2P2ZA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGMKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 62
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p2zA00
2QNIA 1DKMA 5CX4A 3IT0A 4GPZA 2P75A 2F90A 1BQ4A 3QPWA 1RPAA 1EBBA 2P9FA 2OWDA 3GP5A 2DWPA 3IT2A 2I1VB 1CVIA 4PGMA 5AJZA 3K4PA 2WU0A 2DWOA 3DB1A 2HPAA 1V37A 3GP3A 3EOZA 3PGMA 3QPUA 3EZNA 3BIFA 1SKAA 3LNTA 2P6OA 4EO9A 1ND6A 3HJGA 2BIFA 2EKZA 1UJCA 1SK9A 3F3KA 2HIAA 1C7ZA 1K6MA 2IKQA 5HR5A 1RIIA 4HBZA 3C7TA 4GPIB 1YFKA 3K4QA 2A6PA 4ODIA 4PZAA 1XQ9A 1ND5A 1FBTA 1V7QA 3F2IA 2H4XA 3LG2A 3O0TA 4ARVA 4D4MA 1E59A 4IJ6A 2P78A 1DKLA 1NT4A 3KKKA 4E3WA 3QPVA 4D4LA 1DKPA 2H52A 4FDUA 5CDHA 4ARUA 2H0QA 1QHFA 2P30A 2PA0A 3E9EA 5PGMA 3R7AA 3FDZA 1FZTA 2AXNA 3IT1A 2A9JA 3DCYA 1TIPA 3D6AA 1T8PA 4EMBA 1H2FA 3E9CA 5HTKA 2P2ZA 2P2YA 2ENUA 3FJYA 4MA4A 5AJVB 4AROA 3IT3A 1QFXA 4FDTA 5AK0A 4IJ5A 3MBKA 2P9YA 1YJXA 2P9ZA 3LL4A 2RFLA 5AJWA 4JOBA 2GFIA 1SKBA 1BQ3A 1DKOA 1UJBA 2H4ZA 2P6MA 3GW8A 5AJYA 1BIFA 2EKBA 1H2EA 4PZ9A 4TSRA 1IHPA 2P79A 3MXOA 1QWOA 3ZHCA 2HHJA 1E58A 2ENWA 4QIHA 2WNHA 1C80A 3D4IA 3NTLA 2YN2A 3OI7A 2WNIA 3NFYA 1DKQA 4JODA 4D4KA 3FDZB 2OWEA 3D8HA 5CU7A 1RPTA 1SK8A 3E9DA 5AJXA 1DKNA 2EOAA 4D4JA 2YN0A 1C81A 2P77A 4ARSA 4JOCA
chains in the Genus database with same CATH superfamily
1V35A 5AYVA 5AJTA 3A0UA 3EGWA 3U17A 2H9IA 1HDEA 1MOQA 2E5FA 3B1JA 4IHJB 3EWAA 4BGUA 1QBGA 2Y1LA 1I4LD 1NBWB 4F45A 2Q5CA 2E21A 1BRMA 4AMBA 3ELUA 4B31A 1XVUA 1GFWA 4UMFA 3V1TC 3VPAA 3HKCA 2HJSA 3VPCA 1TMOA 4OVKA 4CL8A 1U9IA 4HJXA 4FFSA 4O08A 4Z49A 1DQPA 1H69A 2VRNA 5C51B 2GEJA 3MJEA 1CB0A 5K3CA 3B5JA 5K8CA 1C3LA 3FLEA 1U8UA 3KKNA 1VRCA 3C3JA 3DKVA 4WKNA 4F6CA 1JG7A 2VF4X 5A3QA 2DHCA 3EQ6A 2BFNA 3ZEIA 1TPYA 3PLRA 1AKYA 1ZINA 1FFYA 3R76A 3ENVA 4DNFA 1T9DA 3HN2A 3GNLA 3WGUA 1AB6A 2CNNA 2C4VA 1JHVA 1ZK0A 3JQAB 1KE2A 5CVJA 1IQPA 1XCOA 3PQ8A 1FDSA 2PZGA 4RKQA 5FNZA 4BWVA 4F2GA 1WETA 5I4BA 3E70C 4K9KA 3ER9A 1XRQA 4F3CA 1E79D 1WM1A 4G0XA 2ZJ7A 1GU0A 1RAEA 1VZ3A 2GBFA 3H86A 4MS4B 5FNVA 2O3UA 3FUXA 5DPMA 4MR7A 1A4XA 1GTZA 1WJGA 221PA 2NUAB 3I34X 1JYEA 5DNDA 1NZDA 3L9XA 2WVGA 3R77A 1D7AA 5TV2A 2AXEA 1SVKA 4AI6A 2EL7A 1RXCA 3DBRA 2A5JA 3R3VA 1EDEA 4OXYA 1R9NA 4OXNA 1FTSA 1ZSNA 1FFEA 3C43A 1BTOA 5DLYA 5HFNA 1RWXA 1C0KA 3RYHA 1JAXA 1X0XA 2FOIA 3BCSA 3ZJ5A 1OCEA 3F6SA 2C2GA 5IYZB 1O1YA 3CSDA 2BGJA 1UXHA 3BULA 2Y92A 5AVTA 5GY7A 3LC2O 4BVEA 1NIJA 2WG2A 4B6EA 1GFZA 3A9TA 1D07A 3MWJA 3QU4A 4LHEA 4LNUB 1YS6A 2R6JA 4HWSA 2JJ1A 3QEMA 2GKOA 2EG9A 4G81A 4MITA 4UMDA 4EAAA 1U0LA 2L42A 4XOUA 1FDRA 2VUSA 2VXCA 1XL0A 3R3JA 5FUWA 3RIGA 3TVYA 4DTIA 4BJHB 5LOVA 4ER6A 1O9BA 1ZISA 5D7NA 4NNOA 3WSWA 1H05A 3VGJA 5B3JA 3SX0A 2L2QA 3BSWA 4QU8A 1LWOA 4YR9A 4PZ9A 5JQGB 3UT5B 1GN9A 5FORA 1E3WB 1Q19A 4JXZA 3W5SA 1ABFA 2BAGA 2YOFA 2RGAA 3DUFA 2QMOA 3UB4A 1DZIA 3TRJA 1MJGA 2VPZA 4CDNA 2ZM5A 2AGVA 1ATZA 3MWDA 4ENPA 4KNYA 3SHWA 5EERA 1RRGA 3AG6A 3AGPA 4MO9A 3CYFA 1XO1A 2CB9A 1FYDA 2GEDA 4XWKA 1CQJA 2J6CA 3GH3A 4GLFA 4IX1A 1WMEA 4LCBA 2PUJA 1XHFA 4RSMA 5HSGA 2WHRA 5CDSA 2TMYA 3AEQB 1DWPA 1SUPA 4KJXA 5CYPA 3AX6A 4JUBA 4KGXA 4AKSA 5LQNA 1NVMB 3OM8A 1DKNA 1Y1TA 4K26A 2NV0A 3CWQA 3MB5A 3RHZA 4WJZA 1ODLA 1FSFA 2HDWA 3UV7A 4BO8A 4K3UA 2B78A 3H6HA 2AXQA 1XNJA 1CVLA 5BT9A 3I9OA 3TPFA 3MJHA 4UTVA 5AKGA 5A2QA 1DKMA 4JI8B 4JX8A 2AZMA 2Q5QA 4D3SA 1WHTA 2V1XA 3AK4A 5CEJA 2ZXUA 2B36A 3BB3A 1HG1A 3IUPA 3Q7SA 4DMMA 2EW2A 2ID4A 4GX5A 3UUEA 4GH5A 1SH7A 3N75A 3JQPA 5J2UF 4RDXA 1BHO1 1I24A 2ANBA 1HFWA 2XXBA 2X2OA 1U02A 4TLMB 4D7AA 5TVGA 4OJNA 4TWJA 4X8MA 4DHWA 1FB5A 3GGCA 3QKRB 2A7QA 1GT6A 4LMBA 2PANA 2AJ8A 5CCXA 3A58B 2XYQA 4JXKA 3ZXXA 4ALMA 4W5TA 2QN8A 2A1UA 3BAFA 1C8KA 1ESEA 4TMWA 2CSXA 1QSGA 4OAQA 1EX7A 4FSDA 4JH0A 2C0QA 1JXQA 4JC8A 2P9HA 4YIKA 3B7GA 2Z5FA 3SWWA 2X5KO 4CTNA 4R01A 1V6CA 5KCZA 1LDYA 2IEDA 2MWMA 4TSKA 5FF9A 1CD5A 1M8KA 1FX0B 3WNQA 4B71A 3EXEB 4BCCA 3IR7A 4Q6WA 3PEUA 4Y7DA 1VPWA 4RVSA 4HNGA 2JVJA 2ATCA 1HYGA 3W2FA 5U1PA 4FMCF 3PUYA 2PU5A 4UOEA 5JCPA 1PQWA 2EF0A 4UUNA 3LHFA 3GRAA 4ZU6X 1V9SA 4FGWA 4MYSA 4PAOA 3E9EA 1I3CA 5JCJD 3T7EA 4TLAA 2RSLA 2P41A 3GUYA 4PVCA 3OJCA 3V55A 4DR5B 2P2SA 3KJGA 1Z73A 2HDOA 1J33A 4MRRA 4B3BA 3THSA 4IHQA 4D9MA 5JNRA 2Z98A 4KMOA 5C8ZA 4YP1A 3R75A 3WK7A 4LISA 4DLPA 4HNAB 5B1EA 3PX3A 3O74A 4Y18A 3W6UA 3BL5A 1Y8RB 1W36C 2GEFA 2DKNA 4MQ4A 3G9QA 5AJVB 3WZ2A 1KPGA 4AROA 1SQ6A 2P4QA 1OFHA 2Z9DA 3E1KA 3LY5A 4M1YA 1X14A 4M1SA 2XE8A 4ZQHA 2C3YA 3RQIA 3C3MA 3WK4A 1QRAA 3DH0A 3MRSA 3L0CA 2NU6A 1HDZA 3H5NA 1S8NA 1I6LA 1U1DA 2WVAA 5I3CA 1GADO 1TRHA 2GF9A 4M7WA 3VR0A 5DOZA 2H1SA 4J1TC 4LGMA 3U39A 1Y1RA 3BD9A 3AKCA 3ND7A 4KW7A 4FGZA 2QLTA 4OK6A 5CEEA 4X6XA 4XASA 1QM5A 4QIHA 3V4SA 4WFIA 4BYGA 1H6BA 1LI7A 4PZCA 4B73A 1ZMXA 3L6EA 4Q4AB 2I80A 3QBTA 1UBTS 3AY7A 1NVKA 1IN5A 3SQDA 1DDIA 1M1NA 4CIWA 1G2OA 2I34A 4XEUA 2WQ6A 3ZE0B 4ETIA 1SVWA 4OXQA 4AKIA 3O2SB 3ZU4A 3WLKX 1OB5A 2HYIC 3BMCB 4FLFA 2A1TR 1X86B 3AEKA 3LA6A 3PHJA 3QKUA 3D6UA 4GZ5A 3WB0A 4CXMA 4KIJA 1GAJA 3OPYA 2J5BA 4NIMA 1U9ZA 4OHXA 4YFYA 