A 3VGMA 1G2CB 2Q36A 2FFDB 5F1XA 4A62A 3NFAA 4KH5A 3RMAA 2W83C 3L72D 3LAKA 1K05A 1H89A 3M5RA 3ZLJA 3EYZA 1OH7A 1NTKK 2FXOA 2D1KA 2YX6A 3VQCA 2OYQA 1RBRA 2BASA 4Y99C 3OBWA 1YHQN 3KWIA 4H03B 3KXDA 3CWBE 1T8EA 3FX0A 5CCGC 3GF7A 3LDQA 1XI1A 3M3ZA 3AEAC 1OMIA 3RMDA 1BCCJ 2QWNA 1YQ3C 3QWOC 1YT3A 3T1AA 4AHUA 4LC9B 4M7XA 4DKWA 2VYPA 3I33A 4MFBA 3ULEB 5H1SQ 4C46A 2OPQA 5LMNK 4JI1K 1M90O 5AVXB 2RKIA 5M1PA 3SSUA 4FJHA 3AEFC 3OAKA 1FOSF 1YIJP 1VSIA 2XY8A 1EWRA 4JS5A 4IBNA 5LJVA 1M57D 4IKFA 4FWLA 5SZTA 1GLBG 5CE3A 5CZ1A 1KFDA 2GX9A 4WQ5C 4HB1A 3AECC 3D71A 1BIZA 3L2RA 5AQVA 3OYDA 3SQ1A 1HNXK 3V9XA 3HD7A 1QZ5A 2E1ZA 1RT2A 4OLAA 5AZIA 4BC2A 1J2JB 1L4AB 1F21A 3L2UA 3AVFA 1S22A 1HPZA 3TANA 2P1JA 1NWQA 1UIXA 1KILB 4CF1A 4FJ9A 5I3UA 3HVTA 3RK3C 3NHGA 3PY8A 2C0XA 3AA4A 3M0DA 4CEAA 4WFNL 1QLED 3MEEA 5JS1A 3FZFA 1X22A 3O9SA 2KOGA 5CZ2A 2Y0DA 4ISEA 3NVKA 2E76C 4UQGA 2Z1GA 3PSFA 3VQ7A 3DLHA 3IN6A 4M3RA 1NVOA 3FGAD 5L8RJ 1S9EA 4FWRA 4WY4A 5JVGL 1T6AA 3RGUA 5C0YA 5AQGA 2JWLA 1P8ZA 3HE4B 4HYTB 3CFPA 3TF5A 1MZ9A 3SMPA 4BRKA 3K5NA 3R4YA 4YORA 2E75C 1NTMK 4LFCK 3A5TA 2WWWA 4DQ8A 3K58A 3P1GA 4WBAA 4OLBA 3SQ2A 2GUIA 3U9DA 3O9QA 1IFJA 3SI6A 3KIOA 4C1NI 1C1AA 4W5TA 2D0BA 3KVGA 4IOAL 2O01J 4H13C 3TWHA 1C0GA 3RWUA 4BRDA 3HJFA 4FJNA 1LWUA 1I94K 5DK5A 2ZGYA 3L2VA 2A06D 2YKPA 2HNZA 3OVNA 1P90A 4E7HA 1NKZB 1IFMA 3SZ2A 1VQPP 3TI0A 3SWFA 1LP1B 3AVGA 3FGUA 4YXWH 4IG0A 5F0XA 4DSFA 4NPFX 3H1KE 1OVYA 1VSEA 2J5UA 2AEMA 3CCMP 1NJYA 1RHZB 4KHWA 2W27A 1URQC 1BA0A 3RRGA 5AFUA 3M06A 1VQLP 5APQA 5GIPA 2KYVA 1FJKA 4FO0A 3AE1C 2Z5HA 4XH1A 3LW5J 5APXA 4B8CA 1NGAA 1VAZA 4RWTA 3ULDA 1XHZA 1OX3A 4H44C 4RW7A 4OKEA 3CETA 3EWKA 1JL1A 1GL2A 5KI6A 4ID1A 3VQ5A 3HOSA 3Q5SA 1YJNP 2PP6A 3AEGC 4O5FA 4WE1A 5DMRA 2HHQA 1TK8A 1GL2C 4F3OA 2O8EB 4UB8E 5GIOA 1NTMG 1HYVA 4H5RA 2WBNA 2KQ2A 3NGZA 4ASVA 1JMBA 4DS5A 2HF3A 3PIPL 2FXMA 3K57A 4JK8A 1AQ5A 3G25A 3QO9A 2XY5A 2P9IB 3S9OA 2E74C 2IBZI 4BVOA 4BRHA 1CW5A 4I2PA 3OYEA 3V9ZA 1U45A 1T3JA 3RK3E 3KKRA 2WUSA 2A06E 3D2EB 4DV7K 3QNNA 1FE6A 2P9UA 1FZFA 4BC3A 3V9UA 4PD4H 2IVPA 2M5AB 1SQQJ 3VYIA 1NMDA 2P5OA 4YTPC 3ID6A 5CCHD 3LL3A 3U1AA 4G1QA 1K73Q 2R3SA 1G1IA 5KLIC 2KLUA 4QS7A 1NTKG 1MKMA 5EOYA 4M45A 1R59O 5APSA 3TGUJ 1N36K 4FVMA 3DXMB 1XC9A 1C0UA 1NJXA 2Q3EA 1JY2P 3ZETB 1GLAG 4AH9A 4E7KA 3L75G 3H1LJ 2ZFCA 2YNFA 3SPZA 3LDNA 2BGGA 2AJQA 4I7FA 4KH6A 2YNYA 1M8OB 3CFOA 3C95A 2Y1IA 2QW9A 1VF5C 3L3UA 5AQLA 1BGYG 4GW6A 3EQ2A 5FRNA 3MAQA 2KP8A 3HYFA 3S3MA 1BDGA 2KZMA 2YNIA 3TR8A 1PL5A 1RF0A 2KZZA 4IL6E 2P9KB 4DR4K 2G8UA 1TV6A 4N3YB 4DB3A 3V4QA 3VENA 1VQ6P 5T7BA 1GK6A 2WPVB 2O8BB 1KMIZ 3ENBA 3SAHA 1G99A 3SQ4A 1SQXK 2K3RA 3L70G 2QI2A 1SQBD 1K8AQ 2D0OA 4JN4A 1HQEA 3DLKA 4E1JA 3C6UA 5JMVA 1DX7A 3KQGA 2BCCJ 1DEBA 1QQMA 5M1FA 2Z1JA 1S4XA 2ZXEB 3HE5A 5AW9B 2YKNA 5KJ7A 3HPGA 1BCCE 3CC2N 3KD1E 4BE2A 2SPZA 3CQ8A 