2P2CP

Inhibition of caspase-2 by a designed ankyrin repeat protein (darpin)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
HHGSDLGKKLLEAARAGQDDEVRILMANGADVNATDWLGHTPLHLAAKTGHLEIVEVLLKYGADVNAWDNYGATPLHLAADNGHLEIVEVLLKHGADVNAKDYEGFTPLHLAAYDGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-2
publication title Inhibition of Caspase-2 by a Designed Ankyrin Repeat Protein: Specificity, Structure, and Inhibition Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 158
sequence length 158
chains with identical sequence Q, R, S, T, U
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2p2cP00
3EHQA 2RFAA 3JUEA 1YMPA 3ZKJA 3V79K 2Y1LE 1MX6A 4UUCA 2F8YA 5CERB 4HB5A 3EHRA 5EYLA 4J7WA 5AQAA 4OAVB 3SO8A 3HRAA 5CBNA 2XEHA 4CZ2D 1S70B 5KNGA 2F37A 2A5EA 2F8XK 3B95A 1NFIE 2JABA 2BKGA 4HNAD 5AQ9A 4F6RD 4QQIA 5KWDA 1WG0A 2V5QC 3TWRA 2QYJA 1MX4A 1TR4A 4Z68A 5EN5D 5AARA 3TWVA 3V30A 3V2XA 2DVWA 5EILA 4HRMB 2ZGGA 3UI2A 5EIDA 3TWWA 4CYMD 2VGEA 3Q9NC 4A63B 3AJIA 4O1PA 3T8KA 5HS0A 1BI7B 1AWCB 4BETA 1WDYA 3TWXA 1K1BA 1N0RA 2BKKB 5CEDB 4B93B 5AQ7A 4LSZE 3HG0D 1BD8A 1G3NB 1YYHA 2ETCA 3F6QA 4HI8A 3C5RA 3J5QB 4K5AB 3UTMA 2AJAA 3V2OA 2Y0BG 4DUIA 1BU9A 2J8SD 4O1OA 3NBNB 3IXEA 2DZNA 4BEPA 3B7BA 4U8YD 2ETAA 4K5CA 3AAAC 3TWTA 2RFMA 3W9GA 2PNNA 1D9SA 3TWSA 2NYJA 1BLXB 4ZHBA 1YCSB 4BERA 1UOHA 3TWQA 3V31A 4OAUC 1SVXA 5ENOD 4NIKA 4HI9A 5CECB 5ENTD 4HRLA 1SW6A 3UXGA 4LNUD 3LJNA 5KBAA 5FIOA 5JA4D 1K1AA 1N11A 2MYOA 5AQBA 3J5PA 2FO1E 4K5BA 3ZUVB 5FINA 3T9KA 2L6BA 4ZFHA 5KNHD 1BI8B 2XEEA 3DEPA 5ENQD 4HBDA 1MJ0A 1DC2A 5EIBE 4U95D 5BXUA 2XZDG 4J8YA 4TUMA 1MX2A 4C48B 2XZTG 2KBXA 4G8KA 5ENRD 1MYOA 2ZGDA 4GMRA 1IHBA 4GPMA 3TWUA 4HRNA 1IKND 3KEAA 1IXVA 3EU9A 5HKPA 2V4HC 5CBOA 3JXIA 4RLYA 2DZOA 5ENSD 5CEAA 1DCQA 5ITZF 1K3ZD 5AAOA 2B0OE 4DX6D 1A5EA 4DRXE 3NOGD 1OT8A 2P2CP 4U8VD 4YDWA 4DX2A 4N5QA 2QC9A 3DEOA 3ZNGA 4HQDA 1OY3D 5HRYA 1AP7A 4BSZB 5D66A 4O60A 4QFVA 4JB8P 5BXOA 2KXPC 4G8LA 4DX1A 3Q9UC 4HLLA 2HE0A 3ZU7B 4DX7D 2XENA 3JXJA 4U96D 4LG6A 3NOCD 4F1PA 1N0QA 2DWZA 3D9HA 1QYMA 2ETBA 3W9FA 4YDYA 4ATZD 5JMND 5AN8A 4DX5D 5EYPF 5ENPD 4BESA
chains in the Genus database with same CATH superfamily
1YMPA 3ZXSA 5A7DB 2OCCE 2I6HA 2UY1A 3IKOB 3QKYA 5G05J 3ASOE 3B7TA 2WXQA 4F7AA 5AQ9A 5B3SE 2GW1A 5AARA 2DVWA 4L1BA 5BUZA 2OEWA 3APCA 1WDYA 4XI0A 2VJ8A 5JHBA 4B0ZA 1TEZA 4K5AB 3R7QA 4I6EA 2Y0BG 1O1RA 3PZ3A 4UWGA 4LNGA 4FU3A 1BLXB 3MYVA 4U07A 3TWQA 2VTBA 3BG0B 3LDZA 4WNEA 1K8KG 2E0IA 2CFZA 2GRRB 2IU1A 2DIWA 4A3VA 2XZDG 3NB2A 3TWUA 3IHVA 1IXVA 1JCSA 3EU9A 3ZW3A 3QK0A 4YNDA 1PY1A 1P5QA 3DPDA 4N5QA 1ELWA 1OY3D 4CDNA 4JB8P 1LTXA 3U9WA 3FTVA 4GYWA 1UW4B 2P9PG 3UT7A 3PUKA 4DLQA 3RKVA 5CRUA 4TRQA 1E8WA 3EHRA 4GAAA 3EUVA 2AXZA 3BU8A 3LYAA 5BT1A 2F37A 2A5EA 2XPYA 3ZRHA 2I9CA 1BPOA 5JJ6A 5ANRA 2VSYA 3PEVB 4J8DA 4AV7A 2DCPA 1OCOE 3TWXA 1HH8A 4WWPA 2WM9A 2IY0C 3HG0D 1YYHA 3ASGA 3ZVVA 2Q7FA 4URKA 4I2ZA 2YNQA 3QB2A 4BEPA 4CGVA 3SFXA 4CEMA 4M3OA 4LNUD 3CSFA 2KM4A 1TJCA 3ZUVB 5KNHD 1MHQA 3SHFA 2YQ8A 1UN9A 1N4RA 4G26A 1MYOA 4A1SA 1N52A 2LUHA 4H7YA 5FZSA 4FJYA 4I6GA 5ENNA 4KT6B 2B0OE 3PEUB 2RG8A 5EDSA 3FUEA 3G2SA 1OT8A 4GMJA 3CV0A 3SFYA 3TL5A 3ZNGA 1OCZE 3FTWA 3UT8A 2V8SE 4AP2A 3CVWA 2X6HA 3W9FA 5EX3A 1JWGA 4ACKA 1MX6A 4I1OB 3APDA 3HXCA 1ZU2A 4OAVB 2QY7A 1E8XA 2H6FA 2KCVA 4GZ3A 3B95A 4FC8A 4KVMA 3ZIMA 2XHEA 3TWRA 4TXQA 5EN5D 3SQVA 4E6HA 3AJIA 2LAIA 3FUFA 3DPYA 1BI7B 2PQNA 5LP0A 3F6QA 3D9JA 2B6CA 2WXKA 4E85A 3MA5A 1O5MA 3ENEA 4N39A 4YVOA 1FPPA 2CFUA 3CVLA 4GCNA 4HOQA 2WQ6A 2YHCA 4JEHA 5ENTD 3OXGA 1SA5A 1N4PA 5FINA 2BEDA 3ULQA 2J4DA 4HFGA 1IHGA 4U8HA 3D9OA 2R59A 4JD2G 4GPMA 2X38A 3MX3A 3RRNB 3ZFWA 1KZOA 1HF8A 1YA0A 3FULA 3LEWA 4PS7A 3LY8A 4AJWA 2IQCA 2DYSE 3MEKA 4DRXE 2XGOA 4YDWA 4Q69A 1OWPA 3DEOA 5HRYA 3AG4E 3LKUA 2WB2A 