5AUOB 2RHGB 3LY7A 3L0OA 5KOJB 4GIBA 1SXHA 4XPZA 3ENNA 1C9MA 2A3RA 5D86A 5DO9A 4AN1A 5K05A 1UWCA 4ARIA 3FPAA 1D9ZA 4KWIA 5SV2A 4U6NA 2B0JA 3U31A 5A0TA 4W1SA 1NSYA 5SY6A 5K51A 2DHRA 3FBWA 3P2EA 1ZD1A 3LCVB 2PMFA 2J87A 5BRAA 5L3QB 3K7EA 4EQZA 1KDPA 3KC2A 3QXCA 2I6TA 2W6JA 3W9SA 2NVUB 2C5SA 3G3EA 1RYDA 2JB9A 3VHQA 5FPQA 3U44B 3HVUA 5DNCA 2PEYA 3JALA 2DBZA 3K4PA 4QUBA 1MH9A 2BEUA 2BHNA 2TMKA 4YGYA 4WY8A 5DHFA 1W85A 3PPWA 4Q3OA 4WE3A 5BXQC 3FJ1A 4TWZA 2PFKA 2W6MA 4ZCLA 4KB5A 3VKGA 1XTSA 1KFBB 1U9IC 4JT8A 4IHJF 4PYNA 5EMMA 1TMYA 3HJGA 4F86A 1Q91A 2QTFA 1XZIA 4G0YA 2L17A 2X7HA 3BBLA 1MV8A 2J0UA 1BX1A 3K15A 4KUEA 1XZJA 4PS0A 4UFNA 1G9TA 1PK9A 4LFBB 4BNDB 4F06A 1QIGA 4PLFA 1HM5A 2VZ8A 2FR8A 1CUAA 3HG7A 1FYEA 4FC6A 4L5AA 4L4UA 5KCMA 4X64B 4EHDA 2FDCA 2REQB 4U6QA 3DR3A 1HYBA 3HA5A 3RQSA 4UU8A 5K0CA 2G5TA 4IJ6A 1RRFA 1DKLA 3RC3A 1QG4A 3HS3A 1HPLA 3FLBA 4HNSA 1YS9A 4YWHA 4EEKA 2J3JA 4PLHA 3PJGA 4KQJA 3SIRA 1VYHA 1N34B 3O2NA 4R98A 3QU5A 1UK6A 3KPVA 4GZ3A 3GCWA 3N0WA 4F84A 1PL8A 1QO0A 2ZIXA 4I3GA 4QDKA 3O1LA 4O5AA 4E2YA 2R2GA 1U5BB 1SAYA 3COSA 3N2IA 3PDUA 4GI5A 4TLCA 3RSSA 2PR2A 4DY6A 4L6CA 5ICCA 1D5CA 2HXGA 5LQUA 3SVTA 1H2FA 3LUAA 4L07A 1RYNA 3L1JA 3SJBA 1UT5A 3EF0A 1QWSA 3M83A 1NNI1 2WG0A 4KN6A 3SX2A 2X4DA 1T0HB 3KB2A 1Z8DA 1CX9B 3OPYI 4RJLA 3UXMA 2PX2A 2MIIA 3E7FA 1EVEA 3KTDA 3LX8A 3C3DA 5EWLB 3HDHA 2G4VA 2FG7C 2YOHA 3ITNA 2MYTA 4RY0A 3IEKA 2ZYSA 1IRIA 4MKGA 5EKTA 3P52A 1BQ3A 1R0CA 3ECSA 2BELA 3AESB 4ZCIA 1DKRA 5HRCA 3GW8A 2L19A 4HX2A 1GAQA 1KMQA 3DOOA 4NESA 4OY3A 4C0BA 1FSPA 3A1UA 4Z5XA 2GRAA 5IYZF 4C7BA 4WMLA 3M3PA 1IY9A 1H42A 1YJQA 3I9MA 3KKOA 3OWHA 3P0RA 2JLRA 1IDOA 4GAEA 4QPJC 5CFPA 2XF2A 5KI6A 3EOAI 4MDHA 3EQZA 3AONB 5EQFA 1HSZA 1XYYA 5IJ0A 4CR8A 1G4HA 3PUVA 1P4GA 3KYJB 3OQBA 1JLKA 1D0VA 5DU2A 4A9AA 2VNSA 4B3RB 4C7KA 1ZWLA 5I9TA 1H2XA 4GHWA 3EUFA 4KFCA 5JQGF 4X1IA 4JI0B 4V0LA 4I08A 4JVOA 2QA5A 4F1WA 3SVLA 4MARA 4UVIA 1WVIA 2PT6A 4YMUA 4UD2A 1MQAA 3U3RA 5IDXA 1T10A 1ZN9A 1QK4A 4J1QA 1T1SA 2B1IA 2GHQA 4B5KA 5DIFA 2C9OA 4FHFA 1SCNE 3FWHA 2X19A 1Q0HA 1R16A 4TKUB 1YKSA 3HKDA 4WZZA 1VP9A 5M29A 1UBUS 4JLBA 4IIFA 2YMQA 3HI4A 4AY3A 3SS8A 2DM6A 4WOJA 5A2GA 5L51A 2Q1XA 5BRJA 2OZVA 3VISA 2OE2A 3ZY2A 1IOVA 1GUDA 3NEPX 1TMKA 3HO8A 5IH7A 2IDJA 2Q2OA 4E5NA 1V16A 3MRTA 1Y48E 2ZIVB 2HA0A 3GT0A 3MQ4A 3WGHA 4QGSA 1N3IA 3CUYA 2VH2A 1UMKA 1W9MA 2VTDA 3QFFA 4JVNA 1IU9A 2XTAA 4GFDA 4OP3A 5BYAA 2JBHA 3AI1A 4K9SA 3KHUA 4E70A 3A9UA 2F9FA 2IOQA 2NTEA 2VHZA 3DL7A 3NLLA 1JHOA 1E3MA 1FIUA 3KEGA 3RFUA 3DM9B 3KUXA 4MUEA 3HKBB 3H97A 2PMCA 1I7LA 3W2GA 1VPVA 1ZHOA 1QV7A 5JFOA 5DNAA 2ZUDA 2Q3DA 4OXIA 4L4RA 4OYHA 2AOTB 3IPLA 4HPWA 2ZJ6A 3GXOA 4HSGA 1JZSA 4MMYB 4F1KA 5EC8A 2K6GA 5KYXA 1M66A 4P22A 2V7XA 3UMMA 5IUKC 4RU1A 1F60A 3FX2A 1NNEA 3H5IA 2EQBA 1N77A 3WGJA 1DU4A 1K2VN 1RKVA 3K9HA 3U9SA 1BOFA 1QGAA 2XI4A 3ASUA 1FDWA 2IE8A 3AUTA 4ZQFA 5EHIA 2CE2X 3SFVA 4X95A 3K6SA 5EHZA 1JR2A 1KBQA 2DGDA 2WT8A 2QG9A 3OCXA 4TPKA 1ABBA 2ZRDA 5G3ZA 3BDAA 3K92A 5IKEA 1O4VA 2HZ7A 4YFVA 3PLAE 1DO8A 2X2FA 2BT4A 2ZT8A 3G2NA 3E9CA 1D0IA 1V1MB 2ZRKA 5FYDA 3W6OA 4C43A 5JO9A 1J06A 1ZGJA 4DJTA 3STXA 4QUEA 1UZLA 2AI2A 2D59A 1ANKA 3O90A 3EGDA 1NBMD 4TTJA 2OBYA 3E9NA 2LPMA 2P9YA 2WUGA 4TWAA 1YA6A 4U2GA 4DMGA 2AMYA 4A8PA 2FUEA 4TMFA 3VKUA 1IEXA 2AR9A 3HJFA 4W5JA 1L3CA 2RBKA 3BMQA 2QD5A 1GARA 5E38A 2W6ID 4YT8A 4ZTUB 3QEOA 5ER6A 4U02A 1AQUA 1H8ED 1KK3A 4YAJA 5ALQA 4M87A 1A8UA 1XZEA 2LZ0A 1YQDA 3ZX4A 2D8AA 3OKAA 2C1XA 3H19A 4L72A 4FUQA 1QF9A 3LWZA 2QAJA 4NL4H 1CZOA 1ZC3A 2Q2QA 1T34A 4GX1A 5IBPA 2XA2A 3RPEA 2JAXA 2QKYA 3QNUA 5KVCA 5KYGA 3LSTA 2QRJA 4AYXA 4PPGA 3V4FA 3OCZA 4HQNA 4AN4A 3Q7EA 1TVMA 3BXXA 1ADYA 1H2YA 1DLIA 3HKCB 1PZEA 4N3GA 4KBGA 5B1HA 1V48A 2EC5A 2QK4A 3WRXC 4X94A 4EPWA 4IQ0A 4RZUA 4DADA 1NKSA 3NM6B 2O0HA 2EFHB 2YUIA 3KBOA 4G5QA 1XTVA 3N6XA 3WKCA 1RYEA 4BXOA 1IIRA 3IOYA 5BSGA 1TVEA 2V9PA 1J8VA 3PE4A 2QUKA 3B9RA 4F04A 1ORTA 4NEQA 4PG4A 4YP0A 4RTMA 3LBHA 1P72A 1JPUA 4KBFA 2HQRA 2RJNA 3VU1A 4BLQA 4U9HS 3SC2B 3G0BA 1UR5A 1ZZEA 1G8GA 2FZWA 1MB4A 2JAUA 2Q27A 4LHWA 4FPXA 4LTDA 1AV7A 2LKDA 4FYMA 4EHHA 4LYYA 3KL4A 1DC4A 2FPPA 1FP2A 1XZFA 2WUFA 1E66A 5AO9A 1I1NA 1XTUA 4MR7B 1BS9A 2IX3A 1PD1A 1HY3A 1Z7EA 2BFOA 3A37A 3MJ4A 3N2GB 4MB2A 2J9ZB 4U1RA 1FCJA 4FR5A 2B8WA 2GNAA 3QUQA 4RMJA 3U26A 4HKTA 4B47A 3L8CA 3BWDD 1JSLA 3GEEA 2QVCA 5A7GA 1C3JA 4YJFA 3ZWOA 4B35A 2V58A 5CJ2A 4BN0A 4II2A 1HYQA 4B3CA 4EPRA 1CR6A 1VLQA 1D8AA 1YO6A 2IXEA 5CW2A 4MW1A 3RYHB 3G2PA 4YCCA 3AVYA 1ZNWA 3VZDA 3AJRA 1AF7A 3OZIA 1LU9A 4HUTA 1ZNYA 3TQRA 1YZUA 1NMQA 4HLNA 3ZWYA 1WUJS 5EXSA 1KEPA 1R0BA 1TQ2A 2FYTA 1QH1A 2JH3A 4TKMA 4WNAB 4M49A 2KX7A 2ZQ5A 2XR1A 3IAFA 5C31A 4ZYVA 3QEMB 4MV1A 1T8YA 5FDFA 1ESZA 5JHHB 2BEJA 1UFVA 1RCFA 1N8NA 2L82A 2X0EA 1BVYF 1SC9A 4EO7A 3LWBA 1OZFA 2D8MA 2IK8A 1W96A 3CNLA 2CLIB 3SAJA 2ACWA 3FFXA 5TS2A 4G0UA 3L1HA 3RVRA 1ACLA 4UHFA 1W94A 5CXUA 1NXVA 1FXSA 2UZIR 4YHBA 5FUVA 3TDNA 1G20E 4X71A 4C0JA 3MWYW 1IBLB 5DEIA 1NMEA 3I30X 2PEZA 3TSZA 3U4HA 4DILA 3MBOA 3M4NA 2WJWA 