2P2ZA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGMKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 62
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p2zA00
2HIAA 1SKBA 1FBTA 1E59A 5PGMA 1EBBA 2P6MA 5AK0A 3LG2A 4JODA 1E58A 4ARSA 4ARVA 3E9CA 2AXNA 2ENUA 3BIFA 3NTLA 3NFYA 4EO9A 3IT0A 1DKQA 1DKMA 3D6AA 3DB1A 1BQ4A 2P9YA 2QNIA 2GFIA 2DWPA 2OWEA 1H2EA 2WNHA 1C81A 1CVIA 2OWDA 2P6OA 1BQ3A 2P30A 3EZNA 3OI7A 4AROA 2P78A 1RPTA 2H0QA 3C7TA 3LNTA 2P9ZA 3IT3A 1UJBA 1ND6A 3LL4A 2P2YA 1DKPA 3QPWA 3GP3A 1IHPA 2YN0A 3D8HA 2H4ZA 4D4MA 4ODIA 2WNIA 4PZAA 4D4KA 1FZTA 3E9EA 4GPIB 2PA0A 1H2FA 2EKZA 3D4IA 1YFKA 1QWOA 1V7QA 2P2ZA 2P79A 1RIIA 3KKKA 4D4LA 4E3WA 5HR5A 4GPZA 2YN2A 3E9DA 3FDZA 4QIHA 1DKOA 5AJYA 2P9FA 1DKNA 3EOZA 3FDZB 1NT4A 3IT1A 3O0TA 3K4QA 4HBZA 3ZHCA 1QHFA 2A9JA 4D4JA 1DKLA 4IJ5A 4MA4A 3HJGA 4PGMA 2H4XA 2HPAA 3GP5A 3GW8A 1SK8A 5CU7A 2IKQA 1K6MA 1TIPA 3IT2A 1C80A 1SKAA 2I1VB 4JOCA 5HTKA 3MXOA 1V37A 1UJCA 4TSRA 4IJ6A 4JOBA 4PZ9A 1T8PA 2HHJA 1RPAA 3DCYA 2WU0A 1YJXA 4EMBA 5CX4A 2F90A 2RFLA 4ARUA 4FDUA 2P75A 3K4PA 1ND5A 3PGMA 2A6PA 2DWOA 2EKBA 1BIFA 2EOAA 1XQ9A 3F2IA 3F3KA 3FJYA 1C7ZA 5AJVB 5AJZA 2BIFA 3MBKA 3R7AA 3QPUA 5CDHA 1SK9A 2P77A 4FDTA 3QPVA 2ENWA 5AJXA 5AJWA 2H52A 1QFXA
chains in the Genus database with same CATH superfamily
3MMXA 1NXXA 3CZQA 4PGAA 2OLKA 1JLRA 4DLPA 5C31A 3EXEA 2O0MA 1SCQA 2JFVA 4H59A 3T7AA 4GOOD 1WDMA 3SXUA 3VSCA 2PBFA 3KELA 3BDVA 5F2OA 4B32A 5ILGA 2IYXA 4C6TB 5EXDA 1HT0A 1I0IA 2JI7A 3C8DA 3ZY5A 1PWHA 5BNZA 2GD0A 3CINA 1L5WA 1VSTA 1ZH6A 2JJMA 3EWNA 4MXDA 1TO6A 4HS4A 4O4JA 3RSFA 3TNJA 4F3NA 3S2EA 3CB4A 2ZWPA 1P8AA 5IAJA 2HWUA 3C3BA 3GWGA 4XFKA 2KLHA 3VH4A 1C1XA 3FCSB 4BX8A 4DRZA 2RGBA 1GRRA 1FFWA 1QH0A 3CZ4A 1DRVA 2QKYA 