2P2CP

Inhibition of caspase-2 by a designed ankyrin repeat protein (darpin)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
b'HHGSDLGKKLLEAARAGQDDEVRILMANGADVNATDWLGHTPLHLAAKTGHLEIVEVLLKYGADVNAWDNYGATPLHLAADNGHLEIVEVLLKHGADVNAKDYEGFTPLHLAAYDGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-2
publication title Inhibition of Caspase-2 by a Designed Ankyrin Repeat Protein: Specificity, Structure, and Inhibition Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 158
sequence length 158
chains with identical sequence Q, R, S, T, U
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2p2cP00
1MX6A 4QFVA 1YYHA 3W9GA 3JXIA 5JMND 3V2XA 4J8YA 4Z68A 5FIOA 2DZOA 3TWTA 2DVWA 3JXJA 2KXPC 5KBAA 4DX1A 2QYJA 4K5CA 5CEDB 5EYLA 4K5AB 5EILA 5AAOA 5CBNA 4HQDA 4HI8A 1K3ZD 1OY3D 3TWWA 3V31A 1S70B 5CECB 3LJNA 4DX7D 5CERB 1IXVA 2VGEA 5KNHD 2DWZA 5AQ9A 4BSZB 5EIBE 1BLXB 4UUCA 2FO1E 3TWVA 2V4HC 2XEEA 4HLLA 3ZUVB 1MJ0A 5ENTD 1QYMA 1MYOA 1AWCB 4OAVB 4O1OA 4JB8P 5CBOA 3DEPA 4HB5A 3IXEA 5AN8A 4HNAD 4TUMA 2Y0BG 1G3NB 2J8SD 3NOGD 4G8LA 3Q9NC 5KNGA 2AJAA 1N11A 4BETA 3SO8A 2RFAA 4HRLA 3V79K 4A63B 4J7WA 5BXUA 3B95A 4ZHBA 4LG6A 2ZGGA 2F8YA 2ZGDA 4RLYA 1SVXA 4OAUC 4ZFHA 2V5QC 3EHRA 4HBDA 4NIKA 1NFIE 3UXGA 2MYOA 2ETBA 1WDYA 4GPMA 4F6RD 1N0RA 4DUIA 4K5BA 2RFMA 5EN5D 3UI2A 3NOCD 4U8YD 3TWRA 4BEPA 1BD8A 3V2OA 3TWXA 3Q9UC 4DX2A 2BKGA 3TWQA 4DX6D 5HKPA 4YDWA 3V30A 2F37A 3ZKJA 1YMPA 5EYPF 4C48B 2JABA 3AJIA 2ETCA 2NYJA 4HRMB 4U96D 5AQAA 3T8KA 5KWDA 4O1PA 3W9FA 3J5PA 3TWSA 4U95D 1N0QA 3EU9A 5AQ7A 4CYMD 1IHBA 4HI9A 1AP7A 2XEHA 2Y1LE 5HRYA 3T9KA 5ENRD 1UOHA 4O60A 4BERA 4F1PA 1A5EA 4CZ2D 1WG0A 5AQBA 5BXOA 5HS0A 1BU9A 2XENA 3KEAA 4BESA 5EIDA 4B93B 5ENPD 2L6BA 4GMRA 4YDYA 3HRAA 2F8XK 3C5RA 3F6QA 3JUEA 1D9SA 1YCSB 1DC2A 2XZDG 4ATZD 5ENSD 3TWUA 1MX2A 2HE0A 5ENQD 3UTMA 1TR4A 3D9HA 4N5QA 5ENOD 1K1BA 2B0OE 2DZNA 1IKND 5FINA 3ZNGA 4G8KA 2XZTG 5CEAA 3EHQA 4LSZE 1BI7B 2A5EA 2PNNA 4DX5D 3NBNB 1OT8A 4DRXE 1MX4A 1SW6A 2BKKB 3B7BA 5ITZF 5AARA 3ZU7B 3DEOA 1BI8B 2ETAA 4LNUD 4QQIA 4HRNA 5JA4D 1K1AA 3J5QB 2P2CP 5D66A 3AAAC 2QC9A 2KBXA 4U8VD 1DCQA 3HG0D
chains in the Genus database with same CATH superfamily
5M72A 1X5BA 1ELRA 2GRMA 5BPPA 3AU4A 3CQGB 2DZOA 3Q7FA 3L54A 5CCLA 5KJMA 4YDOA 4EHMA 1N4PA 3AG3E 3Q5MA 4H7YA 4JL0A 2AXUA 3FUNA 1EDUA 2OV8A 3FEYA 3DEPA 4NURA 3U66A 3SO8A 4HRLA 3B7TA 4MRUA 2BUGA 3UM3A 3BG1B 5ENNA 3TWRA 3Q9UC 3FTUA 1UW4B 2WXQA 3GZSA 4HRMB 5KWDA 3C3QA 3EU9A 4ILGA 1A5EA 4XI9A 4B93B 1ELWA 1OWPA 2KCKA 1WY6A 2WVIA 1D9SA 1LF8A 1YCSB 4J0UA 1PC2A 1SA4A 1FCHA 2EIKE 4G11A 1HO8A 3CHSA 5FWQA 5FZRA 3NBNB 2R02A 3KS2A 4DI3A 2KM4A 1RZ4A 3JQ1A 1OWNA 3ZU7B 4N3CA 4GPKA 3ZPJA 3S7FA 4PS3A 4I9EA 4DLOA 3SF4A 4HOSA 3UX4A 5ANLA 4FJYA 3LCAA 3PEUB 3T5VA 4Z68A 2DIWA 1WM5A 5KBAA 4RVBA 2VSYA 3SFZA 2WXIA 3G2UA 3QWVA 1TEZA 3EIJA 5ENTD 5IY5E 1YA0A 2R03A 5AN8A 1S63A 2ILRA 4HXIA 4AV7A 1N11A 4K03A 3K9IA 3AG1E 4YVOA 4CRWA 3UQ3A 4I43A 2ETBA 3UM2A 4F6RD 1FT1A 3LVQE 4HOUA 3NZUA 3UI2A 3DSUA 2DBAA 2PQNA 4L9PA 3TWQA 4XKBA 4MS6A 2WXOA 1LTXA 4O1PA 3ZIMA 1KZOA 5G55A 4UQZA 3WXXA 1H6OA 3EIQC 2Q7FA 3DWLG 4I2WA 2KCLA 4N5QA 1K1BA 1HG2A 3Q79A 4BX8A 2J09A 2PL2A 4A1SA 5JHAA 3QC1A 3VLEA 3ESLA 3DSSA 3MKQA 4G1TA 4GZDA 4GZ6A 3MGBA 2UWJG 3J5QB 2P2CP 3CK9A 2WXPA 2X6KA 5J90A 2CHXA 4QFVA 4P29A 3FULA 1H6PA 3SY2A 5EILA 4JC8A 4AIFA 4CDNA 3DSTA 3PUKA 2EINE 5FQ7A 3C98A 5G04C 2CHWA 3ZUVB 4GAAA 1TNUA 4UQYA 3QWWA 4ANWA 5KNGA 4OYSA 2I1KA 4DPRA 2ZGGA 2BTDA 3LY7A 2ZU6B 3NOCD 5FQ8A 2KZTA 3ML9A 3ZKJA 2FO7A 3L82A 3ASFA 1FVHA 2XEHA 4ANUA 3FH7A 4BERA 3G2SA 4F53A 1OWLA 3E32A 3CSTA 4KMOA 4FADA 1FT2A 1N4QA 3SFYA 4R7LA 2FBNA 1V55E 3ML8A 3MJWA 1Z5SC 2WXNA 3RO3A 5FINA 1Y6IA 3U64A 4F7AA 1BI7B 3HXEA 1OT8A 2WXFA 4GB9A 2VSXE 5A7DB 5A23A 3ZFWA 3SQVA 2I9CA 2QC9A 4CT4A 3PE3A 