3FWVA 3CGHA 1VDYA 3JXJA 2I2OA 4F1SA 1N0QA 3CK9A 3QWPA 5J08A 5G04J 2V4LA 1LF8A 3ZKJA 4KZ0A 4UUCA 4ABNA 5CERB 4HB5A 3HRAA 4K03A 3RAUA 2X6KA 2CG2A 1HS6A 2CHWA 3CVVA 3EJNA 1N4QA 3UQ3A 2VGXB 4UQZA 2DYRE 2HO1A 2ZIRA 5D0OD 5D2MC 3V30A 3AS8A 1NP7A 1FCHA 3FTXA 2BTDA 3TWWA 3FTUA 5FJYA 3ULEG 3E32A 3T8KA 2XQ0A 4AY6A 1AWCB 4TV3A 4RG6A 3E33A 2GRQB 4YVQC 3KAEA 2MOWA 4HI8A 3S7JA 3PNTB 3CVYA 2J8SD 1Y8MA 4I17A 2NYJA 2GROB 1YCSB 4A3TA 2LXMA 1NZNA 5AYWD 1IQUA 4KYOB 1DCEA 1BI8B 2VQ2A 3CLJA 4GZDA 2R2LA 4FADA 3CEQA 3FUDA 1IHBA 3BUAA 4I6JA 4C0EA 3LJ3A 3L54A 3CVQA 4APOA 4KMOA 4JHJA 2XCCA 5IY5E 1HXIA 3D9NA 2NXPA 5H7PA 4H7XA 4ATGA 3GZSA 5D66A 3O48A 1Y6IA 2QFCA 4MS6A 4YDYA 4ATZD 5JMND 5T8IA 2YINA 3EHQA 3ISMC 4JW1A 1S0PA 3ZPJA 5HQ8A 2RKKA 2Y4TA 3FTYA 3SO8A 2XGMA 5KNGA 3DSXA 2JABA 4QQIA 4OVUA 4G1TA 4IYPA 4M7CA 3MCXA 3HVEB 1TN7A 4L2LA 2WXJA 4CCAA 5M72A 2YHEA 3S2AA 3Q5MA 3FUNA 5LOZA 2XEVA 1EPUA 3B7BA 2XPIA 3K9IA 3FUIA 1N9AA 4MBGA 3E30A 3V31A 1TNZA 2NC9A 2P9IG 5ENOD 3JCKC 3SGHA 3ASDA 5FIOA 4DPRA 4C9BB 3ZYLA 1HX8A 1N94A 2IOLA 2P9LG 3T5VA 3FTSA 2ZISA 3PNLB 3HXEA 2ZGDA 4GA2A 3E34A 4W9RA 1KPSB 3CHSA 4EZJA 4RLYA 1TJFA 2WXGA 1FVFA 2XS8A 2R02A 2XCBA 4L9PA 4DI3A 3LXUX 4N3CA 2KXPC 3G2UA 4YDEA 3ZU7B 2QYUA 4V3IA 4BY6A 2XS1A 3FHEA 3PZ4A 5FQ6A 4X8QA 3B7RL 3D9MA 1OWNA 1OWMA 3T5XA 4L7TA 3CIAA 3APFA 4OVVA 3G2VA 1DVPA 1N4SA 5EILA 3CQGB 3UI2A 2VGYA 3HXDA 5CEDB 1NA0A 3PREA 1BD8A 2I1JA 3FUKA 1UJKA 2PL2A 3J5QB 5G05C 1O1SA 2KZTB 3U66A 4O1OA 2I1KA 4FP7A 4ZHBA 4YDOA 4OAUC 4HI9A 4GYYA 3ZHEB 3DEPA 2BUGA 1L5JA 4HVBA 2WXNA 3T8MA 3Q4AB 3UMVA 3AG3E 1IYGA 3HXFA 3UKUG 5J90A 2XGSA 1UG3A 4A55A 4ILIA 4U8VD 2QC9A 2RD0A 3CQCB 4LCTA 4RG9A 2PQRA 1X5BA 3UUXA 2P9KG 3AS4A 2DWZA 3UX4A 4DI4A 5ARFA 5ENPD 1Z3XA 3Q49B 3QARA 5KCMA 4F3VA 3SBSA 1E7VA 2IOSA 3QWWA 3NQPA 5KJLA 4BT9A 2EIJE 2AXUA 5A23A 3ULYA 2A4ZA 3I4GA 4GA0A 2BF0X 3V2XA 2VGXA 2WXRA 2C0LA 1QZ2A 4LSZE 2CG3A 3AS5A 2IEJA 5KJKA 2Y4UA 3RO3A 1TNOA 3IXEA 1PC2A 3SY2A 3GW4A 3TWSA 4GA1A 3TXMA 3Q15A 4BERA 4PH4B 2EQXA 3EHMA 3ABKE 4NIKA 3PDNA 4PS3A 1K1AA 3LCAA 3PZ2A 3LS8A 2M63A 3L9TA 3Q7FA 1INZA 1SZ9A 3L08A 3UIOC 3KEAA 3Q78A 3DXMG 3KSQA 1TNBA 1B89A 1TNYA 3PRZA 3CSTA 1H19A 4NURA 4ANWA 1W3BA 2EIME 2FULA 1Z3YA 1QYMA 3IBEA 3UM0A 1EDUA 3C3OA 3E4BA 3C3QA 1S64A 2KATA 4J7WA 5LCWJ 3ONKA 1S70B 3FTZA 5FQ4A 4CDMA 2J49A 3DSWA 4N5CA 2P9NG 3P1UA 4U0UA 5A6CA 2A5UA 3HVEA 4O1PA 5HS0A 4Y6WA 3ASHA 3VLDA 1RW2A 2LO6A 3R9MA 3AG1E 3TG4A 2MRIA 3UM1A 3VLEA 3UTMA 1HG2A 3PS6A 2C2LA 4ILHB 3NBNB 1XGWA 2DZNA 4U8YD 3W9GA 3E37A 5AJDA 1SW6A 3B13A 1JUQA 2JEKA 4EZLA 2LXLA 1OCRE 4UWLA 3DSUA 4WWNA 2R17C 1QBQA 1Z6TA 3QDNA 1JWFA 4AEZC 3C72A 2WVIA 3BQOA 5ITZF 1JCRA 4AM9A 5EX0A 3L17A 5BV0A 2H6GA 3ML8A 4J6IA 3TG5A 4BSZB 3FFLA 5CMWA 5BPPA 5D0QD 2HE0A 1V55E 1OUVA 4JC8A 3RJVA 4U96D 3NZSA 4LG6A 3NOCD 1IQRA 3PUJA 4XIFA 1SQMA 3CVXA 5AN8A 4DX5D 3LVRE 3L6AA 3V79K 4A1GA 3UKRG 5JHAA 5ARGA 4EBAA 4B94A 4JL0A 4GZ5A 2J9QA 5CBNA 4G24A 5C1DA 2KCLA 5LFAA 4HNAD 4GTSA 1LD7A 3OXLA 3SD5A 4XZ4A 3CK7A 2ZGGA 5G04C 4BFRA 4XKBA 2WXHA 3HHMA 5CMYA 5G55A 2MHKA 4I1AA 1KZPA 4WWOA 2BKKB 4GZCA 2XRZA 4GTVA 4OYSA 2EIKE 3Q7AA 5FZRA 3QJZA 1BU9A 2RFMA 2KZTA 4UQYA 4CRWA 1UOHA 3ABME 3LJNA 5AQBA 4BTBA 2MYOA 5CRVA 1H6OA 4K5BA 4ZFHA 1JCQA 2VSXE 3ZHEA 2FF4A 4DLOA 2LNIA 3QWVA 2J09A 4UI9K 2E2EA 3FU0A 5ENSD 2CHXA 3FH7A 1A17A 1WAO1 2ZU6B 2AWIA 3RK6A 3VTXA 2CHZA 3PZDA 2Y69E 5AENA 3KEZA 5BXOA 5HI7A 4DX7D 3FDHA 4O6FA 2VSNA 3ZYQA 4F1PA 3JQ0A 4JHRA 3BG1B 3QOUA 5EYPF 5FTPA 4N3BA 3MKRA 4GCOA 5DBKA 3GZ2A 2L6JA 4EBAG 4UI9J 4HLEA 2F8XK 4CDRA 3S7DA 4BTAA 4J0UA 1WG0A 2FO7A 3P2BA 2J08A 4LNBA 4HOTA 2VGEA 3PE3A 3TGOA 1K1BA 3U64A 4IRUA 4BX9A 1HE8A 4RSYA 3AU4A 4CT4A 3ASFA 2ZXWE 3SFZA 3OAWA 3TWTA 4K5CA 4XI9A 3I3NA 3IEGA 5CECB 1LD8A 3FUMA 5JA4D 3J5PA 5CHEE 2IONA 1SZAA 2XPZA 3ONLA 3FU5A 5ENRD 