4B3FX 4ZZ1A 3FYUB 4ZO7A 1BEEA 1IUKA 2L19A 4E0BA 3TXAA 5KDDA 2HYDA 4GX2A 4HATA 3KOYA 2Y6VA 1PT9A 1PLJA 1RQNA 2CLIB 2WFLB 3SX4A 1WXGA 2J8ZA 5CUQA 1R5OA 3CSUA 4MULA 1DDIA 1EX9A 4MQEA 4KSBA 3N2LA 3EN0A 4TMKA 3L8ZA 2VSOA 4TLLB 3JZMA 1Y37A 4PC2A 2OXCA 2CNDA 5DLYA 4M0DA 2WU1A 1NUPA 4C6HA 4RC9A 2P8JA 4A1OA 3L4KA 2B1JA 1RZRD 1Z6YA 2A30A 5DYYA 4ZK6A 1YF3A 2C5FA 2FGKA 4J7AA 3IP8A 3GFGA 1SXPA 2CHGA 2VJOA 3EDMA 3OEHD 4OU5A 5EMHA 4Z5XA 1W59A 2DTXA 3LZ6A 2YVUA 1U2TA 2A9PA 4FEYA 4XYEA 3RAPR 4DLAA 4F38A 4ZT5A 1JR2A 1SCJA 3EUEA 4UFOA 1YDHA 2D13A 4E08A 3BDIA 3LBHA 4CCYA 1NULA 3QJYA 1OH8A 1T6BY 1I4TD 2EC5A 3OJXA 3ETEA 3E8MA 3R6TA 5IP5A 1EK1A 3OX3A 4GPEA 2XRZA 2MSLA 3BD6A 3PPWA 1NM5C 4V0QA 1MEEA 3W2HA 4PO3X 1JI3A 4O59O 3W2FA 4TRJA 4IJ5A 4EBFA 3CNEA 2YOGA 1OKKD 4Q03A 4C29A 3PUWA 1N6RA 2DZDA 1Z4LA 3U62A 2C0PA 4R9SA 4AJ2A 5JSUA 1KQGA 4MLPA 1LCIA 4DR3B 1Y82A 1I2AA 2CVOA 3DLIA 4MMZB 4C01A 5IZCC 1G8FA 3AI3A 1LDBA 2VPTA 2CNKA 3E61A 4G5RA 4RHEA 4EO4A 4Q1DA 1ISIA 4MS1B 2KE5A 3R09A 4V3BA 4PYKA 5I3CA 1Q74A 1QG4A 1V25A 3GC6A 2ERYA 1I3OA 3PRYA 3LD9A 3ILVA 4ZXPA 1PZFA 3ZHSA 1KVSA 3OIDA 4TPKA 5E7IA 3ZDZB 3UC5A 3HSKA 1N57A 2ZI7A 1NVBA 3QLEA 1DE0A 1QIGA 4M89A 2WF9A 2Y0EA 3R3VA 1RKUA 3WTCA 1V8PA 3KJGA 3EVCA 4PNHA 3N39C 1Q91A 2YHAA 2FUEA 1DTEA 1SRRA 4CE6A 5KNDH 3AKYA 3TCNA 1TEXA 3AERA 3BCUA 3IR6A 4JVNA 5B58T 1ADJA 3T9BA 2ZDGA 2X15A 4FCCA 4L4ZA 2BGJA 5TRTA 3ZH9B 3KUDA 3QXHA 2H65A 1UXIA 1NVVR 2OVFA 4HJXA 4AO6A 4HAUA 3U0BA 4CQMD 1KJWA 2YJTD 4S35A 1TLLA 3DUFA 4GICA 1KIAA 3ZE6A 1EFDN 1RYBA 4YT2A 4OP2A 4BE4A 3FG9A 3LP5A 4N3AA 5DNWA 1M6YA 2ZP1A 3GNSA 2WSMA 3HCBA 3OC6A 3P2MA 2CV2A 3B1FA 3OIWA 3PQ2A 1AZTA 3Q41A 4JODA 1B93A 2ID4A 3DFKA 5ENZA 4WRRA 3SQOA 1ONNA 2XBUA 5FOSA 4EQZA 1PFGA 2Q3BA 4XFDA 