1H6KA 2WQHA 2DVWA 4WWPA 3ENEA 3RRNB 4GZCA 2QFCA 3FEXA 4GYOA 4GU5A 5E76A 1LD8A 1E96B 3HHMA 2V8SE 4BSZB 1MZCA 2YQ8A 3HVEA 5ANRA 1MJ0A 2IFUA 3R7QA 3QOUA 2DYSE 4WNGA 4G8LA 4BY6A 2J9QA 1E8XA 5AYWD 2R05A 3EDTB 4A63B 4AVXA 3MCXA 3ZYKA 1WDYA 4UWKA 3ULEG 2VQ2A 5FT9A 5DIZA 5DBKA 3ZHEA 3FUJA 4JXTA 3JYSA 4LCTA 2WQ6A 4FP7A 4DX6D 4OVVA 2Y4TA 2V5FA 3PREA 2NYJA 4U96D 3W9FA 1IHBA 1ELKA 2Y1LE 3FTZA 4AP2A 4FLHA 3SD5A 4PH4B 3UT4A 3QB2A 4WNFA 2WXMA 5EKQD 3UIOC 1IHGA 5HI7A 1JWFA 3R9MA 3U9WA 4HRNA 3TAXA 4PS7A 4D10C 3RO2A 3D9LA 5LX8A 3PZ2A 4U8VD 1LD7A 4I1MA 3JUIA 4HVBA 3Q78A 4HS2A 2PQRA 3ZW3A 4XZ4A 5G2NA 1EF1C 1N9AA 2P9PG 5AQ9A 3VTXA 5KJLA 3P1UA 5LCWJ 3ONLA 2PM6A 3DPDA 2IONA 2P9LG 5G04J 4HBDA 3UXGA 4TXPA 2WM9A 3UUXA 2LXLA 2WXJA 2A4ZA 4U8YD 3CIAA 4BEPA 2E0IA 3CVNA 3ZXPA 2UY1B 3OXFA 3T8KA 1ZBPA 1HH8A 4LERA 1WG0A 1OCOE 4ATGA 1UJJA 4L23A 1TJFA 2VTBB 4J8SA 2F8XK 2EILE 2L0IA 1MX2A 2VYIA 1HS6A 4W9RA 4HORA 2HE0A 5HQ8A 3IBEA 3OXGA 2B0OE 3FTVA 4RG6A 5CEAA 3MV2B 4G23A 5ITZF 1MX4A 2BKKB 3QARA 5AARA 2VGXB 1BI8B 2I1JA 2DYRE 3FTWA 4TXQA 5CHEE 5JA4D 2J4DA 1K1AA 4U0ZA 3MKRA 4KVMA 3FUIA 3S7JA 4B0ZA 3GW4A 2X6JA 4RQIA 4PDXA 3FU6A 1DVPA 1OY3D 1S70B 2ZISA 2VJ8A 4DX7D 4GMLA 2NXPA 4TRQA 4UI9K 3FWVA 2AVPA 3IV0A 4HLLA 1JCSA 1QBQA 4JB8P 2WB2A 3UM0A 3FH5A 4FJZA 3PZ1A 1TNYA 1XNFA 5T3RA 4G24A 4Q94A 5CRUA 4KVOA 4U0UA 4G2VA 4YVQC 4JD2G 3QJZA 2FF4A 2RFMA 1O1RA 3RU0A 4DI4A 4JHRA 4GZ3A 4EBAA 2BKGA 3FP3A 4N2SA 4B8CB 2WXGA 3AS8A 2GRPB 5CRVA 3DRAA 1KLXA 4U95D 4GTOA 4GA2A 2EIJE 4GYWA 5KJNA 4F3VA 2FULA 5BXOA 2IY0C 3Q47B 1EPUA 3Q15A 5EIDA 4N3AA 3DXKG 3PZ4A 4GCOA 3CHPA 4RG9A 4A3TA 4ATZD 5B3SE 4AJWA 3UTMA 4U63A 4ANXA 3NQPA 2H6HA 4JVSA 2WXRA 2XHEA 3SNXA 2XGOA 2WPVA 4TXRA 1E90A 2XEVA 3GZ1A 3D9JA 1KT1A 1YYHA 3RRUA 3UT7A 5FJYA 3UPVA 1TNBA 1DCEA 4K5AB 2OOEA 3TWWA 4JA9A 3ABKE 2L9BA 3ESKA 5CERB 3KSLA 3TWVA 3EU5A 2OEVA 4C0MA 5D2MC 3D3MA 3CHQA 3Q75A 4J8EA 3ABME 4DLQA 4L1BA 3CLJA 4BETA 4ZHBA 1N54A 1U2VG 2F8YA 4JEUA 3CVVA 3U4TA 4X8QA 3LKUA 3APDA 4DX2A 2C0LA 5HKPA 3T5XA 3VLDA 3QDNA 3SI5A 3TWSA 3LYAA 3ULQA 3IEGA 4EZLA 4GTPA 3ISMC 2MRIA 2PM7A 4BT9A 2R17C 3CR3A 3TXNA 3Q7AA 3CVUA 2P9IG 4TUUA 1GW6A 3B7SA 3S2AA 5D0OD 1TR4A 5ENOD 3CVQA 3KSQA 4H7XA 3DBSA 3TXMA 2A5EA 1TNZA 3SZ7A 2XGSA 1VDYA 5LOZA 1DCQA 1ZU2A 3CVLA 3T8MA 3FTSA 1SQMA 3CV0A 5CBNA 1K3ZD 3FHEA 3OXLA 4I2ZA 1UN9A 1SZAA 3I4RB 4AXHA 3VTYA 3IXEA 3HXCA 3PNTB 4FULA 4TUMA 4UWHA 2NSZA 3SBSA 2KC7A 4J7WA 3G2VA 5LCWC 1SVXA 3NF1A 4XX5A 1IYGA 3ASHA 3TWXA 4FU3A 2WXHA 3DPYA 1Y8MA 4KZ0A 1QNFA 3AJIA 2R5SA 2Y3AA 4ACKA 4WWNA 2RG8A 4ME2A 5FZSA 4F1PA 3ZGQA 2V4LA 4E85A 3KEAA 5ENPD 2BF0X 3B7UX 3DXMG 4MLPA 2GW1A 4FHKA 3N71A 5CMYA 4B89A 2LAHA 2RKKA 2VSOE 2CG3A 2JEKA 3UKUG 3LXUX 4Y6WA 3C3OA 1PY1A 4I17A 3ZYQA 3CK8A 5CCMA 3CHRA 2XS8A 2GRQB 3ASDA 3SHFA 5H7PA 3NZSA 2QYJA 4HI8A 4GZ5A 3EUVA 3LJNA 2DWZA 2WQ7A 3QAQA 4J8FA 2V4HC 2XEEA 3TGOA 5FTPA 2DCPA 3LPZA 5FZQA 2C2LA 2X6HA 1EYHA 4UI9C 3UINC 2J8SD 1KT0A 1TNOA 2I6HA 3L16A 1P5QA 2LO6A 1OXJA 5BW8C 4LG6A 1S64A 2CFZA 4APOA 4V3IA 1HF8A 1HE8A 3TL5A 4J8DA 3D9MA 2RD0A 4J6IA 2XCCA 4NRHB 2ETCA 4B8AA 3PE4A 4XKCA 1Q2ZA 3URZA 5BV0A 2QZAA 3R9AB 4LEUA 5KJKA 3OAWA 1NL4A 2L6BA 3F6QA 1WAO1 3HDXA 2Y69E 2VGYA 2MHKA 2YHEA 4NQ0A 3LDZA 4DX5D 1JWGA 4HLEA 1V54E 2EIME 1X81A 3D9KA 5T4YA 3OTNA 1RW2A 4AEZC 4C9BB 2L6JA 2JLBA 5AIJA 4J8YA 3E30A 4AY6A 3ZYLA 4K5CA 5CEDB 5AAOA 2C0MA 4BWRA 5CECB 3ZVVA 2PZIA 5BT1A 5LP0A 3UMVA 1H0AA 2XCBA 2XPIA 3IHYA 4ACLA 5CBOA 3RIBA 3KD7A 2UY1A 1Z3YA 4I6JA 1FPPA 4A55A 4EQFA 2X38A 3D9IA 4I1OB 2AW6A 4NIKA 4IRUA 2ZXWE 3HXFA 3I5PA 4GTQA 4DUIA 2GRLA 4FHJA 2X3MA 4EPZA 4JHJA 3ZEFA 2VTBA 4YDWA 5G05J 1QQEA 2WXKA 1JCQA 1JPLA 4C48B 2F0YA 2WMNA 3RAUA 1OCRE 3X2QE 3T9KA 5ENRD 4KXKB 5AJDA 1OCCE 2XRYA 2WXLA 3CVWA 1UJKA 4Q96A 1BU9A 2VGXA 3AG4E 4GTSA 3QNKA 3G2TA 3PVLA 3MYVA 