3K0FB 4XYGA 4F6LA 1PQYA 5IFKA 4UEOA 1G21B 1N2IA 3S55A 3UWOA 3X1ZA 1ISFA 4EG3A 3SC3A 2FHPA 1WZNA 1HV8A 4XPIB 1AX9A 3EWIA 1OWNA 1DADA 1XWIA 4PR0A 3T3DA 3NIGB 3BCRA 1VLLA 3P19A 2HV8A 3OSUA 4GX0A 4EGAA 1GCGA 1RP7A 3TLKA 4C87A 1QUFA 4Q7EA 3CPSA 1M5UA 3KHKA 1S2OA 2NTNA 1IVNA 1RSZA 2A0WA 2FQQA 2QVZX 5JNLA 4XJTA 1TQ4A 2JFQA 1N6NA 2BR3A 5IDQA 5LUAA 2QHXA 1SOAA 4FXOA 4BRWA 1RQGA 1G0NA 1X9IA 4RY2A 4UEJA 1NLUA 4DTCA 1TM7E 3C3PA 2VBGA 3T1OA 4W99A 3CVXA 3TH5A 4RVGA 4DIUA 2H17A 4FFNA 2Q3BA 1Y33E 4Q7JB 5AXCA 1TEVA 5B55A 4PBTA 1W75A 2RIPA 2VF5X 3HV0A 1QYRA 1RWMA 3T95A 1XTKA 1JLSA 1PRYA 1W5TA 2C9DA 2JW5A 3I09A 3Q3EA 1Q95A 1Z08A 4HH1A 1N6IA 2KE5A 2ZANA 3L8EA 3ENZA 4L8LA 3OE7D 5E2BA 2ATIA 3X1WA 4BVJA 2DERA 3H5WA 3RRYA 1O54A 1K8XB 2QQGA 3L4KA 3HUTA 5EIWA 1SWWA 4AVYA 2AA3A 2G6TA 3JAWA 1N2JA 2RHCA 1GVNB 3JV7A 4UARA 3WHLA 4B6OA 1A04A 1OE0A 3E9DA 1FFXA 3DTVD 3JQ8B 2FZVA 3PFFA 4W5HA 1GZDA 5DHPA 2HPHA 4ZI5A 1P7ZA 2IYNA 1AQ6A 2H3HA 4Y9SA 3U5TA 4DJDC 1YQUA 4L5IA 1KO7A 4HRXA 3D8RA 1QFMA 2PA3A 2EKQA 4GM1A 2F1RA 2C9MA 2F90A 2W93A 2QLBA 3I6BA 3WBJA 2PUBA 4H1WA 4IJVA 2CLKB 5AT1A 3C5WP 4DW8A 3D1JA 3NHYA 2A1TS 3FYDA 4FCTA 1PWXA 5IP5A 3Q41A 2DR2A 4ZVTA 3SBEA 1AVTA 4HNQA 2FN3A 3GNTA 2WNSA 3DZIA 5KDOA 1L4EA 1FW6A 1DL5A 1Y6FA 1MAHA 1NQ5A 2NU9A 3EVDA 5EP3A 5IDVA 4D4HA 2QP4A 4C01A 4OLBA 4XB2A 4RULA 2JFYA 3FGZA 4P31A 5B1DA 3LTEA 3ROZA 3LDHA 3W6NA 3HXPA 1XA4A 2OAGA 3R9KA 3FOZA 2VHEA 3WL3A 3G0CA 2ISCA 4X1YA 3EB9A 1GLVA 4YJ3F 4BP3A 5JSYA 2O8CA 4PQRA 3E5NA 4P36A 3AUSA 4HLCA 1FQOA 3D6VA 3HFJA 1E64A 4J7AA 2BD0A 1ORVA 4EHIA 1RM3A 2R8OA 4YCMA 2NV2B 5DP1A 4LJ8A 3ZIDA 2RB5A 2UV8A 4KI0A 4YCLA 3HK2A 3UBTA 2Q9BA 4W7SA 3PYMA 1AE1A 3LBFA 1KETA 4NXNB 4CT5A 1TW3A 5JFTA 3ZOKA 2OBXA 2WTXA 1UPUA 1X70A 3A9RA 4AMGA 2QMHA 5CB4A 1BAPA 2IYLD 2FW0A 4N7BA 1GGEA 3OD1A 4QKQA 1SKUA 3GEMA 5FWYB 4WESA 4UUQA 1KJIA 1LNSA 2C77A 2NTVA 1PQUA 2HT6A 4U2DA 4JI5B 4D9IA 2P9EA 4AY6A 1IG0A 3TKLA 3DO5A 3B3QA 1I4WA 1HNNA 1Y1QA 4DANA 1GPYA 1NW7A 5EMNA 4MRVA 1CY2A 1GLNA 1CIVA 1MB2A 1GL3A 2P0EA 1CS0B 4ZHSA 1RE1A 1ZM3A 1EBUA 3TZBA 1A9QA 1SBCA 5JPDA 2YJ3A 2CXNA 1MTOA 2WPDD 2HLHA 4U0JA 4Y6PA 5K8TA 1E2IA 5REQB 3F4BA 2BH2A 2HMYB 1SUDA 4BMYA 3L0YA 3IP3A 2NXJA 2YBEA 3UC5A 4IIHA 1U0GA 3MM4A 2QJTA 3DG9A 1L1FA 2C7OA 3IXLA 4X66B 4N3BA 3KQOA 4RDHA 4DARA 3KSAC 3A4VA 4B3IA 4E5PA 3ZD7A 3KEOA 1YQEA 4HGQA 4LBWA 2NZ8A 3UMYA 4K9NA 4EQ6A 3GD7A 1NBOA 1BYIA 4GYKA 1OXTA 1W85B 3DPIA 1UC8A 1HEYA 2HIMA 4KTVE 4MP6A 1U8YA 1F2UB 2FUG1 3MTDA 3ETEA 4UPEA 3M1AA 1A9OA 1DAMA 2VT3A 4LJ6A 5INTA 4WWHA 1WABA 2DU8A 5KHAA 2X4LA 3MOSA 4TROA 1A71A 4F3KA 5IAAA 1PV1A 5KWEA 3EVTA 1BD4A 2WW8A 1L5NA 1ISRA 4UVEA 2W37A 4Y6QA 4RCVA 2X2EA 1DUSA 2PIDA 2FV8A 3ZS8A 3BHIA 1GRNA 4FC7A 4N9QA 5DW0A 2W6CX 1X7YA 3TECE 3U4QB 1NQVA 5IMBA 4X24A 1ZIYA 1NVAA 4MW6A 3CR7A 2V7VA 1U7XA 3EEFA 1U5CA 4RIFA 2VDOB 5G0SA 2JLXA 4HRVA 5TQ2A 4YDQA 1ISGA 3BDIA 3DD1A 3I04A 1ELOA 1SJ9A 2C29D 3A27A 2ECKA 4A8HA 3WOVA 4WZAB 3AOEA 4PSUA 2BONA 3WYGA 3NCTA 4CDGA 3I1FA 4EO9A 4W8HA 2O2ZA 4Z4GA 5C9ZA 3L7LA 5EUQB 2O20A 1QGUA 1REQA 2GTPA 1DTWB 5I9MA 1BFKA 4DJ5X 2INGX 5TT0A 4RHTA 4PAMA 1MHTA 1EG7A 2FXIA 4H15A 3NBYC 1FBTA 2F9LA 1LSSA 3DFIA 4AMUA 3GA5A 1TECE 4RELA 4QZVA 5KNCD 5KYYB 3F0TA 2F55A 3TNDA 4QICA 2CFOA 1XU9A 5HCUA 1Y6GA 2GWRA 4XEHA 2AN9A 1D4ZA 2WTBA 4J6FA 1P6QA 1S8AA 1WEHA 1OFIA 1YR6A 2IT1A 3GZNA 1Z0IA 2B99A 3CZAA 1FSZA 4G8JA 4URHA 1ZI6A 3Q2IA 4JUCA 1GV1A 4NCJA 2NGRA 3N5CA 1BKDR 1CXZA 1K5DA 1UWKA 4J3FA 2Z8XA 2C4KA 2IBTA 5AXDA 3EJWA 2X13A 1BHQ1 2Y9PB 3QBVA 3ID6C 2VHCA 1FE8A 3TFWA 2DH6A 5I01A 1XMSA 2FMHA 3UJ6A 3ED5A 3EZ9A 2NOAA 2DWCA 2GAIA 3KP1A 4V0ME 2D13A 4F96A 3NP9A 1KK0A 2Y1EA 1EFPA 4FFMA 3C6MA 4X1IB 3KB6A 1EFAA 2HRBA 5BNFA 3UO8B 4K6FA 4Z9XA 2DULA 4C7OA 3IPCA 2R5FA 4C5CA 3TGLA 4D5EA 3BHJA 5K0TA 4D57A 2GNPA 1NU8A 3KJZA 5B7GA 4ZYTA 2DJIA 3B52X 3JWJA 4W6ZA 4EB8A 3D0RA 3GRRA 2P69A 3ONNA 4NYIR 3BQ9A 4M54A 4QDJA 4C4PA 3HV2A 4NCHA 4DQLA 1XEWX 2HV9A 2IZ7A 1J8QA 2W2LD 2W2VA 1DG9A 1PSWA 2JIBA 3CKLA 1JEDA 4R1LA 3LPMA 4AG5A 2EIHA 3E05A 4OM7A 3LCRA 1SUBA 4OGLA 4Q4HA 1V16B 3NGMA 4XQ0A 3ZHOA 4EYGA 4F4DA 2ODQA 1E69A 4UBLA 4PYOA 5ALRA 3THOA 5C34B 1PVOA 1T2AA 3ZXSA 3L7MA 2BGWA 3HJBA 5CYOA 4DCVA 3CSUA 2AI3A 4ZVQA 5BWOA 2B8JA 3EOBI 2DF8A 3UK7A 2C42A 3KWJA 4RZQA 2GZ1A 3UV3A 5C4IA 3DXXA 5HZHA 1SHTX 4AD8A 4NICA 4HQOA 4Z1MA 1AXRA 3CX7A 2QRHA 1M1YE 4REMA 4IYJA 2JPDA 4UNIA 3Q40A 4LAFA 1PHPA 3EF3A 3T5GA 2WUEA 4NZ9A 4AZSA 1NBAA 4W1PA 4NV3A 1LLUA 1IBKB 2QL7A 2HBYA 1QZXA 4X7PA 4OBXA 3GOHA 3O31A 1P9LA 2PGNA 1TEXA 5DYYA 3F67A 2TYSB 5D1NA 1Y34E 3HH8A 5IBRA 5MGNA 5CHEA 1U1CA 3N5KA 2HBRA 4O3FA 4WDRA 3KYDA 8GPBA 3F3SA 4ZV4A 4YREA 1N4DA 2GPWA 1W30A 2I6GA 4HB0A 2YOGA 4HQKA 4CQMA 2PKCA 1SQFA 1UINA 1ZXBA 1F51E 2XBLA 3EDCA 4X41A 4Z4QA 4XR9A 4NDZA 2Z6VA 1Z12A 3TB6A 1ISPA 3ELWA 2NVBA 5BVGB 3OQ6A 4WLVA 1R0LA 5EJ2A 1NP6A 4CKYA 5CURA 2WIGA 7GPBA 1OZHA 2PZAA 1M1YA 1K27A 1XQ9A 1A2KC 3HR8A 3UAOA 5HE9A 4B6FA 2V7EA 1S1MA 1G4UR 3EGDB 3S1AB 1Z5WA 2C9CA 2EZUA 1J49A 3DFZA 4WK6A 2WWIA 1COZA 3PI7A 3PUKA 3OQJA 4OI4A 