2P24A

I-au/mbp125-135
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
182
structure length
182
Chain Sequence
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-U alpha chain
publication title A new twist in TCR diversity revealed by a forbidden alphabeta TCR.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 35
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p24A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2p24A01
3RFZC 3MQIA 4ZTOH 4Q2ZB 4F9LA 3KYKL 3FCTA 1L0XA 4PGCA 1AHWA 3S88L 4WW2A 2HTKC 3G5VB 1B4JL 1WAAF 3N85L 3STBA 5IHUH 1SM3H 1CQKA 2J7LA 1HIMH 4HQQL 1TZHA 3JBG7 2Y7QB 4HK3N 5EPMB 4GSDH 1IZJA 3WIFA 4DKEL 4BSWA 5DZNA 1YC7A 2R1YB 5E99H 5HD8C 2BMKA 3CFBA 1MAML 3ARBA 4G8FB 4HUWB 4ZS6C 3WCYA 2GY5A 5E6ZA 5IOPB 2EDXA 4QXUL 1AIFB 4FQHA 3KXFB 1B4JH 3N85H 2X44D 3WFHA 3IDGA 4HQQH 4LEXH 2E7CA 4GRLD 3BPNC 3MCG1 4C56D 1JFQL 1RJZB 3RWIB 1TVHB 5H35B 2JELL 3LKQA 4L8DA 4OT1H 4OV5B 5KVFH 4LLWA 4X7CC 3P30H 4GXVL 3B83A 2Z91A 4QXGL 3RP1A 5IMOB 2GAZB 4PY8I 1DUZA 1N64L 1DQJB 1N7MH 1JK8B 1QEWB 1RUPH 1HH6A 5BS0D 3TT3H 3VXNA 3UYOD 2QQQA 2DLGA 5TH2B 3N1GC 1MOEA 3U7WL 3TO4A 4ZS7L 1W2KT 3WIIH 4HDIA 3FMGL 4D8PA 2PW1B 4M03A 1SBSL 4XBEL 4HUNB 1BD2B 3CH1A 4N1HB 4DGIH 3BSZL 3C8HA 5ICZB 1RIVL 1K2DB 3MGOB 2VQUA 4FQXD 4DAGH 3O4LE 3N1FC 3LQZB 3LN4B 5MI0B 5FDWA 5IHBA 5CD5D 5CJQH 2GJZB 3MOAL 3FQXB 1A6WL 4F9PA 3SDDC 4IOIA 2P8LB 3QG7L 1V05A 2GJ6B 2X4OB 2M8XA 2JIXD 1UM5L 3UZEA 1R3KA 1P1ZB 5JUEH 1U3ZA 2CPCA 1BVLA 3MXWL 3GUTB 4XBEH 4IOSD 2EZ0C 1X5FA 4LEOA 3TA3C 4LPXA 3FO2A 5C0AB 4YHKH 2OYPA 3IJYA 3O4LA 1HDMA 4BQCA 4G8IA 4XH2A 2P5EB 3OKKB 5BOPA 4YXHL 1EGJA 2RB8A 3MLYH 2CLVB 3ULUF 5HHVH 4HPOH 1VFBA 4D0DB 5D2LF 3SDAB 1MJ7L 2WV3A 1EGJL 4LF3B 4KPHL 4TULH 4PUBH 3UBXG 2GTWB 5L8LB 1FG9C 3AU1B 3BESR 3P4MB 3L9RB 1FZOB 1JGLH 2HJKA 3HI5L 4X6FA 3MBED 3CDCA 1KNOB 1NBYB 2QHRL 2PTTB 3KLAB 5DJ6A 3KS0H 5IEKB 1S7WA 5HHNB 1KBGH 4YXHH 1BREA 4OIAA 2X70A 3JTSA 3MA9H 1D5BA 1G1CA 3GI8L 1MLCA 2D7MA 1EHXA 5H37G 2VDOL 5EN2A 4D9QE 4OGZA 2V7NA 1A14H 4QRPE 1LO0H 1D6EB 4MCYB 5F70A 2OBGA 1U3HB 3SQOL 1RVFL 1FRGL 3MLSH 1I8KB 3IJHB 1XGRB 2EE6A 1B6DA 4EI5D 4KH2A 2QADC 3W0WD 5E8EB 1IC5H 3OB8A 1OAUH 1R3JB 4FQ2H 3JUZA 4MZ2A 1FIGL 1OB1B 4PJCF 2AK4B 1CLZL 4MLSA 4R0LC 5GZNC 1J7VR 3T0ED 5F89B 4Z77B 5KSAB 2A6JB 4QRPA 5GIRA 4P23C 3KVQA 1X7QA 5DMYA 4ONGH 1J1XL 1I1AD 3HC0A 4NT6B 4HKBA 2CQVA 1M7IB 4HIXH 5F3BA 3AXLB 3JV6A 1UM4L 1J0IA 2C5DC 1P7KB 1A6ZB 1C5CH 5KAQF 3CCHB 3DIFB 2DWEB 4LPCA 1CLZH 1LNUA 3TV3H 3I2CL 2XG5A 3UPAA 2NR6C 5D1XA 4ISVB 4X6CE 4ZFZA 1HHJB 5HHQB 5ERWA 2W65A 1CGSL 4OGXL 4PJ8A 1EVTC 5I73B 1J1XH 3RKDC 3BT2L 1II4E 1NMAL 4JR9L 1NCBH 4YNYB 1W72A 1HOCA 3IRZA 4PJ5E 4NQEB 4XPHH 5IHLB 3MBXH 2VL5B 3PWPE 4Z0BH 1W72L 2CK2A 5J1TC 3SPVB 1G7HB 4I18C 3LKRB 4XB7A 3TBYB 1CICB 2EE2A 2ARJB 4XAWL 1PG7X 4MJID 4ERSL 3WDJA 3QZWA 3NAAL 4NM8H 1CGVA 4HV8A 4X6CA 1DN2A 3CFDA 4YGVA 3T0VA 2YR3A 3D48R 5IW6B 1MF2L 3KNBB 1CXLA 4UNUA 2YEZB 4IDJH 4WUKL 1A6TA 3I6GA 4PJ5A 2OJEB 5J1SC 5T1KA 3MUZ1 3LQMA 3PWPA 3FFCB 3HS0B 3QUZB 4Y4FB 3DROA 2HKFL 4XAWH 4MJ4A 3DSFL 1JF6A 3NBNA 1SY6H 3C6LD 2Y5EA 4PGDB 4Y16A 1F4WL 3RWJA 4F58H 4J1UB 5FGCB 4MVBC 3W9EA 9CGTA 2NY6B 2X6MA 1SYSB 3S9DB 2CKNA 5D7SL 4KY1H 5HYQA 3KPMB 1V7NL 1NGWB 2Q1EA 3CDGA 3IXAB 3H42L 5F8QC 5J0BA 3DXAB 3C8KB 1WBXA 5CZXD 1HI6A 1ITCA 3BO8A 1OGTB 4Q6IA 3WLWC 1CGXA 2AI0L 4R4BB 3W9DA 1QP1A 1T22A 5IB2A 1WBZB 5F9WB 2J88L 4GFTB 3RJDA 4OZFB 3QH3A 5GRZA 3SCMD 3DHJA 3GMOB 4NBXB 1FFNB 4WWKD 2GY7B 1RUML 1V7NH 4JRXE 4PTUB 1F11B 3PDOB 5C9JA 3UAJC 1S7SA 5IFJA 4GMSL 3B9AA 3MODL 3K8MA 2FX7H 1DDHA 5ALBH 4PGEB 4PTTB 1QSEE 2PYFA 1K4DA 4NNPL 1QTYT 5DC0A 3DX8A 2VISA 3QUXB 3TVMC 2W38A 1NCDH 2Y5TA 4LHQB 5I17B 4LP4A 3LS5L 1ZLWK 1LO4H 3IYLW 1LQSR 2VZUA 2QQKL 2QSCH 1KB9K 4JRXA 4L8CB 5SWSB 4NUJB 4UMGA 3HFML 2G9HB 1XR8A 2JB6A 4PJAA 3TP4A 1P4LA 4YO0A 1QSEA 4OD3H 1W0VB 5KVDH 4GW4B 1UH4A 4ZUWA 5D1QB 1JGUL 3CSGA 1WITA 1MHPL 1U8OB 2V5RA 1DE4A 4QHNA 1EPFA 2I24N 3LS5H 1UVQB 3DVNB 4PJHF 1DCLA 5BW7A 1PAMA 5JW5B 1IEBB 4MAUH 1NBVH 5BZWB 1O7VA 3BFOA 1DBJH 3HFMH 3MV7E 4RA3A 35C8H 2PXYD 1RIUH 4H26B 1KXTB 4I13B 1FE8H 4TUOA 3NIFE 1IGYA 4Y88A 4PJDE 4PREB 4BSVB 1KSRA 4KUCF 4W6XB 3RGVD 1U91A 4PBWD 3U48A 1SBBA 2ZCHH 3NABL 4YAQB 1JTPA 2F54B 5SV4A 4XP6L 5A16A 2YN3A 1U8QB 5E2TL 1RZKC 4KJWD 4RGNB 4ZAKC 3ZHDA 3MV7A 5D70L 4CN6A 3KHOA 6FABH 4OLXL 4U3CA 4AM0B 1EUUA 4HBCH 4PJDA 1MRFH 2RCSL 3AFLA 4JM4L 2CK0H 3S96A 3T2PA 3O0RH 1FCGA 5C0GA 2NTFB 3GSVB 3QIWA 4Z7VB 5KJRL 4OCSH 3IAQA 2H3NB 4P2OA 1BEYL 5C0ND 4MQXD 2NY3C 1JWUB 4C57C 3QBTB 3GNML 4MA1B 4E5XA 3NCYS 5EFIA 2V2WB 2JLLA 4J2XA 1B88A 5GS1B 3EYSL 3DJ9A 3L5IA 4P57A 5CBEA 1XGTB 4F7PA 3VXPB 4K94C 4XBPA 1KJMB 2FEEI 5ID0B 5BO1H 3OHXA 1U8NA 4U1HA 3MUY1 1JBJA 1UM6H 1FAIH 3JTTA 4LLYB 2H2PC 3LKNA 5JIIA 1DQTA 4IRSA 2YS4A 3T1FB 2GTZB 4KI1A 4KROB 4HWEL 4LHUB 2UYLA 4BA8A 1CF8H 4XC3H 1RJCA 1OD7A 3ZLQC 3SGKC 3IU3B 3K7UA 3MRRB 4PRNB 4P3CH 4P5TA 4XCFL 1KTLA 1B2WH 1T7VA 3RX5A 4K3HA 2YKLL 1RJLB 1A7PL 1IJ9A 3I50L 4DUWA 4N8VA 4ZPVB 3CFCL 4WW2F 2JF1A 1MFEL 4GW5B 4L3AA 