3GPLA 2CLLB 4MVJG 2QN1A 3E58A 4HLCA 3FW1A 4RHYA 4E5NA 4UOZA 3FF1A 4ARZA 3ZX4A 2A5YB 2IITA 2GPYA 3W8RA 1YFLA 2ZM6B 2WOJA 1G5PA 5CT8A 2FN8A 4C0HA 1KI2A 4QXQA 3V3KA 4ZT2A 1Z07A 3IUSA 2Q5EA 1N7GA 3OJ0A 2EYQA 4E31A 1EI9A 1XZMA 3OOJA 4JKIA 2W2XA 2YXBA 1QBGA 3FF4A 4JJFA 1I2CA 2H1IA 4PYNA 4L5JA 4RDIA 4DILA 1V11A 1OIXA 1Y34E 3HJNA 1WPXA 3EF1A 3LCUA 3TSYA 1KMCA 5H83A 4GPAA 4K6OA 1VPTA 1AD2A 3LLVA 2VAWA 2IEIA 5CNIA 1B6RA 1UQUA 4GOND 2FE1A 1XJWA 1J33A 2ZS9A 1XZQA 2IJGX 3C6YA 4PIMA 1BXKA 2RGWA 2P4SA 3FPEA 4V0MA 3SDSA 1U7XA 1XD8A 4J6FA 2ZTLA 4EITA 3TB4A 4C2AA 1KYTA 4FX5A 1QYCA 2OBYA 3C3EA 1M8KA 4GM1A 2ZXEA 1P77A 4L27A 5MFZA 2D7JA 2RH4A 3EWAA 3ZHXA 1B16A 3EY4A 2E82A 4WCDA 3ZWCA 4OU4A 1CHNA 1OA1A 1Y3BE 3FDZA 3S70A 2FXIA 1C7JA 1T10A 1W5FA 3AR7A 3IUMA 4E5KA 2PZGA 1RXUA 4Q24A 3MCVA 3A06A 3Q7RA 5DWDA 2CHEA 1NMZA 1PZHA 2XGSA 2D8AA 4LI3X 3PEYA 2R1UA 2V7WA 3CLRC 3GEDA 3WR5A 4HXEB 3GT3A 4B6PA 3D7RA 4NBWA 2CLEB 3ESZA 1PD1A 1W85A 3FWNA 4ZWNA 3W5CA 1WDTA 3BQMB 1WHTA 2E4UA 1MV8A 3WNQA 1KI9A 3QXXA 2RH8A 2O7VA 2OZKA 5KYVA 4CMAA 4S24A 2DHEA 1VGRA 2JFOA 4X6LA 3MELA 3NIBA 2O3QA 1V4VA 1A50B 1DOHA 3DDSA 4QAJA 4E5UA 4IIUA 4LJLA 1O9GA 1Q7TA 2BFBB 2J9FB 1RP7A 1ZEMA 2VK8A 2NT3A 3O31A 2H54A 3ASVA 5AVKA 3RBVA 1ESZA 5EWMB 5CD1A 3JWJA 4RZIA 4EB3A 1ADFA 2IW3A 5I5GA 1R10A 5U4XA 5DYIA 3H4VA 5J40A 1TM5E 1X1EA 2ZI9A 3SZ3A 2NV0A 1ORHA 4X3OA 2JKVA 2J0UB 1EP1B 4FEEA 3I2YX 4QDZA 3I5MA 2QIPA 4NV3A 4QLOA 3LPNA 3SZMA 2O54A 3BH6A 3HA5A 4DXHA 3RODA 4BXOA 4DMGA 3JQFC 3VOTA 1KAOA 3CF0A 3MBKA 3RS2A 1HT2E 3O91A 4IJMA 1XALA 4LHYA 3RFFA 1F0PA 5DXFA 1PZNA 2TMYA 3GFOA 4ZOQI 4X71A 5AW0A 3ENVA 5K6AC 3T0IA 2HIHA 1B0PA 2IYYA 5DJ5A 5F3WB 2FH5B 2BEWA 3PEUA 1PVVA 7REQB 3EASA 2ZWVA 1E59A 2IDJA 5DGCA 3DMTA 2CV1A 2MSNA 3MUOA 