3E9QA 3LT1A 1P31A 4Q01A 3FYUB 2V98A 1QUEA 4PWZA 4X8LA 1TAHA 4M1ZA 3BMQB 3K0CC 2WEKA 1K88A 3C4JA 4FR0A 3RUFA 5F2NA 3LLMA 2IPXA 4LPSA 2WAYA 3E5RA 3E8XA 5DNEA 1MJFA 4BFWA 4HLQB 3MGAA 3HMKA 4YLGA 4CPDA 1HFJA 1P5HA 3IV7A 1X7HA 4ASUD 2AG1A 4S1OA 1I6MA 3JAKA 1CUJA 4OMFG 2N42A 2I8LA 3EULA 3ILXA 3D6TB 5C5EA 4JP1A 4IQFA 2J4DA 1U98A 4Z3OA 3VBCA 1XZKA 1FU4A 2YJ5A 5AKKA 5M3BA 4Z53A 2WFLB 1JHDA 2QNBA 4MJXA 4QQNA 4UOZA 4RIIA 3BMXA 3HA3A 2J6BA 5ADWA 4D0SA 1M2GA 4V1CI 4JYAB 3HB9A 4S1TA 5EYPA 2HMSA 1VMAA 3BPSA 2Y0BA 5CBPA 4DIKA 5G0WA 2ZJZA 5B7QA 5HNKA 4ZALA 5I7RA 3V5NA 2X9QA 3DQQA 3SMVA 3TR5A 3G23A 1CWUA 1H22A 3MELA 3DDUA 3OU7A 4NRDA 4Y1EA 5GINE 1ORIA 1XZHA 4E2ZA 2WSBA 3JD2A 4TVOA 1MRZA 1G1MA 1SXIA 2E55A 3CT4A 4IWYA 3QWHA 4D80A 4EW6A 2AN4A 5M7EA 1E2DA 3ZHXA 3WTCA 4DUYB 3U7EB 5IFLA 3W4JA 3ELYA 4PN3A 1N6OA 1P45A 16PKA 4RPGA 2DPXA 1XA0A 2D1QA 2FPPB 2NW6A 4LBYA 2MSCB 1VM6A 3SQMA 3ZNQA 4DBVO 2Y71A 2CGEA 1GGVA 3ICPA 3UKJA 1JP7A 4DCTA 4EY3A 2ZJAA 3QU2A 4N5MA 4BQRA 3OIUA 4G8CA 3NBZC 3MCWA 2HSGA 1Y3CE 3C6QA 1N8TA 1SPBS 2YVQA 5JNUA 2Q3MA 1RWQA 2R6R1 2XHEA 4FFVA 5FA6A 1L5FA 3HADA 3X1DA 4HGNA 2W2TA 4B3MB 4BP9A 3G5MA 1UMBA 3ANYB 3ZE9A 1M2VB 1XXHB 1AM4D 2H1FA 3AQIA 1M1UA 4GPBA 1EB8A 4QDXA 5JZMA 1I7SB 1APBA 1Y8CA 2P5YA 1BE1A 2VXOA 4O2BA 4I36A 3H17A 4HZIA 3ENKA 2PK3A 3R24A 4IZOA 4QUGA 4AMYA 4K05A 1FMLA 3SHFA 1Z2CA 4IZ6A 4R69A 1A8SA 3OFKA 2GEUA 5C81A 2XDAA 2FF7A 4FNAA 4ICIA 2YX1A 4AU1A 2N3ZA 1JDZA 2CY0A 4BMDA 2QZ9A 1YS7A 4LQDA 3VAZA 5EA2A 3JZIA 4EYQA 3LUFA 4G6ZA 2CCGA 3BL8A 1C2YA 3B85A 1YU6A 1L7DA 2LWIA 3GHHA 1LPNA 1YJCA 2TECE 1E2LA 2UZ1A 3PDWA 2G7MC 1C4KA 1X15A 4JEUA 4JT9A 2Z8YM 4BLOA 7YASA 2PS1A 3BIFA 1CKEA 5LCXA 2HGSA 2H29A 3LNTA 1OTXA 2VDVE 3FPSA 2HO4A 4EP1A 5FBHA 1Z6TA 4PAWA 3WKEA 2IXAA 3RFFA 2PXXA 3SE0A 5JYBA 2O1WA 3KYCB 4UU7A 2XB2A 4PHFA 5JSQA 3ZD6A 4B3SB 5C1OA 2JA2A 2XKBA 2EW8A 1NVGA 3E4CA 1FMCA 4Q6BA 3S2UA 1ND5A 1KSGA 1KY2A 2VBFA 4QJIA 3S2FA 5ITVA 5KTNA 1JEQA 2J9GA 3BGDA 2OCXA 3U4IA 1FZQA 4WVFA 7REQB 4DLRA 3H7IA 1FFSA 2VWGA 1YVDA 3ZY4A 3QKWA 5FP0A 4F2WA 2X9VA 1XRLA 2YFKA 3EQ2A 4HDMA 2ZT5A 3IAEA 1XB2A 3BUSA 3PLNA 4JVMA 4AB1A 5AW6A 5K99A 2D3TA 2OXTA 4GLBA 2P6RA 4HYQA 5AUPB 3QQPA 1QRUA 1T2CA 3KTAA 1IG3A 4DABA 4BKMA 5EJ7A 1MRSA 4DZTA 1P60A 2JHCA 3OT5A 1MG0A 3JTMA 5GZ1A 3NBAA 1NJFA 3C15C 5BNTA 1P1CA 3MGCA 4EMBA 4QDUA 3STVA 1ZK1A 3FPLA 2W00A 3HBFA 4GU5A 4MWGA 4U7FA 3QE3A 1EM8B 1X6VA 2NAPA 3Q6MA 4NMMA 2XXAB 1BE8A 5JBIA 2JGDA 2PIAA 3HB4X 1PJSA 1E5TA 2FMTA 3MK31 1ORHA 4M21A 4KYTA 3QVVA 3R7WA 4BO5A 4CI0B 3B8EA 1HNZB 1FFXB 2VYVD 4F9FA 2J9FB 3DJFA 5IAOA 1S2IA 4OHMA 1DBSA 3JPWA 5DCYA 3MUEA 4WCFA 5AJYA 5AVWA 1QF6A 1KXJA 4UQOA 1TM2A 3CZPA 2DE0X 4Y0VA 5LC1A 2C9ZA 4E6EA 4RTNA 5J4KA 1W36D 3GDFA 2F9MA 2VWPA 9LDBA 4P9NA 1GA4A 1Z6QA 5DDIP 2VAWA 1YDWA 4RY9A 1WV0A 3HCNA 4RVOA 2V54A 4TWBA 2QX4A 3JQGB 2GZAA 2PWPA 2X9LA 1R37A 1IONA 2PKWA 4QSHA 2NU9B 1WB5A 4BMOB 1AQJA 1TCUA 1UBSB 3S5UA 3QELA 4PX5A 2NTYC 4D6PA 1FK8A 5L45A 2PD4A 2QLJA 4N1AA 1UAAA 2J0SA 2XE4A 4AKEA 3LGSA 5K3EA 4F3TA 2FPGA 4TL8A 1NV9A 3CLKA 3OQIA 2AB0A 1UDXA 2RG7A 5I9BA 2G9UA 2GLTA 3HU1A 4RIEA 3RNOA 2EHDA 2HKIA 1N6KA 4FE4A 4EY5A 4O25A 1B6GA 4M1OA 3I9KA 3T7KA 5DRTA 5IZCC 3JQ6A 2FPLA 2H1CA 1PT7A 3JQRA 5JBQA 2DQYA 3O8QA 1XKQA 4LGCA 5F98A 3QEAZ 3IKLA 2AQ8A 1OROA 1VE3A 3OJEA 3KDSE 3MB8A 4G9EA 2WIFA 5CVTA 4JP5A 2WU0A 3PKZA 4OMDA 5EXTA 4C1BA 1ZUWA 3TIFA 3HZOA 1CQWA 5FPKA 1D2HA 4HY3A 4CL3A 1YZNA 2JAHA 3NRBA 4URZR 5TGTA 1E9CA 5MN4A 1R4MB 3FRJA 3O9VA 4JC0A 3UVEA 1YA4A 1SN7A 2BKVA 4MV0A 3AC0A 5IM4A 2FK8A 2XT9A 2HU2A 5AKLA 5KB3A 1UJMA 2V5UA 1C7ZA 1DAGA 1LTKA 2E1RA 3GZ4A 3H2SA 5EE1A 3CEHA 1M0EA 3IKVA 3C24A 4YUYA 3IE2A 1KZ1A 4Y2TA 3P4YA 1JE0A 4JVLA 1CUBA 1UT6A 4D4MA 2H4XA 3KSUA 3O0TA 2JLAA 5LLSA 5THKA 3RJ5A 3WK8A 1TZJA 2H2FA 3UJ9A 4HNUA 1L7EA 1C4OA 1HDCA 1NV8A 3INNA 1HT3A 1VL8A 4YCJA 3IDAA 1PUJA 5FHQA 3TWOA 1YFLA 2Q1YA 3KU1A 1CQIA 4BNJA 5JS1A 1I3NA 4LHVA 2VEOA 4BAUA 4C3VA 1BW9B 1QH9A 3DWGA 1G3RA 3DXZA 3M1IA 1XZNA 2YV2A 3DUWA 4XW2A 4HWKA 3ZTTA 5JATA 1Z8HA 2IY8A 3OZFA 4YWJA 3ZG6A 7MHTA 2I7TA 3NPAA 1F4VA 3UIEA 3G2IA 3LHKA 3GLRA 1M2HA 4ZRNA 1JA9A 3EPJA 1WXXA 2BR5A 1IUNA 1E9SA 1FUUA 2OAQ1 4WASA 2P2ZA 1PYOA 3DV9A 2A88A 4QECA 1GNQA 1LS6A 4CM9A 1T3TA 5A4IS 2ZUFA 1B8UA 3QV1A 4QOIA 3TW8A 2PUGA 1RABA 2PMBA 4ZC8A 2D2VA 2FP3A 5EE0A 3WLJA 3WO0A 1JDTA 4E5VA 1ZJWA 3H0KA 3ZI7A 4GMKA 1KR5A 1XZBA 2J3DA 1NI4A 2FPIB 3RYIB 4KN8A 4YQFA 3VVCA 4IQGA 1WUKS 2O4CA 2Z56A 1Z5UA 5AM1A 4L9RA 2I3BA 1XHEA 3V48A 1H2EA 1IHYA 2HCRA 5IN5A 2QMYA 2Z6UA 4KR2A 1ESNA 3CLRD 2OKCA 1USKA 4P7GA 3IPXA 3ANXA 2UUBB 1EFDN 2Y1XA 3RUIA 2RKWA 3W1EA 3U0VA 4FWIB 1E6LA 2QLFA 3RV3A 5TDHA 5LQRA 3AETA 3I6YA 3IEUA 1OVGA 4GDMA 3ACBA 3KFLA 1H6DA 4P2GA 4DWOA 4V0QA 5P21A 5FO0A 1JSZA 5LMCA 4LJKA 3HBLA 2ZBRA 4DVGA 4HQRA 1MEJA 1TM5E 3LM8A 1W5SA 4I6JA 1U2GC 4PBSA 4CLDA 5FTLA 1V9CA 2VAPA 3L9WA 2FE4A 4W7HA 4DREA 2PRJA 1K89A 4ROTA 2X4IA 4HG2A 1RAFA 5I9SA 3T3MB 3U3ZA 2CJPA 2NZ2A 2FKAA 3BM5A 2PCLA 4JLSA 4JYBA 1UIMA 1YGPA 2HWWA 2GPBA 1F5NA 3QLUC 4K9DA 2W22A 