1TAUA 3UKRB 4M7YA 3PH0A 2YKMA 4MDAA 5AQRA 2G8VA 4B3OA 3DLLL 4EP4A 2F4VK 1MUUA 1LTTC 2K9YA 3AE5C 1EXQA 4AHVA 2RPIA 1U4BA 3U9ZA 1SL0A 4O55A 3M9HA 3R2PA 4FSVA 4C1NK 4C8OA 1SQVG 1HYZA 4WYBA 4Z94A 4GVEA 5J2QA 2V51B 4H5VA 5KKZC 1KXPA 3P38A 1JCCA 2WPQA 3H1LG 1W2BO 2NRTA 4HVJA 1M90Q 3JSMA 4ELTA 4M3TA 2HVIA 2W6JH 3BVHA 1KQGB 1YJ9N 3EZ5A 1GW4A 1KFNA 4D6TG 1L0LD 4DR2K 4DSKA 5AQSA 4EZ9A 2OYHB 3OJUA 5EFWB 2R44A 2FF3B 5TKYA 4DCHA 4ILHA 3ZSZA 1NK8A 4CEQA 3KLFA 5H2FH 4DQIA 1NHLA 3AO3A 1FZEA 3CJBA 2I1JA 4E7JA 3ZT2A 1JTHA 4O8UA 2E2QA 4B9TA 1ZBFA 2A1SA 4H0VB 1ATNA 3HUSC 4FLVA 3S4RA 3NGYA 3TNUA 4CJLA 1OVUA 4XH4A 1X9SA 3B5ND 1UA0A 3ZSQA 5GAHP 3CPEA 3RBZA 3G71P 3W0LA 3MEGA 3TNUB 3R1XA 4K25A 5HROA 1SQBG 5B66H 1VQNP 2VCPA 1M1KQ 5AVYB 4JKDA 3ZT4A 3ZX3A 3AVLA 3AO2A 3KHUA 3A2FA 2YCHA 2WT7B 1XHXA 3CJCA 1RBUA 2P7JA 1YVNA 3L8BA 3M9BA 3SNNA 1N5YA 4PJ0H 2C9LY 1JLEA 3E66A 4YNQA 5BRFA 3KD5E 4CERA 4YOVA 4IL6X 4A7PA 3V1RA 4CECA 1PFIA 1YITP 3HE5B 2J4RA 3AARA 1AQTA 1SKWA 4JI5K 4PWDA 1S2EA 4C23A 2ZGZA 4ELVA 2NRHA 4BGAA 3CX5E 1L2PA 1NGFA 4GVMA 1QX8A 1JCFA 3CPWM 1Q2NA 3PO4A 3HPOA 2JR8A 4M63C 1IBMK 2X6SA 2POHA 3LW5H 1A5VA 5AQNA 2HW3A 3MN7A 4FYDA 1EO1A 1NGIA 2JKVA 3U4LA 4BC4A 3GHGC 1A5WA 3MX5A 1LWCA 3HBTA 2ZE2A 3GL1A 2ZJSE 2ZWHA 3LPTA 4JEPA 1Z6RA 4OVNF 2D2CC 2Y9ZA 2ETJA 5KPTA 5KTQA 1SUQA 5HRNA 2LSNA 1NAFA 1LT9B 2A6AA 4O4GA 4EHUA 4KTQA 1NG9A 1NKCA 3FXEA 1T6DA 1YJWP 4X64K 1YTZT 5HRPA 5KAIE 3SUQA 3D2FA 3WXKA 1PGQA 2K37A 1WBDA 1LAWA 1ASWA 1GL2D 3KK2A 5BRHA 1WMKA 3CG7A 4LSNA 4K42A 3TTCA 4DJGA 3DI6A 4CW7B 3HVRA 2UUBK 2GWKA 3Q2YA 1SQXG 2V7QH 1KN7A 3MGNA 3E1RA 5CBNA 1NJZA 1HKGA 2KZIA 3GDQA 4KRFA 3O4QA 2PAVA 2IS3A 3SWKA 3OS0A 4GDOA 3AA3A 4BG8A 2BUPA 1J1DC 2JO1A 3MP7B 1D9FA 2O1JA 4B1XB 3P32A 1SQVJ 2FSJA 2I5JA 1SQPJ 3O8ZA 1X9WA 2WT7A 2YHAA 4CK3A 3CQXA 3TTFA 4IFDK 3I55P 3VQ8A 2QJKB 4KKOA 2JP3A 2ZYAA 1X1PA 1WT6A 2PFXA 2L91A 1ASVA 2QJYC 1YVUA 4FJKA 1NTZG 2Y9YA 3BRVB 4XE5B 1SQPK 3ZX0A 1FXXA 3DJCA 2OTKE 1LWUB 4FJLA 2OYIC 2DFFA 1VF5D 3LDLA 3QNOA 3L73D 1SL1A 1NTME 3L72J 3PP5A 4BDPA 4I2LC 2QWPA 5F2RA 3NTNA 3FWLA 4IO8A 4LFAK 2P51A 3KZIH 4GKGA 3P8CE 1ESVA 1KLMA 1RILA 4CVNE 3CFRA 1NU0A 1XWLA 5IT9O 4KHNA 1PP9D 2XNXA 4HWIA 4Y1CA 4WY4C 3CMAP 4H0TB 1VK0A 3VEWA 2E42A 1V4TA 2X6NA 5AW8B 4EI2A 4QMAA 1IKWA 3TAEA 4DCKA 3SFEC 4NLCA 1QVFO 1GL2B 3VN5A 4CJ4A 3HD7D 3AVAA 1KQSM 4DV5K 2UYTA 1M1JB 1SQXD 5K5GB 2DFEA 3SAFA 4JKBA 1TL3A 3THXB 3AE8C 3HRNA 5C25A 4M3YA 5CCHC 1BE3G 1Y47A 1FZBA 3M1FA 1DT9A 5CY4A 1NOYA 3U3GA 2A45H 1L3VA 3WQTA 5D3GA 3BP8A 1VQ8P 4C8KA 5HRRA 2QA4N 2FSNA 4H5TA 2A1RA 1S9GA 1VL2A 1LP1A 1J5OA 1JXBA 3NH0A 4ZKPA 2VG7A 5AQUA 3KJVA 3A0BE 2NRVA 3D7EO 3FFIA 4KT0J 3MHVA 4DS4A 3HL8A 3GW6A 3ITKA 2O01H 1K8AO 2FLOA 2J58A 3MWTA 3P8CD 3T69A 4N41A 3CMAN 1DD3A 2Z4EA 1L4AA 1T05A 2P67A 4DTXA 4C8MA 4A2BA 2G3AA 1T8ZA 3IKMA 1L4AC 3O4WA 4TSXA 2W8ZA 