4HRNA 4PDXA 4GB9A 5T4YA 2DZOA 2WXOA 3Q75A 3ZN3A 3D9PA 2FEZA 1HU3A 3FY4A 2GRPB 3SBTB 4O60A 2H6HA 3HXBA 4GYOA 1GW6A 3Q9UC 4Q94A 1V54E 4GU5A 3RRMB 3TAXA 3VTYA 4I1MA 3L82A 3G2WA 1SA4A 2L9BA 5ANLA 5C2YA 4JA9A 4I9EA 3CHOA 3FU6A 4GTMA 1MX4A 3G2TA 5G2NA 2LAHA 1HO8A 3FP3A 3LPZA 1FVHA 1H2TC 3FUJA 3ASNE 1TN6A 5E75A 1N0RA 5FZQA 4B93B 2QZAA 3EIJA 3KS2A 2ETAA 2PNNA 1SVXA 3UXGA 2OVBA 5T3RA 1N11A 5CCMA 2WXPA 3S7BA 1MJ0A 1E8YA 4B89A 4J8YA 4TUMA 2X6IA 3DSTA 2NSZA 5BV1A 2PM7A 3UM3A 2OOEA 3R9AB 2IJGX 4DX6D 4AIFA 3CHMA 4LUNU 4ANXA 4RVBA 2IO3C 4XE0A 3NZUA 4J8SA 3X2QE 2FI7A 4HLLA 4JA7A 2R5SA 2WQ7A 4JXTA 2XENA 4LEUA 3D9HA 4EPZA 4F53A 3MZLB 4WAFA 4TUUA 4JZYA 4BESA 4JVSA 4GTRA 4GPKA 1JPLA 5BW8C 2JLBA 1X81A 3SZ7A 4U04A 2GRMA 3MGBA 3HYMB 1NFIE 2ONDA 5EKQD 4XX5A 5KWDA 4G23A 3CK8A 1Z5SC 4Z68A 4AXHA 4A63B 3GZ1A 4BETA 4KBQA 4WNFA 5B1BE 1D8DA 3D9LA 5AQ7A 5JJ7A 4EZKA 1G3NB 2XRYA 4PUCA 2ETCA 5AIJA 3Q79A 1U2VG 4N2SA 1E90A 3UIPC 4DK5A 2UWJG 3D3MA 2GGFA 2KCKA 3ESKA 3URZA 4HRLA 1ZBPA 4GTQA 4HOUA 4ANUA 2XEEA 4MLPA 5ENQD 4HBDA 1DC2A 1HFAA 2IFUA 2AXVA 1DNPA 3MKQB 1MX2A 5KJMA 4GMRA 1IKND 1ELKA 3ML9A 5FT9A 4Y6CA 3FUHA 1EF1C 2OEVA 3L22A 2AW6A 2P2CP 3BEEA 2H6IA 3D9IA 4G8LA 5CCLA 2V0PA 3FU3A 2P9SG 1H0AA 2VSOE 3O4ZA 3ESLA 5DIZA 3RO2A 1MZCA 2Y1LE 2F8YA 3B7SA 1QNFA 3JQ1A 3OXFA 2XEHA 4CZ2D 4D10C 3CHRA 2BKGA 2ILRA 5B1AE 4Q96A 3TWVA 2J4BA 4HRMB 5E76A 4RQIA 4I2WA 3FH8A 4FLBA 5BNWA 2GRLA 4MKTA 5LCWC 4NACA 1UN8A 3OTNA 4UWHA 3V2OA 1O1TA 4KZCA 4GMLA 1HG5A 3PVLA 3N71A 1H2UA 1EYHA 3DSVA 1H6PA 3SI5A 4BT8A 4AVXA 4UWFA 4U95D 1NI1A 4G11A 4ILGA 2L0TB 3S7FA 5HKPA 4GTOA 2WXLA 1U3DA 5CEAA 4HXIA 1K3ZD 5AAOA 2EINE 3NOGD 4WUYA 5FWQA 1KT1A 1KT0A 5AJLA 3IV0A 3IHYA 4IULA 3CVNA 2KC7A 1S63A 4B8AA 1OCCE 3FH5A 4LRZA 4ANVA 2UY1B 2V5FA 4AY5A 5AQAA 3KD7A 3RSEG 4J8EA 3Q73A 4F6RD 3PH0C 1OWLA 4KVOA 2V5QC 4GTTA 3EIQC 4FA6A 1TR4A 4IN3B 2WXMA 5FQ7A 1D8EA 2WQHA 3UT4A 3Q9NC 3QAQA 3DBSA 4EECA 3EHNA 2IF4A 2DBAA 2X3MA 3I4RB 4KXKB 3AU5A 2L0IA 2LSUA 3DRAA 2R05A 1KLXA 4GZ6A 2VTBB 3ZXPA 1ELRA 2L6BA 1N54A 4ACLA 2WPVA 4FLHA 2Y3AA 1NL4A 4C48B 2XZTG 3HIZA 4G8KA 3LVQE 4CGWA 3R7RA 4DJAA 3LY9A 3CHQA 3QNKA 4I9CA 4FJZA 1UJJA 4G2VA 5CBOA 3DWLG 4U0ZA 1DCQA 1A5EA 1E96B 4B8CB 3L13A 4WNGA 1HZ4A 3PE4A 4FHKA 4QFVA 1MQSA 3AG2E 4WNDA 4HOSA 3WG7E 2PZIA 1FT1A 2OVFA 3FEXA 3ZYKA 2R03A 2IO2C 4NQ0A 3D9KA 4XEIG 3Q47B 3RIBA 3C3RA 4FHJA 4K0RA 4L23A 2X6FA 2HM8A 2EILE 3LY7A 3UPVA 4NRHB 3DSSA 4CYMD 1TYQG 4LERA 3CR3A 1E8ZA 5LX8A 3U3WA 3ZEFA 2F0YA 4J8FA 3ZYMA 3QC1A 3C5RA 3FEYA 4ME2A 4UI9C 3CHPA 2P58C 4TXRA 3AAAC 1D9SA 3I5PA 3ZGQA 1AP7A 3MV3B 1QQEA 4UWKA 5KBAA 2FO1E 3T9KA 3U4TA 3NAWA 5EIBE 4HS2A 3EU5A 3UINC 4FULA 2KBXA 3WXXA 3MKQA 3VLFA 4JPSA 1OXJA 1OWOA 2V4HC 3JXIA 1H6KA 4XKCA 1U3CA 3JUIA 2HR2A 2J07A 5KJNA 4AOFA 4HORA 1TNUA 3ABLE 2VYIA 2OV8A 1WM5A 4P29A 4I43A 3JYSA 4TXPA 2GRNB 1TN8A 3TXNA 3KSLA 4PS8A 4JHKA 4APFA 3B7UX 3UM2A 2WXIA 3EDTB 3JUEA 2RFAA 4MRUA 1PAQA 3CVPA 5EYLA 2AVPA 2WMNA 1RZ4A 3GYZA 3CKCA 4C0MA 4BWRA 4BSXA 2QYJA 2P9UG 5EIDA 4U7EB 4UQXA 3MV2B 4L2YA 4JEUA 1FT2A 2WXFA 3L16A 2FBNA 1Q2ZA 1NA3A 2AJAA 4DUIA 1N95A 3RU0A 3CKBA 4BX8A 1E7UA 4EHMA 3SNXA 2PM6A 2LSVA 5BXUA 1ZB1A 3TJPA 4U0SA 4EQFA 3C98A 4U63A 5JJTA 1H2VC 3PZ1A 4DX2A 4GTPA 2X6JA 4HQDA 2HYZA 3MJWA 2C0MA 3CVUA 4N3AA 2WMOA 3RRUA 4DX1A 1WY6A 4CT0A 4N2QA 4G25A 1XNFA 4R7LA 2ETBA 3DXKG 3NF1A 3HDXA 5FQ8A 3SF4A
chains in the Genus database with same CATH topology