1DC2A 3IKOB 4LUNU 4I1AA 3D9HA 3ZNGA 4EBAG 1IQRA 4N39A 3S7BA 4BTAA 3DEOA 1DNPA 3E33A 4GTTA 2HO1A 4M7CA 1MX6A 2ZIRA 5KCMA 3I3NA 2H6GA 4HOTA 3TJPA 3APCA 5EYLA 3Q73A 3CHMA 2LUHA 3LY9A 3V31A 4WAFA 1H2VC 3C72A 1BLXB 4UUCA 2FO1E 3FUKA 3DSXA 2HR2A 3PEVB 2XPYA 4HNAD 2B6CA 4CT0A 3BUAA 2CHZA 1E8ZA 3SFXA 4IN3B 3KAEA 3QKYA 4EZJA 2IQCA 2YNQA 3FUDA 2E2EA 5EN5D 4CEMA 4UI9J 1H19A 3ASOE 4AY5A 1L5JA 4XIFA 3CEQA 2CFUA 4GYYA 3KEZA 3PZDA 5A6CA 5AQ7A 2ONDA 1AP7A 3PUJA 4XI0A 1NZNA 4K0RA 4GA0A 3APFA 1A17A 3BQOA 3C5RA 3CKBA 5ENSD 3I4GA 4CDRA 3CKCA 2DZNA 2XPZA 3HIZA 3S7DA 3E34A 4XEIG 1SA5A 4L7TA 3RJVA 5JJTA 2LXMA 4KYOB 2OEWA 3HG0D 2AXZA 2P58C 3D9OA 5D0QD 1JUQA 2H6FA 3ZN3A 4WWOA 2KXPC 1D8DA 4I6GA 4HQDA 5ARFA 5BNWA 1K8KG 3VLFA 2LSUA 3L6AA 3PS6A 3SBTB 4JHKA 3D9PA 3FU3A 4HB5A 3SGHA 4DK5A 2IJGX 5JJ7A 3L13A 3ASNE 4L2LA 3BEEA 2HYZA 4RLYA 5CMWA 1N0RA 4LRZA 1Z3XA 1BD8A 4N3BA 4U04A 3V30A 2F37A 2Y4UA 2P9KG 2MOWA 2R2LA 4IULA 5AQAA 3J5PA 4LNBA 4ILHB 4URKA 3PZ3A 4AOFA 3ZYMA 3FUFA 3FUHA 2XENA 3WG7E 1S0PA 3C3RA 3L22A 4YDYA 4CGWA 1NP7A 2IOLA 4G8KA 3GZ2A 1HG5A 3LJ3A 3MX3A 4LSZE 3EHMA 4CDMA 1HZ4A 1SW6A 4BTBA 4QQIA 3E37A 3L08A 1ZB1A 2CG2A 3AS5A 4HOQA 5D66A 2KBXA 4E6HA 4FA6A 3MV3B 3RSEG 5FIOA 3TWTA 4U07A 5E75A 4JPSA 4DX1A 3L17A 4DJAA 1O5MA 2I2OA 4G25A 5KNHD 5EIBE 4TV3A 1H2UA 4GA1A 1N95A 3MA5A 4JZYA 3FU0A 5C2YA 3NOGD 1IQUA 1JCRA 3FY4A 4GTVA 3UIPC 5LFAA 3Q4AB 4EZKA 1TJCA 1UG3A 3LY8A 1TYQG 2IEJA 2IO2C 3NAWA 3EHNA 4JW1A 4Q69A 4WNEA 2R59A 5EX0A 4YNDA 5G05C 1MHQA 2GRNB 3LVRE 4F1SA 1UOHA 2P9NG 5FQ6A 3FFLA 5AQBA 1N94A 3EJNA 4BESA 5B1AE 3PDNA 4GMRA 1HU3A 4Y6CA 3MEKA 5ENQD 4B94A 3GYZA 3U3WA 3PNLB 1IKND 4I6EA 2J4BA 3QK0A 2OVFA 1U3DA 3G2WA 4LNUD 1E8WA 2IO3C 2XQ0A 2KATA 4I9CA 2KCVA 3AAAC 4XE0A 3NB2A 2WMOA 4N2QA 2H6IA 3JXIA 3V2XA 2OCCE 4UWFA 3B13A 4PS8A 3MKQB 1E8YA 1W3BA 4ANVA 1H2TC 1IXVA 3ONKA 3AU5A 3MZLB 1AWCB 2GROB 4A3VA 2LSVA 4N5CA 4ABNA 1G3NB 4WUYA 3ZRHA 4AM9A 3V79K 2ZGDA 4OAUC 3DSWA 3ASGA 1NFIE 5EX3A 1NA0A 3AG2E 3RKVA 3HXBA 4JA7A 1OUVA 3DSVA 4BX9A 4OVUA 3TG4A 4CCAA 1YMPA 5EYPF 2M63A 4BSXA 4G26A 3UT8A 2A5UA 4UQXA 3JQ0A 4CZ2D 5T8IA 2GRRB 3FUEA 4IYPA 1HX8A 1KZPA 2LNIA 3ULYA 3B7RL 2KZTB 3TG5A 5EDSA 1XGWA 3TWUA 4EECA 4GCNA 1N4RA 4CGVA 3UKRG 2PNNA 5ARGA 2P9UG 4UWLA 3R7RA 1HXIA 4ILIA 1B89A 5JJ6A 3O48A 3LS8A 4JEHA 3RRMB 2VSNA 1OWMA 2J08A 3ZXSA 2L0TB 3ABLE 3AS4A 3BU8A 3P2BA 2IF4A 3FTXA 4HFGA 5BV1A 1UN8A 1QYMA 1MYOA 3E4BA 4OAVB 2IOSA 2FI7A 2AWIA 2QYUA 3Q9NC 4L2YA 2AJAA 3PRZA 5BXUA 5JHBA 2EQXA 5BUZA 3EHRA 4KT6B 3FU5A 1N52A 4GPMA 3CK7A 1INZA 3FDHA 3HVEB 4U8HA 4GTMA 4YDEA 1D8EA 2JABA 2X6IA 1N4SA 4UWGA 1QZ2A 1BPOA 5B1BE 4CYMD 4HI9A 2QY7A 1TN8A 5HRYA 2V0PA 3D9NA 3ZHEB 5HS0A 2GGFA 4RSYA 3UM1A 4GMJA 1FVFA 1O1SA 2XGMA 5FQ4A 1U3CA 2XZTG 4KZCA 3EHQA 1PAQA 2XRZA 5AJLA 3IHVA 2J49A 3QWPA 2ETAA 1O1TA 3L9TA 3LEWA 4GTRA 4MKTA 2X6FA 4K5BA 2AXVA 3CVPA 3W9GA 5JMND 2FEZA 3O4ZA 4C0EA 1Z6TA 3JXJA 4O6FA 4PUCA 2P9SG 3CGHA 3CSFA 1TN6A 1KPSB 2VGEA 2XS1A 3HYMB 1HFAA 4WNDA 4U0SA 4O1OA 2IU1A 3BG0B 3CVYA 3Q49B 5C1DA 2YINA 2Y0BG 2BEDA 2RFAA 3B95A 1OWOA 4FC8A 4ZFHA 2V5QC 4BT8A 2MYOA 1MQSA 2YHCA 3FH8A 2OVBA 1E7VA 3V2OA 1E7UA 4NACA 4A1GA 2HM8A 1N0QA 4APFA 4BFRA 5J08A 3RK6A 4O60A 4FLBA 3CHOA 3FUMA 3FTYA 1NA3A 2NC9A 4U7EB 4KBQA 3HRAA 3JUEA 1SZ9A 2XZDG 2J07A 1OCZE 1TN7A 4MBGA 5AENA 4M3OA 4DRXE 3B7BA 2LAIA 4LNGA 3CVXA 1NI1A 3CQCB 3PH0C 3HXDA 3JCKC
chains in the Genus database with same CATH topology