2ZROA 4WL0A 3A2MA 3NNNA 2NXNA 1SULA 1YOVB 1EBFA 1ZJZA 1VTKA 2B4TO 4RVCA 1HG1A 5K8LA 3QI7A 3ZXSA 4XW2A 3IURA 5K7SA 4AS2A 5AJUA 4RJJA 4B6GA 2EW1A 4V1CB 5JXWA 1A9YA 4ZVSA 1K7XB 4ZI7B 1CZOA 2V59A 3ENWA 1H2BA 1BXRB 2XVYA 3CH5A 2AN1A 2CL6X 3L1KA 4BVEA 2ZT6A 3I32A 3WGHA 4AD8A 4EF4A 2TS1A 4YQYA 3VVMA 4LFBB 3VZCA 5D5PA 4DBZA 2A9VA 2CHQA 4CMJA 3JD2A 3D7KA 1SUAA 2VDWB 1SWWA 2FJ0A 3NKFA 2ODNA 4FKZA 2CJYA 3HU1A 4GGMX 3BWDD 3QM1A 1AY0A 4TMZA 4TTAA 2Z6QA 3IKVA 2OZLB 3ZIDA 3FPSA 1MDBA 3VBCA 3EXFB 1SD1A 1BA2A 2H1SA 3JD0A 5JQGB 2QNRA 1CZLA 1NN0A 1Y1QA 4URHA 1RHMA 4P83A 3UB4A 3O0DA 5LQDA 1XT6A 4GVPA 1YBVA 2XGMA 4YUYA 1AV6A 1A5ZA 3C5VA 4B6RA 1ZESA 2FP3A 2NO7A 4OHYA 1J39A 2ZSHA 1SVNA 3D9QX 3UUWA 4HB2A 4KDRA 2REOA 3GR6A 4ZVKA 1EXWA 1GADO 2AZXA 5BP7A 4NFSA 1JIUA 1OT5A 2HSWA 5EN4A 1CERA 1G3UA 3PXCX 2OXTA 1KZYC 1QNFA 2EJCA 2RGGA 4NP6A 4EOGA 3TUIC 4NZZA 3CJTA 4L57A 3RVJA 3S2YA 1W35A 3AYZB 3JAWB 3MMPA 4P53A 3ZCSA 3LW8A 5AOVA 2DC1A 5GY7A 1FE8A 2DF8A 4QU8A 3VDNB 3P9SA 1V1RB 1EIWA 2JPDA 1H9CA 3STWA 1JDZA 1I3NA 2XTJA 3LDFA 4LNAA 2HMVA 3HUFA 4WA8A 3JVDA 1E5QA 1LBSA 3E9NA 5K2MA 3DL0A 3AUKA 5EJMA 2WHPB 1D7AA 1PWZA 1ZKMA 2G5TA 2FP4A 2HC9A 3EUAA 3OCCA 3WVNA 4JI5B 1WF6A 1L7DA 2GRUA 4HNHA 1GGFA 5E38A 1TIKA 1XK6A 2J48A 3C98A 5A7FA 2ZXUA 1B43A 2HLPA 2IZ7A 3LQQA 4LRSB 5DHUA 3U26A 1REQA 2RAVA 2W6MA 4FVTA 4YBRA 3OU7A 3UJPA 1D2NA 2JGFA 4WQMA 1QH8A 2JJ1D 2NAFA 3IV6A 1GFZA 1WUHS 4KR7A 5TSDA 2W98A 3QZUA 2DEUA 2I33A 3NKVA 1C8KA 4CMIA 2O1XA 2BKEA 3AKDA 4G23A 2QRKA 1BE0A 3IX7A 3OBIA 1NUHA 2EFJA 1OIWA 1KDVA 4PZEA 5CBPA 1U11A 3Q8MA 2ORVA 3AXSA 4LY9A 2WV7A 3WLIA 5BNFA 1AN9A 2BGNA 1C7ZA 1T9CA 1XEXA 2KYRA 3GCZA 3KLOA 4GGOA 3ZOKA 4CKEB 1M7BA 4M76B 1EFVB 4NDZA 2A9QA 3ABSB 2P3SA 1FW8A 4G65A 5CW1A 2W8ZA 3W3AH 