3EHQA 2RFAA 3JUEA 1YMPA 3ZKJA 3V79K 2Y1LE 1MX6A 4UUCA 2F8YA 5CERB 4HB5A 3EHRA 5EYLA 4J7WA 5AQAA 4OAVB 3SO8A 3HRAA 5CBNA 2XEHA 4CZ2D 1S70B 5KNGA 2F37A 2A5EA 2F8XK 3B95A 1NFIE 2JABA 2BKGA 4HNAD 5AQ9A 4F6RD 4QQIA 5KWDA 1WG0A 2V5QC 3TWRA 2QYJA 1MX4A 1TR4A 4Z68A 5EN5D 5AARA 3TWVA 3V30A 3V2XA 2DVWA 5EILA 4HRMB 2ZGGA 3UI2A 5EIDA 3TWWA 4CYMD 2VGEA 3Q9NC 4A63B 3AJIA 4O1PA 3T8KA 5HS0A 1BI7B 1AWCB 4BETA 1WDYA 3TWXA 1K1BA 1N0RA 2BKKB 5CEDB 4B93B 5AQ7A 4LSZE 3HG0D 1BD8A 1G3NB 1YYHA 2ETCA 3F6QA 4HI8A 3C5RA 3J5QB 4K5AB 3UTMA 2AJAA 3V2OA 2Y0BG 4DUIA 1BU9A 2J8SD 4O1OA 3NBNB 3IXEA 2DZNA 4BEPA 3B7BA 4U8YD 2ETAA 4K5CA 3AAAC 3TWTA 2RFMA 3W9GA 2PNNA 1D9SA 3TWSA 2NYJA 1BLXB 4ZHBA 1YCSB 4BERA 1UOHA 3TWQA 3V31A 4OAUC 1SVXA 5ENOD 4NIKA 4HI9A 5CECB 5ENTD 4HRLA 1SW6A 3UXGA 4LNUD 3LJNA 5KBAA 5FIOA 5JA4D 1K1AA 1N11A 2MYOA 5AQBA 3J5PA 2FO1E 4K5BA 3ZUVB 5FINA 3T9KA 2L6BA 4ZFHA 5KNHD 1BI8B 2XEEA 3DEPA 5ENQD 4HBDA 1MJ0A 1DC2A 5EIBE 4U95D 5BXUA 2XZDG 4J8YA 4TUMA 1MX2A 4C48B 2XZTG 2KBXA 4G8KA 5ENRD 1MYOA 2ZGDA 4GMRA 1IHBA 4GPMA 3TWUA 4HRNA 1IKND 3KEAA 1IXVA 3EU9A 5HKPA 2V4HC 5CBOA 3JXIA 4RLYA 2DZOA 5ENSD 5CEAA 1DCQA 5ITZF 1K3ZD 5AAOA 2B0OE 4DX6D 1A5EA 4DRXE 3NOGD 1OT8A 2P2CP 4U8VD 4YDWA 4DX2A 4N5QA 2QC9A 3DEOA 3ZNGA 4HQDA 1OY3D 5HRYA 1AP7A 4BSZB 5D66A 4O60A 4QFVA 4JB8P 5BXOA 2KXPC 4G8LA 4DX1A 3Q9UC 4HLLA 2HE0A 3ZU7B 4DX7D 2XENA 3JXJA 4U96D 4LG6A 3NOCD 4F1PA 1N0QA 2DWZA 3D9HA 1QYMA 2ETBA 3W9FA 4YDYA 4ATZD 5JMND 5AN8A 4DX5D 5EYPF 5ENPD 4BESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHQ A;  2RFA A;  3JUE A;  1YMP A;  3ZKJ A;  3V79 K;  2Y1L E;  1MX6 A;  4UUC A;  2F8Y A;  5CER B;  4HB5 A;  3EHR A;  5EYL A;  4J7W A;  5AQA A;  4OAV B;  3SO8 A;  3HRA A;  5CBN A;  2XEH A;  4CZ2 D;  1S70 B;  5KNG A;  2F37 A;  2A5E A;  2F8X K;  3B95 A;  1NFI E;  2JAB A;  2BKG A;  4HNA D;  5AQ9 A;  4F6R D;  4QQI A;  5KWD A;  1WG0 A;  2V5Q C;  3TWR A;  2QYJ A;  1MX4 A;  1TR4 A;  4Z68 A;  5EN5 D;  5AAR A;  3TWV A;  3V30 A;  3V2X A;  2DVW A;  5EIL A;  4HRM B;  2ZGG A;  3UI2 A;  5EID A;  3TWW A;  4CYM D;  2VGE A;  3Q9N C;  4A63 B;  3AJI A;  4O1P A;  3T8K A;  5HS0 A;  1BI7 B;  1AWC B;  4BET A;  1WDY A;  3TWX A;  1K1B A;  1N0R A;  2BKK B;  5CED B;  4B93 B;  5AQ7 A;  4LSZ E;  3HG0 D;  1BD8 A;  1G3N B;  1YYH A;  2ETC A;  3F6Q A;  4HI8 A;  3C5R A;  3J5Q B;  4K5A B;  3UTM A;  2AJA A;  3V2O A;  2Y0B G;  4DUI A;  1BU9 A;  2J8S D;  4O1O A;  3NBN B;  3IXE A;  2DZN A;  4BEP A;  3B7B A;  4U8Y D;  2ETA A;  4K5C A;  3AAA C;  3TWT A;  2RFM A;  3W9G A;  2PNN A;  1D9S A;  3TWS A;  2NYJ A;  1BLX B;  4ZHB A;  1YCS B;  4BER A;  1UOH A;  3TWQ A;  3V31 A;  4OAU C;  1SVX A;  5ENO D;  4NIK A;  4HI9 A;  5CEC B;  5ENT D;  4HRL A;  1SW6 A;  3UXG A;  4LNU D;  3LJN A;  5KBA A;  5FIO A;  5JA4 D;  1K1A A;  1N11 A;  2MYO A;  5AQB A;  3J5P A;  2FO1 E;  4K5B A;  3ZUV B;  5FIN A;  3T9K A;  2L6B A;  4ZFH A;  5KNH D;  1BI8 B;  2XEE A;  3DEP A;  5ENQ D;  4HBD A;  1MJ0 A;  1DC2 A;  5EIB E;  4U95 D;  5BXU A;  2XZD G;  4J8Y A;  4TUM A;  1MX2 A;  4C48 B;  2XZT G;  2KBX A;  4G8K A;  5ENR D;  1MYO A;  2ZGD A;  4GMR A;  1IHB A;  4GPM A;  3TWU A;  4HRN A;  1IKN D;  3KEA A;  1IXV A;  3EU9 A;  5HKP A;  2V4H C;  5CBO A;  3JXI A;  4RLY A;  2DZO A;  5ENS D;  5CEA A;  1DCQ A;  5ITZ F;  1K3Z D;  5AAO A;  2B0O E;  4DX6 D;  1A5E A;  4DRX E;  3NOG D;  1OT8 A;  2P2C P;  4U8V D;  4YDW A;  4DX2 A;  4N5Q A;  2QC9 A;  3DEO A;  3ZNG A;  4HQD A;  1OY3 D;  5HRY A;  1AP7 A;  4BSZ B;  5D66 A;  4O60 A;  4QFV A;  4JB8 P;  5BXO A;  2KXP C;  4G8L A;  4DX1 A;  3Q9U C;  4HLL A;  2HE0 A;  3ZU7 B;  4DX7 D;  2XEN A;  3JXJ A;  4U96 D;  4LG6 A;  3NOC D;  4F1P A;  1N0Q A;  2DWZ A;  3D9H A;  1QYM A;  2ETB A;  3W9F A;  4YDY A;  4ATZ D;  5JMN D;  5AN8 A;  4DX5 D;  5EYP F;  5ENP D;  4BES A; 
#chains in the Genus database with same CATH topology