3ROOB 2DWDA 1RK1B 2AV7B 1J86A 3EZJB 3SKJH 5EU4B 3REWA 3MRLB 4NO0B 3HZYB 1IQWL 1T20A 1I7TB 6CGTA 2C3XA 1MCLA 3GSOB 3KXFD 1XF3A 3QIBC 3BI9X 5KSBB 5IROC 1K3IA 2FATL 3CLEH 4YDKH 4U1GC 2NXZB 1JWSB 3RWDA 5BVPL 4PY7B 1ROWA 2X89D 3VGAB 2P8MA 5HDQL 1GCFA 3GSQB 3BZEB 5MENB 5CILH 4P4KC 2E7LC 1T5XB 3IGAA 2DS4A 1JP5A 1MUJA 4OGAD 1OGAA 2XNAA 2YD2A 4FABL 5IWLC 3H3PL 5DVKA 2WMPA 1BPVA 4RBPK 1U3YA 1RZKH 5CIPA 2EH7L 3QEUB 4MDIB 5HDQH 3VFNA 4JANB 4XX1E 5DURB 1RULL 3NZ8B 4HUVA 5DC4B 3T08A 5D4QA 3LAFA 3AMKA 4D0CB 2IALB 3PWVA 2IGFL 4FNLL 1VEPA 4JZJB 1A6AB 4QHUA 1JVKA 5DQJB 2WP3O 4BQBA 3CJJA 2Q7YA 3O6LL 4FABH 3GIZH 4CW1B 5GGTA 1LD9B 1YQVL 5C0DB 3H3PH 1J5OL 2OL3A 2R2BB 1MCPL 4UV4H 4WU7A 2W60A 5GGTL 4KMLB 1E6JL 4HS3A 3A6BL 4WEUD 2JCCA 2OL3L 4WTZA 1OY3B 4L29A 3QEQE 4O4YH 4KWUA 4J6RL 3JXAA 3BPCA 1OAQL 5F7KC 3LHPL 2WBJD 4FNLH 3VXTB 1A3QA 5GRVK 1QLRB 3U2SB 3QIUB 1J5OH 5DJAB 2CDGA 3RZWA 3U0TB 3D69B 3BPLB 2BVPB 4MXWL 3WL9B 1E6JH 2P5ED 3PWUA 3V0VA 4UOJA 1TIUA 5TQ0L 3RBSA 1AKJA 3HI1A 3BDXA 2GFBB 2NNAA 4RFNC 3SDAD 1Q72L 2IMMA 3BKCH 4PJXE 5IB4B 2X4QB 1KIRB 5BQ7A 2A6KB 4TSCL 4EUPH 1T2QL 5CGTA 1UB6A 4LVNC 4RFOH 4Y5YB 3BP7A 4WHYH 2VH5L 4P46B 2Z8VC 4KQ4H 1CK0L 4JHAH 3OR6A 5I1HH 3OKEB 3IVKA 3D18A 1T83C 4KI5D 4HS8L 4PJFE 4JCMA 2V5YA 4LCWB 1CTNA 4M6ML 3MJ9A 5GRUL 4PJXA 3TH4T 1Q9LA 3L7FA 4QRTA 4ZOBA 4P4RA 3MJ9L 5FA4A 5DFTA 2R0ZH 3SGJA 4KHXL 1U3JA 3TJEL 5HJ3A 2DAVA 3G6AA 5HGDB 2PUQT 3ZE1F 4HS8H 3ORJA 4JFEE 3AAZB 4DVBA 5C1MB 3WHXB 4PJFA 1SYVA 4YHNA 1OSPH 1A4JA 3P4LA 1FO0A 4NDMB 2DQIL 2AEPL 3U83A 1PZ5B 1BF2A 3TBTA 1E27B 4NO5A 4Y5VC 1JPFB 5GRUH 3CX5K 4TYUA 3EO0B 1FO0L 3OKLB 3U46B 1JF1A 3NOIA 4KMTL 3UJJL 1KELL 5K93A 2GSIB 4JFEA 3OBAA 1R3IL 2MTPA 2UWEB 3NN8B 1ZXQA 4OCRL 1OTSD 4WI6A 5ALCH 1ZGLM 3V5KB 3HE7A 5EU7C 5F9DC 2DQIH 2FO4B 1CE6B 1BFVL 1MFDL 2HLAA 1GGUA 5DK2B 1EFXD 3BVNA 1PBYA 2Z31A 3HRZA 4BQ9A 3T0AA 2ADFL 1A4KB 4N0UE 5HYSB 1IM3A 1P4BL 1T5WB 25C8H 2YPVL 3NPSC 5JXAL 4JJHA 5IV2A 3HUJE 2GUOB 1R3IH 3U36B 2APWA 4OI9A 4XPTH 4RGMB 2AJ3A 3BKML 1R0AL 1GGIL 5E5UB 3VFUB 1YY9C 3WFBH 4PJEB 3C9NB 4GG8A 4HIEA 2ADFH 4HK0A 4I0PB 1CICD 4TRPL 3AS3A 1RIHH 5I66A 4BSJA 5EU3A 4W70A 5DRWB 3D39B 4IMLB 1MHHB 3VFRB 3HUJA 5F6IC 2QQNH 1JGDA 1WQVT 4FFVC 3WYRA 4QWWD 3BKYL 4X6CF 5D7LE 3BKMH 3M17B 5SWQA 4MA7L 3MFFB 4XNXL 3MRGB 5EC1A 2R39A 2FDBP 4HGKC 3RU8L 3FFCD 4XNMA 3QUZD 1IAKB 4PJ9A 4EDXA 2NW3B 4TRPH 5DJ0B 1JPSH 2QQLH 2FO1A 3QEQD 2R0WH 3RY5A 3I3DA 3FQTA 1JPGB 1H8OA 2NY6D 3DV4A 2X4TB 1ZT1A 5IJVA 5I6XB 4WW1A 1JWMB 4UI2A 2X4PA 2D9CA 5IESH 3FHQA 3LPFA 5E8PB 4MAYB 1CDUA 3O2DH 2A0LD 3Q6FA 5DUBA 3RU8H 4DN3L 1U9KA 4OCXH 1O0VA 3GRWA 1K85A 3IKCA 2XWJA 5FAAA 2X4UB 3KYNB 3O6FB 3WN5C 4EXKA 3GRWL 3QULB 3RVUC 4NBYB 1MCOH 2HJFB 2I07A 3FQWB 1TTUA 4E42A 3MTRA 5F9OL 3F12A 2X10A 3RDTD 5IKCB 3FT3B 4CVZA 3UBXI 2HWZL 3G04B 4NKMA 3HR6A 1N4XH 4MNHA 5K59F 2HFEA 1QBLH 2B7DT 3LZFL 5GSRA 3S3PA 4MCZB 5LCVH 3V4VH 4LBEB 3WS3A 4OQTA 5KG9B 4PJBE 1DL7H 3GZKA 3CUPB 5D7JB 1D5IH 4OIIL 5BMFL 1T0MA 4XCYA 4LLQA 3QUXD 1JNNH 1MY5A 5HI3D 5DLML 3QO0B 2BERA 2DL2A 3OKOA 4OQTL 3TZVB 3IETA 4L1DA 3ZYZA 5LAXB 3EO9H 5HHXH 1Q9KA 1PEWA 3SKMB 1LDSA 3QDJE 3W81A 4F80A 1IEAA 2CDEB 5JHDE 4UT7H 2KZ1B 3GSWB 5SWSD 4K71C 1GAFH 1RHFA 2R1XB 1NFDE 4MJ2A 2AJSH 1TTFA 1BAFL 3HZKB 1D7FA 1WV7T 1G9MH 2ZCKH 4PJBA 4EN3B 5EO0B 1M4KA 1TETL 3G6JA 1UCBH 1IAOB 1S5HA 5TQ2L 1X6NA 4F3FB 4HIHB 4PJAF 4PYHA 2DTSA 2VB5A 3I9GL 3RVVC 4LKXB 4J4PD 5JIHA 4HT1H 2XZZA 3QDJA 5C86A 3VE0A 3S34H 4JKLA 3L3KA 5JHDA 4KKCD 1Y18B 5L9DH 2NW2A 1NFDA 1ZA3B 4H5SB 4KK6D 2X5PA 3FB6B 3OAZK 1QSVA 5DEGA 2C1OB 2X4RB 1ZS8A 4WO4B 1PX4A 5L6YH 5KN5A 1CR9H 3V6BR 4O2CB 3LEYH 1EJOL 5D1ZA 4QHKI 2ZG3A 4X4XA 1VCAA 5TDPA 4JKPL 1NC4D 5C92A 3ARXA 1GOGA 2P47B 4JVWA 5B8CC 5C0CE 5I18L 3UTTB 4M48L 3W2DL 3W11D 4RGND 3IXTB 3FOLA 1UQSA 4OCWH 3VW3H 5D2NB 2J4WH 2OQJB 4JAMA 5HVHB 4GRLC 1U8HA 3PWNA 5DUMH 4P3DB 5C0EA 2C7UA 4R3SB 3SE8L 4PJDF 4GAJH 3TWCL 3HI6L 4PJ9D 1S5IL 4PB9L 4CUCA 4OLWL 4I3RL 3MRFA 4JM2B 5FHAL 3SJVB 4M48H 3W2DH 4BQ6A 4PV9B 4JQIH 1B0WA 3I6LE 2AXFB 3PP3K 3OGCB 1LK2B 5BV7C 3L1OL 5EOTB 4HG4K 3W5NA 4EIGB 3PABB 4ZUTB 1KFAL 5HDBE 5D7LD 3C5SA 1IBGL 1G7PA 3VG0H 1H5BA 2P48B 5C0BE 4ZSOE 4HFUL 1KGCD 5B3NA 1QR4A 4ODHL 2VLLA 4ZFOA 4IJ3B 4R7DB 1DBBH 1S5IH 3IFLH 3PHSA 4MNQB 4EUPG 5DYOB 2VDRL 5E08H 4FQQB 4XWOD 3BAEL 4WHYG 3GSNH 4ZFOL 5CMAA 4NZDA 1NGYB 4FQXC 4C4KO 2QR0B 4LHUD 2VLKA 3MLWH 2WP3T 4KV5E 4MGXA 1FL6B 4LARH 5CD5C 3EYFA 3MRPA 5IQ7L 3RNKB 5T33H 4EZMA 5EH1A 3O8XA 3B2UD 5D8JH 3HN3A 3MOBH 1BZ9B 2D0FA 3QYCA 4DCQB 4I2XB 2OSLB 4ZSOA 4X8XA 5CSBA 5F7FA 3V79C 4M8QA 3VWJB 1YECL 3HC3H 5HHPB 4M61A 4P2QE 2DI9A 2NXYD 2N4IA 4L4VB 5D93C 2VDNL 3DV6A 5I1GH 4GS7B 8FABA 1A2YB 2DIJA 4K9EL 5H2BA 5TDNA 1WTGT 4NO0D 1I7ZA 1P6AB 4LIQE 3IDMA 5ESAB 4MNGB 4XP9H 4J3OC 3FT4B 2NXZD 4R9HA 3K0WA 2VWEE 1YECH 2GJJA 4R26H 4LOUD 3AS0A 4P2QA 3I6KB 2BOCA 4JPWH 3QXAB 1XGUB 4F9LC 2VE6B 2ZUQB 4ETQA 4AT6B 1TCMA 4YDLC 5JHDD 4Q74A 1AHWC 4WNQA 1QLEL 1ZVHA 2FNBA 1UJTA 3MUGB 3VXUE 1F4AA 1VESA 4ZOAA 5A43C 4ZG1A 4HCRA 4DVRH 3X3FL 4R2GD 4UUJB 2DQFA 3TM6A 3EHBD 