1EB9A 2CL6X 4UPDA 3TD2A 2B3TA 4C3OB 2CNKA 2C20A 1XKTA 4R1OA 5JXIA 4PZAA 3K9QO 2O23A 3ZXYA 3AR4A 2FGJA 1TB4A 4F9TA 2FZGA 3F1KA 3C97A 3JSXA 3HYNA 4I8IA 3FAZA 2C4NA 1BQ4A 4NK5A 3DDCA 3WMGA 3UPTA 3L0DA 3WWCA 4GSLA 1ECBA 1KQOA 4B9AA 4H1VA 2MHCA 1C9DB 4R3NA 4YGXB 4WZ6A 3UPDA 1EQAA 3EOZA 4UZEA 5C3MA 4G07A 2IXTA 2KW5A 3U5ZB 2QN2A 5KJ6A 1DBWA 3EWSA 1FNDA 3Q85A 2ISSD 1Z2OX 2QL6A 4TRMA 1ZG3A 4X3OA 4LECA 3EAQA 4FYWA 4Q0MA 5CCBA 3E9RA 3L01A 3N28A 2JGLA 5LVAA 1Y6QA 3EEYA 4BE7B 2ILVA 1IQUA 2ZWAA 5G40A 2B98A 5LMNB 3A6GA 2JJ8A 3QYPA 3W79A 3M4ZA 1GCOA 1O6ZA 5DISB 4JC4A 4P08A 4FNGA 5EQTA 2XCSB 1JEYB 4TTAA 3TRKA 4K2HA 4JB0A 2WF5A 3AIOA 4I4LA 3QVGA 3E2PA 4FOLA 4RTJA 3WK5A 6YASA 1GFIA 4BEVA 3SZ3A 3SXUA 3E61A 4LXUA 1JDJA 1XTZA 4DN6A 2XUGA 1E7WA 2H92A 1M8GA 2HXYA 4CW7A 2CBXA 2PFGA 2R3SA 1ISHA 3I39X 3HE3A 3WGLA 4DMFA 2PY6A 2VSYA 3FI0A 4MVJE 1VFNA 1RXVA 4YQZA 3AT1A 3FOFC 2N47A 2IVFA 1BE0A 3I8SA 1RBQA 5B7PA 3QOXA 1DJQA 4ZVOA 1Y9ZA 4DDUA 4NARA 1Z6PA 3AB8A 3C5CA 1W35A 2IDKA 3HCBA 1IJEA 2O48X 1N5LA 3SR4A 3ORSA 1E1KA 1CDDA 3B2QA 3LUBA 1MHPA 2EWMA 2VPQA 3U81A 4NMXB 4V1CB 1ZM2A 4G3XA 3KEFA 3DFKA 4M7OA 3RRFA 5BQ3A 2R5WA 4KWEA 5GJVC 2C5BA 4ZCQA 4QJ3A 3FSRA 3BXEA 2EDCA 1EGHA 4E4TA 1T25A 5I7VA 5IF9A 1ECPA 3E03A 5DGCA 4YBRA 2FEKA 1T1GA 3RKUA 3OIDA 3I6ZA 2P5UA 2CJXA 4WCFC 3H9BA 2EBWA 3F96A 3GGSA 4IGFA 4ND8B 1TCAA 4ER3A 3PEVA 3EVZA 3WLTA 1HDRA 5LXTA 1YWGO 1RD4A 2EGHA 3FPBA 3R0VA 4MVJA 4M98A 2ZJYA 5T4FA 1QTNA 2IBMA 1J1IA 3A31A 2EZ8A 3LBIA 2LP4Y 3Q0IA 1EESA 1SU6A 4FK8A 1U5AA 4F1JA 2QPTA 1T6NA 2H59A 3MRVA 1WVGA 2ERCA 4X20B 4XOIA 4FE3A 3CCBA 4FKMA 5CU7A 1PGNA 1G5PA 1NR5A 3GGGA 3X44A 2ZUBA 4ZEOA 2Y27A 3VVLA 3DDNA 3ZV3A 4D9GA 1K7FB 1BA2A 3IEPA 4URWR 3CF0A 1TRKA 2VR1A 2Q9CA 2Q7XA 4Q7MB 1IVYA 3PENA 2VNIA 2QRZA 3UH0A 3B38A 1P29A 2ZSUA 4FT4A 5ALOA 2P62A 1X7DA 2NQ8A 1P8AA 4P3PA 2ZRHA 4U5QA 1CW2B 1UBEA 2QTAA 3H3XA 3ZCQA 1TD1A 4KE6A 4HJRA 4G65A 5KUTA 3HFGA 3U7RA 3PCTA 2GN0A 4MLPA 3UB2A 3UENA 5LWHA 4WKBA 2FN4A 1JS1X 3ULKA 2DCMA 2XMCA 1YCFA 1U80A 4LOIA 1Z29A 3JAKB 3IP6A 3M6IA 1RRCA 3ZHTA 2D0IA 4JLDA 4ZT6A 1B2LA 3VI4B 2BBSA 1LDBA 3TF5A 1LUAA 3NTOA 4RACA 1PS9A 2I3DA 2YIJA 3TTTA 5D3KA 1GZ7A 3CS3A 1LEHA 4C7XA 4C4YA 4IXTA 3BWEA 4I5IA 3UZUA 3EARA 2YYYA 2WICA 5HF6A 3VYVA 3C8MA 5KPJA 5EYPB 2BHTA 2UVPB 3EFOA 3T5DA 3PUXA 3RFTA 3T7SA 1DDOA 4ZI2A 1K3FA 2W6JD 4JLNA 4AZ0A 2HF8A 3GZTB 1GZ3A 1YUBA 1ZUNB 2C2ZA 3A04A 2RKBA 4ZT7A 3WIEA 4ZMRA 2IXDA 3N05A 4GM4A 5HJ2A 2ZR0A 1AY0A 1KSHA 4DM4A 2Y68A 3H2KA 4DDVA 2WZCA 2ETVA 4RTSA 1ZNZA 2W6NA 3WL4A 2H0QA 1YR7A 4MUHA 3SM9A 4PR3A 4NENB 1EWVA 2GXSA 2P5TB 3D43A 2OFPA 5GVRA 1HI9A 1J99A 2A14A 1XRMA 3GDWA 2ORWA 3HC7A 3LPAA 2VYNA 4HH3C 4LQ4A 4R2HA 2Q8QA 2RBGA 4MWCA 3L18A 4K9RA 621PA 5EXXA 4BQIA 4DV4B 2CK3A 2GD0A 1U8ZA 2RH4A 4OHVA 2Q6TA 3ROMA 1QX3A 2BM1A 2Q4BA 2VJMA 3M5PA 3FNRA 2PJDA 1DP4A 1QLJA 5FPPA 3IXQA 3P71T 4WOCA 2QJOA 1SXJB 3NKVA 4FDTA 4HGYA 5AW5A 5KBYA 3VZSA 2JLCA 1WBJB 4EG8A 3MPUA 2BSQA 2A67A 1QRRA 2VDUE 3AJDA 3GRPA 3RF7A 1OW3B 1S3IA 4R2MA 1STOA 3EPPA 3LRPA 2EG5A 2WJVA 4JQCA 1VHTA 3WB1A 1VJTA 1QO0D 4BLVA 2ES4A 4IDNA 3UK0A 3E7DA 3P2IA 1TTTA 3WL5A 2DFDA 4I4NA 4CRWB 2XVAA 3JRXA 2ZRFA 2FQWA 1G2PA 2H1RA 1PNRA 3KOWA 3LS2A 4NFHA 3KAPA 2GEKA 4OJTA 2GAJA 2C3MA 4AX4A 2CJWB 4FMDF 2RJ3A 2ASVA 3FMVA 1L7AA 1Z2DA 2B6NA 3RODA 3CLHA 5L6MB 5B4VA 4ZKEA 2WU3A 2FSSA 1D2GA 2EJBA 2YZMA 5KTRA 2UZ1B 2R7MA 5C8XA 5JEEA 3JQBC 4XE5A 3E15A 5DBOA 4QUHA 3TOVA 3GLIA 4YJGA 1Y3HA 5KWVA 4BO3A 4PYKA 1WDKA 4WLOA 3ZBTA 4ZIRA 4RO0A 5GJCA 2BFWA 4C22A 3BWYA 2OZEA 1YB5A 2G07A 4TTVA 1DRKA 1JHMA 1HEUA 4H1TA 1QZZA 1THMA 3B3AA 4PSKA 4UU0A 4DLTA 2VP4A 2MMCA 4ZTBA 3NHBA 3DE7X 1L4YA 3NRJA 3IVXA 4R71A 3D7RA 1T4CB 1UBCA 3VH3A 5FOQA 1L5MA 1BXZA 4JBIA 2AKYA 1C1YA 2GN9A 4WUVA 4F7DA 4W5NA 3KQQA 4QLAA 2CFIA 4A6DA 3RRZA 1VRVA 1KEZA 2O7RA 3BK7A 2I1VB 2ZJ3A 1IN6A 5HIMA 3VH4A 3R6WA 1IXSB 4Q47A 1UBGA 3LOPA 4UVDA 2N75A 5IKPA 4K87A 1NC3A 1XQVA 1NXXA 2MU1A 2C5FA 2YY6A 2XGGA 4BUCA 5C18A 4ECEA 4OBBA 4HXGA 3BN3A 1H93A 5T3UA 1NDQA 3MN1A 4QOFA 3TOCA 4X0EA 4DRYA 5IMSA 5FL7D 3IO3A 3WNVA 3WV5A 2GZMA 4YALA 3MG9A 2YNMA 2NMVA 1YGYA 2R48A 1MV5A 4A0HA 5KX5A 3TUZC 4LXQA 4FYIA 3ZUPA 2J07A 2ZTHA 1PJAA 3HXTA 3SIPA 3PK0A 2IQIA 4MUYA 3TZQA 2N0SA 4FBGA 2ZS9A 2XGSA 2J8ZA 3WQHA 3ZWVA 1G8FA 2OOSA 1AS2A 1GGNA 3T9AA 4GOND 4PO3X 4PW0A 2WAMA 3EA0A 2IHZA 3WHPA 3R7WB 1JMYA 3H9CA 4WKOA 3LECA 4D4LA 1QS0B 3P5SA 3ILSA 4KN9S 4NPCA 1SKQA 1E8NA 3SHQA 3UFXA 2OQRA 3RW9A 1NHGA 3HNPA 3R5JA 4G1UC 3OIFA 2YVAA 1Z38A 4EMUA 3WNBA 2I67A 2XEXA 3JCZA 3TAXA 1W47A 2ZU6A 3LUHA 1H1LA 5J47A 2ZB4A 2UZ4A 3EIHA 4FD3A 2Z1DA 4UREA 5EFZA 1ZICA 3U3KA 4BLUA 2XUIA 4MLDA 5JLAA 1F6WA 3KZVA 4LPKA 3SQWA 4X63A 1GT91 3LFTA 1PK7A 3QK7A 3GLHA 2FQXA 4LXXA 4KGZA 1Z13A 1K4KA 2W8ZA 2EFCB 4BFXA 3K73O 3HSSA 2ID9A 3QELB 3GJ7A 4R05A 3ZDRA 1IN8A 1L5VA 1WXFA 1S02A 1D2RA 1W0CA 1JX6A 3EVNA 3QLEA 4OFBA 5AJWA 1J2TA 1YJ8A 3WZMA 4BU1A 4P0QB 4WZBE 1JHQA 2VWHA 3E8MA 3UW3A 2EQAA 5TQVA 3QXSA 3TLYA 5HCIA 1Y3AA 3D54D 3IHTA 3N7AA 5EXPA 1RJ9A 2WOJA 4LK2A 3ZWAA 1V5EA 1KVUA 