 1YMP A;  3ZXS A;  5A7D B;  2OCC E;  2I6H A;  2UY1 A;  3IKO B;  3QKY A;  5G05 J;  3ASO E;  3B7T A;  2WXQ A;  4F7A A;  5AQ9 A;  5B3S E;  2GW1 A;  5AAR A;  2DVW A;  4L1B A;  5BUZ A;  2OEW A;  3APC A;  1WDY A;  4XI0 A;  2VJ8 A;  5JHB A;  4B0Z A;  1TEZ A;  4K5A B;  3R7Q A;  4I6E A;  2Y0B G;  1O1R A;  3PZ3 A;  4UWG A;  4LNG A;  4FU3 A;  1BLX B;  3MYV A;  4U07 A;  3TWQ A;  2VTB A;  3BG0 B;  3LDZ A;  4WNE A;  1K8K G;  2E0I A;  2CFZ A;  2GRR B;  2IU1 A;  2DIW A;  4A3V A;  2XZD G;  3NB2 A;  3TWU A;  3IHV A;  1IXV A;  1JCS A;  3EU9 A;  3ZW3 A;  3QK0 A;  4YND A;  1PY1 A;  1P5Q A;  3DPD A;  4N5Q A;  1ELW A;  1OY3 D;  4CDN A;  4JB8 P;  1LTX A;  3U9W A;  3FTV A;  4GYW A;  1UW4 B;  2P9P G;  3UT7 A;  3PUK A;  4DLQ A;  3RKV A;  5CRU A;  4TRQ A;  1E8W A;  3EHR A;  4GAA A;  3EUV A;  2AXZ A;  3BU8 A;  3LYA A;  5BT1 A;  2F37 A;  2A5E A;  2XPY A;  3ZRH A;  2I9C A;  1BPO A;  5JJ6 A;  5ANR A;  2VSY A;  3PEV B;  4J8D A;  4AV7 A;  2DCP A;  1OCO E;  3TWX A;  1HH8 A;  4WWP A;  2WM9 A;  2IY0 C;  3HG0 D;  1YYH A;  3ASG A;  3ZVV A;  2Q7F A;  4URK A;  4I2Z A;  2YNQ A;  3QB2 A;  4BEP A;  4CGV A;  3SFX A;  4CEM A;  4M3O A;  4LNU D;  3CSF A;  2KM4 A;  1TJC A;  3ZUV B;  5KNH D;  1MHQ A;  3SHF A;  2YQ8 A;  1UN9 A;  1N4R A;  4G26 A;  1MYO A;  4A1S A;  1N52 A;  2LUH A;  4H7Y A;  5FZS A;  4FJY A;  4I6G A;  5ENN A;  4KT6 B;  2B0O E;  3PEU B;  2RG8 A;  5EDS A;  3FUE A;  3G2S A;  1OT8 A;  4GMJ A;  3CV0 A;  3SFY A;  3TL5 A;  3ZNG A;  1OCZ E;  3FTW A;  3UT8 A;  2V8S E;  4AP2 A;  3CVW A;  2X6H A;  3W9F A;  5EX3 A;  1JWG A;  4ACK A;  1MX6 A;  4I1O B;  3APD A;  3HXC A;  1ZU2 A;  4OAV B;  2QY7 A;  1E8X A;  2H6F A;  2KCV A;  4GZ3 A;  3B95 A;  4FC8 A;  4KVM A;  3ZIM A;  2XHE A;  3TWR A;  4TXQ A;  5EN5 D;  3SQV A;  4E6H A;  3AJI A;  2LAI A;  3FUF A;  3DPY A;  1BI7 B;  2PQN A;  5LP0 A;  3F6Q A;  3D9J A;  2B6C A;  2WXK A;  4E85 A;  3MA5 A;  1O5M A;  3ENE A;  4N39 A;  4YVO A;  1FPP A;  2CFU A;  3CVL A;  4GCN A;  4HOQ A;  2WQ6 A;  2YHC A;  4JEH A;  5ENT D;  3OXG A;  1SA5 A;  1N4P A;  5FIN A;  2BED A;  3ULQ A;  2J4D A;  4HFG A;  1IHG A;  4U8H A;  3D9O A;  2R59 A;  4JD2 G;  4GPM A;  2X38 A;  3MX3 A;  3RRN B;  3ZFW A;  1KZO A;  1HF8 A;  1YA0 A;  3FUL A;  3LEW A;  4PS7 A;  3LY8 A;  4AJW A;  2IQC A;  2DYS E;  3MEK A;  4DRX E;  2XGO A;  4YDW A;  4Q69 A;  1OWP A;  3DEO A;  5HRY A;  3AG4 E;  3LKU A;  2WB2 A;  3FWV A;  3CGH A;  1VDY A;  3JXJ A;  2I2O A;  4F1S A;  1N0Q A;  3CK9 A;  3QWP A;  5J08 A;  5G04 J;  2V4L A;  1LF8 A;  3ZKJ A;  4KZ0 A;  4UUC A;  4ABN A;  5CER B;  4HB5 A;  3HRA A;  4K03 A;  3RAU A;  2X6K A;  2CG2 A;  1HS6 A;  2CHW A;  3CVV A;  3EJN A;  1N4Q A;  3UQ3 A;  2VGX B;  4UQZ A;  2DYR E;  2HO1 A;  2ZIR A;  5D0O D;  5D2M C;  3V30 A;  3AS8 A;  1NP7 A;  1FCH A;  3FTX A;  2BTD A;  3TWW A;  3FTU A;  5FJY A;  3ULE G;  3E32 A;  3T8K A;  2XQ0 A;  4AY6 A;  1AWC B;  4TV3 A;  4RG6 A;  3E33 A;  2GRQ B;  4YVQ C;  3KAE A;  2MOW A;  4HI8 A;  3S7J A;  3PNT B;  3CVY A;  2J8S D;  1Y8M A;  4I17 A;  2NYJ A;  2GRO B;  1YCS B;  4A3T A;  2LXM A;  1NZN A;  5AYW D;  1IQU A;  4KYO B;  1DCE A;  1BI8 B;  2VQ2 A;  3CLJ A;  4GZD A;  2R2L A;  4FAD A;  3CEQ A;  3FUD A;  1IHB A;  3BUA A;  4I6J A;  4C0E A;  3LJ3 A;  3L54 A;  3CVQ A;  4APO A;  4KMO A;  4JHJ A;  2XCC A;  5IY5 E;  1HXI A;  3D9N A;  2NXP A;  5H7P A;  4H7X A;  4ATG A;  3GZS A;  5D66 A;  3O48 A;  1Y6I A;  2QFC A;  4MS6 A;  4YDY A;  4ATZ D;  5JMN D;  5T8I A;  2YIN A;  3EHQ A;  3ISM C;  4JW1 A;  1S0P A;  3ZPJ A;  5HQ8 A;  2RKK A;  2Y4T A;  3FTY A;  3SO8 A;  2XGM A;  5KNG A;  3DSX A;  2JAB A;  4QQI A;  4OVU A;  4G1T A;  4IYP A;  4M7C A;  3MCX A;  3HVE B;  1TN7 A;  4L2L A;  2WXJ A;  4CCA A;  5M72 A;  2YHE A;  3S2A A;  3Q5M A;  3FUN A;  5LOZ A;  2XEV A;  1EPU A;  3B7B A;  2XPI A;  3K9I A;  3FUI A;  1N9A A;  4MBG A;  3E30 A;  3V31 A;  1TNZ A;  2NC9 A;  2P9I G;  5ENO D;  3JCK C;  3SGH A;  3ASD A;  5FIO A;  4DPR A;  4C9B B;  3ZYL A;  1HX8 A;  1N94 A;  2IOL A;  2P9L G;  3T5V A;  3FTS A;  2ZIS A;  3PNL B;  3HXE A;  2ZGD A;  4GA2 A;  3E34 A;  4W9R A;  1KPS B;  3CHS A;  4EZJ A;  