3QQ3B 3OAUL 4S2SB 2IMNA 1L7IL 1UKSA 5I75C 3DX7B 2ARWA 4ZXBB 5TGBA 3EDJA 5FGBA 1RZ7H 2XA8H 4WEBH 4ONHA 1S7RA 2D7TH 5FB8A 4UT9L 3LCYA 4QHMB 4EI5C 2B0SH 3EOYG 2CKBH 1FVDB 2DDQH 1J0HA 1ZVSB 5EO9A 3QHZH 4R4FL 2B1HL 4P3WA 4PB0H 4F2MB 1I8MA 3GMMB 2GCYB 3VI4E 4BK5A 1F6LL 1ZHNA 4JRYB 3H3KA 2YC1A 4NRXA 3RIFF 3PGFL 3HMWH 3MNZB 3OAUH 4NP4H 3JV4B 3JVGA 1FDLH 4NN6C 5IVXB 3T0EC 5DI8A 2XZQH 2C1PB 3EYQD 4RMSA 3ZSTA 1ZVYA 1I1AC 3ARGB 2VAJA 3AREA 4PYGA 5DJYA 1IFHL 2APFA 2JCCF 2V5MA 3WDIA 5C0CD 5LXGH 4NC2B 5JNYA 2FLBT 5F1IA 1YN7A 2UZYB 1TJIH 5E95B 5DT1H 3RTQB 4QRQA 2EIDA 5AZEL 2OJZL 5D71L 1AR2A 1T0PB 2VXTL 4OFKA 4PRIE 5DWUL 2DJUA 4XGZA 3MNWA 2ZWLT 1YDPB 5I1DA 5L2KB 1MHCA 4X99B 5T3ZE 2ZKHH 4R6UA 1G7JB 5CINH 4P46D 4KC3B 4NYLA 1VADB 3LKOB 1UJ3A 4WU5B 3BP5A 4ODTH 3U4BL 3NTCL 4PRIA 3C6SB 5DWUH 1ZOXA 4JHZA 4GG6E 4XVSH 5CUSL 5C0BD 5JQ6H 4LSPL 4LFHD 3NCJL 4NQSB 1MJUL 3UTQA 5LQBL 2EE3A 4LCWD 2OXHA 1E4WL 1I4FA 1UZ8B 4IEFB 2ZSWB 4H20H 1DBAL 4V1DE 3O2WL 4FG6D 1Z9OA 3K74B 4LSUL 4JDVB 4L9LB 3PL6B 1UFUA 4DK6A 5T3ZL 3LD8B 2DQHH 4TPRL 4PJXF 1OL0A 4RMTA 5EU6E 1AFVH 1U8PA 5TFSH 3GMRB 3U4BH 3L3GA 1HXYB 12E8H 3F7YB 3EYOB 3C6LC 2BSRB 2EO9A 2R1WB 1M05B 1X44A 3MJGX 5KW9H 1E6OH 4JPIA 4OB5H 4L8SA 5FIEA 1UWEL 1KCSL 2R4RL 1J87A 3MZTA 2YPKB 1XF1A 2YD3A 2P49B 4PJFF 4V1DA 5LWYL 1A5FH 4Y2OA 2Z8SA 4KAQH 3IT8D 4D3CH 4XVJH 4BQ8A 5DJXA 1PDKA 3O9WB 2R0KH 1LE5A 2XA3A 5DVNA 3ZE2F 5FF6A 4P5MA 5CZXC 2JJUA 1DBKL 4ELMF 2HVJB 1UCTA 1WBYA 5E2JA 3UEZA 4RAUB 1YYLH 3UBXB 4RRPG 4K2UH 5E4IA 3C8DA 5F1KC 4XZUA 2EDRA 1CD8A 3SCMC 3BRFA 4KTDL 5F7UA 2RFXB 1E4XL 1WEJL 1XZ0A 5EBLA 2B39A 1WFNA 5JQHC 5FKPA 3HC4L 2IFFL 4TUKH 4JPVH 2PTVA 2RBLA 1I75A 1S3KH 3L95A 3FOMA 2VXUH 3MYJA 3ZHKA 1NC2B 3MLVL 1ZKAA 1YEHH 3B5HA 5ADPL 1FYHB 5ACMA 2FJGB 3VXUD 2W9DL 2C4FU 2A73A 4E0RB 1TNMA 2F19L 5E24E 4KVCH 3QJFA 1AXTL 3V0WL 4G6FB 1YPZB 4DFIA 3QT2A 7CGTA 1AJ7L 1G6RH 2IFFH 3WNLA 2D31B 4RX4A 5CP7A 3SDYL 2KZWA 5DQDL 3D39D 4N9GA 3NFNB 1UWGH 5FECB 1CL7H 1YJDC 5GS0D 4TOYH 4F57L 4PGBA 4Y1AA 1MLBB 5ADPH 5JLZA 2DQTL 3KPPB 5J12C 1QO3A 5I15L 3ILPA 1ZTXL 3HUJF 2FYYB 4S10A 4CBPA 1AXTH 1X5KA 1XAUA 4FXGB 1P5VA 2P46B 4Y4HB 3KR3L 5FKAA 3HG1B 1FBIL 2PXYC 3GBML 5DQDH 2E27H 3ULSA 1P53A 2ATPA 4F57H 3RGVC 3DBXA 3B2VL 5JOPE 5A3ID 2NZIA 2DQTH 4MAYD 1KPRA 4OZ4A 2D0HA 4K8RL 3MLUH 2WW8A 2E8ZA 3KR3H 4KJWC 5ESQA 3ECBB 3ZYIA 5FM5O 3S4SG 1K6QL 4JO1L 3BDBA 2H32H 4HJ0D 3E3QE 2VMFA 1KXVC 3DTXA 5FUZL 1OWWA 5JDJA 4RMQA 1G7QA 4QYOB 4XPBH 5FM8A 1MPAL 4CMMA 3LQAC 3DYOA 1F4XH 4EVNB 4E9LA 4P48A 4ZNCD 3GJFA 5C0NC 1DQQB 4MQXC 4ODWA 3ZKND 4DGYL 1OW0A 1EEYA 1WVZA 3S97C 3D3VE 4JO1H 4ZO7A 4M1GH 2BCKA 3PV7A 4V1DD 4Z78A 2ATKB 1OP5K 3OL2A 4DJMA 3DVFA 4ZUUA 3KPNB 1YEFH 2EXWD 1N8ZB 3BZ4B 4HBQA 5EU6D 1QRNE 5DZOA 1JI2A 4AIZA 2GIYA 4XP5L 5CBAA 3QNYB 2OTPA 3TNNA 3WNKA 1T7XA 5CP3A 4G6AD 1MNUH 1JUFA 4I3SH 3LPWA 3D3VA 2QL1A 5E8OA 3HR5B 3HNSH 2V2XA 3G6JF 3D25A 1IGMH 4C4KT 4DOHE 2XN9A 3NCCB 1RJYB 3DGGA 1KIPB 1OF2A 2VXQH 4WCYH 3C5JA 4O5LH 3RVTD 4ACPA 4M43L 5IR1A 1QRNA 3T4AA 3MREB 4U1SA 2DQUL 1GZQB 5I74B 3GKZA 4WO4D 2CLZA 3SBWA 1GZPA 1L7TL 4CJ0A 3C60B 1Q9WA 3KPSB 2J8UA 1A64A 1NFDF 4NQXB 3WEXB 2C3VB 4HXBH 4X6BA 2OR7A 4TSAH 1YJDH 1ZANL 1TQBB 1SEBA 2PYEB 3NPZB 2R2EA 4MS8C 2Z35A 4M93B 4M43H 3OF6D 1NLDL 4CNIB 2YD6A 2I5YL 3MZGB 4MJ5A 4JQXC 4F7TB 1T7ZA 2DQUH 3MRQA 5JW4N 1L7TH 3VD7A 2BVQB 5JIKA 1J1OL 4DZ8A 3VFWB 3PV6A 3BISA 2ZG1A 4FQCH 1VENA 4OM1L 5FGRA 4QF1B 3T0XA 5T1DH 2BVUA 2E7BA 4RBPH 3VRIB 4GRWE 4QXTA 1OARL 3SJVD 4IRZL 4OGAC 5E00A 2VQ1A 5C0RL 5AWNH 3S5LA 4KGLA 4NPYA 3MRHA 1CYGA 4JDZB 3R4DA 3TYFB 2W0KA 2HG5A 4A6YB 5GRVL 4OM1H 4OM0L 2KL6A 1BLNA 4MNQD 1KENH 3PWLB 4QT5B 4ZPTB 5GGQL 5BJTA 5DK0A 3GIVA 3CK0L 1IGCH 3LQAH 5MHSE 1XIWB 3MLTA 3VXOB 1FNFA 4JG0L 1LO2L 5FO8A 1ZSDA 1X3DA 2OZ4A 5MI0C 2EH8H 5EU5B 4F33A 1C8PA 3F6LA 4FMFA 4L5FL 5JOPD 1HCVA 1MCSA 5GJTH 2OZ4L 5EORL 1INEH 3H7BB 3VFMB 4BFIB 3QIWC 4CKVX 4ZO9A 4QKXB 3OKYA 5HDBF 5ADOH 1YYML 3ULVD 2WBJC 3CK0H 3KPQA 5DK3A 4ZD3H 1PG7H 1A0QH 3BEWB 5F96L 4L4VD 5DJ2B 2ZUTA 2A77H 5C0IB 3KLSA 4Y4KB 2XACC 2R1YA 2F74A 3WUZA 4N0FB 3DSNA 1HSBB 2VDQL 1XGYH 4L5FH 3O3AB 1SEQL 4LSVH 3V0AC 5IOPA 3PJSB 4HJGA 4OF3A 4GLRI 3SDAC 1AIFA 5DF0A 5HHOE 4X98B 2JK5B 5AD0A 3BPOB 2L7JA 2CUMA 3EDKA 4X6DE 1HHKB 3TCLB 4HMDA 2IPTL 2OP4H 3O11B 5GGUB 4DWHA 1P69B 3D0VB 3D3VD 2BJMH 2AEWA 4JO2L 4NN7C 2RR3A 4G9FE 4U05A 1CFVH 4JFHE 2LABA 2OS7A 4KI5C 3HE6B 4P5TC 1NGPL 1SEQH 3HRPA 2XI9A 2VN7A 2Y36H 4ODXA 3HMXH 1T7YA 5IMOA 2GAZA 5HHOA 1DQJA 1JN6B 4X6DA 4YEEA 1QEWA 1T0NB 4YUEH 1RZJL 3HTLX 4U6YA 4RQQA 3UO1L 3EJZD 1H3PL 4ODVH 1U92B 1MIEL 2MCPH 4BZ1L 3QWRA 1NKRA 3HZVA 2PW1A 1IC1A 1BD2A 4Z7UE 3SY0B 4P59L 4JGUA 3WBDA 1V3KA 4XAKE 2IBZX 4EDWL 3MGOA 3LQZA 3LN4A 5ICYB 4DTGL 3BPNB 2AJYH 2GJZA 3L3IA 3QJHB 1BM3L 2GJ6A 4W4OC 3C2AH 4G3YH 1RURH 5C7XH 5JO5A 1BMGA 4JY5L 1P1ZA 4PFEA 3P4OA 1JRHL 2RIKA 5DA0B 3GUTA 1RK0A 4Z7UA 2I60H 1NLBL 1YEEH 4X4ZA 4WY7L 2KUTA 3IDJA 5C0AA 1RU9H 5J3HD 1H3VA 2Q76B 3MC0A 1V7ML 2YPLB 5FYKU 1JI1A 4X0KB 1RQ5A 3QO1B 3MNVB 3IFPA 1TJHL 4UTBH 3ELAT 3QCTL 4FS0A 3OKKA 5IBTH 