4LOAA 4PC1A 4PNPA 3K9CA 3AF2A 3AI7A 1QVAA 1X3LA 1Y5LA 3O8QB 3QE4A 4QEKA 1MOPA 5EJEA 2VJPA 3QHAA 1ZXLA 1HYEA 1ZMOA 4MWDA 2OHOA 4DV7B 3PNVA 2FZKA 2FN7A 2OEPA 4EG1A 3ABIA 4Y7CA 2A9KA 1O6GA 4N0EA 4V0SA 4DZRA 3D1VA 1QCCA 2W5UA 2OQ2A 3UEOA 5L3SA 2QU7A 1L7PA 2O7VA 4RK5A 2VAXA 4UE3S 3D02A 1ZDMA 1Z2NX 4GE0A 3K6KA 4OIMA 1ZCJA 2OV3A 2ZVJA 4KVGA 1QP4A 3HJUA 4XM2A 1ISIA 5AIBA 3K9GA 3TTYA 1N6HA 1XXLA 2XT0A 2Z58A 3GIDA 3I9FA 3QVXA 4XLLA 3MCZA 4GPTA 2CZQA 3NP7A 1HRKA 4G1VA 4WZBA 3EEOA 2E4YA 4J0JA 4KFRA 2ZE8A 3RIYA 2PUDA 3TZCA 1L6IA 2R85A 3O26A 1Z4OA 2CHVA 4TRNA 1J6UA 2VH5R 3S8MA 4ACBA 4M1EA 1W48A 5MHTA 3JASA 3QOWA 3T99A 3QE0A 2B0CA 2HHHB 2O3SA 4JLAA 1CQIB 3L46A 1BU5A 1AQIA 1CE8A 3L1UA 4ZZ2A 4LF7B 4PZYA 4XQ9A 5CLQA 1IM2A 4DZZA 5KWIA 3DB1A 4JKIA 4N3NA 3RTGA 5AW7A 1GD1O 4I9FA 4HC4A 4C06A 3ZHVA 1B6TA 2ZT7A 1KO1A 1J1ZA 4LOKA 2PUVA 4WLEA 5BQXA 1JI3A 3VR3A 4PYRA 5CX1A 1ZOOA 4DRXA 4RPLA 3RS7A 5IG2A 1FMTA 2QORA 5KYWA 3A1EA 1TQ8A 5EG5A 3MQFA 3RUAA 3OY7A 2A57A 1OLUB 1FXWF 1PJ3A 2HIAA 2Y6UA 4L8GA 4NZPA 4E14A 4XIYA 1EGQA 1TE2A 2Z4TA 3TW8B 2VJOA 2GBLC 2ORVA 2QXUA 3C74A 3FDJA 3Q4GA 4QGAA 3OAAA 4RABA 5COBA 3RC2A 1V4VA 3E3LA 3AIIA 1UBRS 4JX9A 4ZMBA 1XDWA 1XD2A 1Z4KA 4L73A 4LSGA 1Q1QA 5KMGA 3AXSA 4TGLA 4PO1A 4MOWA 4KDEA 4PHTA 4KHPB 2NQTA 2X42A 1W2WB 4GGPA 3RHFA 2X3FA 5I4CA 3CRNA 4JWKA 5E9JA 4OATA 1H23A 1OA0A 2DSTA 2MSLA 1LTHR 2ZDHA 3GFRA 2F4VB 1HE5A 4MIEA 3CTPA 3KEQA 3WHIA 1SNYA 2DYKA 2R1TB 3IAM6 5ES3A 4O4JA 5EPOA 2IWRA 1QLHA 4EUKA 4HDNB 4OKIA 4P3OA 2ZTSA 3TVTA 3AHJA 1R9JA 2VSOA 1YR1A 4C0SA 1FVXA 5EL0A 2FA9A 2IXGA 2OBLA 1SVMA 4BHTA 3NAGA 5DM70 1GXSA 1B1AA 1DBQA 1I7NA 1T0BA 2DMRA 3A1NA 4IKOA 3SU8A 4JU9A 2HC9A 4QL3A 2ZVDA 1UAYA 5LQJA 1TTPB 4WK0B 3PXGA 3L77A 5JMWA 2FPOA 2FZ5A 3E0XA 1QNFA 1PUXA 1TL7C 3PXCX 1A4IA 3EDYA 3I37X 3JARB 1R12A 2BCEA 3AERB 1E9BA 4HGPA 3UAYA 4W5RA 5GJBA 2JFXA 1U7DA 1XR3A 2WWHA 4BCDA 3DV0A 4TUYB 2ZWPA 1M8JA 3IXMA 4LWPA 4ZOCA 4FS8A 2R8RA 3KLPX 1YDMA 1Y9EA 2MTBA 2YZ2A 2G5CA 2BP7B 1I0LA 3F5SA 3A4IA 3NASA 4IV8A 3B60A 1BN6A 2XTMA 1RQXA 3OKCA 4UUBA 4M0EA 1R27A 3JD1A 4IJKA 3Q87B 4JT2A 1UADA 4XYEA 5IXYA 2IYEA 2YN2A 3GAFA 1JFVA 2X8JA 3OWOA 1JQDA 5KOHA 2GHIA 2YFYA 4QLBA 3JQQA 4GUAA 2AEMA 2E89A 4DV5B 4QREA 4FGLA 1B23P 2ZQZA 4P82A 4ID3A 4ZT5A 4CQNA 1Q0UA 3FI9A 2QM7A 3WZLA 4XIIA 4NX2A 2W48A 2O8VA 5EMKA 3UJ3X 1UDWA 2Y9MB 4LTMA 2H4YA 4EKDA 1XNQB 1YQXA 4MCAA 1L9XA 1XLWA 3WGMA 1CUEA 4MQ6A 2ZRGA 2OBFA 4D99A 4FFDA 5L7YA 1EFVA 1CQPA 3KO8A 3ZDEA 4CHGA 2YJNA 1N3LA 3E3MA 3NBMA 4R8KA 3R3UA 1Q1BA 1XAJA 2H85A 1MBZA 2GCPA 1GSIA 3GR6A 1JLMA 2OG1A 4URFA 4XX0B 2B1GA 1LLQA 2UU9B 1DT3A 1NSFA 3BFKA 4LG1A 1JFSA 4WECA 1E7QA 4AK9A 4GNRA 1AKRA 5AW2A 2JLYA 1BVRA 3W0LB 1KVTA 1ENOA 4NYJQ 1JJAA 5LJIA 1DSSG 1VPDA 1C3XA 3BTVA 3LBNA 1R88A 4FX2A 3AEZA 5FR2A 4G84A 4BU0A 4LDPA 4DOMA 3WRVA 4YCNA 1P1FA 3F2VA 1JDBC 3LU1A 3ANLA 4IFIA 1PL7A 3QPCA 2VSXA 1Z6ZA 1KVSA 2RARA 1L4LA 2ZI5A 1GRQA 2F64A 3V6LA 4FFPA 4QSMA 3GGJA 3IESA 4CHTA 2P65A 4MUIA 4EW3A 5G0UA 3I6MA 2WF8A 4UHCA 1AT1A 4DG8A 5CNKA 1DVRA 4XJVA 2CN1A 3IP8A 3MWKA 1AZTA 4FGUA 4PZZA 2P90A 3KR1A 5EHQA 3B53X 4YPVA 3HCEA 3HRIA 5TJ9A 1JB1A 2O0JA 3PI6A 3QZUA 2X7XA 1KQNA 2Q7OE 3TIVA 2W8BA 3PWZA 1M6VA 2YXEA 2DPGA 4F4CA 2V1UA 4LRWA 1TEHA 5JOQA 4MPPA 4PLPA 3H4VA 3DPSA 4K86A 1MB9A 4LJ7A 4EG7A 5LD2B 1XXHE 3LCJA 1SA0A 3LKVA 5FBRB 2G80A 5DN6A 5LXTB 121PA 3MT9A 2PUCA 2GJ8A 3PTLA 1SUWA 3ORQA 4EMTA 2CL5A 4KR7A 4WRRA 4C3ZA 3F78A 1NLFA 1EDOA 4DCMA 4EB6A 3WB9A 4L9AA 1R00A 1V8OA 4JR2A 4Z7NB 5TMPA 2EJWA 2XNHA 4IAOA 1XTTA 4X5OA 1P0PA 4TTQA 3T9EA 4QTTB 5DSZA 2D5BA 3USZA 4MRAA 2HAEA 2QTHA 1VSTA 1R50A 2QP9X 2V0GA 3WWYA 2EX4A 1Z4NA 2P9ZA 2PL9A 4C6TA 2Y67A 4HNTA 2YL2A 1KJZA 1W1WA 2ORED 1YBHA 3KT8A 4DCNA 4KO2S 4P4GA 3ZY6A 3KQHA 4RHYA 3PF9A 4ZFNA 2Z5LA 1HT0A 1XLUA 2ZT6A 4FD2A 1Y7IA 5CHYA 5HW0A 1NMZA 2I6QA 4QVKA 3ITKA 4ARZB 3QFCA 3HL4A 4NOMA 2HK6A 3IERA 5AOBA 3FOWA 3P0EA 1EUDA 4ENSA 3PRHA 1NATA 2JJMA 3DZBA 3MWEB 1BWRA 3ZK7A 2RB4A 2I4OA 2JIRA 2ZE5A 1TJ4A 2QD3A 3L4JA 1NF8A 2GBIA 3AP3A 3QMPA 1ISMA 1E32A 3O47A 3DHVA 1LBIA 2X0DA 2XGJA 1U0SY 2PGXA 4RVUA 4EF5A 4LY9A 4X61A 3INGA 3BWBA 2FSFA 4HEHA 3PEWA 1A8PA 3WJ7A 4FSHA 3JQCA 3LDFA 1CYDA 3PVCA 3FWKA 1HFKA 3MLBA 3NUQA 4Q19A 1FYFA 1N9KA 1JSCA 3F6PA 4O5OA 1THGA 1GRVA 2VYQA 3L0BA 2DFNA 3PFKA 3VUFA 3AVUA 2IELA 4RC9A 1Y4UA 2DQ4A 4OQ4A 3RKRA 3CUUA 2CXPA 3O4FA 5K9ZA 2AG0A 3LW7A 1HL7A 4QUIA 3ADOA 5HBRA 2LCIA 4PXAA 5ERGB 2EKPA 1WMFA 3VYRB 4IDQA 1RJWA 5K0SA 2PNJA 4G0PA 2O5RA 4IUDS 5IM4F 1CFJA 3E2MA 1C1DB 3PDIA 1G55A 3VU8A 1CY4A 4D43A 3KHSA 1U0BB 1IB6A 3ER6A 1CR2A 3T35A 4ALIA 4DA9A 5EGNA 4BV9A 2AUMA 1KI9A 1FNCA 2O4UX 3OD5A 3RASA 2VQDA 2JHFA 4N39A 5KVQA 4CLRA 4X92A 1JH8A 3GJXC 4JJ4A 4BO0A 3P26A 1Z07A 2G67A 1F20A 2WM2A 3DOIA 5CAEA 2HNAA 1KI1A 4KR9A 5KTMA 3ZCPA 3D3WA 1P7PA 1QP8A 4QUKA 4YJ2B 1RFGE 5B7NA 3G8DA 2YW9A 4DGSA 2C9BA 2DBRA 1UC5B 2WY2D 2MINA 5LP1A 2EJCA 3IURA 5DVZA 1RJGA 3VKHA 1O9GA 1YKFA 3G1WA 2GA9A 5CLFA 1CUVA 4ON9A 4F21A 1H3EA 1H0KA 3BHMA 2BOVA 2PSFA 3HJHA 3FAKA 3PXBA 1VKRA 3QLTA 4KO3S 