4RLY A;  1TJF A;  2WXG A;  1FVF A;  2XS8 A;  2R02 A;  2XCB A;  4L9P A;  4DI3 A;  3LXU X;  4N3C A;  2KXP C;  3G2U A;  4YDE A;  3ZU7 B;  2QYU A;  4V3I A;  4BY6 A;  2XS1 A;  3FHE A;  3PZ4 A;  5FQ6 A;  4X8Q A;  3B7R L;  3D9M A;  1OWN A;  1OWM A;  3T5X A;  4L7T A;  3CIA A;  3APF A;  4OVV A;  3G2V A;  1DVP A;  1N4S A;  5EIL A;  3CQG B;  3UI2 A;  2VGY A;  3HXD A;  5CED B;  1NA0 A;  3PRE A;  1BD8 A;  2I1J A;  3FUK A;  1UJK A;  2PL2 A;  3J5Q B;  5G05 C;  1O1S A;  2KZT B;  3U66 A;  4O1O A;  2I1K A;  4FP7 A;  4ZHB A;  4YDO A;  4OAU C;  4HI9 A;  4GYY A;  3ZHE B;  3DEP A;  2BUG A;  1L5J A;  4HVB A;  2WXN A;  3T8M A;  3Q4A B;  3UMV A;  3AG3 E;  1IYG A;  3HXF A;  3UKU G;  5J90 A;  2XGS A;  1UG3 A;  4A55 A;  4ILI A;  4U8V D;  2QC9 A;  2RD0 A;  3CQC B;  4LCT A;  4RG9 A;  2PQR A;  1X5B A;  3UUX A;  2P9K G;  3AS4 A;  2DWZ A;  3UX4 A;  4DI4 A;  5ARF A;  5ENP D;  1Z3X A;  3Q49 B;  3QAR A;  5KCM A;  4F3V A;  3SBS A;  1E7V A;  2IOS A;  3QWW A;  3NQP A;  5KJL A;  4BT9 A;  2EIJ E;  2AXU A;  5A23 A;  3ULY A;  2A4Z A;  3I4G A;  4GA0 A;  2BF0 X;  3V2X A;  2VGX A;  2WXR A;  2C0L A;  1QZ2 A;  4LSZ E;  2CG3 A;  3AS5 A;  2IEJ A;  5KJK A;  2Y4U A;  3RO3 A;  1TNO A;  3IXE A;  1PC2 A;  3SY2 A;  3GW4 A;  3TWS A;  4GA1 A;  3TXM A;  3Q15 A;  4BER A;  4PH4 B;  2EQX A;  3EHM A;  3ABK E;  4NIK A;  3PDN A;  4PS3 A;  1K1A A;  3LCA A;  3PZ2 A;  3LS8 A;  2M63 A;  3L9T A;  3Q7F A;  1INZ A;  1SZ9 A;  3L08 A;  3UIO C;  3KEA A;  3Q78 A;  3DXM G;  3KSQ A;  1TNB A;  1B89 A;  1TNY A;  3PRZ A;  3CST A;  1H19 A;  4NUR A;  4ANW A;  1W3B A;  2EIM E;  2FUL A;  1Z3Y A;  1QYM A;  3IBE A;  3UM0 A;  1EDU A;  3C3O A;  3E4B A;  3C3Q A;  1S64 A;  2KAT A;  4J7W A;  5LCW J;  3ONK A;  1S70 B;  3FTZ A;  5FQ4 A;  4CDM A;  2J49 A;  3DSW A;  4N5C A;  2P9N G;  3P1U A;  4U0U A;  5A6C A;  2A5U A;  3HVE A;  4O1P A;  5HS0 A;  4Y6W A;  3ASH A;  3VLD A;  1RW2 A;  2LO6 A;  3R9M A;  3AG1 E;  3TG4 A;  2MRI A;  3UM1 A;  3VLE A;  3UTM A;  1HG2 A;  3PS6 A;  2C2L A;  4ILH B;  3NBN B;  1XGW A;  2DZN A;  4U8Y D;  3W9G A;  3E37 A;  5AJD A;  1SW6 A;  3B13 A;  1JUQ A;  2JEK A;  4EZL A;  2LXL A;  1OCR E;  4UWL A;  3DSU A;  4WWN A;  2R17 C;  1QBQ A;  1Z6T A;  3QDN A;  1JWF A;  4AEZ C;  3C72 A;  2WVI A;  3BQO A;  5ITZ F;  1JCR A;  4AM9 A;  5EX0 A;  3L17 A;  5BV0 A;  2H6G A;  3ML8 A;  4J6I A;  3TG5 A;  4BSZ B;  3FFL A;  5CMW A;  5BPP A;  5D0Q D;  2HE0 A;  1V55 E;  1OUV A;  4JC8 A;  3RJV A;  4U96 D;  3NZS A;  4LG6 A;  3NOC D;  1IQR A;  3PUJ A;  4XIF A;  1SQM A;  3CVX A;  5AN8 A;  4DX5 D;  3LVR E;  3L6A A;  3V79 K;  4A1G A;  3UKR G;  5JHA A;  5ARG A;  4EBA A;  4B94 A;  4JL0 A;  4GZ5 A;  2J9Q A;  5CBN A;  4G24 A;  5C1D A;  2KCL A;  5LFA A;  4HNA D;  4GTS A;  1LD7 A;  3OXL A;  3SD5 A;  4XZ4 A;  3CK7 A;  2ZGG A;  5G04 C;  4BFR A;  4XKB A;  2WXH A;  3HHM A;  5CMY A;  5G55 A;  2MHK A;  4I1A A;  1KZP A;  4WWO A;  2BKK B;  4GZC A;  2XRZ A;  4GTV A;  4OYS A;  2EIK E;  3Q7A A;  5FZR A;  3QJZ A;  1BU9 A;  2RFM A;  2KZT A;  4UQY A;  4CRW A;  1UOH A;  3ABM E;  3LJN A;  5AQB A;  4BTB A;  2MYO A;  5CRV A;  1H6O A;  4K5B A;  4ZFH A;  1JCQ A;  2VSX E;  3ZHE A;  2FF4 A;  4DLO A;  2LNI A;  3QWV A;  2J09 A;  4UI9 K;  2E2E A;  3FU0 A;  5ENS D;  2CHX A;  3FH7 A;  1A17 A;  1WAO 1;  2ZU6 B;  2AWI A;  3RK6 A;  3VTX A;  2CHZ A;  3PZD A;  2Y69 E;  5AEN A;  3KEZ A;  5BXO A;  5HI7 A;  4DX7 D;  3FDH A;  4O6F A;  2VSN A;  3ZYQ A;  4F1P A;  3JQ0 A;  4JHR A;  3BG1 B;  3QOU A;  5EYP F;  5FTP A;  4N3B A;  3MKR A;  4GCO A;  5DBK A;  3GZ2 A;  2L6J A;  4EBA G;  4UI9 J;  4HLE A;  2F8X K;  4CDR A;  3S7D A;  4BTA A;  4J0U A;  1WG0 A;  2FO7 A;  3P2B A;  2J08 A;  4LNB A;  4HOT A;  2VGE A;  3PE3 A;  3TGO A;  1K1B A;  3U64 A;  4IRU A;  4BX9 A;  1HE8 A;  4RSY A;  3AU4 A;  4CT4 A;  3ASF