3AEEC 1NGDA 2HPCA 5KLVJ 2AEJA 3BUZB 3A0BH 3SCXA 4OGQC 4NYNA 4A5BA 3BRTB 2OTLN 4WY4D 1QVGM 3BF1A 4CJ3A 2G8HA 2ZVOB 3ZSVA 4UB6H 3AO1A 2HPCB 4KHSA 3OYHA 1FJPA 1SS6A 1JJ2M 4DHYA 3CCUP 4CJVA 3RR8A 2H89C 2C0WA 3JXUA 1XNRK 4CZFA 4JYAK 5CCGA 4H5WA 5TKWA 2B88A 2OPPA 4CD1A 1IK9A 4I7ZC 3UKUA 1JY3P 2BCCE 1RQVA 1LWFA 1NJIQ 3WEEB 2AP1A 1YTUA 1NTZE 3QEVA 2Q0UA 5AW6B 4EDFA 1O13A 4Z4CA 4H0PA 1L3TA 1PP9E 4U3FG 3CMEP 3TAGA 4BR4A 4IWVA 5EU7A 1FZCB 1K6YA 4JI2K 3BF3A 2F9WA 3ZSYA 2OZMA 3FWNA 1GDTA 3NAEA 2QJKC 3L70J 5CR4A 1MDUB 1ZBLA 1JLBA 5M1OA 1J54A 1KQLA 4IDHA 4QAGA 4DSJA 3OW2M 1NH4A 1LTJB 3NH1A 1JLFA 3OTOK 4KHPK 5EVZA 4H0YB 3TSUA 4JKGB 1RF1C 4CCHA 5KKZB 1FS0E 3VMAA 3W3DA 3OBYA 4NXNK 3RSEB 1ZBSA 3G0ZA 2ZXXA 3EL2A 4J2DA 2BEZF 1C1BA 3TGUE 4CZKA 5M1KA 1ZYQA 1W97L 2IZ1A 4CK2A 2WSFH 4CJTA 3D6YA 2BCCD 4JKCA 2W42A 3WEEA 4G9ZA 2E20A 4K0KK 1SQPG 1NTZD 1NOZA 3NF6A 4YOYA 1QQNA 3CMEN 4F2RA 2FKWB 1VQ7N 3TTDA 2FFDA 3OYJA 5AVZB 3B5NA 4R4MA 3KLIA 4CGJA 1YYCA 5FPDA 2FFDC 5DJTB 2M8RA 4FWKA 3H45C 5HLFA 5FLXO 2WSCH 5CCGD 4Q5VA 4AHRA 4E7IA 1GZLA 3PHLA 2P58A 5KGWA 2E43A 1OW6A 1U48A
chains in the Genus database with same CATH topology
3K5LA 2PYJA 1T7PA 3HTKA 3AVHA 1MFZA 4DTPA 2O4GA 4FM2A 3VQQA 3BGRA 3VA0A 3B6PA 1JY2N 4DTOA 1H8AA 1BI4A 1RE4A 1S9KE 1N73B 1AFOA 1HGVA 4R5PA 4OGEA 4KB1A 4LD0A 2DY4A 2A45I 2OZSA 1TL1A 1HBWA 4K8ZA 3S3OA 3LAMA 1RY3A 3KYQA 2QXFA 3VQPA 4FJ5A 3SJJA 2HMIA 1JY2O 1ZLLA 2OYIA 1HRHA 2OYHA 4B86A 2P5GA 3QERA 3SV3A 3AVNA 3VMZA 2HHUA 1JOCA 1Q9YA 4AHCA 4CJ5A 1NKNA 3DLEA 2PAJA 1YTAA 1RT3A 3LANA 1FZCC 3OY9A 3DRRA 4FXDA 1JNMA 1DH3A 3L36A 4M3UA 3DLBA 1ZV8A 1NK7A 2R5DA 1L4AD 1KVAA 1BISA 4JRQA 2XRIA 3TAFA 3TK1A 3GHGA 2ITGA 5HBMA 4I9QA 3ZT3A 2XU6A 4FJ7A 3QEPA 4Z4EA 1RDCA 4W5NA 3L3VA 1LWUC 2KFNA 1XTCC 1SFCC 4FLWA 1S1UA 3V6DA 3EY1A 4DLGA 3ZCMA 3C6TA 1B9DA 1QL2A 2JGUA 3LALA 2I1KA 2WSEH 3OYFA 3NF9A 2G8FA 2CPSA 1JLCA 1RTDA 1S1TA 1ITGA 1SQQK 3H32B 1G2CA 2Q7CA 2HLOA 1GTWA 1WNSA 2YO2A 1IKYA 5AVQB 2G8KA 1QHTA 4FLXA 4ZKUA 3RMCA 4IG3A 1KSPA 1D9DA 5APVA 1TK0A 1NO4A 2YO3A 4CEZA 2Z1IA 3NMDA 4KTWA 4HHTA 4N5SA 4KTZA 2W6AA 1VSMA 3KK3A 4CFDA 3RK2D 3OYMA 1BCMA 3V5BA 4OVLA 4RESB 3MECA 2OPRA 4CK1A 4DTRA 1FK9A 3ZSXA 1URQD 3AV9A 5KLVK 3HT3A 3RK3D 4HTUA 4CJQA 3WNHA 4AUWA 3RRHA 4RW8A 2Y1JA 4O9BA 3HE4A 1GU5A 3AO4A 5BU5A 1Z26A 4QOZB 3PX0A 4NCBA 4FJXA 3QEIA 3NGIA 4CHYA 4FJ8A 4W80A 4CEFA 1RT1A 5AW7B 4CGGA 2L5GB 3L4FA 3VTPC 3SWYA 5J1EA 4W7YA 3HD7B 5E41A 2H43A 3TAMA 1SKSA 3LWLA 4AHSA 5AVUB 3TAPA 1C6VA 3ISNC 1ZBUA 3L37A 4DF8A 1IFIA 2HODA 4FLYA 1T2KD 3K5MA 1JL2A 3KLHA 1A5XA 1IKVA 1QSLA 1TKXA 4L8RB 4RW6A 3NE6A 3IS9A 1RTJA 2VG5A 3QLHA 3LZJA 2Z1HA 1ZR2A 1N86A 3IG1A 2XY6A 5HRSA 2H7HA 1JLGA 1HNIA 3I8DA 4DSIA 1IG9A 3LPUA 3RK2C 5CJ0A 4CIFA 1ZN5A 1VSLA 4Y1DA 2FYUK 1WSEA 3P5JA 2RF2A 5AW1B 4LLHA 2P2UA 3OS1A 4FJGA 4PQUA 2A45G 1QTMA 1QS4A 4IFVA 