1MX6A 4QFVA 1YYHA 3W9GA 3JXIA 5JMND 3V2XA 4J8YA 4Z68A 5FIOA 2DZOA 3TWTA 2DVWA 3JXJA 2KXPC 5KBAA 4DX1A 2QYJA 4K5CA 5CEDB 5EYLA 4K5AB 5EILA 5AAOA 5CBNA 4HQDA 4HI8A 1K3ZD 1OY3D 3TWWA 3V31A 1S70B 5CECB 3LJNA 4DX7D 5CERB 1IXVA 2VGEA 5KNHD 2DWZA 5AQ9A 4BSZB 5EIBE 1BLXB 4UUCA 2FO1E 3TWVA 2V4HC 2XEEA 4HLLA 3ZUVB 1MJ0A 5ENTD 1QYMA 1MYOA 1AWCB 4OAVB 4O1OA 4JB8P 5CBOA 3DEPA 4HB5A 3IXEA 5AN8A 4HNAD 4TUMA 2Y0BG 1G3NB 2J8SD 3NOGD 4G8LA 3Q9NC 5KNGA 2AJAA 1N11A 4BETA 3SO8A 2RFAA 4HRLA 3V79K 4A63B 4J7WA 5BXUA 3B95A 4ZHBA 4LG6A 2ZGGA 2F8YA 2ZGDA 4RLYA 1SVXA 4OAUC 4ZFHA 2V5QC 3EHRA 4HBDA 4NIKA 1NFIE 3UXGA 2MYOA 2ETBA 1WDYA 4GPMA 4F6RD 1N0RA 4DUIA 4K5BA 2RFMA 5EN5D 3UI2A 3NOCD 4U8YD 3TWRA 4BEPA 1BD8A 3V2OA 3TWXA 3Q9UC 4DX2A 2BKGA 3TWQA 4DX6D 5HKPA 4YDWA 3V30A 2F37A 3ZKJA 1YMPA 5EYPF 4C48B 2JABA 3AJIA 2ETCA 2NYJA 4HRMB 4U96D 5AQAA 3T8KA 5KWDA 4O1PA 3W9FA 3J5PA 3TWSA 4U95D 1N0QA 3EU9A 5AQ7A 4CYMD 1IHBA 4HI9A 1AP7A 2XEHA 2Y1LE 5HRYA 3T9KA 5ENRD 1UOHA 4O60A 4BERA 4F1PA 1A5EA 4CZ2D 1WG0A 5AQBA 5BXOA 5HS0A 1BU9A 2XENA 3KEAA 4BESA 5EIDA 4B93B 5ENPD 2L6BA 4GMRA 4YDYA 3HRAA 2F8XK 3C5RA 3F6QA 3JUEA 1D9SA 1YCSB 1DC2A 2XZDG 4ATZD 5ENSD 3TWUA 1MX2A 2HE0A 5ENQD 3UTMA 1TR4A 3D9HA 4N5QA 5ENOD 1K1BA 2B0OE 2DZNA 1IKND 5FINA 3ZNGA 4G8KA 2XZTG 5CEAA 3EHQA 4LSZE 1BI7B 2A5EA 2PNNA 4DX5D 3NBNB 1OT8A 4DRXE 1MX4A 1SW6A 2BKKB 3B7BA 5ITZF 5AARA 3ZU7B 3DEOA 1BI8B 2ETAA 4LNUD 4QQIA 4HRNA 5JA4D 1K1AA 3J5QB 2P2CP 5D66A 3AAAC 2QC9A 2KBXA 4U8VD 1DCQA 3HG0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX6 A;  4QFV A;  1YYH A;  3W9G A;  3JXI A;  5JMN D;  3V2X A;  4J8Y A;  4Z68 A;  5FIO A;  2DZO A;  3TWT A;  2DVW A;  3JXJ A;  2KXP C;  5KBA A;  4DX1 A;  2QYJ A;  4K5C A;  5CED B;  5EYL A;  4K5A B;  5EIL A;  5AAO A;  5CBN A;  4HQD A;  4HI8 A;  1K3Z D;  1OY3 D;  3TWW A;  3V31 A;  1S70 B;  5CEC B;  3LJN A;  4DX7 D;  5CER B;  1IXV A;  2VGE A;  5KNH D;  2DWZ A;  5AQ9 A;  4BSZ B;  5EIB E;  1BLX B;  4UUC A;  2FO1 E;  3TWV A;  2V4H C;  2XEE A;  4HLL A;  3ZUV B;  1MJ0 A;  5ENT D;  1QYM A;  1MYO A;  1AWC B;  4OAV B;  4O1O A;  4JB8 P;  5CBO A;  3DEP A;  4HB5 A;  3IXE A;  5AN8 A;  4HNA D;  4TUM A;  2Y0B G;  1G3N B;  2J8S D;  3NOG D;  4G8L A;  3Q9N C;  5KNG A;  2AJA A;  1N11 A;  4BET A;  3SO8 A;  2RFA A;  4HRL A;  3V79 K;  4A63 B;  4J7W A;  5BXU A;  3B95 A;  4ZHB A;  4LG6 A;  2ZGG A;  2F8Y A;  2ZGD A;  4RLY A;  1SVX A;  4OAU C;  4ZFH A;  2V5Q C;  3EHR A;  4HBD A;  4NIK A;  1NFI E;  3UXG A;  2MYO A;  2ETB A;  1WDY A;  4GPM A;  4F6R D;  1N0R A;  4DUI A;  4K5B A;  2RFM A;  5EN5 D;  3UI2 A;  3NOC D;  4U8Y D;  3TWR A;  4BEP A;  1BD8 A;  3V2O A;  3TWX A;  3Q9U C;  4DX2 A;  2BKG A;  3TWQ A;  4DX6 D;  5HKP A;  4YDW A;  3V30 A;  2F37 A;  3ZKJ A;  1YMP A;  5EYP F;  4C48 B;  2JAB A;  3AJI A;  2ETC A;  2NYJ A;  4HRM B;  4U96 D;  5AQA A;  3T8K A;  5KWD A;  4O1P A;  3W9F A;  3J5P A;  3TWS A;  4U95 D;  1N0Q A;  3EU9 A;  5AQ7 A;  4CYM D;  1IHB A;  4HI9 A;  1AP7 A;  2XEH A;  2Y1L E;  5HRY A;  3T9K A;  5ENR D;  1UOH A;  4O60 A;  4BER A;  4F1P A;  1A5E A;  4CZ2 D;  1WG0 A;  5AQB A;  5BXO A;  5HS0 A;  1BU9 A;  2XEN A;  3KEA A;  4BES A;  5EID A;  4B93 B;  5ENP D;  2L6B A;  4GMR A;  4YDY A;  3HRA A;  2F8X K;  3C5R A;  3F6Q A;  3JUE A;  1D9S A;  1YCS B;  1DC2 A;  2XZD G;  4ATZ D;  5ENS D;  3TWU A;  1MX2 A;  2HE0 A;  5ENQ D;  3UTM A;  1TR4 A;  3D9H A;  4N5Q A;  5ENO D;  1K1B A;  2B0O E;  2DZN A;  1IKN D;  5FIN A;  3ZNG A;  4G8K A;  2XZT G;  5CEA A;  3EHQ A;  4LSZ E;  1BI7 B;  2A5E A;  2PNN A;  4DX5 D;  3NBN B;  1OT8 A;  4DRX E;  1MX4 A;  1SW6 A;  2BKK B;  3B7B A;  5ITZ F;  5AAR A;  3ZU7 B;  3DEO A;  1BI8 B;  2ETA A;  4LNU D;  4QQI A;  4HRN A;  5JA4 D;  1K1A A;  3J5Q B;  2P2C P;  5D66 A;  3AAA C;  2QC9 A;  2KBX A;  4U8V D;  1DCQ A;  3HG0 D; 
#chains in the Genus database with same CATH topology