A;  2ZXW E;  3SFZ A;  3OAW A;  3TWT A;  4K5C A;  4XI9 A;  3I3N A;  3IEG A;  5CEC B;  1LD8 A;  3FUM A;  5JA4 D;  3J5P A;  5CHE E;  2ION A;  1SZA A;  2XPZ A;  3ONL A;  3FU5 A;  5ENR D;  4HRN A;  4PDX A;  4GB9 A;  5T4Y A;  2DZO A;  2WXO A;  3Q75 A;  3ZN3 A;  3D9P A;  2FEZ A;  1HU3 A;  3FY4 A;  2GRP B;  3SBT B;  4O60 A;  2H6H A;  3HXB A;  4GYO A;  1GW6 A;  3Q9U C;  4Q94 A;  1V54 E;  4GU5 A;  3RRM B;  3TAX A;  3VTY A;  4I1M A;  3L82 A;  3G2W A;  1SA4 A;  2L9B A;  5ANL A;  5C2Y A;  4JA9 A;  4I9E A;  3CHO A;  3FU6 A;  4GTM A;  1MX4 A;  3G2T A;  5G2N A;  2LAH A;  1HO8 A;  3FP3 A;  3LPZ A;  1FVH A;  1H2T C;  3FUJ A;  3ASN E;  1TN6 A;  5E75 A;  1N0R A;  5FZQ A;  4B93 B;  2QZA A;  3EIJ A;  3KS2 A;  2ETA A;  2PNN A;  1SVX A;  3UXG A;  2OVB A;  5T3R A;  1N11 A;  5CCM A;  2WXP A;  3S7B A;  1MJ0 A;  1E8Y A;  4B89 A;  4J8Y A;  4TUM A;  2X6I A;  3DST A;  2NSZ A;  5BV1 A;  2PM7 A;  3UM3 A;  2OOE A;  3R9A B;  2IJG X;  4DX6 D;  4AIF A;  3CHM A;  4LUN U;  4ANX A;  4RVB A;  2IO3 C;  4XE0 A;  3NZU A;  4J8S A;  3X2Q E;  2FI7 A;  4HLL A;  4JA7 A;  2R5S A;  2WQ7 A;  4JXT A;  2XEN A;  4LEU A;  3D9H A;  4EPZ A;  4F53 A;  3MZL B;  4WAF A;  4TUU A;  4JZY A;  4BES A;  4JVS A;  4GTR A;  4GPK A;  1JPL A;  5BW8 C;  2JLB A;  1X81 A;  3SZ7 A;  4U04 A;  2GRM A;  3MGB A;  3HYM B;  1NFI E;  2OND A;  5EKQ D;  4XX5 A;  5KWD A;  4G23 A;  3CK8 A;  1Z5S C;  4Z68 A;  4AXH A;  4A63 B;  3GZ1 A;  4BET A;  4KBQ A;  4WNF A;  5B1B E;  1D8D A;  3D9L A;  5AQ7 A;  5JJ7 A;  4EZK A;  1G3N B;  2XRY A;  4PUC A;  2ETC A;  5AIJ A;  3Q79 A;  1U2V G;  4N2S A;  1E90 A;  3UIP C;  4DK5 A;  2UWJ G;  3D3M A;  2GGF A;  2KCK A;  3ESK A;  3URZ A;  4HRL A;  1ZBP A;  4GTQ A;  4HOU A;  4ANU A;  2XEE A;  4MLP A;  5ENQ D;  4HBD A;  1DC2 A;  1HFA A;  2IFU A;  2AXV A;  1DNP A;  3MKQ B;  1MX2 A;  5KJM A;  4GMR A;  1IKN D;  1ELK A;  3ML9 A;  5FT9 A;  4Y6C A;  3FUH A;  1EF1 C;  2OEV A;  3L22 A;  2AW6 A;  2P2C P;  3BEE A;  2H6I A;  3D9I A;  4G8L A;  5CCL A;  2V0P A;  3FU3 A;  2P9S G;  1H0A A;  2VSO E;  3O4Z A;  3ESL A;  5DIZ A;  3RO2 A;  1MZC A;  2Y1L E;  2F8Y A;  3B7S A;  1QNF A;  3JQ1 A;  3OXF A;  2XEH A;  4CZ2 D;  4D10 C;  3CHR A;  2BKG A;  2ILR A;  5B1A E;  4Q96 A;  3TWV A;  2J4B A;  4HRM B;  5E76 A;  4RQI A;  4I2W A;  3FH8 A;  4FLB A;  5BNW A;  2GRL A;  4MKT A;  5LCW C;  4NAC A;  1UN8 A;  3OTN A;  4UWH A;  3V2O A;  1O1T A;  4KZC A;  4GML A;  1HG5 A;  3PVL A;  3N71 A;  1H2U A;  1EYH A;  3DSV A;  1H6P A;  3SI5 A;  4BT8 A;  4AVX A;  4UWF A;  4U95 D;  1NI1 A;  4G11 A;  4ILG A;  2L0T B;  3S7F A;  5HKP A;  4GTO A;  2WXL A;  1U3D A;  5CEA A;  4HXI A;  1K3Z D;  5AAO A;  2EIN E;  3NOG D;  4WUY A;  5FWQ A;  1KT1 A;  1KT0 A;  5AJL A;  3IV0 A;  3IHY A;  4IUL A;  3CVN A;  2KC7 A;  1S63 A;  4B8A A;  1OCC E;  3FH5 A;  4LRZ A;  4ANV A;  2UY1 B;  2V5F A;  4AY5 A;  5AQA A;  3KD7 A;  3RSE G;  4J8E A;  3Q73 A;  4F6R D;  3PH0 C;  1OWL A;  4KVO A;  2V5Q C;  4GTT A;  3EIQ C;  4FA6 A;  1TR4 A;  4IN3 B;  2WXM A;  5FQ7 A;  1D8E A;  2WQH A;  3UT4 A;  3Q9N C;  3QAQ A;  3DBS A;  4EEC A;  3EHN A;  2IF4 A;  2DBA A;  2X3M A;  3I4R B;  4KXK B;  3AU5 A;  2L0I A;  2LSU A;  3DRA A;  2R05 A;  1KLX A;  4GZ6 A;  2VTB B;  3ZXP A;  1ELR A;  2L6B A;  1N54 A;  4ACL A;  2WPV A;  4FLH A;  2Y3A A;  1NL4 A;  4C48 B;  2XZT G;  3HIZ A;  4G8K A;  3LVQ E;  4CGW A;  3R7R A;  4DJA A;  3LY9 A;  3CHQ A;  3QNK A;  4I9C A;  4FJZ A;  1UJJ A;  4G2V A;  5CBO A;  3DWL G;  4U0Z A;  1DCQ A;  1A5E A;  1E96 B;  4B8C B;  3L13 A;  4WNG A;  1HZ4 A;  3PE4 A;  4FHK A;  4QFV A;  1MQS A;  3AG2 E;  4WND A;  4HOS A;  3WG7 E;  2PZI A;  1FT1 A;  2OVF A;  3FEX A;  3ZYK A;  2R03 A;  2IO2 C;  4NQ0 A;  3D9K A;  4XEI G;  3Q47 B;  3RIB A;  3C3R A;  4FHJ A;  4K0R A;  4L23 A;  2X6F A;  2HM8 A;  2EIL E;  