2YNHA 3LP1A 3VMXA 3M8QA 4N78D 3OYCA 4H4OA 1UOCA 5APYA 1J53A 1NK0A 1S6PA 3B5NB 4CJRA 1VDFA 1S9KD 4DTSA 2QKKA 4CHPA 4DU3A 2FBXA 4CIEA 3TABA 4N6JA 3MXIA 5JS2A 1LW0A 1WLJA 1RT6A 2DTUA 1T3UA 1Z56A 4AILC 4BWMA 1C1CA 1QE1A 2MJZA 1UAXA 1SQVK 3BATA 5BVZA 2OPSA 4B9MA 4CEBA 4E3SA 3H6PA 4EZ6A 4N56A 3QEXA 5CJ4A 5BU8B 3OYKA 2Q9IA 1ZR4A 3ZT0A 1M7LA 1C0TA 3LP3A 2NPSD 3K59A 3V9SA 2X78A 1FAVA 4CJPA 4DF4A 1CZ9A 1IFDA 4CEOA 4XIUA 4WY4B 3P8MC 1XTGB 1KCFA 4JYBA 4C8LA 3WNGA 1W0HA 3RL0B 3SYZA 2N9BA 1FZCA 3E1IA 3RL0C 3AVBA 4B9UA 1WN7A 2W6BA 4N47A 4PY5A 3SUNA 3I5CA 1J1EB 1KVBA 2QM7A 1BI4B 4CF9A 5HP1A 3VP8A 1HTLC 2XY7A 1IKXA 3B8EB 4PA1A 3V81A 4KPYA 2QM8A 3VQDA 3C9IA 3KLEA 4KI4A 3B5NC 1MU2A 2VG6A 2LKMA 3QIPA 2B5JA 4J2BA 3GHGB 2WITA 4FCYA 1JO5A 5KJ7C 4LH5A 3UIAA 1LTSC 2GM4A 3BDPA 1CXUA 3ZSRA 4E7LA 1X8YA 4NCAA 1FZGA 3VMYA 3QINA 1A02F 1FU1A 1NTZK 3OYNA 1NK4A 1RE3C 1G1JA 1I3AA 2IX7C 1NK6A 1KILC 3IFMA 5AVTB 5APWA 4NCGA 1BL3A 3NCIA 2N1TB 2Z5IA 1D8YA 4C7NA 3IAYA 1JY3O 2IFMA 2BE2A 1RT4A 1NK5A 2HYNA 2NUBA 3JYTA 1NJWA 4C7NB 4RG8A 4BE0A 4LSLA 3V2NA 1RF1A 2F8TA 1D5AA 3OYIA 4E1NA 3VQAA 1NK9A 3NXSA 2PY5A 2X74A 1R0AA 4M3LA 3TSIA 4FJJA 4DQPA 4I2QA 5KRTA 4JRPA 3CI9A 4CJWA 4F3TA 4CE9A 3EFGA 4HCBA 1NOHA 4FW1A 2HHSA 3F9KA 3AVMA 4KHXA 1IO2A 3RL0D 2EHGA 5AW4B 1N7LA 3V2RA 2Q3IA 1ASUA 4HCCA 2JEEA 4CJFA 1TK5A 4DFMA 3SPYA 3PUFA 2F96A 3LIDA 3M8RA 1GOCA 2KSJA 5FRMA 1IJDB 1RT5A 1RNHA 3RMBA 3WMM0 2VRSA 2EX3A 1LGHB 3PX6A 2NPSC 2R32A 1WSFA 3MIWA 3O3FA 1M1JC 1RE4C 3HP6A 1HWTC 4EOTA 1LT9C 2XHBA 3P83D 1TAQA 4ZTJA 3N7NA 2G8WA 4OKJA 1VRTA 1VRUA 4ZHRA 3T19A 3OYGA 1QSSA 2XKMA 3MEDA 2BANA 4FZYA 4M3WA 2R3CA 1KILA 4Z4GA 2IOCA 1BQNA 3LDSA 3L2QA 3OYLA 1X9MA 4FZZA 3SUOA 3A3YB 4KHQA 1N7SC 4FLTA 3ZSWA 4DQSA 3SQ0A 3CM6A 4W5OA 5APUA 4KFBA 3SV4A 5CYQA 5APTA 2N1TC 2R7YA 2HHWA 1LTGC 2RN2A 4B9LA 3AVKA 3RR7A 2WOMA 2J59M 3OYBA 4FJMA 3QEWA 1S1WA 2Q3SA 5KTBA 3HPHA 3D45A 4C8NA 4B8AB 2GBZA 3HTKB 2PYLA 3T3FA 3KK1A 1CZQA 2VWKA 4DSLA 1LW2A 4H4MA 3QIOA 3TYYA 1WAFA 1URQB 3OYAA 5C42A 2WONA 4FK2A 4DTJA 3KTQA 1I39A 3LIEA 3UIQA 1LV5A 1TKTA 4H8KA 2F8SA 3AVCA 1LTJA 4NYFA 2VWJA 1SKRA 1EETA 4O0JA 2YV0X 3AO5A 3VP9A 3BASA 4IDKA 3PX4A 3M8PA 1JLAA 4F4KA 1SLQA 1KRPA 2GUSA 4EIJA 1RE3A 1CLQA 4CGFA 1W2EA 1CZBA 1HGZA 1N73C 3TARA 4KV8A 1TKZA 3M8SA 1VSKA 3V4WA 1WAJA 3NBPA 1RDDA 4DSEA 1JUNA 1BQMA 1KLNA 1IC2A 1DTTA 3CLQA 1BGXT 4KHYA 1HH0A 1GK4A 1IO4A 4DQQA 4DU1A 3D0PA 4CEEA 3K2PA 3DOLA 1RT7A 3PO5A 2CPBA 3THVA 3I0SA 1JY3N 1CI6B 4J2AA 1WSIA 1T03A 4MQ3A 5CHXA 3LWMA 4Q0BA 4B9NA 2IGIA 4CHQA 1LTAC 1Y97A 3O3GA 4ID5A 1E5WA 1QQCA 1RTIA 3KKSA 4OPKA 5J2NA 1LTBC 3OJSA 4I6MC 1G15A 1OWAA 4LGDE 4CFBA 1BIUA 3VQ9A 1FKPA 3V4IA 1SQBK 1DTQA 4Z0UA 4FLZA 4DQRA 4E19A 2OYIB 4DWIA 4BWJA 1L0NK 3HSTB 3U3YA 4BACA 3II6A 3O4NA 2XO7A 4FK4A 1RBSA 1M1JA 5KJ7D 2WZ7A 4RW9A 2HVHA 4IFMA 2BDPA 1SFCD 3U6FA 2YMYA 