 5M72 A;  1X5B A;  1ELR A;  2GRM A;  5BPP A;  3AU4 A;  3CQG B;  2DZO A;  3Q7F A;  3L54 A;  5CCL A;  5KJM A;  4YDO A;  4EHM A;  1N4P A;  3AG3 E;  3Q5M A;  4H7Y A;  4JL0 A;  2AXU A;  3FUN A;  1EDU A;  2OV8 A;  3FEY A;  3DEP A;  4NUR A;  3U66 A;  3SO8 A;  4HRL A;  3B7T A;  4MRU A;  2BUG A;  3UM3 A;  3BG1 B;  5ENN A;  3TWR A;  3Q9U C;  3FTU A;  1UW4 B;  2WXQ A;  3GZS A;  4HRM B;  5KWD A;  3C3Q A;  3EU9 A;  4ILG A;  1A5E A;  4XI9 A;  4B93 B;  1ELW A;  1OWP A;  2KCK A;  1WY6 A;  2WVI A;  1D9S A;  1LF8 A;  1YCS B;  4J0U A;  1PC2 A;  1SA4 A;  1FCH A;  2EIK E;  4G11 A;  1HO8 A;  3CHS A;  5FWQ A;  5FZR A;  3NBN B;  2R02 A;  3KS2 A;  4DI3 A;  2KM4 A;  1RZ4 A;  3JQ1 A;  1OWN A;  3ZU7 B;  4N3C A;  4GPK A;  3ZPJ A;  3S7F A;  4PS3 A;  4I9E A;  4DLO A;  3SF4 A;  4HOS A;  3UX4 A;  5ANL A;  4FJY A;  3LCA A;  3PEU B;  3T5V A;  4Z68 A;  2DIW A;  1WM5 A;  5KBA A;  4RVB A;  2VSY A;  3SFZ A;  2WXI A;  3G2U A;  3QWV A;  1TEZ A;  3EIJ A;  5ENT D;  5IY5 E;  1YA0 A;  2R03 A;  5AN8 A;  1S63 A;  2ILR A;  4HXI A;  4AV7 A;  1N11 A;  4K03 A;  3K9I A;  3AG1 E;  4YVO A;  4CRW A;  3UQ3 A;  4I43 A;  2ETB A;  3UM2 A;  4F6R D;  1FT1 A;  3LVQ E;  4HOU A;  3NZU A;  3UI2 A;  3DSU A;  2DBA A;  2PQN A;  4L9P A;  3TWQ A;  4XKB A;  4MS6 A;  2WXO A;  1LTX A;  4O1P A;  3ZIM A;  1KZO A;  5G55 A;  4UQZ A;  3WXX A;  1H6O A;  3EIQ C;  2Q7F A;  3DWL G;  4I2W A;  2KCL A;  4N5Q A;  1K1B A;  1HG2 A;  3Q79 A;  4BX8 A;  2J09 A;  2PL2 A;  4A1S A;  5JHA A;  3QC1 A;  3VLE A;  3ESL A;  3DSS A;  3MKQ A;  4G1T A;  4GZD A;  4GZ6 A;  3MGB A;  2UWJ G;  3J5Q B;  2P2C P;  3CK9 A;  2WXP A;  2X6K A;  5J90 A;  2CHX A;  4QFV A;  4P29 A;  3FUL A;  1H6P A;  3SY2 A;  5EIL A;  4JC8 A;  4AIF A;  4CDN A;  3DST A;  3PUK A;  2EIN E;  5FQ7 A;  3C98 A;  5G04 C;  2CHW A;  3ZUV B;  4GAA A;  1TNU A;  4UQY A;  3QWW A;  4ANW A;  5KNG A;  4OYS A;  2I1K A;  4DPR A;  2ZGG A;  2BTD A;  3LY7 A;  2ZU6 B;  3NOC D;  5FQ8 A;  2KZT A;  3ML9 A;  3ZKJ A;  2FO7 A;  3L82 A;  3ASF A;  1FVH A;  2XEH A;  4ANU A;  3FH7 A;  4BER A;  3G2S A;  4F53 A;  1OWL A;  3E32 A;  3CST A;  4KMO A;  4FAD A;  1FT2 A;  1N4Q A;  3SFY A;  4R7L A;  2FBN A;  1V55 E;  3ML8 A;  3MJW A;  1Z5S C;  2WXN A;  3RO3 A;  5FIN A;  1Y6I A;  3U64 A;  4F7A A;  1BI7 B;  3HXE A;  1OT8 A;  2WXF A;  4GB9 A;  2VSX E;  5A7D B;  5A23 A;  3ZFW A;  3SQV A;  2I9C A;  2QC9 A;  4CT4 A;  3PE3 A;  1H6K A;  2WQH A;  2DVW A;  4WWP A;  3ENE A;  3RRN B;  4GZC A;  2QFC A;  3FEX A;  4GYO A;  4GU5 A;  5E76 A;  1LD8 A;  1E96 B;  3HHM A;  2V8S E;  4BSZ B;  1MZC A;  2YQ8 A;  3HVE A;  5ANR A;  1MJ0 A;  2IFU A;  3R7Q A;  3QOU A;  2DYS E;  4WNG A;  4G8L A;  4BY6 A;  2J9Q A;  1E8X A;  5AYW D;  2R05 A;  3EDT B;  4A63 B;  4AVX A;  3MCX A;  3ZYK A;  1WDY A;  4UWK A;  3ULE G;  2VQ2 A;  5FT9 A;  5DIZ A;  5DBK A;  3ZHE A;  3FUJ A;  4JXT A;  3JYS A;  4LCT A;  2WQ6 A;  4FP7 A;  4DX6 D;  4OVV A;  2Y4T A;  2V5F A;  3PRE A;  2NYJ A;  4U96 D;  3W9F A;  1IHB A;  1ELK A;  2Y1L E;  3FTZ A;  4AP2 A;  4FLH A;  3SD5 A;  4PH4 B;  3UT4 A;  3QB2 A;  4WNF A;  2WXM A;  5EKQ D;  3UIO C;  1IHG A;  5HI7 A;  1JWF A;  3R9M A;  3U9W A;  4HRN A;  3TAX A;  4PS7 A;  4D10 C;  3RO2 A;  3D9L A;  5LX8 A;  3PZ2 A;  4U8V D;  1LD7 A;  4I1M A;  3JUI A;  4HVB A;  3Q78 A;  4HS2 A;  2PQR A;  3ZW3 A;  4XZ4 A;  5G2N A;  1EF1 C;  1N9A A;  2P9P G;  5AQ9 A;  3VTX A;  5KJL A;  3P1U A;  5LCW J;  3ONL A;  2PM6 A;  3DPD A;  2ION A;  2P9L G;  5G04 J;  4HBD A;  3UXG A;  4TXP A;  2WM9 A;  3UUX A;  2LXL A;  2WXJ A;  2A4Z A;  4U8Y D;  3CIA A;  4BEP A;  2E0I A;  3CVN A;  3ZXP A;  2UY1 B;  3OXF A;  3T8K A;  1ZBP A;  1HH8 A;  4LER A;  1WG0 A;  1OCO E;  4ATG A;  1UJJ A;  4L23 A;  1TJF A;  2VTB B;  4J8S A;  2F8X K;  2EIL E;  2L0I A;  1MX2 A;  2VYI A;  1HS6 A;  4W9R A;  4HOR A;  2HE0 A;  5HQ8 A;  3IBE A;  3OXG A;  2B0O E;  3FTV A;  4RG6 A;  5CEA A;  3MV2 B;  4G23 A;  5ITZ F;  1MX4 A;  2BKK B;  3QAR A;  5AAR A;  2VGX B;  1BI8 B;  2I1J A;  2DYR E;  3FTW A;  4TXQ A;  5CHE E;  5JA4 D;  2J4D A;  1K1A A;  4U0Z A;  3MKR A;  4KVM A;  3FUI A;  3S7J A;  4B0Z A;  3GW4 A;  2X6J A;  