2XQYK 1HYSD 2FECI 1KJ3H 1CFTA 3TT1H 1CZ8L 5E2WH 3FN0L 4D0DA 2IH3B 5L2KD 4LF3A 3WSQL 1Z9SA 3O3DB 2GTWA 1I7RA 1FIEA 5C6WH 2BY2A 4PV8B 5DJZB 5C6PB 3VFSA 1FZOA 5CCKL 3GSUB 1NSNL 3F62A 4GUPB 2CD0A 2PO6A 3KLAA 4G6MH 1CICC 5IEKA 1K5NB 3SDDB 4BKLB 3NFSL 3AS1A 5HYJE 3SOBL 1FL3A 4L3EE 4N0RA 4MZ3A 1N2RB 4AJ0A 3UYRH 3WSQH 4NQUA 1CFNB 1WFTA 5MHSD 4QWWC 3QCUH 1PY4A 4M5ZL 3L3JA 4BH7B 5F88B 4RIRB 2APXA 1D6EA 3QUZC 1GJIA 3WDHA 2R4SL 3FB7B 2EDEA 2OMNA 1U3HA 3NFSH 4L8BB 5DD6B 4WTWA 2DM2A 4ODUB 4ODSH 3IJHA 1A9BB 2IQ9H 1C12A 1N3NB 1XGRA 3RX8A 5HYJA 5FYKE 5E1AB 5ICXA 2NY6C 1FYTB 1PSKH 2WZPD 4L3EA 3RWFB 1ZHLB 1FVCB 15C8H 5E8EA 2Q87A 1DTUA 1OB1A 5F8RC 1J05B 1BZQK 2AK4A 3O9WD 4GOSA 2A0LC 4BZYA 2CR3A 1I1CA 2XICA 5CEXB 3JWDL 4Z77A 5KSAA 4FZ8H 2A6JA 3IFNH 4Y2DD 1KLGA 5TE7H 3HPLB 2NY7H 4JDTL 4UQ2A 3D5OF 2VNCA 4EIZC 2I26N 3G9AB 4K7PL 4PJGB 3ZL4H 5IQ9B 1CXKA 3T4YB 1AP2B 4D0BB 1P7KA 4JFFE 1LE9A 1A6ZA 2WIIB 1M7XA 3CCHA 3RDTC 3KYOB 1Z3GH 3KJ4C 4MWFB 4Y19E 4ISVA 4XCNB 4G9FD 1HHJA 5HHQA 3UTPD 4NQCB 1KJVB 4JDTH 1NC2D 3QUXC 1QHPA 3EFFB 4HZLB 4XB8A 2X4SB 1G7LB 4Z9KB 5HI3C 5DSCB 4HPYH 3UZVB 1YNKH 5BRZE 2Z4QB 2QADB 5MERA 2H6PB 4J3VA 4PLOB 4XXDB 3LIZL 1J8HB 3ARDB 4NQEA 1CI5A 4JFFA 4I0CC 2V5TA 3SPVA 4R0LB 1H9VA 2FD6H 3KDMB 1YEJL 1HHHA 4JZNB 1UA6H 4KMQA 4LCCA 4NO2B 5DUPL 1A1OB 3KNBA 2COQA 1RUKL 4XAKD 2VDKH 4J3SA 4OZHE 3LIZH 2OJEA 2JB5H 4J4PC 1JPTH 3OAZH 4PD4K 4BFGA 3HS0A 43CAB 1A9EA 1MCCA 4Y4FA 5E4EC 2CDFA 1KLUA 3HG1D 4KKCC 2IBBA 4PGDA 2VDPL 4LCUA 4KK6C 3VD4A 1LP9E 2GI7A 3QZWG 3X13B 1UYWL 1SYSA 2EDBA 3F7RA 4HWBA 3BRDA 1SQ2N 3MLXL 2E9IA 1A47A 2B1AH 3IFOA 3IXAA 5D6DA 5TF0A 3MMEA 4HWBL 2Y25A 2VDLL 3Q1SH 3RWCA 3DXAA 1PKQE 4I18B 1CD9B 3M8OL 4YLQT 2YN5A 3W11C 4RGNC 1OGTA 4UV7L 3LKPB 5LG1A 1A02N 1WBZA 2W07A 1UYWH 2YHGA 4F8TA 1T1XA 4X4ME 3I85A 3OB0K 1FFNA 1W8OA 4M6NH 3PP3H 1F11A 3TN0A 5E8NB 1IAIL 32C2A 3LMJL 4H88L 4PJ9C 4PGEA 4PTTA 1PKQA 2EDWA 3VFTB 1ZLSL 1PGRB 2BDNH 4XBGB 4MA1C 1Y6NR 2J6EL 4NRYB 4LSSH 1FAKT 5J1AA 5JPMB 4L3ED 5CWSB 5GS1C 3R1GH 1MCKA 4LQFH 4JJ5B 4OZGE 3NCMA 4PJIB 4JZOB 1TZGH 1SJEA 4LSTH 4X4MA 2R69L 1CVRA 1FQ9C 4OZFH 2ZUVA 3DNKA 1S7VB 4M00A 5KS9B 5D7IB 1ZLSH 1HXMA 3GB7A 3O41A 4XWOC 4LSRL 4LPWA 3LS4H 2J6EH 4GW4A 3CFIC 5FYKD 4DKFH 5D1QA 3ESVF 3UTSE 3AM8A 2UY7A 3F7VB 1OP9A 1UVQA 3IS1X 5C70A 4L1HA 3P2TA 1IGIH 2DICA 3WFCL 3B2UC 4FTVE 4UT6H 4XC1H 1JGVL 3A6CL 3QCVL 1EUTA 4XP4L 4GT7A 5BZWA 3D0LB 4LLUA 4H26A 3VH8G 4OTXH 4LVOB 4P2RB 2YZ8A 4AMKL 4POYA 4JB9H 3DX9A 4PREA 3TVMB 3C60D 4BSVA 1NFIB 1ETZA 3FFDB 3ZT5A 2NXYC 1JYXA 3UP1A 4YAQA 2F54A 4LRNH 4PS4H 3SDXE 4S0TD 2W9EL 2VRAA 1N59B 1YEIL 2J8UF 2PYED 8CGTA 1U8QA 4KHTL 4N5UA 3LPGA 5LGJB 4OI7A 3VD3A 1NMBL 1Q1JL 4Y19D 3KPOA 1JCKA 3BH8B 5K9OB 3QWQB 1LGVA 3L7EB 1RZFH 4H0IA 4LOUC 2ITCB 3CFJB 2DLTA 3DETD 5BRZD 1NL0L 1L9MA 2NTFA 4X5XA 4ZQKB 3QUYD 4G7VH 2W9EH 3E6HB 3SDXA 3TPKA 5K9JL 3LB6D 3BP4B 1MCHA 1QLFB 4JY6B 4LK4A 5I76B 2FR4B 3PHOB 4X7TA 4GMTH 1JWUA 1QFWL 3FAXA 3QPQD 1ACYH 4KVNL 3B9KA 3LKSB 2RHEA 2V2WA 1L9NA 4R2GC 1OM3L 4HK3J 3EHBC 4P0DA 1KPVA 5EUOE 3WO3B 4K07A 1GXEA 1LHZA 5MP6H 4ZUSB 4R96B 5D1ZC 4TVPE 5DTFB 1KJMA 4JN1H 3QHTC 5ID0A 4N5ED 5DQ9B 5CZKA 1JMXA 3V52L 5ISZE 4LLYA 5ANMB 1XIWD 1VDGA 4ZAKB 1FNGB 2DQEL 4NFBA 5MEPB 3T1FA 2VLRB 2XQBL 3QFJB 1YMMD 4XP1L 2D4DA 3BN3B 3ET9F 3FQRA 1H3UA 5I2IA 5I9QB 3IU3A 2VIRB 4PRNA 4Y5XA 5HGGS 4RDQG 4X80L 4U1JB 1CU4L 1CLYH 2F8XC 4ORGB 3EYQC 4MJ6B 5EZOL 1PKOA 1M1SA 4I5BB 2NY3B 1D5ZB 3FQNB 3H0TB 5D6CB 4ZPVA 3UROR 1UT9A 5FCSH 4N0YH 3WNMA 4XP1H 1T21B 3H9HA 3BPLC 2FZ3A 4Y4KD 1EXUB 2AV7A 3RAJL 2HTLD 3QDGE 4XI5D 2B2XL 1NAKL 4FP8H 4X80H 3HZYA 4HF5H 4JFPB 2NY5C 4NWTH 2EEBA 5BXFB 1Z2KA 4MD4A 4QGTA 5KSBA 2ZSVB 3BHBA 4WHDA 1AO7E 4XMKH 1MEXL 3FB5B 4PY7A 4Y5YC 1P7QB 2AKRA 3Q6GH 4P46C 5HXMA 4N8VG 3O6ML 3RX7A 3PIQB 1X5JA 3OX8B 2UVEA 3IJSA 3HE6D 3QDGA 5MENA 1NAKH 3O8XC 1T5XA 2GK0B 5B3JE 2JE8A 4EUPB 2HTKD 4Q0XH 4HD9A 1T03L 5EOCL 1AO7A 4FG6C 1JHTB 5I1AA 4NQDB 4MDIA 4OF5A 3LRGA 4JANA 1BVKB 1MAKA 4JLRB 3UTSD 2GSGB 1EMTL 2E6PA 2X1OA 2RJMA 4FTVD 2UUDK 3NIGF 1I1FA 4JZJA 1A6AA 3REVA 5DQJA 4CW1A 1PZUB 5C0DA 4U1GB 3LSOA 2R2BA 4MDJB 3QEGL 3SE9H 3FT2A 3VGGA 3GMPA 5A1AA 3LOWA 3NA9L 1BQLH 3DMMA 5HVGB 2DLFH 3BW9B 4OZIE 1CD1A 3MCLL 4P4KB 1I9EA 3S37X 4DKDC 5GZOC 3INUH 4JFXB 3RRQA 4WUUB 1T1WB 1T1ZB 2CIIB 5FGSA 2R56L 3GMNB 2XKUA 5TE4L 4IRJA 5DJAA 2YPLD 5DD3L 2VWEC 4Z7UF 4LLMB 2BVPA 2M1KA 1GIGL 1DBMH 5CEZE 4LU5L 4OI8A 2ADGA 3UJIL 1OOAA 5DMIL 4RMWA 2GFBA 3MCKA 4G8GB 4OZIA 1UWXH 4XX1G 2YBRB 3O4OC 1MFAH 3V6FB 1G9EA 4RWYL 5GPRA 1ZT7B 3FRUB 3QXDB 3BZFA 4RGMC 1RD6A 1A1MB 1NGQH 3VFVA 5I8OH 1T3FB 3MV9B 3OJVC 4KQ3L 4YQXL 3CSBA 3JWOC 1XCQB 4KJQD 3QWOA 2AABL 1KYOJ 1S8DA 4YHLH 2Z92A 3ALWA 3OJDA 5GGVL 1R3HB 4HMEA 4TVPD 3I02B 5DVMA 2NY2B 4XT1C 2BVYA 5CEZL 5F7MC 5ISZD 2EZ0D 4UTAL 5GS0C 1YEGH 3BD3A 4QOKE 2NY5H 3N1PC 5FOBA 5T1LB 3CXHJ 4U7KA 4U7SA 3PP4H 5J6HA 4KQ3H 2CMRL 1G9NC 4ZFGL 1DSFH 4IHOB 4OLZH 4S11A 5KSVB 3L5XL 1FJ1B 2H8PB 4UINH 2J2ZA 1I7UB 1IGTA 5HGDA 5ILTL 4FFZL 4M7KH 3AAZA 1MI5E 5AUMB 3H9SE 4RFNB 3TC9A 4NDMA 5CSZB 4AG4H 