3DRSA 4KI6A 1YTZI 3ZSOA 2HHXA 2JLEA 1B92A 2GV9A 3HK2A 2O1KA 3OJAB 1FBMA 2PZSA 1NU1K 3OS2A 5AVVB 1GOAA 3HXMA 1CI6A 3S9HA 3A2AA 4LC1A 4W7ZA 3KDPB 3QETA 3HUSB 1C0MA 2XV5A 3NFQA 1HYSA 1H88A 2IDOA 1N7SD 4CF8A 1W9HA 3M0DC 5CYMA 2KFZA 2N1TA 3P7KA 4M41A 4IFYA 1KTQA 1WRGA 3C94A 1JCDA 3K5OA 3M91A 4K8XA 1LWEA 2FBVA 3V2QA 4BE1A 4FZXC 3WNEA 4FJIA 4E89A 4YFUA 4CGHA 4DFPA 4OGCA 3VQ4A 2IAJA 2HFED 3IRXA 2KTQA 1U47A 1FKOA 4DTMA 3ITHA 4DTUA 1WSJA 5J2PA 1O1WA 4LH4A 4PUOA 3DLGA 3OA7A 1BHLA 1GD2E 1UWBA 1SFCA 4DMNA 4N78E 4Z4IA 3DYAA 4F8RA 1LTJC 3LZIA 4M42A 4CIGA 1LT9A 1GOBA 3N4XA 3LP2A 4BDZA 4KB0A 2IFNA 3TAQA 4AYCA 4DG1A 1ZBHA 4JYCA 2YNGA 2N1TD 1CXQA 3HP9A 1TKDA 1BCOA 4ELUA 1HNVA 3QESA 1GU4A 1X9VA 1VSDA 5AW3B 2FBYA 2M3BA 4CHZA 1VSJA 1S5JA 1T2KC 1U04A 3U59A 1Q8IA 4CF2A 4O44A 1OXZA 2QKBA 3V1OA 3HUSA 4JS4A 3MXJA 2ZQBA 3HM9A 2HHTA 4CFCA 1B9FA 1J1EC 3I0RA 1L0LK 1NKEA 4ICLA 4CJEA 3S3NA 3MD0A 2C9NY 1LTIC 3KPEA 5AW2B 4DFJA 4KHUA 3CM5A 4GT1A 3ZT1A 2DFHA 4DFKA 4WB4A 3CL3D 1FOSE 4C7RA 3B6OA 4Y99B 1IFNA 3KLGA 2HG5D 1KVCA 3NF8A 3RK2B 1RBVA 4Z4HA 1HJBA 1S6QA 3SUPA 5CCHA 5J2MA 3G3ZA 1EKEA 2WPRA 3AVJA 3HO1A 2B6AA 3MTUE 1RDAA 1CSBA 2XZRA 1SVFA 1RCHA 1A02J 4CJUA 4CGDA 4JLHA 3VN0A 5CMZA 4M3XA 1TVRA 2G8IA 3WNFA 1SP4A 4CFAA 1EP4A 4CGIA 4FM0A 4HUFA 4LY7A 4FK0A 5C24A 1URQA 4DU4A 2B4JA 1JKHA 4CF0A 3U1CA 4CJSA 5KRSA 3L2WA 3G10A 4DOJA 3AVIA 2FYZA 5AVRB 4GIFA 1RDBA 2D5RA 3VQ6A 2O4IA 3DM2A 2KW4A 1RF1B 5AVWB 1TGOA 1FDMA 1U49A 5SWMA 2H8PD 1HJRA 4CHOA 4B9SA 2Q5UA 1WSHA 2HNDA 1X79B 2OYHC 3AA2A 4FM1A 1VPCA 4GMJB 1HVVA 1N6QA 4E1MA 1REVA 3DRPA 3V1QA 4W5QA 3H32A 4ZTFA 1N7SA 2WPSA 3HD7C 1L3SA 1HQUA 3ASMA 4AHTA 3F73A 2ATQA 3VQEA 4CJKA 3MXMA 1JMMA 3AA5X 4DZOA 1KZUB 1JTHB 3O3HA 2YHBA 3A7OA 2YKOA 1Q9XA 4BDYA 2QK9A 1MV8A 2FBTA 3T97A 3DMJA 3LP0A 1KILD 1RF0C 1S1XA 4I1LA 3DOKA 4FLUA 1ZBIA 4O5BA 4CHNA 1NKBA 1L3UA 3PV8A 2YKQA 4OKKA 2HODB 3V9WA 4QCLA 1SL2A 1N2DC 1RTHA 2NPSB 1RBTA 1DLOA 2GUVA 4B9VA 2JJLA 2NPSA 4DLEA 2E4LA 2D0CA 2E6MA 1KFMA 2KB7P 1LAVA 3VQBA 5AVSB 1QSYA 1EX4A 4B08A 4DTNA 1GW3A 1N7SB 2R5BA 1WSGA 3V2PA 5I42A 2ZD1A 2WTYA 4EP5A 4CESA 4F2SA 4J2EA 1N73A 1VSHA 1J1DB 4IFFA 4JF7A 2HHVA 3E01A 5AW5B 1S1VA 3VOPA 3DLRA 2HB5A 3RK3B 1HMVA 1JLQA 4HUGA 5K14A 4O0IA 3NH2A 5AW0B 4AQRD 1J9AA 4KO0A 1UA1A 5FDLA 2IPPA 4OH8B 3CYMA 4E0DA 4CEDA 1QL1A 3M0AA 1VSFA 2FC0A 4RW4A 4N76A 2IC3A 4Z4FA 4HUEA 3VA3A 3MUDA 3ALYA 4M3ZA 3L35A 5FROA 2E6LA 1JXEA 3IR9A 4OPJA 1FZAA 2KLVA 1HUCA 4HH2A 2D0AA 1L5UA 4XA4A 3H08A 2XDJA 1IH7A 1SV5A 2OARA 4OJRA 3RTVA 2OA8A 4I9LA 1SFCB 4KAZA 1EQ7A 4KREA 2HNYA 5KGXA 4FW2A 1KFSA 3NDKA 3M9QA 4W5RA 3NF7A 1Z25A 1G2CB 2FFDB 3NFAA 3RMAA 3LAKA 1H89A 3EYZA 1NTKK 2OYQA 3VQCA 1RBRA 2BASA 4Y99C 1T8EA 5CCGC 1XI1A 3RMDA 1YT3A 3T1AA 4AHUA 4MFBA 4C46A 2OPQA 5AVXB 2RKIA 4FJHA 3OAKA 1FOSF 1VSIA 2XY8A 4JS5A 4IBNA 4IKFA 5SZTA 5CZ1A 1KFDA 1BIZA 