4RQI A;  4PDX A;  3FU6 A;  1DVP A;  1OY3 D;  1S70 B;  2ZIS A;  2VJ8 A;  4DX7 D;  4GML A;  2NXP A;  4TRQ A;  4UI9 K;  3FWV A;  2AVP A;  3IV0 A;  4HLL A;  1JCS A;  1QBQ A;  4JB8 P;  2WB2 A;  3UM0 A;  3FH5 A;  4FJZ A;  3PZ1 A;  1TNY A;  1XNF A;  5T3R A;  4G24 A;  4Q94 A;  5CRU A;  4KVO A;  4U0U A;  4G2V A;  4YVQ C;  4JD2 G;  3QJZ A;  2FF4 A;  2RFM A;  1O1R A;  3RU0 A;  4DI4 A;  4JHR A;  4GZ3 A;  4EBA A;  2BKG A;  3FP3 A;  4N2S A;  4B8C B;  2WXG A;  3AS8 A;  2GRP B;  5CRV A;  3DRA A;  1KLX A;  4U95 D;  4GTO A;  4GA2 A;  2EIJ E;  4GYW A;  5KJN A;  4F3V A;  2FUL A;  5BXO A;  2IY0 C;  3Q47 B;  1EPU A;  3Q15 A;  5EID A;  4N3A A;  3DXK G;  3PZ4 A;  4GCO A;  3CHP A;  4RG9 A;  4A3T A;  4ATZ D;  5B3S E;  4AJW A;  3UTM A;  4U63 A;  4ANX A;  3NQP A;  2H6H A;  4JVS A;  2WXR A;  2XHE A;  3SNX A;  2XGO A;  2WPV A;  4TXR A;  1E90 A;  2XEV A;  3GZ1 A;  3D9J A;  1KT1 A;  1YYH A;  3RRU A;  3UT7 A;  5FJY A;  3UPV A;  1TNB A;  1DCE A;  4K5A B;  2OOE A;  3TWW A;  4JA9 A;  3ABK E;  2L9B A;  3ESK A;  5CER B;  3KSL A;  3TWV A;  3EU5 A;  2OEV A;  4C0M A;  5D2M C;  3D3M A;  3CHQ A;  3Q75 A;  4J8E A;  3ABM E;  4DLQ A;  4L1B A;  3CLJ A;  4BET A;  4ZHB A;  1N54 A;  1U2V G;  2F8Y A;  4JEU A;  3CVV A;  3U4T A;  4X8Q A;  3LKU A;  3APD A;  4DX2 A;  2C0L A;  5HKP A;  3T5X A;  3VLD A;  3QDN A;  3SI5 A;  3TWS A;  3LYA A;  3ULQ A;  3IEG A;  4EZL A;  4GTP A;  3ISM C;  2MRI A;  2PM7 A;  4BT9 A;  2R17 C;  3CR3 A;  3TXN A;  3Q7A A;  3CVU A;  2P9I G;  4TUU A;  1GW6 A;  3B7S A;  3S2A A;  5D0O D;  1TR4 A;  5ENO D;  3CVQ A;  3KSQ A;  4H7X A;  3DBS A;  3TXM A;  2A5E A;  1TNZ A;  3SZ7 A;  2XGS A;  1VDY A;  5LOZ A;  1DCQ A;  1ZU2 A;  3CVL A;  3T8M A;  3FTS A;  1SQM A;  3CV0 A;  5CBN A;  1K3Z D;  3FHE A;  3OXL A;  4I2Z A;  1UN9 A;  1SZA A;  3I4R B;  4AXH A;  3VTY A;  3IXE A;  3HXC A;  3PNT B;  4FUL A;  4TUM A;  4UWH A;  2NSZ A;  3SBS A;  2KC7 A;  4J7W A;  3G2V A;  5LCW C;  1SVX A;  3NF1 A;  4XX5 A;  1IYG A;  3ASH A;  3TWX A;  4FU3 A;  2WXH A;  3DPY A;  1Y8M A;  4KZ0 A;  1QNF A;  3AJI A;  2R5S A;  2Y3A A;  4ACK A;  4WWN A;  2RG8 A;  4ME2 A;  5FZS A;  4F1P A;  3ZGQ A;  2V4L A;  4E85 A;  3KEA A;  5ENP D;  2BF0 X;  3B7U X;  3DXM G;  4MLP A;  2GW1 A;  4FHK A;  3N71 A;  5CMY A;  4B89 A;  2LAH A;  2RKK A;  2VSO E;  2CG3 A;  2JEK A;  3UKU G;  3LXU X;  4Y6W A;  3C3O A;  1PY1 A;  4I17 A;  3ZYQ A;  3CK8 A;  5CCM A;  3CHR A;  2XS8 A;  2GRQ B;  3ASD A;  3SHF A;  5H7P A;  3NZS A;  2QYJ A;  4HI8 A;  4GZ5 A;  3EUV A;  3LJN A;  2DWZ A;  2WQ7 A;  3QAQ A;  4J8F A;  2V4H C;  2XEE A;  3TGO A;  5FTP A;  2DCP A;  3LPZ A;  5FZQ A;  2C2L A;  2X6H A;  1EYH A;  4UI9 C;  3UIN C;  2J8S D;  1KT0 A;  1TNO A;  2I6H A;  3L16 A;  1P5Q A;  2LO6 A;  1OXJ A;  5BW8 C;  4LG6 A;  1S64 A;  2CFZ A;  4APO A;  4V3I A;  1HF8 A;  1HE8 A;  3TL5 A;  4J8D A;  3D9M A;  2RD0 A;  4J6I A;  2XCC A;  4NRH B;  2ETC A;  4B8A A;  3PE4 A;  4XKC A;  1Q2Z A;  3URZ A;  5BV0 A;  2QZA A;  3R9A B;  4LEU A;  5KJK A;  3OAW A;  1NL4 A;  2L6B A;  3F6Q A;  1WAO 1;  3HDX A;  2Y69 E;  2VGY A;  2MHK A;  2YHE A;  4NQ0 A;  3LDZ A;  4DX5 D;  1JWG A;  4HLE A;  1V54 E;  2EIM E;  1X81 A;  3D9K A;  5T4Y A;  3OTN A;  1RW2 A;  4AEZ C;  4C9B B;  2L6J A;  2JLB A;  5AIJ A;  4J8Y A;  3E30 A;  4AY6 A;  3ZYL A;  4K5C A;  5CED B;  5AAO A;  2C0M A;  4BWR A;  5CEC B;  3ZVV A;  2PZI A;  5BT1 A;  5LP0 A;  3UMV A;  1H0A A;  2XCB A;  2XPI A;  3IHY A;  4ACL A;  5CBO A;  3RIB A;  3KD7 A;  2UY1 A;  1Z3Y A;  4I6J A;  1FPP A;  4A55 A;  4EQF A;  2X38 A;  3D9I A;  4I1O B;  2AW6 A;  4NIK A;  4IRU A;  2ZXW E;  3HXF A;  3I5P A;  4GTQ A;  4DUI A;  2GRL A;  4FHJ A;  2X3M A;  4EPZ A;  4JHJ A;  3ZEF A;  2VTB A;  4YDW A;  5G05 J;  1QQE A;  2WXK A;  1JCQ A;  1JPL A;  4C48 B;  2F0Y A;  2WMN A;  3RAU A;  1OCR