2NU8A 4C4ZA 2A35A 2YBDA 4JBLA 3A4LA 3V33A 1RVV1 1J7KA 4H17A 4MI3A 3IR5A 4FYXA 5A4DA 2J0EA 1MVLA 4XLZA 5HS6A 1Z88A 1AXEA 3CX4A 4EAQA 4RA9B 1YRYE 3ZJYA 4J9UE 5K3OA 1K8QA 4FCWA 1M0WA 4UHHA 1TIPA 1JIVA 1T3GA 1Z17A 4E12A 3UGJA 5ALXA 4DLZA 1SU4A 4LDRA 2J32A 1P3DA 2VHVA 2WJHA 3NH6A 3PHHA 5B2ZA 4YJGB 4FYKA 3U61B 4QFBA 2QT9A 3V1UA 1KH2A 3QITA 1WTAA 1DC3A 1ULUA 2OFWA 4WPGA 3HNOA 1TCCA 3TNFA 1KBZA 1VE1A 3W05A 5BXYA 2PLNA 2WAOA 3BCUA 3LPNA 4FNMA 4JOBA 4Z1OA 3T5MA 5BYBA 4EF6A 3GNQA 3VNUA 1G5IA 1RZ3A 4IV0A 4WOKA 4XWWA 2ZTUA 3ROXA 2OP0A 4UDNA 1P18A 1WOYA 1ZQ9A 2O6HA 5EE9A 1U6KA 1L0BA 1E1CB 1CERA 1TUBA 5ALNA 3LCUA 3VI3B 3SHVA 4N18A 1HF3A 3DDZX 4UM5A 3O92A 3LAWA 4EHAA 3T12A 2PS3A 3IQGX 1ESDA 2B35A 4B5LA 5LZ4A 1V4BA 3CEMA 4J16C 4REQB 5JAZA 3PWSA 1GQSA 3MS2A 2HJVA 3ABSB 1HDXA 3PA6A 1E6KA 1GYQA 2I3AA 4RK1A 4TUYF 5DBFA 1ODCA 3PGJA 1THZA 4QJ4A 2QZJA 1TA9A 3AZPA 2WUDA 3BE6A 1D2CA 1QNLA 4EA7A 2CMFA 3V8RA 2VTKA 4BKPA 1FJ2A 5CD1A 3VR5A 1L5ZA 5CGZA 1XK7A 3VU0A 4AMZA 1D4OA 3C6YA 2G4CA 2OGWA 3PC2A 4KZKA 2QRLA 4J0FA 4KXYA 3ONDA 3KZMA 3UMSA 1WV1A 2FZLA 5H9WA 5HYVA 2C8JA 1HR0B 4AKHA 1N78A 1L5HA 4DM7A 1AS3A 4UQLA 2XD9A 4DJFC 2VDPB 4HZGA 3WXBA 4TQUS 4KOEC 3WLPA 4P0PB 3I5MA 4LZJA 2V3CC 3P8ZA 1VKJA 1QOZA 3RAJA 2R8YA 5J58A 4Q18A 5DLQC 4FQ5A 4IEFB 3EHDA 1NJ2A 1FJGB 4CE6A 2BJHA 3L7OA 1WU7A 2EZ4A 4MRSA 1XQXA 3UWSA 3L1IA 4P1ZA 1MOZA 1N75A 1P9WA 1WPXA 1YJAA 2FI1A 3EZNA 5TS3A 3N8IA 1O6BA 1R5BA 2BFBB 5A62A 4ZJUA 1H1LB 1MZVA 1X8LA 3M2TA 2GM5A 2VJCA 3OEEA 4TKVA 1CJCA 2C07A 1O8CA 4W8OA 3D81A 3GEDA 3NBQA 1W0KA 3E7WA 1G8JA 2HRQA 2A30A 3LY8A 1F8UA 2ZWIA 4Z1MD 3S6JA 1UANA 3Q3GE 5TPWA 2C2HA 3OZGA 2ZUSA 4ZC1A 3EXIB 1VLMA 2A86A 2P68A 3BZUA 1KOLA 4IIJB 2A84A 3H3JA 1ZM7A 3LYAA 1ZONA 3R4CA 2QYOA 1QOPB 3KKKA 2FPRA 3MJVA 4S35A 4F9GA 4HR7A 2O8EB 1ZH4A 5JZBA 1TZCA 3DHYA 3DXYA 3N74A 1AB5A 1Z7WA 2WJIA 2OGSA 2ECPA 4HD8A 2IPAB 5CA1B 2XLCA 2EATA 1T5LA 3VPSA 4BE9A 3CVOA 4CQMD 4WBNB 2IYUA 3AHHA 3ADDA 1QQ6A 3NJ8A 3UTDA 1WCXA 1ISJA 3CUWA 4BP8A 3HL0A 2FJPA 4RFVA 2ZBFA 5DHUA 2Y4NA 3FUWA 1N9ZA 4PLVA 4K6OA 4F3NA 2NUBA 3E22A 4GM0A 5DYTA 1UP7A 1Z45A 2CXOA 1TA0A 4ZEWA 2PQ0A 5B3LA 4QG7A 3VA7A 2ON6A 2H57A 4P84A 1BS2A 3L07A 3HEBA 2HPZA 4QXMA 3WQRA 4MAFA 1C7FA 2E37A 4NTZA 1YJXA 3BS4A 4A73A 3DR5A 5LQDA 2ZZMA 3ONWA 3BDVA 1VCIA 5LYJA 3PS9A 3UHFA 2AV6A 4E07A 5FTNA 1QKJA 2CLLB 3LIIA 1OXUA 3PFIA 5LXTF 5I47A 5HF8A 2DT5A 4GKKB 4WN9B 4TM7A 2WYUA 1AF4A 4BKQA 2BGTA 3PQCA 3Q8LA 1MAUA 1G63A 1GZUA 3K0SA 3FDFA 1CRQA 4B3DA 4BO1A 4LRUA 2D0DA 2Z3WA 1DEAA 4JI6B 4A2WA 4QU5A 5K3FA 2IU4A 3AUUA 3BIXA 4PLGA 3C5HA 4DV0B 3B8HA 3A6HA 1CE8B 4J0DA 5CFMA 1FU7A 4ETNA 1PEAA 2GO1A 4LJAA 1IQ0A 1GDHA 2A9RA 5SZIA 3VTZA 2GM4A 4FX5A 5BOSA 4WKCA 1YI0A 1U3DA 1CZUA 4S05A 3U13A 4AIIA 2RE8A 4WBSA 4JCOA 2E2WA 3K05A 4DLAA 3AR9A 3KJIA 3TN7A 3TYXA 2AMFA 1UQUA 4BN5A 2FDXA 1HLFA 1LA2A 3VR4A 1N33B 1UM9A 2IU3A 4K9LA 3CHYA 2PAFA 5A9RA 1OWMA 2JZNA 1QU2A 1QO9A 3S44A 4CM8A 4CEJA 1CUIA 3TMYA 2DTDA 5JMPA 2CDRA 2H7VA 4CDMA 1M9NA 3DQPA 2JFVA 1QGZA 5KTOA 5AVZA 3F73A 1HMPA 1TZMA 2A5LA 1O96B 1WDLA 2OECA 1Z4PX 3STHA 2QNRA 3OE1A 4DIOA 2OB1A 2AR0A 1K9SA 1J56A 3DVSX 3K8YA 2BTQA 3U09A 3D2LA 5LQKA 1ILEA 3M6FA 4BZXA 4GOKA 1U0HC 1ONPA 4MCIA 3ZK9A 1XVIA 4RZ2A 3T3OA 3IVCA 3HB1A 4HS4A 5AI6A 4A5SA 3TBFA 4O4JB 2JGEA 4YUVA 5JTTA 2B3DA 2JS7A 3EUEA 1JLHA 1NVTA 1QIEA 5TVKA 5EJMA 3TSOA 3G6WA 3UOAB 1SK9A 4EPTA 2YUTA 4GOXA 1QYVA 2VF8A 1S7CA 2WSMA 3HFSA 4GMGA 3WQQA 3NV7A 1NQXA 1NRJB 3TKAA 2XGMA 2OZLA 2Q99A 3LX6A 5G4KA 2EGGA 3H5LA 1GXSB 3RAGA 3UAZA 3BXHA 3WLNA 4B85A 4PXSA 1IPHA 2PNFA 3QIAA 4JENA 1A1SA 1Q1ZA 3O9ZA 3OLZA 1EE9A 1I32A 4I5DA 2F00A 4KFTA 4C0KA 3I01M 1DV2A 4UEWA 3GJSA 1GTVA 2RAUA 1BRTA 4JK3A 3ZQUA 1OIVA 4XWYA 2IP2A 3OUZA 4LZAA 1X1SA 1OT3A 4GICA 4W1RA 2WJAA 2BFDB 2NO7A 2Q0QA 2NT3A 3FPCA 4A8JA 1YF3A 1R0XA 4YJ2F 1JVNA 3VNAA 4V0OA 2FPUA 1K8YB 2JC3A 5JT1A 5K0FA 1PUIA 3ETLA 3HYCA 3GJ0A 5EWJA 3STTA 1HG0A 4N65A 1GPNA 2E6UX 1E4EA 4D8UA 3X1YA 1LRKA 4S1WA 2DWUA 1X87A 3GVIA 2GCIA 3DAFA 4ROSA 3IQWA 3EZLA 4HUQA 2HZBA 3ETCA 5J2TB 2I9PA 3BG5A 2X8JB 3MJRA 5KOHB 2HSDA 2VHJA 3N6RA 1UK7A 2G5PA 3BORA 1IJBA 1QG2A 3NX4A 3T8YA 4EZIA 3H1TA 3IJPA 1S2DA 1OXXK 4MV6A 3MBKA 2J0VA 3M3HA 3RBZA 3VAAA 2IS4A 4XGNA 3UMJA 4B2LA 3R7SA 4OQYA 4U39A 3K2EA 3TGWA 2JI4A 1TKAA 4L51A 2C4TA 4JUAA 4QAJA 4I3FA 1EZ1A 2J85A 1L2TA 3VU9A 1R8JA 1M2OB 3VZRA 2B20A 5F5NA 4L0QA 4Y2PA 3P5BA 1NVVQ 4OHZA 1OPXA 1ZJ6A 1ZXXA 5ECYA 1EFRA 1EK5A 1R3DA 2X1VA 5TNXA 1KC3A 3H6KA 1FRFS 3U4AA 3N8GA 3QGMA 4ZI7A 3RS9A 3SIXA 4ATNA 2P4EA 1E79A 1GPKA 4JUIA 4NC9A 4FDVA 4EVIA 2NYRA 2OB2A 3RVDA 4JNKA 1I1OA 4D9KA 4KXQA 3RBVA 4YEDA 3CLTD 1Y1PA 1W19A 1V39A 3ISJA 5GMOA 1HE1C 2G1JA 1M2WA 2PS9A 1XRPA 3O4VA 2IE0A 4WY5A 4RTOA 4PLYA 1ZIPA 4DM3A 4G5XA 3URMA 4Z54A 3R9XA 1F5SA 1RPTA 1ZN2A 3CT6A 3EW7A 3OTQA 1NDUA 3PHLA 4PSDA 3M6AA 2OK7A 1WMSA 3MINA 2XA9A 4WOBA 2P9GA 1KR2A 2MR5A 4XWAA 3WBBA 1SOMA 4AECA 2IHNA 4CIBA 1ZESA 1PWZA 3Q3VA 3OIYA 4YPOA 2DFPA 1SEPA 3QI2A 3WYBA 1XMXA 2DUNA 4GXNA 4EB0A 3K0BA 1H3FA 3R2JA 3LDAA 1GTJ1 2BMEA 3L82B 