3L2RA 3OYDA 3SQ1A 3V9XA 3HD7A 4OLAA 1RT2A 1J2JB 1L4AB 1F21A 3L2UA 3AVFA 1HPZA 3TANA 2P1JA 1NWQA 1KILB 4CF1A 4FJ9A 5I3UA 3HVTA 3RK3C 3NHGA 3PY8A 2C0XA 3AA4A 3M0DA 4CEAA 5JS1A 3MEEA 5CZ2A 2KOGA 4UQGA 2Z1GA 3VQ7A 3DLHA 4M3RA 1S9EA 4WY4A 3HE4B 4HYTB 3CFPA 1MZ9A 3K5NA 1NTMK 3A5TA 2WWWA 3K58A 3P1GA 4WBAA 4OLBA 3SQ2A 2GUIA 1IFJA 3SI6A 3KIOA 1C1AA 4W5TA 2D0BA 3TWHA 3RWUA 3HJFA 4FJNA 1LWUA 5DK5A 3L2VA 2YKPA 2HNZA 3OVNA 4E7HA 1NKZB 1IFMA 3SZ2A 3TI0A 3SWFA 4IG0A 3AVGA 4DSFA 1VSEA 1NJYA 4KHWA 2W27A 1URQC 3RRGA 3M06A 5APQA 2KYVA 1FJKA 2Z5HA 5APXA 4B8CA 3ULDA 1XHZA 4RW7A 4OKEA 1JL1A 1GL2A 5KI6A 4ID1A 3VQ5A 2PP6A 4WE1A 5DMRA 2HHQA 1TK8A 1GL2C 4F3OA 1HYVA 2KQ2A 3NGZA 4DS5A 2FXMA 3K57A 1AQ5A 3QO9A 2XY5A 1CW5A 4I2PA 3OYEA 3V9ZA 1U45A 1T3JA 3KKRA 3QNNA 1FZFA 3V9UA 3VYIA 2P5OA 5CCHD 3U1AA 4G1QA 1G1IA 4M45A 5APSA 4FVMA 1XC9A 1C0UA 1NJXA 1JY2P 4AH9A 4E7KA 3SPZA 2ZFCA 2YNFA 2AJQA 2BGGA 4I7FA 2YNYA 3CFOA 3C95A 2Y1IA 3L3UA 4GW6A 3EQ2A 5FRNA 3MAQA 2KP8A 3HYFA 3S3MA 2KZMA 2YNIA 3TR8A 1RF0A 2KZZA 2G8UA 1TV6A 4N3YB 3V4QA 5T7BA 1GK6A 3SQ4A 1SQXK 1HQEA 3DLKA 3C6UA 1DX7A 3KQGA 1DEBA 2Z1JA 2ZXEB 3HE5A 5AW9B 2YKNA 5KJ7A 3HPGA 3KD1E 4BE2A 3CQ8A 1TAUA 2YKMA 2G8VA 4B3OA 4EP4A 1MUUA 1LTTC 1EXQA 4AHVA 2RPIA 1U4BA 1SL0A 4O55A 3M9HA 3R2PA 4C8OA 1HYZA 5J2QA 1JCCA 2WPQA 4HVJA 3JSMA 4ELTA 4M3TA 2HVIA 3BVHA 3EZ5A 1GW4A 1KFNA 4DSKA 4EZ9A 2OYHB 3OJUA 3ZSZA 1NK8A 4CEQA 3KLFA 4DQIA 1NHLA 3AO3A 1FZEA 4E7JA 2I1JA 3ZT2A 1JTHA 4B9TA 1ZBFA 2A1SA 3HUSC 4FLVA 3NGYA 3TNUA 4CJLA 1X9SA 3B5ND 1UA0A 3ZSQA 3MEGA 3TNUB 5HROA 5AVYB 3ZT4A 3AVLA 3AO2A 3A2FA 2WT7B 1XHXA 1RBUA 2P7JA 3L8BA 3M9BA 3SNNA 1N5YA 2C9LY 1JLEA 4YNQA 3KD5E 4CERA 3V1RA 4CECA 1PFIA 3HE5B 1SKWA 4PWDA 4ELVA 4GVMA 3PO4A 3HPOA 2X6SA 2POHA 3LW5H 1A5VA 2HW3A 4FYDA 3GHGC 1A5WA 1LWCA 2ZE2A 3LPTA 2ETJA 5KTQA 1SUQA 5HRNA 2LSNA 1NAFA 1LT9B 4O4GA 4KTQA 1NKCA 1YTZT 5HRPA 3SUQA 1LAWA 1ASWA 1GL2D 3KK2A 3CG7A 4LSNA 3DI6A 3HVRA 3MGNA 1NJZA 4KRFA 3O4QA 2IS3A 3OS0A 3AA3A 1J1DC 1D9FA 2O1JA 3P32A 2I5JA 3O8ZA 1X9WA 2WT7A 2YHAA 4CK3A 4IFDK 3VQ8A 4KKOA 1X1PA 1WT6A 1ASVA 1YVUA 4FJKA 3BRVB 4XE5B 1SQPK 1FXXA 1LWUB 4FJLA 2OYIC 2DFFA 3QNOA 1SL1A 3PP5A 4BDPA 4I2LC 3NTNA 2P51A 4GKGA 3P8CE 1KLMA 1RILA 3CFRA 1XWLA 4KHNA 2XNXA 4Y1CA 4WY4C 1VK0A 2E42A 2X6NA 5AW8B 1IKWA 3TAEA 1GL2B 3VN5A 4CJ4A 3HD7D 3AVAA 1M1JB 2DFEA 1TL3A 5C25A 3HRNA 4M3YA 5CCHC 1FZBA 5CY4A 1NOYA 3U3GA 2A45H 1L3VA 5D3GA 4C8KA 5HRRA 2A1RA 1S9GA 1J5OA 1JXBA 3NH0A 4ZKPA 2VG7A 3KJVA 3FFIA 4DS4A 3HL8A 2O01H 2J58A 4N41A 3P8CD 2Z4EA 1L4AA 1T05A 2P67A 4DTXA 4C8MA 1T8ZA 1L4AC 4TSXA 2HPCA 3SCXA 4NYNA 3BRTB 4WY4D 4CJ3A 2G8HA 3ZSVA 3AO1A 2HPCB 4KHSA 3OYHA 1FJPA 4CJVA 3RR8A 2C0WA 5CCGA 2OPPA 1IK9A 1JY3P 1LWFA 1YTUA 3QEVA 5AW6B 4Z4CA 1L3TA 3TAGA 5EU7A 1FZCB 1K6YA 3ZSYA 2OZMA 1GDTA 3NAEA 1ZBLA 1JLBA 1J54A 1KQLA 4QAGA 4DSJA 1NH4A 1LTJB 3NH1A 