E;  3X2Q E;  3T9K A;  5ENR D;  4KXK B;  5AJD A;  1OCC E;  2XRY A;  2WXL A;  3CVW A;  1UJK A;  4Q96 A;  1BU9 A;  2VGX A;  3AG4 E;  4GTS A;  3QNK A;  3G2T A;  3PVL A;  3MYV A;  1DC2 A;  3IKO B;  4LUN U;  4I1A A;  3D9H A;  3ZNG A;  4EBA G;  1IQR A;  4N39 A;  3S7B A;  4BTA A;  3DEO A;  1DNP A;  3E33 A;  4GTT A;  2HO1 A;  4M7C A;  1MX6 A;  2ZIR A;  5KCM A;  3I3N A;  2H6G A;  4HOT A;  3TJP A;  3APC A;  5EYL A;  3Q73 A;  3CHM A;  2LUH A;  3LY9 A;  3V31 A;  4WAF A;  1H2V C;  3C72 A;  1BLX B;  4UUC A;  2FO1 E;  3FUK A;  3DSX A;  2HR2 A;  3PEV B;  2XPY A;  4HNA D;  2B6C A;  4CT0 A;  3BUA A;  2CHZ A;  1E8Z A;  3SFX A;  4IN3 B;  3KAE A;  3QKY A;  4EZJ A;  2IQC A;  2YNQ A;  3FUD A;  2E2E A;  5EN5 D;  4CEM A;  4UI9 J;  1H19 A;  3ASO E;  4AY5 A;  1L5J A;  4XIF A;  3CEQ A;  2CFU A;  4GYY A;  3KEZ A;  3PZD A;  5A6C A;  5AQ7 A;  2OND A;  1AP7 A;  3PUJ A;  4XI0 A;  1NZN A;  4K0R A;  4GA0 A;  3APF A;  1A17 A;  3BQO A;  3C5R A;  3CKB A;  5ENS D;  3I4G A;  4CDR A;  3CKC A;  2DZN A;  2XPZ A;  3HIZ A;  3S7D A;  3E34 A;  4XEI G;  1SA5 A;  4L7T A;  3RJV A;  5JJT A;  2LXM A;  4KYO B;  2OEW A;  3HG0 D;  2AXZ A;  2P58 C;  3D9O A;  5D0Q D;  1JUQ A;  2H6F A;  3ZN3 A;  4WWO A;  2KXP C;  1D8D A;  4I6G A;  4HQD A;  5ARF A;  5BNW A;  1K8K G;  3VLF A;  2LSU A;  3L6A A;  3PS6 A;  3SBT B;  4JHK A;  3D9P A;  3FU3 A;  4HB5 A;  3SGH A;  4DK5 A;  2IJG X;  5JJ7 A;  3L13 A;  3ASN E;  4L2L A;  3BEE A;  2HYZ A;  4RLY A;  5CMW A;  1N0R A;  4LRZ A;  1Z3X A;  1BD8 A;  4N3B A;  4U04 A;  3V30 A;  2F37 A;  2Y4U A;  2P9K G;  2MOW A;  2R2L A;  4IUL A;  5AQA A;  3J5P A;  4LNB A;  4ILH B;  4URK A;  3PZ3 A;  4AOF A;  3ZYM A;  3FUF A;  3FUH A;  2XEN A;  3WG7 E;  1S0P A;  3C3R A;  3L22 A;  4YDY A;  4CGW A;  1NP7 A;  2IOL A;  4G8K A;  3GZ2 A;  1HG5 A;  3LJ3 A;  3MX3 A;  4LSZ E;  3EHM A;  4CDM A;  1HZ4 A;  1SW6 A;  4BTB A;  4QQI A;  3E37 A;  3L08 A;  1ZB1 A;  2CG2 A;  3AS5 A;  4HOQ A;  5D66 A;  2KBX A;  4E6H A;  4FA6 A;  3MV3 B;  3RSE G;  5FIO A;  3TWT A;  4U07 A;  5E75 A;  4JPS A;  4DX1 A;  3L17 A;  4DJA A;  1O5M A;  2I2O A;  4G25 A;  5KNH D;  5EIB E;  4TV3 A;  1H2U A;  4GA1 A;  1N95 A;  3MA5 A;  4JZY A;  3FU0 A;  5C2Y A;  3NOG D;  1IQU A;  1JCR A;  3FY4 A;  4GTV A;  3UIP C;  5LFA A;  3Q4A B;  4EZK A;  1TJC A;  1UG3 A;  3LY8 A;  1TYQ G;  2IEJ A;  2IO2 C;  3NAW A;  3EHN A;  4JW1 A;  4Q69 A;  4WNE A;  2R59 A;  5EX0 A;  4YND A;  5G05 C;  1MHQ A;  2GRN B;  3LVR E;  4F1S A;  1UOH A;  2P9N G;  5FQ6 A;  3FFL A;  5AQB A;  1N94 A;  3EJN A;  4BES A;  5B1A E;  3PDN A;  4GMR A;  1HU3 A;  4Y6C A;  3MEK A;  5ENQ D;  4B94 A;  3GYZ A;  3U3W A;  3PNL B;  1IKN D;  4I6E A;  2J4B A;  3QK0 A;  2OVF A;  1U3D A;  3G2W A;  4LNU D;  1E8W A;  2IO3 C;  2XQ0 A;  2KAT A;  4I9C A;  2KCV A;  3AAA C;  4XE0 A;  3NB2 A;  2WMO A;  4N2Q A;  2H6I A;  3JXI A;  3V2X A;  2OCC E;  4UWF A;  3B13 A;  4PS8 A;  3MKQ B;  1E8Y A;  1W3B A;  4ANV A;  1H2T C;  1IXV A;  3ONK A;  3AU5 A;  3MZL B;  1AWC B;  2GRO B;  4A3V A;  2LSV A;  4N5C A;  4ABN A;  1G3N B;  4WUY A;  3ZRH A;  4AM9 A;  3V79 K;  2ZGD A;  4OAU C;  3DSW A;  3ASG A;  1NFI E;  5EX3 A;  1NA0 A;  3AG2 E;  3RKV A;  3HXB A;  4JA7 A;  1OUV A;  3DSV A;  4BX9 A;  4OVU A;  3TG4 A;  4CCA A;  1YMP A;  5EYP F;  2M63 A;  4BSX A;  4G26 A;  3UT8 A;  2A5U A;  4UQX A;  3JQ0 A;  4CZ2 D;  5T8I A;  2GRR B;  3FUE A;  4IYP A;  1HX8 A;  1KZP A;  2LNI A;  3ULY A;  3B7R L;  2KZT B;  3TG5 A;  5EDS A;  1XGW A;  3TWU A;  4EEC A;  4GCN A;  1N4R A;  4CGV A;  3UKR G;  2PNN A;  5ARG A;  2P9U G;  4UWL A;  3R7R A;  1HXI A;  4ILI A;  1B89 A;  5JJ6 A;  3O48 A;  3LS8 A;  4JEH A;  3RRM B;  2VSN A;  1OWM A;  2J08 A;  3ZXS A;  2L0T B;  3ABL E;  3AS4 A;  3BU8 A;  3P2B A;  2IF4 A;  3FTX A;  4HFG A;  5BV1 A;  1UN8 A;  1QYM A;  1MYO A;  