1HURA 2J7PD 5IHPA 2GJKA 2P91A 3F5SA 2GN6A 3WB9A 2BMFA 4HZUA 2GPTA 4IIXA 2B25A 4R9RA 3ZXYA 4Q01A 4RK7A 3LSYA 2CLCX 4BB6A 5JFTA 1I3KA 2XNCA 3GNTA 4MOWA 1NY5A 3LCRA 4I66A 2ROQA 2DLDA 4MCAA 4B6EA 1UP4A 3EZLA 4URXR 1U4OA 3CKKA 5ALNA 2PRZA 3FJOA 1E1QD 3GAFA 1X0XA 1LK0A 3TR5A 5DCWA 4BUCA 1OKKA 2C2ZA 2PSEA 3DE2X 3IV9A 4MVYA 3IIIA 4P34A 3DM5A 3VXKA 1XU4A 4MVJI 3VYVA 4QFBA 5B58C 1G18A 3PGLA 2B2NA 1FEZA 1EAYA 3HA7A 2BFMA 1XDGA 2XNSA 3IAAA 2DRIA 4TM8A 5FA6A 2A5DA 4QOFA 3GRFA 5JNRA 3VNAA 3K30A 3R1IA 4DCOA 2X8BA 3TRDA 5CTAA 1IAVA 1CZNA 1JJFA 2IUFA 4OHWA 5BSGA 3G13A 4W8HA 1XKLA 4PR3A 3QV2A 4Q3DA 2PX6A 2QI9F 5ECWA 3G1WA 1UXHA 4LJ5A 3H1EA 5IAKA 4O2AB 4DLTA 1GQFA 1XX6A 1AUQA 1P5FA 1RLMA 1RWOA 1ULAA 2BP7B 1ONSA 2CXRA 1BE1A 1E7WA 1EVJA 2B30A 1JSXA 1ZL2A 3HI4A 4IV5A 4PPGA 1EE1A 1JWAB 4W8GA 5CHYA 4LRTB 3KKKA 2JLCA 1AF7A 4A9AA 2J85A 1HDZA 1X9GA 1EDDA 1PJ3A 1RQXA 2PFKA 3M70A 4KMRA 4YJ3A 5AIBA 4CZ2A 1FBNA 4NZMA 3KSDO 1N0VC 3KZXA 3DEHA 3NAQA 5GJBA 1RNLA 1EH5A 3EG9A 3W0LB 5FD8A 1W0JD 4HWTA 4D4JA 3WA7A 1IOVA 3LVBA 3AONB 4IXWA 1IXYA 4QOIA 2Y67A 1SC4A 3B1WA 2Q21A 5ENVA 4ZIRA 2Z2IA 3OAAD 3CB2A 1SIOA 2D6FA 2J9ZB 4J4TA 4IGKA 4EA8A 2HK9A 2ZJ0A 1B1AA 3IMKA 2Y9PB 3NTQA 5AVJA 3MWDA 2ZRAA 4JEMA 4X66B 2C57A 2X8LA 4IL5A 1G9SA 5L7YA 5K8JB 2Q4EA 5DGDA 3NATA 1Q84A 4PX3A 4I5FA 2H59A 2HQBA 3YASA 4TVBA 3H75A 3L4EA 1HXHA 2WU0A 5F4BA 3U3JA 3VDXA 3DQZA 4BMXA 4F5EA 4IJQA 3SJUA 3FD8A 4PQYA 3OMWA 4OFBA 4B7CA 4L4XA 3AU9A 3PKJA 2ZUSA 3I0NA 2G1AA 1R4MB 3WWYA 3SY8A 4R8RA 3B1KA 2CMFA 4ZCSA 3F47A 2Q9CA 1DJQA 1S2IA 1HFJA 3FI0A 2C5LA 4NBKA 5L3ZA 5I9LA 2ZBUA 3O38A 5IN5A 1P61B 2PE5A 1JEEA 1KYWA 1Y9DA 2R6R1 2XKAA 4C0LA 3W8DA 3W79A 5DM1A 2PLFA 2PSDA 4F1KA 1PJTA 1FSZA 2HPZA 1UZUA 3DMPA 3P5BA 4FJ1A 4RFSB 4XPIB 2OPHA 