3QWAA 3TX6A 4HLUC 4J4TA 1KAQA 1XI2A 2A9VA 4BQFA 4UVHA 2Y0DA 5C35A 1ZRMA 1EUQA 4TQ9A 1EBBA 2C5LA 2A5GA 2W8BB 4Q21A 4I81A 4I1RA 4ZOLB 4JKOA 3P2KA 1TTHA 2CE7A 3QVLA 2J08A 2RAVA 2AFHE 3VR5H 2VTBB 1SXJE 4CT0A 4MROA 5B1IA 3S4YA 2E9SA 4QX6A 2FNAA 3GN1A 1V1JA 2IYPA 2OBBA 2PKYX 3S68A 4ZK6A 2OR3A 3ZDFA 2XUDA 3BERA 4GQBA 3K8OE 3FR7A 4YB8A 3RNLA 5L4SA 1ZD5A 4ESEA 5I8PA 1EX1A 3C3WA 3ANMA 4LF5B 2CKDA 3K70D 3KXDA 1GYPA 1BHJA 2VL7A 3F2IA 1MJHA 5EMLA 3LGAA 3V4LA 3I58A 3IDQA 4CM4B 4OPMA 2J3QA 1XGKA 4R1MA 4WXEA 1KFCB 5DNWA 3WMWA 1I51A 3HUEA 5AM2A 1D3AA 1I14A 1RMYA 3B89A 1SPXA 3A10A 5LZ2A 4CCSA 5LNK1 3ZWBA 3PP8A 4JIMA 4C0AC 5ENZA 2AFHA 1R64A 1F3LA 1U6JA 3PC6A 3QUCA 4MQEB 4RSGA 1KI3A 4D79A 5C37A 1MLDA 1GILA 4YK7A 4BFUA 5C32A 4KAFA 3D7MA 3SJZA 3ADKA 4IIJF 1KZHA 1TLFA 4JLKA 1EUDB 4AQYB 3JATA 4OQXA 3D0OA 4RJIA 2O19A 2D7DA 1ZCZA 2I54A 3K96A 4KPUA 2N46A 2OHGA 2CXHA 2SHKA 5AVKA 2HJGA 4C3UA 1BEEA 1WUTA 4O2RA 3RI3A 1U4OA 2Y0EA 3EEIA 4FE7A 3VO2A 1PJTA 3TJZA 3W1WA 5CA1F 1SD2A 1HDYA 3K31A 3L8YA 3UAGA 4YMHA 2MSEB 1JXMA 3R5TA 4PYMA 4WBNF 5I48A 4JUFA 2HTEA 3AWIA 1FX1A 1W88A 2QX8A 1ZRHA 5B2EA 1GZ5A 4C20A 5CVVA 2VFAA 1RW4A 1NJ5A 3KYIB 1USUA 4NI5A 1V7ZA 2AW3A 2ZRBA 1ODJA 2XCOA 5F1KA 5BSHA 4CLOA 5I9NA 5IHPA 4AJ4A 2NSLA 2IP1A 1QHEA 4GI7A 5BV1A 2XMQA 2XMGA 4WT7A 4HDRA 4R0VA 1KMHA 3HGQA 2PH3A 5JH7A 3UT0A 2XH8A 4BE4A 3AHFA 3CZ9A 3F6BX 5DCWA 4FJ0A 4H3VA 1HDOA 3UGKA 1KBOA 4BZQA 3ZPXA 3OT1B 2UUCB 1U81A 2ADFA 3KUDA 3SF8B 3I62A 5KWJA 1GTL1 2C4MA 5JS6A 5HZGA 5J63A 3SDBA 2ZRAA 5C5IA 2ZK7A 4JFRA 1JHUA 4YRLA 2QTVB 5FQNA 2I6XA 1O94C 2J9YB 2PYDA 1LC3A 1W29A 3WAJA 2D2EA 2FP4A 3OFSA 5HQJA 4CF4A 3GLUA 1II9A 4G5YA 1UEJA 4U2KA 2EOAA 3D3WB 5CB6A 4LF6B 3V3KA 4M1KA 2B83A 4JR0A 3RROA 1EK1A 2ZIWB 2MINB 3BTOA 3HP1A 4UQPA 4MIOA 4QUJA 2JBAA 1S2GA 3LXMA 5K0JA 2VPWA 4IOMA 4YAGA 2OV8A 1A8QA 3C3EA 1B0PA 1ENZA 1J0BA 2B8NA 1D1TA 1T5HX 1NQTA 4PYQA 1N6PA 1TZKA 5EIBD 2FUNB 2NU8B 3FLMA 1SBYA 2X8WA 3IAS1 4RPIA 4UFOA 2YRXA 4EJSB 2F8SA 2OGUA 3EIWA 3TD6A 3VR4H 2YVLA 4N3CA 3WWEA 3MS7A 2J4FA 3AUKA 2JD1A 3B3JA 3PD0A 2HFJA 4BNFA 1WZEA 2WIAA 2AEFA 3QJYA 4MPDA 3RSQA 2UYHA 2G9VA 4KXWA 1AHHA 4KIWA 1DBPA 5DM4A 1FRNA 1Z6GA 3K35A 3KALA 4ZVNA 3AG5A 2X77A 2AFIB 3QKSB 4MR8A 4Q3KA 4TV9B 3IOEA 5HF9A 9ATCA 5HUQA 5IDWA 3H1AA 4A8TA 1B16A 3PTAA 1ZP6A 1N25A 2OM2A 4L76A 1Y1LA 1FBNA 4ZMSA 3U6KA 3GFBA 2F4NA 2J6HA 2ZUCA 4ND2A 2WTMA 1VIDA 3RYFA 4CG0A 1CEYA 2WWYA 3SE7A 4O4JF 4RF5A 4OHUA 3TRHA 1M7BA 1KNQA 1KRXA 5E4FA 4P8RA 5FBLB 4S04A 2H52A 4KXFB 1VL1A 3RREA 3DEHA 4TT8A 4E1AA 4B4VA 3Q9UA 2ZJOA 1BCRB 4G4IA 3UY4A 3OF5A 4EECA 2P30A 4K9QA 3JYQA 1U94A 4KLZA 3C7KA 4LRTB 4I50B 5I6DA 3OLXA 1E5XA 2A9JA 3DMHA 3KOZA 3UMRA 3ZZ1A 1IHOA 1E1MA 1XEXA 2PL1A 1IATA 4G1EB 2P3QA 3TRIA 4YX9A 2YKGA 3ZQJA 1S5PA 2FLKA 2PBFA 2H1OA 3B48A 2BSAA 5U9CA 1QIKA 2CD9A 2G8LA 2Q1WA 3C3BA 1ZEJA 3KJXA 4JBHA 5DBEX 5EEHA 4FT2A 1L4FA 4WAUA 1I4EB 1YRAA 1GUZA 1Z47A 4UBJA 5C80A 4EY8A 1EXMA 3SBDA 1KOJA 5DASA 2C0PA 3CZ5A 5MN5A 1E2PA 1IMOA 1XWFA 2QE6A 2Q5JA 5DGDA 4RTQA 3D6NB 3GC6A 3K53A 4ID9A 4D82A 1B8PA 2EYUA 2DXIA 4OFZA 4YLYA 2CMKA 4Z8XA 4W63A 5IBCA 5KOYA 2YZKA 1L5HB 5J2TF 1RYMA 4LKOA 1XUOA 1YQTA 2VYFA 1VMDA 3QX7A 2DHQA 4IJQA 5BVHA 4HTAA 1F1JA 2FMIA 2GN8A 1RRVA 5KKAA 1TUIA 3LC0A 4O8ZA 1Z2AA 4PHGA 4DR1B 3U7GA 2FPXA 2DAPA 4O63O 5CLGA 1YUNA 3DDOA 1AKQA 4Y2YA 5AD1A 3T0GA 1SGWA 4MAMA 3P97A 3DAYA 3VHXB 1EDDA 2Q0XA 3D7KA 3VOAA 2Q6OA 3O94A 4BFSA 2P0AA 3PYXA 4WXMA 5FI0B 1A9TA 4JI2B 4QDOA 1KGDA 4ER0A 1BXRB 5BQ5A 3R8FA 5F21A 4BASA 3T15A 4YT2A 2XSZD 4B44A 2HCBA 2I2XB 3IBSA 4NCAA 3UPUA 2G0AA 3PIRA 4DSZA 4C07A 5TPWB 1ZL2A 2V5VA 1GCAA 2CEAA 1YOVB 1SBQA 3F5MA 5JDCA 2PRKA 2PUEA 1ZVQA 1Q7RA 2NV6A 1T9CA 1OHHD 2AC7A 2OCYC 3DO6A 3T5BA 2PD3A 4F56A 3O1IC 1Z62A 2AJCA 2QVLA 3KVVA 5IABA 4MVJD 4N48A 1RE0A 1DE0A 2XTJA 4J90A 1I3KA 3M6WA 1G3QA 1P1KA 1Y42X 3DZFA 3H1BA 5KC9A 2CT8A 1QYIA 4YRSA 1VLJA 3OOHA 5AXBA 2P2LA 1SVIA 1A5BB 3AZOA 3GEHA 4UZSA 2C5AA 3F8WA 4B82A 4Y30A 3IEMA 1C3OA 1WB6A 1WMDA 4KQEA 1NVFA 3EMBA 2HH9A 2VUHB 4M0KA 5D5HA 1ZLXA 2QRUA 1P5RA 1NPTO 2RGUA 1VKHA 1SKYB 4FEEA 4GLOA 3ESAA 3E22B 5EP4A 3K0AB 5IVDA 1ZH8A 4BO4A 4CEHA 2J59A 4AN0A 1FFDA 1LKZA 1RIIA 2CUKA 4PVDA 1SCIA 3ZJ4A 4ZOLF 2H51A 1XZLA 2HUPA 3C5VA 1K4YA 3D7NA 4BNXA 3D8NA 3AW8A 4TYQA 3H1GA 4GR9A 3PHCA 4NS1A 4RD4A 3F46A 3HU5A 5ECWA 2CNWA 4BNUA 4WLUA 2Q4OA 4PC2A 3DVRX 7ADHA 1W52X 1DMSA 3LHIA 2PFSA 3IAHA 3OA2A 4EPVA 3FHJA 3IBTA 3TLJA 3HZRA 3IDFA 4JLOA 1CRPA 2EWWA 4HDKB 1PDVA 1QAMA 3UOWA 1V11B 1CUUA 2OG2A 3ZDXB 4UNPA 3IT1A 3UHJA 2B8EA 1X1CA 1SXJC 2ZDQA 3F6CA 3DCYA 3LE8A 3OETA 3OZBA 4F3YA 1MCZA 3V8BA 2ZE6A 3MAJA 5NULA 5GP1A 2OFOA 3TL3A 1R0YA 3HCFA 2GT1A 4I66A 2IIVA 2VN8A 3IUBA 3BICA 1PJ2A 3FNGA 2D2XA 3LRXA 3DC2A 1CUSA 3COYA 3EFBA 3LUKA 1GSAA 2ICAA 4NG4A 3REFA 3GPCA 3LLSA 3LYUA 2WU4A 3LKZA 4MMXB 3RU3A 1OAOA 4CMCA 4YRBA 3F49S 2P9QA 3NB0A 5ALYA 5JI2E 2GFIA 3RIMA 4CFSA 1UM9B 5HIIA 2EL9A 3EH1A 3OTWA 2APJA 4ER7A 1D6JA 2O57A 4MNTA 3DW3X 3WADA 1OXSC 2ACEA 3SZGA 3TAUA 4IIVA 1DWUA 1XDBA 2J7KA 4KQ2A 4Y1FA 4CIYA <