4XMPH 5I6XC 1JPFA 4W81A 5C0JA 4LLVB 2HJLB 3EYVB 4QOKA 1IQDB 3L5HA 4LVNB 3OKLA 5A3IC 3KPRB 1VFOA 4MAYC 4JFDB 3BIBX 3MLRH 1R24B 5ITFA 4DEPB 2VC2L 3EO1B 3QDGD 1J1PH 2AJVL 1D9KA 3BIAX 1AD0B 3NN8A 2UWEA 1IE5A 1F45A 4HKZB 5FHBL 3OR7B 3S35X 3PWJB 1NEZB 1CE6A 4IS6B 5DK2A 4K23L 5FXCH 3RY6C 3WS6A 5IBUG 3DARA 5F6HJ 2P7TA 5HYSA 5D5ME 4GW1B 1T5WA 1JYWA 2Q8AH 1RFDL 1X4ZA 4IIQA 5FYJU 4NQCD 3L3HB 4LRIA 4M8VA 3E8UL 1I85C 1OP5H 3ZKNC 4ZFFB 2UZXB 5HY9A 1K4CB 1OAYL 2VXVL 1INQB 4HWZB 5F1OB 2WUCH 5C6TL 2A6IB 1VGEH 3P9MB 1OTUD 4HLZH 5DD0L 4Y5VB 3SE3C 1Q0YL 1X5YA 2ZNWA 5AAMA 2HP4A 1J8HD 2VR9A 3ARDD 5CAYB 3FHAA 5JPNA 2CO7B 3C9NA 3QI9A 5MEQB 4AEIL 1LO5B 4I0PA 2EXWC 5D5MA 2MHAB 4NC0B 4OKVB 5DRWA 1S7TA 5EZLA 3VFRA 1OAZL 3BD4A 1HINH 1EVUA 3FONB 4G6AC 2XTJE 3MFFA 3LRSA 3VWKB 3MRGA 5IEHB 1RSFA 4HUXB 1IAKA 1ZA6B 3RVTC 4CMHC 2J5LC 5DR5L 2PR4H 5DJ0A 1MJJB 3JWOH 3NPSB 4OAWA 1T4KB 4Z7QE 3QG6A 4HS6B 1MJ8L 4NJAL 5C07B 4PJCB 4NJ9L 4WFFD 5FV1L 3TIDB 5FYJE 3ILQC 1GC1C 3EDDA 5GS0H 1KTDB 4HEME 3MR9A 4HFWB 5HHMD 1KIUA 4QRRE 5DR5H 5DFWH 3MV8B 5CEYA 5C08B 1C5BH 4X6EA 3VMOA 5KANI 4P9MH 2CLRB 1IL1A 3O6FA 5HVHC 2EDLA 1PQZB 4DZBA 3QULA 4GKZB 4X5WA 3EOBB 2DKUA 4O51B 5CJXA 5F6IB 4KZDL 3DURA 4Z8FL 4CDGC 1AGDB 2HJFA 4UNVA 1JPST 1BX2B 3FL7A 3FQWA 4HXAH 3DVGB 3FB8A 2VYRE 5IKCA 3FT3A 2CIKB 2DRUA 3G04A 3MGTB 1DN0A 4MCZA 4LBEA 5E6ID 2ESVB 5D7JA 3CUPA 4QRRA 1MWAA 5F97E 5ESVB 3BGMA 1FG2B 3OWEA 5FCUH 5L2JB 3QO0A 3TZVA 3VGBA 3FRPA 5I1LB 3QQ4B 2FEEL 5SX5K 1A7NL 1HH9B 3FTGB 5DO2D 4LHUG 3ARYA 1CXFA 3GK8L 4KTYA 4WI7A 3SKMA 5A2IH 3TF7C 3GSWA 3G5XB 1FH5L 3GGWB 1A7OL 3HZKA 3TBSB 5F7DA 4EN3A 1MI5D 1IAOA 3H9SD 1ZGLB 3WN5B 2SEBB 2AEQH 4X7SL 4DN4H 4K3JH 3BE1L 3WUWB 3X3GL 5GRJH 3OXSA 5SWZB 1I8IA 4EQ3A 3MRIB 4R8WL 4TNWK 4XRCB 3UTTE 2P8PB 2F5AL 3T0WA 3T2QA 1OSZB 4KUZH 3MRBB 3GEWB 3S4SB 1NDGB 4HKJB 4S1QL 5BZDB 1DVFA 3JUYA 2VL4A 1KJ2H 2B20A 4GQ9L 3FB6A 3WHE0 5GHWH 4NOFA 2X4RA 2BNQE 4QTHB 2WAHA 5F3HB 2EXYD 3WLBA 1WAAE 3GHEL 1FZJB 3DUUB 3GHBL 4NUGH 4QTIL 4YE4L 2YRLA 3UJTH 3M1BB 4K71B 2HRPL 4G7YL 3UTTA 5JR1H 3QPXL 4S1DD 1AI1H 3IXTA 4BFBD 43C9B 4CJ1A 4L4TB 2OQJA 3V7MA 5B4MD 3V5DA 5I1IL 2Z9TA 3U79A 2Q86A 3CLFL 4LDLB 3B5GA 4FMKA 3V4UL 1FFOA 4R3SA 2X9YA 5CZVH 1CT8A 3ARSA 4GXUM 1GC1H 4PV9A 4NHCH 4Z7VF 3BEVA 3U9UB 3K2UL 3SDXF 3O3EA 3OGCA 4TNVF 3HAEH 3D85A 4PRBB 2D7QA 3MO1A 1F6AB 2BXZA 3IKKA 5T5NG 3SBWC 5E1HB 4Q9RL 4ZUTA 5J57B 2IADA 3EJZC 5C2BH 2IH1B 3CXDL 2XTJD 4I9WE 3VRLF 4YC2C 5F9JB 4R7DA 5B8CB 2F58L 3UZQA 1DANT 5DYOA 5FO7B 3B9DA 4U6VL 4U0RC 5ETUB 3QDHA 3THMH 2EKSB 3K8LA 1NGYA 1CS6A 4G43B 4GRLB 4PJHB 3UXFA 1CLOH 1WFUA 3CD4A 3DGCR 2VLMD 2ZP0T 4EOWL 3WFDH 5FYJD 4APQD 3EIFA 3P11L 1I9RL 2CKBB 2OSLA 4M1DL 1FZKB 1NANI 1ERNA 3QDMB 3C5ZA 1NDMB 3WV0A 3G9VA 3VWJA 2AJUL 5J3HC 3UTOA 5BV7B 3TEUA 1A3RL 1P9MA 1KN2L 5BS0B 1MFCL 5DHVH 1I3RA 4EOWH 1HYSC 1DUYB 2HFGH 2AXGB 1KCVL 5IG7B 1KEGH 2IPUK 3L6FB 4MNGA 3BH9A 5HTSA 1MCRA 1CTOA 2DBLH 4M1DH 3FT4A 1EEZB 4O2FA 4LFHG 5EDXA 3R06B 4H1LA 2E9BA 4BELD 1P7QD 4OUOA 2CSPA 5DHYB 2DLIA 3ULUE 5KSBF 1MH5B 3ULVH 4RMUA 5D2LE 5IHZB 1S9XA 2ZPKH 1MFCH 5MEOB 1XGUA 3RJQB 3CSYA 2PN5A 4O02L 5HYFA 1XGQA 1TITA 2X9WA 4LNRB 4ESKA 2JIXB 4ETYA 5IW1A 4M4PA 2G2RB 3F58L 4X8JA 1T04B 3IRPX 2EDTA 3B3IB 4QXWA 5JHLH 2ZOLA 1OPGL 2MFNA 4UUJA 3ZDZE 4U1IB 4FQLL 4NQDD 3QQ3A 2W9LA 4MD5B 4L9LC 1U8KB 1HN1A 3WD5H 1H0DB 4RFEB 4S2SA 2MMXA 5D93B 3DX7A 5E2VH 1P84K 4NZRL 4ZXBA 3SE4C 4OFIA 2G5BB 3N1QC 2GHWB 2XKNB 4HLZG 4Z95H 1BBJB 1KB5B 4P9HC 4KJYB 5EC2B 2XKSA 1ZVSA 3S36X 1U95A 1FC2D 2IG2L 5DGRA 5TDOB 1OPGH 5B3JF 3GMMA 2BC4B 1IT9H 4FQLH 2EDDA 2BNQD 4JRYA 4NKQB 4H25A 3MNZA 3O9WC 3FO0H 1JV5B 3P4NB 4PRPB 3V6ZA 5A40E 2WUBL 1R5WB 4ZNEE 5I8EB 2HVKB 1QUNA 2C1PA 4KKBD 4Y2DC 5J7CC 4WI4A 2BZDA 1CDYA 3ARGA 4F7EB 4YDLB 2MQ3A 4PGCB 1AHWB 4WUUD 5J11C 1RZJC 2VO5A 4M4RA 3RTQA 3T77B 1QYGH 2EYRA 2ZJSH 3D85D 3T65B 4YDVB 4KGJA 1S9VA 4KK5D 3QR2A 4RISL 4K3DL 4UIKH 2ICCA 5IJKC 5I75B 1DLFL 1SVZA 4WHTB 4G8GD 5DEFA 3CFBB 2R23A 3ARBB 1YDPA 5I19L 2R29H 5HPMA 3V9FA 1K8IA 2W59A 4IM8A 3QUKA 4FQHB 4EI5B 4KZEL 1G7JA 4OZIF 5AEAA 3IDGB 2V9TA 3MV9D 1I3GL 3GMQA 3NACL 3GI9L 2FWOA 3SKOB 3KPTA 1LK3H 3LKOA 1S7UA 4OJFH 4PRHE 1QBMH 1MVUA 4NN6B 1QR1B 3U30C 3T0EB 3LKQB 4L8DB 3STZA 3TBVA 2NY2D 5CD3A 1I1AB 1XH3B 2Z91B 1T89A 1MQKL 1JIBA 2HYMA 2ZSWA 1JTTA 4MD0B 4DFHA 5T1LD 1G6RB 1I3GH 4K3GA 3PL6A 2YK1L 3RGHA 3VXNB 2EDJA 2Y4SA 3GMRA 2N7AA 1HXYA 3F7YA 1UACH 1BIIA 1CXIA 1M05A 5E8DH 4HDIB 3BWAB 3EGSA 4D8PB 4P2YA 1H8NA 1TJGL 1D5MA 4WI3A 5E5RB 2C4XA 4U1NA 3SKNB 5DVLA 2YPKA 2ZOKA 1ZWIB 3CH1B 1FL5A 4BZ2L 2DOCA 1F4HA 5KVGH 2VR4A 4OF8A 3EYUH 4FQIL 4NZUL 4R90L 3G5ZA 5EG6C 4BUHA 5IP4A 5I1CL 5FDWB 4GKSB 2PO6C 3ZE0F 4AQOA 1IKFL 2HVJA 4LGSB 4NKDA 3OB0H 4RAUA 3CU7A 1JHLH 1R3KB 5EOQL 4JG1H 3UBXA 1NAMA 5KVEL 1V3LA 2IANE 3WXVL 5HDLA 2D03H 2RFXA 1NAML 2UWEF 1C16A 4PG9A 3KLDA 3D9AL 4P9HH 4Z0XA 5AZ2H 3ULUD 3IJYB 3O4LB 1HDMB 2J8OA 1T7WA 1LDPH 4G8IB 3QP3A 5BCAA 4YX2H 1GGCL 3C6LB 5LJYH 1VFBB 3MRJB 2PETA 4UBDD 2JJWA 4EBQL 3G08A 2P5WE 1YN6A 4E0RA 3MA7A 2IANA 4C54A 1YPZA 5C09E 4X6FB 3AMLA 