1JLFA 1RF1C 4CCHA 3G0ZA 4J2DA 1C1BA 1ZYQA 4CK2A 2WSFH 4CJTA 2W42A 1NOZA 3NF6A 4F2RA 2FKWB 2FFDA 3OYJA 5AVZB 3B5NA 3KLIA 4CGJA 1YYCA 2FFDC 2M8RA 5HLFA 2WSCH 5CCGD 4Q5VA 4AHRA 4E7IA 1GZLA 5KGWA 2E43A 1U48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  2B5J A;  4LH4 A;  4J2B A;  4PUO A;  2HNZ A;  3K5L A;  3DLG A;  2PYJ A;  3OVN A;  4FCY A;  1BHL A;  4E7H A;  1T7P A;  3SZ2 A;  1UWB A;  3AVH A;  3TI0 A;  4IG0 A;  3AVG A;  4DSF A;  4DMN A;  4Z4I A;  1VSE A;  4LH5 A;  3DYA A;  4DTP A;  1NJY A;  4F8R A;  2O4G A;  4KHW A;  3LZI A;  4FM2 A;  3RRG A;  4M42 A;  3VQQ A;  4CIG A;  3BDP A;  1GOB A;  3BGR A;  3VA0 A;  1CXU A;  3B6P A;  4B8C A;  3LP2 A;  3ULD A;  3ZSR A;  4BDZ A;  4E7L A;  4DTO A;  3TAQ A;  1XHZ A;  1BI4 A;  4KB0 A;  4RW7 A;  4OKE A;  4DG1 A;  4NCA A;  1ZBH A;  2YNG A;  1CXQ A;  1JL1 A;  3HP9 A;  5KI6 A;  4ID1 A;  3VQ5 A;  1TKD A;  1BCO A;  4R5P A;  4ELU A;  4OGE A;  4WE1 A;  4KB1 A;  5DMR A;  2HHQ A;  1TK8 A;  3QIN A;  4LD0 A;  4F3O A;  1HNV A;  3QES A;  3OYN A;  1HYV A;  2DY4 A;  1NK4 A;  1VSD A;  2FBY A;  2KQ2 A;  4CHZ A;  3NGZ A;  1VSJ A;  1TL1 A;  2OZS A;  4DS5 A;  1I3A A;  1NK6 A;  4K8Z A;  3K57 A;  3S3O A;  3LAM A;  3QO9 A;  2XY5 A;  1S5J A;  2QXF A;  3VQP A;  4FJ5 A;  1U04 A;  4NCG A;  4I2P A;  3OYE A;  3V9Z A;  3SJJ A;  1U45 A;  1BL3 A;  3NCI A;  1Q8I A;  4CF2 A;  3KKR A;  2HMI A;  1HRH A;  4O44 A;  1D8Y A;  2P5G A;  3QNN A;  3QER A;  3IAY A;  3SV3 A;  3V9U A;  3AVN A;  2QKB A;  2BE2 A;  3V1O A;  2HHU A;  1RT4 A;  1NK5 A;  4JS4 A;  2P5O A;  3MXJ A;  1Q9Y A;  2ZQB A;  4AHC A;  4G1Q A;  4CJ5 A;  2NUB A;  3JYT A;  1NJW A;  3HM9 A;  4RG8 A;  3DLE A;  4M45 A;  2HHT A;  2PAJ A;  4CFC A;  4BE0 A;  1B9F A;  1YTA A;  1RT3 A;  4FVM A;  3I0R A;  3LAN A;  1XC9 A;  1C0U A;  4LSL A;  1NKE A;  4ICL A;  1NJX A;  4CJE A;  3OY9 A;  4AH9 A;  3DRR A;  4E7K A;  3SPZ A;  2AJQ A;  2YNF A;  3S3N A;  2F8T A;  1D5A A;  2BGG A;  4FXD A;  4I7F A;  3OYI A;  4E1N A;  3VQA A;  1NK9 A;  4M3U A;  3CFO A;  2PY5 A;  3C95 A;  3DLB A;  2X74 A;  4DFJ A;  2Y1I A;  1R0A A;  1NK7 A;  4FJJ A;  4DQP A;  3L3U A;  4I2Q A;  4GW6 A;  5KRT A;  5FRN A;  4JRP A;  3MAQ A;  4KHU A;  3CM5 A;  3HYF A;  1KVA A;  1BIS A;  3ZT1 A;  2DFH A;  4JRQ A;  2XRI A;  3S3M A;  4DFK A;  2YNI A;  3TAF A;  2KZM A;  3TR8 A;  4CJW A;  4F3T A;  2KZZ A;  4CE9 A;  4HCB A;  3B6O A;  4FW1 A;  3KLG A;  2ITG A;  2G8U A;  1TV6 A;  3F9K A;  3AVM A;  2HHS A;  1IO2 A;  1KVC A;  3NF8 A;  5HBM A;  3ZT3 A;  4I9Q A;  4FJ7 A;  2EHG A;  5T7B A;  1RBV A;  4Z4H A;  3QEP A;  4Z4E A;  1RDC A;  4W5N A;  1ASU A;  3L3V A;  3SQ4 A;  1S6Q A;  4CJF A;  1TK5 A;  4HCC A;  4DFM A;  3SUP A;  5J2M A;  3SPY A;  3PUF A;  1EKE A;  3AVJ A;  2F96 A;  3HO1 A;  1HQE A;  3DLK A;  2B6A A;  3C6U A;  1RDA A;  2KFN A;  3M8R A;  2Z1J A;  1GOC A;  2YKN A;  3HPG