3E4B A;  4OAV B;  2IOS A;  2FI7 A;  2AWI A;  2QYU A;  3Q9N C;  4L2Y A;  2AJA A;  3PRZ A;  5BXU A;  5JHB A;  2EQX A;  5BUZ A;  3EHR A;  4KT6 B;  3FU5 A;  1N52 A;  4GPM A;  3CK7 A;  1INZ A;  3FDH A;  3HVE B;  4U8H A;  4GTM A;  4YDE A;  1D8E A;  2JAB A;  2X6I A;  1N4S A;  4UWG A;  1QZ2 A;  1BPO A;  5B1B E;  4CYM D;  4HI9 A;  2QY7 A;  1TN8 A;  5HRY A;  2V0P A;  3D9N A;  3ZHE B;  5HS0 A;  2GGF A;  4RSY A;  3UM1 A;  4GMJ A;  1FVF A;  1O1S A;  2XGM A;  5FQ4 A;  1U3C A;  2XZT G;  4KZC A;  3EHQ A;  1PAQ A;  2XRZ A;  5AJL A;  3IHV A;  2J49 A;  3QWP A;  2ETA A;  1O1T A;  3L9T A;  3LEW A;  4GTR A;  4MKT A;  2X6F A;  4K5B A;  2AXV A;  3CVP A;  3W9G A;  5JMN D;  2FEZ A;  3O4Z A;  4C0E A;  1Z6T A;  3JXJ A;  4O6F A;  4PUC A;  2P9S G;  3CGH A;  3CSF A;  1TN6 A;  1KPS B;  2VGE A;  2XS1 A;  3HYM B;  1HFA A;  4WND A;  4U0S A;  4O1O A;  2IU1 A;  3BG0 B;  3CVY A;  3Q49 B;  5C1D A;  2YIN A;  2Y0B G;  2BED A;  2RFA A;  3B95 A;  1OWO A;  4FC8 A;  4ZFH A;  2V5Q C;  4BT8 A;  2MYO A;  1MQS A;  2YHC A;  3FH8 A;  2OVB A;  1E7V A;  3V2O A;  1E7U A;  4NAC A;  4A1G A;  2HM8 A;  1N0Q A;  4APF A;  4BFR A;  5J08 A;  3RK6 A;  4O60 A;  4FLB A;  3CHO A;  3FUM A;  3FTY A;  1NA3 A;  2NC9 A;  4U7E B;  4KBQ A;  3HRA A;  3JUE A;  1SZ9 A;  2XZD G;  2J07 A;  1OCZ E;  1TN7 A;  4MBG A;  5AEN A;  4M3O A;  4DRX E;  3B7B A;  2LAI A;  4LNG A;  3CVX A;  1NI1 A;  3CQC B;  3PH0 C;  3HXD A;  3JCK C; 
#chains in the Genus database with same CATH homology
 1MX6 A;  4QFV A;  1YYH A;  3W9G A;  3JXI A;  5JMN D;  3V2X A;  4J8Y A;  4Z68 A;  5FIO A;  2DZO A;  3TWT A;  2DVW A;  3JXJ A;  2KXP C;  5KBA A;  4DX1 A;  2QYJ A;  4K5C A;  5CED B;  5EYL A;  4K5A B;  5EIL A;  5AAO A;  5CBN A;  4HQD A;  4HI8 A;  1K3Z D;  1OY3 D;  3TWW A;  3V31 A;  1S70 B;  5CEC B;  3LJN A;  4DX7 D;  5CER B;  1IXV A;  2VGE A;  5KNH D;  2DWZ A;  5AQ9 A;  4BSZ B;  5EIB E;  1BLX B;  4UUC A;  2FO1 E;  3TWV A;  2V4H C;  2XEE A;  4HLL A;  3ZUV B;  1MJ0 A;  5ENT D;  1QYM A;  1MYO A;  1AWC B;  4OAV B;  4O1O A;  4JB8 P;  5CBO A;  3DEP A;  4HB5 A;  3IXE A;  5AN8 A;  4HNA D;  4TUM A;  2Y0B G;  1G3N B;  2J8S D;  3NOG D;  4G8L A;  3Q9N C;  5KNG A;  2AJA A;  1N11 A;  4BET A;  3SO8 A;  2RFA A;  4HRL A;  3V79 K;  4A63 B;  4J7W A;  5BXU A;  3B95 A;  4ZHB A;  4LG6 A;  2ZGG A;  2F8Y A;  2ZGD A;  4RLY A;  1SVX A;  4OAU C;  4ZFH A;  2V5Q C;  3EHR A;  4HBD A;  4NIK A;  1NFI E;  3UXG A;  2MYO A;  2ETB A;  1WDY A;  4GPM A;  4F6R D;  1N0R A;  4DUI A;  4K5B A;  2RFM A;  5EN5 D;  3UI2 A;  3NOC D;  4U8Y D;  3TWR A;  4BEP A;  1BD8 A;  3V2O A;  3TWX A;  3Q9U C;  4DX2 A;  2BKG A;  3TWQ A;  4DX6 D;  5HKP A;  4YDW A;  3V30 A;  2F37 A;  3ZKJ A;  1YMP A;  5EYP F;  4C48 B;  2JAB A;  3AJI A;  2ETC A;  2NYJ A;  4HRM B;  4U96 D;  5AQA A;  3T8K A;  5KWD A;  4O1P A;  3W9F A;  3J5P A;  3TWS A;  4U95 D;  1N0Q A;  3EU9 A;  5AQ7 A;  4CYM D;  1IHB A;  4HI9 A;  1AP7 A;  2XEH A;  2Y1L E;  5HRY A;  3T9K A;  5ENR D;  1UOH A;  4O60 A;  4BER A;  4F1P A;  1A5E A;  4CZ2 D;  1WG0 A;  5AQB A;  5BXO A;  5HS0 A;  1BU9 A;  2XEN A;  3KEA A;  4BES A;  5EID A;  4B93 B;  5ENP D;  2L6B A;  4GMR A;  4YDY A;  3HRA A;  2F8X K;  3C5R A;  3F6Q A;  3JUE A;  1D9S A;  1YCS B;  1DC2 A;  2XZD G;  4ATZ D;  5ENS D;  3TWU A;  1MX2 A;  2HE0 A;  5ENQ D;  3UTM A;  1TR4 A;  3D9H A;  4N5Q A;  5ENO D;  1K1B A;  2B0O E;  2DZN A;  1IKN D;  5FIN A;  3ZNG A;  4G8K A;  2XZT G;  5CEA A;  3EHQ A;  4LSZ E;  1BI7 B;  2A5E A;  2PNN A;  4DX5 D;  3NBN B;  1OT8 A;  4DRX E;  1MX4 A;  1SW6 A;  2BKK B;  3B7B A;  5ITZ F;  5AAR A;  3ZU7 B;  3DEO A;  1BI8 B;  2ETA A;  4LNU D;  4QQI A;  4HRN A;  5JA4 D;  1K1A A;  3J5Q B;  2P2C P;  5D66 A;  3AAA C;  2QC9 A;  2KBX A;  4U8V D;  1DCQ A;  3HG0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...