5T3XL 2AS5M 4DQOL 4FXKB 5DJ6B 4UDTA 5I30L 1N6QL 2VZTA 3K8KA 5FECA 2X1QA 2X70B 3BUTA 1OVZA 2C26A 5D5MF 3QEHA 4ZTPH 1D5BB 1HE7A 1MLCB 4EBQH 3MROB 3KPPA 2UY6A 2P5WA 3SCMB 3VWKD 1IAIM 5EN2B 2FYYA 2EIZA 4ZOCA 5DRZB 2VSCA 3RL1A 4YR6B 4JPKL 4Y4HA 4NSKA 5C09A 5T3XH 2Y07L 5GJSL 4PRDA 1N6QH 3HAEG 1WGOA 4HJJL 3VXSE 3MRMA 3IF1B 3LH2H 3C60C 2QV2A 4HHAB 5EA0H 1MCDA 3L3OB 1HZHL 3L3DA 1WZ1H 2LV4A 2BHYA 1BJ1J 2FX9H 2NMSA 4PR5B 4FZEL 2YD4A 3PQYE 1RUAL 5E94B 1MRDH 1Y6KR 2YUXA 3MV8D 4QRPB 5C08D 5GIRB 1TNNA 4LCCC 5L7XL 2NTSP 3VXSA 1I9JH 4HKBB 3B8YA 1KCRH 5F3BB 1VFMA 1PW3A 2YA1A 2MOVA 2FJHB 3DETC 2QLVB 3V8OA 3MACH 5E7FA 3WO4C 3QUYC 1N5YH 3LB6C 2LU7A 4PRHD 1AE6L 1BOGA 1DQQA 2E6JA 2XQYG 1FCCA 4WFED 1B6UA 3QPQC 3VXRE 2W65B 1YUHA 3P0VL 5H94B 2VQTA 2JJTA 2M2DA 3CPLA 4N8PA 1C1EH 2ATKA 2CJUL 3KPNA 2L4OA 4N5EC 4G5ZL 1N8ZA 3HZMB 4M5YL 4JFQB 1XIWC 2XRAL 3QZWB 5IB3B 4HG4J 4X6CB 2E3VA 3EOAA 3VXRA 3WKML 5FYLD 3P0VH 1WT5A 3HR5A 3TO2A 4XCCH 3TCXA 2OR9H 1XF2A 1H3XA 1GGBH 1RJYA 1FGNH 1QFWM 1A6TB 3I6GB 4PJ5B 1CCZA 4G5ZH 4YK4C 1EK3A 1A7QH 1QBBA 3PWPB 1BP3B 3OQ3B 3TIEA 2AGJL 4CN4A 3DROB 2ZG2A 3MREA 4GH7B 4OLYL 3RWJB 2YMXL 1H15A 1P4IL 3W9EB 2EYTB 4EQ2A 1FSKC 3CMGA 4Y4KC 2AXJA 1J18A 2HTLC 4XI5C 5HYQB 3ARFA 4ZTOL 1A7RH 5FYKH 2BSED 3HLAA 4RMRA 3IDYC 3CDGB 3ISWA 4DGVH 4GKNA 1DQDH 3KPLB 4CNIA 5IHUL 1SM3L 2FRGP 5CSGA 1MHEB 4S0SD 3BO8B 1HIML 4YWGH 4F7TA 4L4TD 2D9QB 4UB0L 4W6WB 1NJ9A 3W9DB 4FQ1H 1WIPA 5IB2B 4GAGH 2BVQA 3NVQA 5DJ8B 3RHWK 3KJ6L 5E99L 3I75B 4YIQB 2RQ8A 4QF1A 3HE6C 4OFYD 3SO3C 2BVTA 3QXWA 3VRIA 1S7SB 5DMKA 4PPTA 1A6UH 5CGYD 1U2HA 2PYFB 4LEXL 1QSZA 3DUSA 4KKNA 4UB0H 5EBMA 3DX8B 2VISB 1A1NA 1HEZB 3BQUA 3CU1A 2Y6SD 3NZHH 2Y5TB 4WVRA 2UUDH 4QRUB 4NWUH 3KJ6H 1WIUA 4NCC2 5C0FA 3BDYH 1HCFX 4OT1L 1NMCB 3WNPA 4A6YL 4Z7WE 5KVFL 5JXED 3P30L 4CRPA 1QA9A 4JRXB 3PWLA 2DD8L 3BMWA 4ZPTA 5HGHA 2O5YH 4GQPH 4NIKB 3VH8B 1R5IB 1V8HA 1XR8B 2JB6B 2HN7B 1N7ML 4YO0B 1QSEB 3CSPA 1ORQA 1RUPL 3VGHA 1G6VK 2XFXB 4WFHE 3TT3L 3VXME 1N6UA 1BBDH 1J10A 1CFQA 3BKJH 5AAWA 1EAPA 1AGBA 4QHNB 4JQVC 4U3HA 4HSQA 3WIIL 4A6YH 1KN4H 4Z7WA 1AGFA 2DJ4A 1UH3A 2DD8H 3PQYD 1JZ4A 3IAPA 4KUCD 1BFTA 3QDMD 4OCLC 4RNRA 4DGIL 2IAMD 5E7BA 2VZOA 5CGMA 1VA9A 2A74B 4DAGL 3T04D 1NH6A 4TUOB 1IGYB 5DJ2A 5DC9B 5C0IA 5CJQL 1U91B 1Q8MA 3VXMA 5INDB 2X1PA 5A16B 1D3CA 2GITA 3PJSA 5JUEL 5A2JH 5IB5A 5J56B 2BP3A 2JK5A 4KDTC 2BFVH 2CXKA 5IMLA 1AQDB 2QJDA 3PXHA 3QSKB 5E2UH 3IDNA 4YHKL 3MV7B 3O11A 5GGUA 3D0VA 2K1MA 1YMHB 4KJQC 4PJDB 3SDCD 1CFSB 2H1PH 4NQVB 4H8WC 2DKMA 3WJLA 3MLYL 5C0GB 4LDEB 3QIWB 1VPOH 4HPOL 5HHVL 4QY8A 4XHQA 3FO9A 5JMOC 3BP6A 4AENB 4HH9B 1A6VH 3MX0A 1UXSB 4TULL 4PUBL 4WV1C 5EZIH 2WBJB 5BOZG 4M9OA 1JN6A 4LMQE 2DQGH 4E5XB 5L0QB 3Q48A 5EFIB 1JGLL 5IK3A 5TJWK 5C9KA 1U92A 3ARFD 1KBGL 5FO9A 2EYSA 4XBPB 1DQLH 3U1SH 3MA9L 3OHXB 4U1MA 1TXKA 1U8NB 2BRQA 1FZMA 2DTMH 1RY7B 4GAYA 3ZE1E 1IM9D 1ZHKB 5ICYA 4M7JH 4PRPD 1A14L 2UYLB 3AROA 2FH6A 1FN4B 3AS2A 4NN7B 1EBAA 1LO0L 2AJZA 4P5TB 3ZDZF 1KTLB 3CAFA 3H7LA 5I1JH 3MLSL 3B9VA 3N0PB 4LHJB 3PHQA 1QKZH 5J06A 3ABZA 4HC1H 3OXRB 3UPRB 1IC5L 1OAUL 4FQ2L 4N8VB 2ENSA 2IBGA 4FXLA 5EIIB 5M7QA 5T1MA 1BQHG 3QO1A 3W82A 2FJFB 5EOCJ 2DWDB 2LVEA 3CVHH 3ARBD 4NFCA 4LCYA 4ONGL 4Z5RA 3REWB 1T20B 2G5RA 4HKXB 4HIXL 2E9JA 3GM8A 1ADQH 1OTUC 1RAMA 1H3GA 5DJCB 3ARDC 1U8MA 1ZEAH 3T2NL 3WNOA 1AD9A 1C5CL 3TV3L 2P8MB 2WQ8A 2NX5E 1OCWH 4OKDA 3SDDA 4F37F 3T0BA 3WFEH 3VU2A 4OV6F 3R8QA 1BHGA 3IGAB 1N2RA 4F15C 2F53E 4OCNC 4PRAB 1CFNA 3DPBA 1NCBL 3RZCA 2XNAB 5B38A 4S1RL 3TA3A 1MCJA 4HH8A 4MB4A 4N0CD 4CL7A 4XPHL 1EFXB 3MBXL 5GS3A 3T2NH 2WM0A 4Z0BL 4NC1E 4RIRA 4WFHD 5FK9A 2NX5A 4OUUA 4L8BA 4NM8L 3TO4D 3P77B 1A9BA 4H8WH 5E1AA 3GMLA 1FYTA 2L7UA 2A9NH 2BVOB 2IBZY 4TVPH 4YFLF 4DKAA 2F53A 4QHUB 1G0DA 4S1RH 3RWEA 1W8NA 5FOJA 4IDJL 4ORZC 1SY6A 1QSFE 5E03A 1RMFH 4HS3B 1SY6L 4L29B 3QISA 2VDMH 4F58L 2M26A 2GW5A 4OSUH 3BPCB 1AY1H 5JW3H 1JZ7A 3T4YA 4KY1L 1AP2A 2J12B 4D0BA 3L5WA 2WIIA 2BXYA 4LPUA 1VSCA 3O4LD 3F7PC 4ZOEA 5DVOA 5KZCD 1EBPA 4MWFA 1YNLH 5IBLC 1QSFA 3PWUB 5SX5H 5E6IC 1KJVA 1AKJB 2E6QA 3PGCA 4LDOB 3QNZA 3A6OA 3QEQB 3EFFA 2X4SA 5DSCA 4M7ZB 3QQNA 1B0RB 3A67L 5K59E 5BQ7B 4XXDA 1QFUL 3GKWH 5DO2C 4NCDA 3IB4A 3BP7B 3DO7A 3LN5A 4R0LA 5JW4M 3K81A 1KC5H 4YDIH 3SGEI 2FX7L 3KDMA 5ALBL 1EERB 4P23A 1YPZF 2Z8WC 2H9GA 1NCDL 4AH2B 4HULB 3A67H 4PJXB 5D7KE 1LO4L 2CUIA 1Q9LB 3H3BC 1QFUH 3L7FB 3GFUA 4QRTB 2QSCL 4JY4B 3DWTA 4P4RB 3RDTB 43CAA 5I1EH 2O61A 3KJ4B 4PJAE 4N90E 5HJ3B 4XNUH 4LRIC 4OD2B 1JYVA 4OD3L 4LVOC 4L3CB 5ENWA 5KVDL 3X13A 1EH9A 1EFQA 4PJFB 1SYVB 1VACB 4YHNB 2XXMB 1FO0B 2KQMA 4KJPD 3E6FB 5IBUB 2EXYC 3H2WA 1EHLH 4D9QD 3QI9C 2YSSB 4U31A 4I18A 4XHJD 5SX4H 4MAUL 1JF1B 1NBVL 1DBJL 4QRPD 1UXWA 4S1DC 35C8L 1RIUL 1FFPB 1LO3H 3LKPA 4G6JL 3PNWB 1HQRA 4PBXA 1FE8L 4JFEB 5B4MC 1A8JH 3KHQA 1ZMYA 1FLRH 4CGTA 2ZCHL 2HLAB 2PW2B 3RWHB 1F3RB 3BVNB 2Z31B 1NCCH 5E8NA 4LKCA 3HRZB 1CN4A 5IVOA 1IM3B 2WIMA 5EWIH 3DRTA 2EDKA 4ONFH 5E4EB 5D1XD 1XCTB 1EV2E 4XBGA 2UZIH 3O6KH 4PJ8D 6FABL 4NRYA 4G6JH 2MNUA 4MSWA 5IV2B 5CWSA 4UNTA 4HBCL 1VKXA 1MRFL 