A;  4FLW A;  1S1U A;  5FRM A;  1RCH A;  1RT5 A;  3V6D A;  4CJU A;  4CGD A;  3EY1 A;  4DLG A;  4BE2 A;  3KD1 E;  3CQ8 A;  4JLH A;  3ZCM A;  3C6T A;  1RNH A;  4M3X A;  3RMB A;  1TAU A;  1TVR A;  2YKM A;  1B9D A;  2G8V A;  3WNF A;  2G8I A;  4B3O A;  2EX3 A;  4CFA A;  4EP4 A;  1EP4 A;  2JGU A;  4CGI A;  3PX6 A;  3LAL A;  4FM0 A;  1EXQ A;  4AHV A;  2RPI A;  1U4B A;  3OYF A;  4HUF A;  4O55 A;  1SL0 A;  1WSF A;  4LY7 A;  4FK0 A;  3NF9 A;  1HYZ A;  2B4J A;  5C24 A;  1JKH A;  4CF0 A;  3O3F A;  4DU4 A;  3HP6 A;  2G8F A;  1JLC A;  5J2Q A;  1RTD A;  4CJS A;  5KRS A;  3L2W A;  3G10 A;  2XHB A;  3P83 D;  1S1T A;  1TAQ A;  1ITG A;  3AVI A;  4HVJ A;  4ZTJ A;  2G8W A;  3JSM A;  4ELT A;  4M3T A;  2HVI A;  1RDB A;  4C8O A;  2D5R A;  3EZ5 A;  4OKJ A;  1VRT A;  3VQ6 A;  2O4I A;  4DSK A;  3DM2 A;  1VRU A;  2KW4 A;  4EZ9 A;  3OJU A;  4ZHR A;  3ZSZ A;  3T19 A;  1NK8 A;  1TGO A;  4CEQ A;  3KLF A;  3OYG A;  1U49 A;  5SWM A;  1WNS A;  4DQI A;  1QSS A;  1HJR A;  4CHO A;  4B9S A;  1WSH A;  2HND A;  1IKY A;  3AO3 A;  4FM1 A;  3AA2 A;  3MED A;  2BAN A;  4E7J A;  4FZY A;  3ZT2 A;  4B9T A;  4M3W A;  1ZBF A;  2A1S A;  4GMJ B;  2IOC A;  1BQN A;  3LDS A;  4Z4G A;  4FLV A;  2G8K A;  1QHT A;  3NGY A;  1N6Q A;  4FLX A;  4E1M A;  4CJL A;  3L2Q A;  4IG3 A;  1REV A;  3OYL A;  3RMC A;  1X9S A;  1X9M A;  4FZZ A;  3DRP A;  3SUO A;  3ZSQ A;  1UA0 A;  1KSP A;  1D9D A;  4KHQ A;  3V1Q A;  4W5Q A;  1TK0 A;  4FLT A;  3MEG A;  3ZSW A;  4DQS A;  3SQ0 A;  4ZTF A;  5HRO A;  4CEZ A;  3CM6 A;  3ZT4 A;  3AVL A;  3AO2 A;  1L3S A;  2Z1I A;  3A2F A;  4W5O A;  4KFB A;  3SV4 A;  1HQU A;  1XHX A;  4KTW A;  1RBU A;  3ASM A;  4AHT A;  4HHT A;  4N5S A;  4KTZ A;  5CYQ A;  2ATQ A;  3F73 A;  3L8B A;  3VQE A;  3SNN A;  1N5Y A;  1JLE A;  1VSM A;  4CJK A;  2R7Y A;  3MXM A;  4YNQ A;  3KK3 A;  4CFD A;  3KD5 E;  2HHW A;  3OYM A;  4CER A;  1BCM A;  4OVL A;  3AA5 X;  2RN2 A;  4B9L A;  3V1R A;  4CEC A;  3AVK A;  4PWD A;  1SKW A;  3O3H A;  3MEC A;  2OPR A;  2YHB A;  3RR7 A;  4CK1 A;  4DTR A;  2WOM A;  1FK9 A;  1Q9X A;  3ZSX A;  3OYB A;  4ELV A;  4BDY A;  4FJM A;  2FBT A;  3QEW A;  2QK9 A;  3AV9 A;  4GVM A;  1S1W A;  2Q3S A;  3DMJ A;  3HT3 A;  2A1R A;  3LP0 A;  5DK5 A;  3HPO A;  3HPH A;  3PO4 A;  2X6S A;  2HW3 A;  1A5V A;  4HTU A;  1S1X A;  4FYD A;  4FLU A;  3DOK A;  4CJQ A;  1ZBI A;  3D45 A;  3WNH A;  4O5B A;  3RRH A;  4C8N A;  4B8A B;  4CHN A;  1NKB A;  2GBZ A;  1L3U A;  4RW8 A;  1A5W A;  3PV8 A;  2PYL A;  1LWC A;  2Y1J A;  2ZE2 A;  3T3F A;  3AO4 A;  3KK1 A;  4OKK A;  3LPT A;  2VWK A;  4DSL A;  1LW2 A;  1Z26 A;  4H4M A;  3V9W A;  4QOZ B;  3PX0 A;  4NCB A;  4QCL A;  2ETJ A;  4FJX A;  5KTQ A;  1SUQ A;  5HRN A;  3QEI A;  3NGI A;  1SL2 A;  4CHY A;  3QIO A;  2LSN A;  1RTH A;  1RBT A;  4O4G A;  1WAF A;  3OYA A;  4KTQ A;  4FJ8 A;  4CEF A;  1NKC A;