3LY7 A;  3UPV A;  4NRH B;  3DSS A;  4CYM D;  1TYQ G;  4LER A;  3CR3 A;  1E8Z A;  5LX8 A;  3U3W A;  3ZEF A;  2F0Y A;  4J8F A;  3ZYM A;  3QC1 A;  3C5R A;  3FEY A;  4ME2 A;  4UI9 C;  3CHP A;  2P58 C;  4TXR A;  3AAA C;  1D9S A;  3I5P A;  3ZGQ A;  1AP7 A;  3MV3 B;  1QQE A;  4UWK A;  5KBA A;  2FO1 E;  3T9K A;  3U4T A;  3NAW A;  5EIB E;  4HS2 A;  3EU5 A;  3UIN C;  4FUL A;  2KBX A;  3WXX A;  3MKQ A;  3VLF A;  4JPS A;  1OXJ A;  1OWO A;  2V4H C;  3JXI A;  1H6K A;  4XKC A;  1U3C A;  3JUI A;  2HR2 A;  2J07 A;  5KJN A;  4AOF A;  4HOR A;  1TNU A;  3ABL E;  2VYI A;  2OV8 A;  1WM5 A;  4P29 A;  4I43 A;  3JYS A;  4TXP A;  2GRN B;  1TN8 A;  3TXN A;  3KSL A;  4PS8 A;  4JHK A;  4APF A;  3B7U X;  3UM2 A;  2WXI A;  3EDT B;  3JUE A;  2RFA A;  4MRU A;  1PAQ A;  3CVP A;  5EYL A;  2AVP A;  2WMN A;  1RZ4 A;  3GYZ A;  3CKC A;  4C0M A;  4BWR A;  4BSX A;  2QYJ A;  2P9U G;  5EID A;  4U7E B;  4UQX A;  3MV2 B;  4L2Y A;  4JEU A;  1FT2 A;  2WXF A;  3L16 A;  2FBN A;  1Q2Z A;  1NA3 A;  2AJA A;  4DUI A;  1N95 A;  3RU0 A;  3CKB A;  4BX8 A;  1E7U A;  4EHM A;  3SNX A;  2PM6 A;  2LSV A;  5BXU A;  1ZB1 A;  3TJP A;  4U0S A;  4EQF A;  3C98 A;  4U63 A;  5JJT A;  1H2V C;  3PZ1 A;  4DX2 A;  4GTP A;  2X6J A;  4HQD A;  2HYZ A;  3MJW A;  2C0M A;  3CVU A;  4N3A A;  2WMO A;  3RRU A;  4DX1 A;  1WY6 A;  4CT0 A;  4N2Q A;  4G25 A;  1XNF A;  4R7L A;  2ETB A;  3DXK G;  3NF1 A;  3HDX A;  5FQ8 A;  3SF4 A; 
#chains in the Genus database with same CATH homology
 3EHQ A;  2RFA A;  3JUE A;  1YMP A;  3ZKJ A;  3V79 K;  2Y1L E;  1MX6 A;  4UUC A;  2F8Y A;  5CER B;  4HB5 A;  3EHR A;  5EYL A;  4J7W A;  5AQA A;  4OAV B;  3SO8 A;  3HRA A;  5CBN A;  2XEH A;  4CZ2 D;  1S70 B;  5KNG A;  2F37 A;  2A5E A;  2F8X K;  3B95 A;  1NFI E;  2JAB A;  2BKG A;  4HNA D;  5AQ9 A;  4F6R D;  4QQI A;  5KWD A;  1WG0 A;  2V5Q C;  3TWR A;  2QYJ A;  1MX4 A;  1TR4 A;  4Z68 A;  5EN5 D;  5AAR A;  3TWV A;  3V30 A;  3V2X A;  2DVW A;  5EIL A;  4HRM B;  2ZGG A;  3UI2 A;  5EID A;  3TWW A;  4CYM D;  2VGE A;  3Q9N C;  4A63 B;  3AJI A;  4O1P A;  3T8K A;  5HS0 A;  1BI7 B;  1AWC B;  4BET A;  1WDY A;  3TWX A;  1K1B A;  1N0R A;  2BKK B;  5CED B;  4B93 B;  5AQ7 A;  4LSZ E;  3HG0 D;  1BD8 A;  1G3N B;  1YYH A;  2ETC A;  3F6Q A;  4HI8 A;  3C5R A;  3J5Q B;  4K5A B;  3UTM A;  2AJA A;  3V2O A;  2Y0B G;  4DUI A;  1BU9 A;  2J8S D;  4O1O A;  3NBN B;  3IXE A;  2DZN A;  4BEP A;  3B7B A;  4U8Y D;  2ETA A;  4K5C A;  3AAA C;  3TWT A;  2RFM A;  3W9G A;  2PNN A;  1D9S A;  3TWS A;  2NYJ A;  1BLX B;  4ZHB A;  1YCS B;  4BER A;  1UOH A;  3TWQ A;  3V31 A;  4OAU C;  1SVX A;  5ENO D;  4NIK A;  4HI9 A;  5CEC B;  5ENT D;  4HRL A;  1SW6 A;  3UXG A;  4LNU D;  3LJN A;  5KBA A;  5FIO A;  5JA4 D;  1K1A A;  1N11 A;  2MYO A;  5AQB A;  3J5P A;  2FO1 E;  4K5B A;  3ZUV B;  5FIN A;  3T9K A;  2L6B A;  4ZFH A;  5KNH D;  1BI8 B;  2XEE A;  3DEP A;  5ENQ D;  4HBD A;  1MJ0 A;  1DC2 A;  5EIB E;  4U95 D;  5BXU A;  2XZD G;  4J8Y A;  4TUM A;  1MX2 A;  4C48 B;  2XZT G;  2KBX A;  4G8K A;  5ENR D;  1MYO A;  2ZGD A;  4GMR A;  1IHB A;  4GPM A;  3TWU A;  4HRN A;  1IKN D;  3KEA A;  1IXV A;  3EU9 A;  5HKP A;  2V4H C;  5CBO A;  3JXI A;  4RLY A;  2DZO A;  5ENS D;  5CEA A;  1DCQ A;  5ITZ F;  1K3Z D;  5AAO A;  2B0O E;  4DX6 D;  1A5E A;  4DRX E;  3NOG D;  1OT8 A;  2P2C P;  4U8V D;  4YDW A;  4DX2 A;  4N5Q A;  2QC9 A;  3DEO A;  3ZNG A;  4HQD A;  1OY3 D;  5HRY A;  1AP7 A;  4BSZ B;  5D66 A;  4O60 A;  4QFV A;  4JB8 P;  5BXO A;  2KXP C;  4G8L A;  4DX1 A;  3Q9U C;  4HLL A;  2HE0 A;  3ZU7 B;  4DX7 D;  2XEN A;  3JXJ A;  4U96 D;  4LG6 A;  3NOC D;  4F1P A;  1N0Q A;  2DWZ A;  3D9H A;  1QYM A;  2ETB A;  3W9F A;  4YDY A;  4ATZ D;  5JMN D;  5AN8 A;  4DX5 D;  5EYP F;  5ENP D;  4BES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...