2AJ3B 2CK0L 4JZOA 1MFBL 1FV1B 3O0RL 3ZZ1A 2XTJC 4OCSL 1NC4B 3N1MC 3OZ9H 3IAGC 4HIEB 1Q94B 4HK0B 4N0UB 4EI6A 4GRMB 3BGAA 1RZGA 1S7XA 1AXSB 2FIKA 5EU3B 3EJYD 2JJSA 3CFEA 3HUJB 5CJXC 5I9QC 2Q8BL 4KRLB 1CWVA 3EUUA 3VFOA 1MFBH 1XF4A 4APQC 5BO1L 4PJ5D 5J9PA 4J3TA 5T1KD 5EC1B 1UM6L 3ZDXF 3PWPD 1FAIL 1XMWA 4PJ9B 1KG0A 3V5HA 2XTLA 4Q7DA 3VGFA 3H6JA 4Y16D 3FQTB 3TVMA 3Q3GA 4KTEH 4DW2H 1VGKB 4CN1A 1F3DH 3DV4B 1CF8L 2H2SD 4XC3L 5IJVB 5HGAB 4WW1B 4P3CL 5E6YA 2Q8BH 5D7LB 3HNVH 1N59A 2X4PB 1B2WL 2ADIA 3OTTA 4X83A 3ZSSA 4QCIA 2HFFA 4RSVA 4H0GA 5DUBB 5LGJA 3ESUF 3W39A 1RHHA 1I1RA 5KSUB 3T3PF 2MCG1 5K9OA 1DFBH 5EBWA 1CDCA 4CAGA 4YBHA 4BM7A 1FPTH 3UDWA 5AYUH 3SKJL 4GLRH 4E42B 1OAKL 1ND0B 3BP4A 3F12B 2FR4A 5I76A 4JY6A 1G0YR 4CVZB 4NKMB 2G60H 4MNHB 5GSRB 1INDH 3RIAF 3CLEL 4YDKL 1K8DB 1X5GA 3WS3B 4N8CH 3LKSA 1T0MB 3CH8A 4YHYC 1AQKH 4M62H 2F15A 3OKOB 3AUVA 3IETB 5EO1A 2NXYB 4QRSB 4KKAD 4R96A 2Z0BA 4NO3B 5D7KD 2JKXA 3S35H 5CILL 1Q9KB 4OF6A 1OAKH 5DQ9A 4M02A 2DM4A 4PP1D 4JRXD 4HGMA 3QRGH 4MS8D 3X14A 1OGAE 2EDYA 4JCLA 4YXLH 4MQ7A 2DMCA 4ZAKA 1FNGA 4N90D 4Y8AA 5MEPA 5L88H 4URTB 2VLRA 1GPOH 1QSED 3QFJA 1HSAA 4PJBB 4G42B 1RZKL 2NY4C 1ACZA 1S5HB 2JJVA 1IKNC 4MLIA 4NKIH 1QACA 1U8IA 4KKBC 4MJ6A 2FB4L 1CXHA 3QDJB 1ZV5A 2FHBA 3V8CA 3K4DA 4Y7MA 3L3KB 5JHDB 1QHOA 3FQNA 2NW2B 3GIZL 5D6CA 1LEGA 1NFDB 4UU9A 4D9LH 3TYGH 4Z7WF 2VXSH 4R2GB 5DEGB 2Q3AA 4UV4L 2FECL 5INCA 4KK5C 5KTEH 5F72S 4KU1A 2JCCE 5A2KH 5D1ZB 5TDPB 1BIHA 4O4YL 4JFPA 2FB4H 5BXFA 1A7BA 3O3BB 4K94L 2ZSVA 2NYYD 5FYJH 5DRNA 1FNSH 1ZK9A 1HKLH 2A83B 5LVEA 5DD1H 3HNTH 3FB5A 3BUYA 3FOLB 2P44B 3MV7D 1UQSB 2N7BA 4U2ZA 4EXPX 1UEYA 3PIQA 3SGKA 1U8HB 3K46A 3U7YH 3PWNB 2F5BL 3QHFH 5C0EB 2C7UB 5E9DE 1CG9A 2ICWA 3QIWD 1NGXA 4EUPA 2J1KA 3B8SA 4JREC 2NY2C 4P2OD 1Q0XH 4E41E 4K94H 4U2YA 3BKCL 3MRFB 5C0CB 2I9TB 4RFOL 5B39A 1JHTA 1DR9A 4PG2C 4KQ4L 3F65A 4JHAL 3U9PH 5I1HL 4GXUN 4JLRA 2ICEA 1JYNA 1R5VB 2GSGA 2LU3A 3MJ8A 3RL2A 2F5BH 1G7PB 1H5BB 1MRCL 5E9DA 4AEHL 4RGOH 1WC7A 3UPCA 3V4PH 3NIDE 2VLLB 3QIBA 4ZFOB 4JO4H 5IROA 1QNZH 4E41A 5SV3A 4WI9A 4IRSD 3MRDB 1NBZB 2B4CC 3PGDA 5CMAB 4JFOA 3QNXA 3C09C 2R0ZL 4HGWB 4OGYH 4U4BA 4LP5A 3EYFB 1T66D 3MRPB 4DEPC 3KLHD 3D2UA 4P5TD 4HUUA 2K7QA 2WQRA 4P4KA 5FEBA 1ONQB 3O8XB 1QQDA 4UZGA 5TF1H 1MRCH 3X11B 4JFXA 4AEHH 4YHMH 5C0BB 1OSPL 4ZSOB 4D2NA 4HUKB 3ZE2E 2ED7A 5F7EL 1LEKB 4ELME 4LLMA 2QKIA 4OFDA 4M1CD 3UC0L 3ULUC 7FABH 4JFZL 2MSPA 2VLJE 3DV6B 2XWTB 4FQPA 2C9AA 1I7ZB 2YBRA 5ALCL 3V6FA 4UBDC 2ADJB 4WEMB 3FRUA 3MJ7A 1DEEA 4XXCC 4B53A 2BY1A 1A1MA 2I9LA 5F7EH 2H26A 3RA7H 4YBLB 4ELMA 1W0WA 3UC0H 1NCUA 5JOEA 2DB8A 5K33A 4JFZH 2BOCB 25C8L 4MB3A 1SMOA 4YHPA 4XWGH 1HHIB 2VLJA 2NCMA 3I02A 5GQBA 5IMMA 3KGRA 4JGMA 4PJ7E 4XPTL 4WNQB 1OGAD 3WFBL 3VWKC 4LAQH 1IGFH 4U1LA 4O00A 2DQFB 1KOAA 1OQOA 4IHOA 5KSVA 2H8PA 2XT1B 4XNZB 4KRPC 2QTEA 4WFGE 4WI5A 3U0PB 3BYYA 1RIHL 5TGBB 5ITBH 4ONHB 5CSZA 1S7RB 3O4OB 3HPJB 2QQNL 3TFKD 4V2CB 3C08H 4U3XA 4LLVA 4PJ7A 4LASH 1BWWA 2F8OA 2P24B 2LE9A 3MRKB 5IUSA 3VXUB 3KPRA 2V17H 5GGRY 5GGVY 1KEMH 4JFDA 3QXVA 2FGWH 1X5LA 5HI5D 4NRXB 3QXTA 3EO1A 4LAJH 1CBVH 1T83A 5D72L 1JPSL 2QQLL 5DI8B 2R0WL 1AD0A 1F8TL 2PCPA 4KXZI 3AREB 2ZUYA 2R8SH 4YXKL 3O2DA 1B3JA 3RWGA 4LPTA 5F1IB 5IESL 2XWBA 4TQEH 3O2DL 4R4ND 4GW1A 2B4CH 1G7MA 4G8EB 4I1NB 3L3HA 1MVFA 4LL9A 1AKJD 4OCXL 5D72H 3MNWB 3DLQR 5E9DD 1A22B 3BYTA 3RPIB 1B0GA 2BX5A 2IPUG 1F3JA 2VJXA 4HWZA 1F8TH 5EU7E 1O5DT 3P0GB 5I1DB 1GGTA 1MHCB 4L9DA 4ZUVB 4E41D 3RNQA 4YXKH 1MCOL 5JORA 1I9IH 2AK1H 1AH1A 3P9LB 4F7MA 3O45A 4MA3B 4NYLB 5IIEA 2BRRL 4LPYA 1N4XL 1UGNA 1UJ3B 1QBLL 2MHAA 4NKOA 4YHZL 4PRIB 3T1WA 5LCVL 3V4VL 1WWWX 1DL7L 4YJZL 1D5IL 3ULUH 2A1WH 1LEIA 1JNNL 3FONA 5KVMC 3MXVL 1X5HA 2IPKB 1JHKH 3CZFA 3U0WH 1I4FB 3WXWH 3EO9L 1WWCA 4NHUB 2HT2D 5HHXL 5DEZA 1LVEA 5IEHA 2HKHH 3K3QA 4ZO8A 4UT7L 1ZA6A 2BRRH 1GAFL 2K3TA 2AJSL 4YHZH 3L3GB 2XY1A 3UX9B 4RRPA 3G6JE 1G9ML 2ZCKL 4GG6B 1UCBL 1G84A 1Q38A 1V5JA 5C07A 3MXVH 4L8SB 1M6OB 4CVXB 1OD9A 3TIDA 3CZJA 3KWWA 4V1DB 2WBWB 4CADA 1KTDA 3EBAA 2N56A 4HT1L 4OLUH 1I8LC 5DJXB 3S34L 3ME0A 3VXQA 1KJ2B 2YRPA 5EU6B 5C8JB 5L9DL 4P5MB 2WANA 1WICA 4JFED 1WBYB 2FBJH 1PQZA 1JNHB 3EOBA 3GO1H 5L6YL 3HE7D 1WWAX 1AGEB 1CR9L 5K9QG 3LEYL 1BX2A 1JRHI 1OAXL 4CU6A 1BQSA 2Z31D 2AV1B 2AW2A 2CIKA 5EBLB 1OLLA 3S36H 3FQUA 2YXFA 1ORSA 2ESVA 3QUMH 4CMHB 2J5LB 5CGYC 5ESVA 1JF5A 3FOMB 4OCWL 2RGSA 3VW3L 2J4WL 3TNMB 3MYJB 5L2JA 3VA6A 2Y6SC 5SWZE 5DUML 3S98A 1OAXH 2A73B 2W91A 3LDBC 4QHKJ 3VCLA 3X12A 3QJFB 4GAJL 3G5XA 5JXEC 3GSXA 1U8JA 1MCQA 3HAEB 4JQIL 4TSBL 1S7QB 1IGJB 2WINA 4N9GB 1ZGLA 3WN5A 1Q9OA 2SEBA 5KS9F 3BZDA 4PGBB 1J0ZA 3DI3B 5HGBB 5JLZB 5SWZA 3MRIA 3VG0L 2CXGA 4XRCA 2X4NA 2P8PA 3K4AA 3GSNA 3HKFA 1DBBL 3IFLL 5D96C 2NLJA 2BHZA 2HMID 5E08L 3S4SA 1NDGA 4HKJA 5IFHH 5FKAB 4TSBH 2IAMC 3GSNL 2VLKE 3MLWL 3N9GH 1KTRL 1U93A 2ATPB 4LARL 1DQMH 3DRQB 2ZCLH 5GGSY 5GRXG 1D5XA 5FYLH 5T33L 1KPRB 5D8JL 4C83B 2DYPA 3MOBL 1S9KC 3M1BA 1NCAH 4MQSB 2YD8A 1U6AH 4X4YB 5ESQB 2YXMA 3HC3L 5DHVB 2MWCA 3DTXB 2ED8A 1NCWH 3SDCC 5I1GL 4Z7OE 2DQDH 5CJOH 2HH0H 3P73B 3VFGH 2FSEA 4HIJB 4XP9L 3GBNH 3C87A 2O5XH 2YRZA 1D6VH 4ZYKB 3ZTNH 3WJJC 4PRBA 1F6AA 1EEYB 4R26L 3WIHH 2VZ1A 4Z18A 3P9WB 4C56E 1BJ8A 4J7RA 5CHNA 2YD1A 5LKNA 4JPWL 4Z78B 3MUHL 3ARFC 3BOVA 1WCBA 1F6FB 1U2CA 5F9JA 4ZUUB 4PP2A 5FO7A 3TPUB 4AIZB 1TTGA 4N9OB 4NQTA 5CBAB 4DVRL 4YPGA 4G43A 4GRLA 3ES6B 1JUFB 4HX1B 3D3VB 4RWHA 5I1KH 5E8OB 4C56A 3W5MA 1DLHA 2W1NA 3D25B 1RZ7L 5B22A 2Y72A 3OPZH 2XA8L 2CKBA 4WEBL 3DGGB 3K4ZA 3QDJD 4LLDB 1FZKA 2D7TL 1OF2B 4OD1H 2D4FA 4D9RE 4WW2C 5IR1B 2B0SL 2CKBL 1NDMA 2DDQL 1QRNB 1JNJA 1J0KA 3GJEA 1F2XK 3QHZL 4PB0L 2GYSA 2CLZB 5F7LB 1GZPB 1Q9WB 5BS0A 5J6GA 3HMWL 4NP4L 1XF5B 4JHWH 1FDLL 5BV7L 5D1ZD 4YHOH 1DUYA 2XZQL 2NY0B 5E70A 5IVZA 1KPUA 2FX8H 3ARBC 3L6FA 4MX7A 4DOHB 4YC2B 1SEBB 2BHUA 1EEZA 2Z35B 5LXGL 5D9SA 3RUGE 3CMOH 3R06A 4U0RB 4XMLL 1TJIL 2BY3A 2OTUA 5DT1L 4GBXA 4MJ5B 5DHYA 3VMNA 1MREH 4FQXA 1MH5A 5FM5M 4WI2A 1OHQA 1DP0A 1J11A 5BV7H 4DZ8B 4QHLA 3PV6B 2JIXA 2KDGA 1T1YB 2R2HA 1ODAA 4YDJA 2G2RA 1LMKA 3STLB 4NZTH 1KCKA 4ZDHA 2ZKHL 1Y6MR 3FO1B 3HCVA 1TCRB 3TGXA 5E00B 4XNYH 3CVIH 4J8RB 1IAII 3RUGA 4XMLH 5CINL 4YHIA 4U1IA 4N0CC 3S5LB 3ARQA 4H1LG 1R3LB 2VR5A 1J88A 5IM7A 1B9ZA 3MRHB 4RFEA 4UILH 5I71B 4ODTL 3QFDA 4XVSL 3IS0X 3TO4C 4FQJH 5JQ6L 3ZYOA 2YA2A 1BBJA 3NMEA 5EC2A 3OKNB 4GRWB 5HYEA 5BJTB 2C4FT 5DK0B 4H20L 3GIVB 1Z5LB 3I6LD 5TDOA 1PLGH 1NEZG 2D7PA 5FO8B 2VLKD 1ZSDB 4LPVA 2DQHL 1HHGA 3MBEA 1AFVL 5I8EA 3RPKA 5TFSL 2HVKA 4F9PC 12E8L 3WJLC 5K9KA 3M45A 3WE6A 2BNRE 3O8XD 3PE9A 4MMZC 3VRJB 4F7EA 2CGRL 4WTXA 1RZIA 5KW9L 5KOMC 4UDUB 1E6OL 4OB5L 3W0WE 3T77A 3KPQB 1A5FL 1R6VA 3K2MC 2ZNXA 4KAQL 3T65A 4D3CL 1KB5H 4YDVA 4XVJL 2OK0L 3E2HB 4Q9BA 1MCBA 4AEEA 3NIDF 5TPWH 2R0KL 3T0EE 3LN9A 2F74B 1WJ3A 4WHTA 1G7IB 1ITBB 3DO3A 3HA0A 3KYKH 2VITB 2BNRA 1YYLL 1ES0B 3KS0J 2OX5A 4HJGB 2CGRH 1PYWB 4RAHA 4K2UL 2EC9U 3S88H 3E0GA 1NCTA 4EI5A 5ACZA 3W0WA 5AD0B 3ZTJH 3UCRA 1MFNA 3B5TA 3SKOA 4FOMA 5CFHA 2OK0H 5DRXA 4DKEH 4P2QD 2FL5A 1QR1A 4TUKL 4JPVL 3T0EA 1MCNA 2QSTA 2DM7A 1S3KL 4Y2DB 2VXUL 1UB5A 1MAMH 5DS8B 1I1AA 5GZOD 1XH3A 4QXUH 4ODXB 1YEHL 5J11B 3WKNA 4U33A 1C7TA 5HHOB 4MD0A 1YQ2A 4PIRF 2DLHA 1MELA 4X6DB 1G6RA 4KVCL 1NEUA 1QFWI 2BNUA 4U6YB 4ODBD 4RQQB 4NN5B 1QVOA 4MJIE 4ZODA 1G6RL 1I1YA 1JFQH 3P0YL 4G9FB 2JELH 3BWAA 1UWGL 3HZVB 2OTWB 4GXVH 1CL7L 1L0QA 4TOYL 4Y1AE 2D0GA 3SKNA 5LGKA 4QXGH 1ED3B 4D9RD 1F00I 1ZWIA 2LQRA 4KJPC 5C71A 1N64H 1JNLL 4GBXD 1BQHB 5KAQG 1UWXK 2XZCL 1S78D 2A6DA 4POZD 1JGEB 4PJ7F 4GKSA 4XHJC 1VFAA 3L3IB 2GT9A 4MJIA 3U30B 3GSRA 3P0YH 3U7WH 4ZS7H 5JO5B 4F7CB 3ARED 2E27L 3FMGH 1EJ6A 3P4OB 1SBSH 1PX3A 1RK0B 4Z7UB 3RZCC 3B6SA 3IDJB 3BSZH 1EX0A 1JNLH 1HNFA 1RIVH 1YNTB 3OKDB 4LSQL 2NY1C 2XZCH 3MLUL 4XPFL 5ELIA 3IFPB 1NUDA 3MOAH 1A6WH 2H32A 2W0FB 5D1XC 3QG7H 4NRZB 3C6LA 1CFTB 3MRJA 4PJ8C 1UM5H 2VZSA 1H3TA 4Z76B 4LVHB 4WGVB 3MXWH 1EZVY 2Y1VA 4M6OL 3RI5F 1I7RB 2EICA 2VABB 4XPBL 1GVIA 3S3SA 3VFSB 3WUWG 4LSQH 1F4XL 4WDIA 5EZJB 5IF0A 4JFYA 5JA9A 2PO6B 4NC1C 4PRID 4XPFH 4FXKA 5M95B 4EJ1C 1TVBA 2DN7A 3EJYC 4G80A 1FL3B 4M1GL 1MJ7H 2APTA 1EGJH 1QPXA 3MROA 4KPHH 2MJWA 4M6OH 5T3ZD 3SCMA 5I16A 4G9DB 3DYPA 4WWKA 5DRZA 2B5IC 3L3JB 1YEFL 1CLCA 4YR6A 3HI5H 1RV6X 3NCYP 2QHRH 3TBWB 4LVEA 3RHWF 2BNRD 4JKWA 1TQCC 4Y16C 5HYJB 1C12B 1XR9B 3IF1A 1MNUL 4I3SL 4HHAA 5ICXB 3WMSA 3GI8H 4L3EB 3L3OA 2H2SC 3HNSL 2VAAA 1IGML 4U0QB 1P2CB 2VDOH 2XN9E 5E5MB 4PR5A 4HIIA 2VXQL 4WCYL 4O5LL 5E94A 1RZ8A 4KKLD 1FP5A 1KLGB 2PNDA 4Y8DC 3SQOH 4Q6IC 1RVFH 4UQ2B 2G75B 1FRGH 2XXCB 3ROLB 2J8UE 2VUOA 4HXBL 2FJHA 4TSAL 1YJDL 1LE9B 1FIGH 3LVEA 3QA3A 1BQUA 2VN4A 1U58B 4P5KA 1KYOK 1Y0LB 5SX4I 4JKMA 1LILA 2PXYA 3VFPB 2D2OA 3HB3D 5H94A 3RGVA 2KPNA 1UZ6E 5MERB 1UM4H 1EDQA 4KKAC 4FQCL 3ILQD 1NMCC 5T1DL 3TH2T 4JFFB 1W0YT 3ALPA 3CXHK 4PP1C 3HZMA 1VEOA 3I2CH 4JFQA 1HHHB 4RX4D 5IB3A 4Y19B 5AWNL 4LCCB 1CGSH 4OGXH 4JE4B 1F58L 5GRWA 3V2AR 3BT2H 4Y1AD 1NMAH 4M3JA 4JR9H 5BRZB 3U4EB 4K7FA 5IB1A 3WO4B 3QUYB 3CIQA 3LEXB 5BW7C 1SJHB 1W72H 4NNXB 1HQ4B 1KENL 1A9EB 1QZ1A 3QB7C 2CDFB 1KLUB 1IGCL 1OT1A 3LQAL 4ERSH 3NAAH 2F9BT 4OCYL 4LCUB 2EKJA 2GKIA 1F58H 5F44A 2EYTA 1BFSA 2EH8L 1MF2H 3SKUD 4K8RD 1E28B 1EAJA 2V2TA 5GJTL 1INEL 3IFOB 1NANH 3MMEB 4OZHB 4WUKH 3RWCB 3KPLA 5ADOL 2NYYC 2HKFH 1MHEA 3DSFH 1HILA 4OCYH 4ZD3L 1F4WH 1B4RA 1PG7L 2X40A 1A0QL 1YMMB 2BVEA 2JJSC 1LP9B 2ZUSA 2A77L 5DJ8A 1KIQB 3I75A 4YIQA 5JW4Q 5D7SH 1T1XB 3IDXL 1XGYL 1F3DJ 4Q2ZA 2DF3A 3BIKB 4LSVL 1UADC 2Y06L 3TN0B 2NZ9D 3H42H 2VERN 3KXFE 4Y89A 1KT2B 4YK4B 3G5VA 2FLRT 32C2B 2Q20A 4P2OC 5DZLA 1PKQB 3VDAA 2Y7QA 5DD5L 2OP4L 5L0QC 1HEZA 2AI0H 2VOTA 5EPMA 2BJML 5J1AB 2J88H 4QRUA 1FSKB 2IQAB 1CFVL 5GS2D 3IDXH 3HMXA 5FA3B 1SJEB 1RUMH 3IDYB 4G8FA 4HUWA 4X7EC 2Y06H 2Y36L 2WK2A 3HMXL 4GMSH 4KK9C 1R5IA 3VH8A 3MODH 3KXFA 3ZTJG 4Z7OF 1JMZA 2HN7A 2KQNA 4IRSC 4JQXA 1HXMB 3GB7B 3O41B 4MXVF 4NNPH 4AL8L 4YUEL 5DD5H 2XFXA 2X89A 1P84J 3NIGE 3UDWC 1RJZA 3QQ9D 4ODVL 1UC6A 3RWIA 4OZGB 1TVHA 1KULA 5H35A 1T66C 3KLHC 2MCPL 2XN9D 3SO3B 4OV5A 1BD2E 2QQKH 4JGJA 1QRND 4LLUB 3ZHLA 1WWBX 2O26U 2A74A 3ARRA 1JK8A 4HAGA 4AL8H 3AVEA<