2IYEA 5IVKA 4FBGA 3Q7SA 1TZMA 5AJXA 1T0HB 3QG1A 2TSYB 3RAFC 4Q12A 4WOCA 3ZKAA 3EZYA 1EDEA 1RU3A 1YB1A 4BATA 1J1IA 3JALA 4B7AA 4GYKA 5JBQA 1YBFA 1N32B 2LVBA 5IVDA 1ZFNA 1L4YA 1FU7A 3LL7A 4NESA 3EXEB 3WBKA 5B3JA 2JFFA 1SB8A 2G36A 3GARA 5GZ3A 4EO9A 2G5PA 1N6PA 1PDWA 2CLHB 4V0KA 4EW3A 9LDBA 2AA3A 1Q17A 3CIFA 2IE8A 4FWIB 2ZR9A 4M1SA 2FF5A 2Q3EA 3HJTA 1ZONA 1E0JA 1WMFA 1BFDA 1NKTA 2FPOA 4JYCA 2H17A 5DTEA 3T3EA 4BQRA 4ACAA 1C9KA 1PBNA 1I4WA 1VMIA 4DV4B 3NEJA 2ZW9A 1RBQA 1JHXA 5DYTA 5F7ZA 1Z33A 1ENYA 1CJCA 4YA6A 1L4EA 4JBGA 5CVEA 5T8KC 3RHSA 1CP3A 4CF4A 5CFMA 2PJDA 3PFWO 4NOLA 4CL3A 2QX8A 2POCA 4HLNA 4A8TA 1RWQA 2IP4A 1A1SA 1V8ZA 2F00A 1J23A 5DV9A 1E9VA 3V1MA 2A3RA 5CFNA 3Q98A 1ZSVA 1MA3A 3NT5A 3N76A 5CNMA 2ASVA 1XMPA 4AW9A 2GEKA 5B12A 5M3BA 3A28A 1KZ7B 4EJ6A 4ODIA 4CM7A 5KX5B 4PZAA 2FPGA 3LUJA 2ZREA 3I6YA 3UWMA 1G66A 2J5RA 1H9BA 4RX1A 3VPAA 4WCFB 5IPFA 4RD2A 3F71A 2QMUA 1XRSB 1P5RA 3HCDA 2WF6A 4BNMA 1Z0UA 1DQNA 1KAEA 1KDOA 2OORA 5KJ1A 3VSBA 3EA4A 4RQAA 2FQYA 1JU3A 4S1WA 1SY7A 1LW7A 3TG2A 1DQZA 2FW0A 4CG2A 1R9NA 5KYUB 2MMGA 4TMTA 4OK3A 1T9BA 3N2GB 4FD2A 2REQA 4PSDA 4ZD6A 1YQUA 2FWIA 3BIOA 4LRUA 1I5RA 3BOSA 3ZWDA 1V3VA 4X00A 3ZWPA 1Y6ZA 3MYYA 5TQ0B 1E2UA 4RQBA 2FFQA 3W1WA 3KIPA 5TEWA 1V9SA 3R23A 4IOJA 3QW4B 3CTMA 4JLNA 2BGMA 1P7YA 4JROA 3RIMA 2QUZA 2PGAA 1VJ0A 3HV2A 3MHPA 5EHIA 1N3BA 3EVTA 4OGWA 3W9YA 4XKJA 2VKTA 5KOJB 5GONA 3VR3A 3INNA 4RKFA 1I7QB 1J07A 2P69A 4L5YA 2VTEA 3LZCA 4EL0A 1RT9A 3SZLA 2OFWA 1FIUA 1YI0A 3BXPA 1DFGA 5B36A 5J1TB 3OM1A 1GQOA 1UC9A 2IY9A 2V1XA 3UYKA 3VGPA 4ZHQB 5A1JA 1XD2A 4BQSA 3GLGE 1NSYA 1CJMA 4WGFA 4WIAA 1Z2CA 2EKDA 2PKRA 3HYLA 3DT6A 4JB3A 2I8CA 2A0KA 5TMDA 2VCYA 2ID9A 4FYHA 3UJ3X 5I4KA 3SQDA 3RHTA 3NBZC 2EKPA 2QYSA 4LHZA 2JJQA 1A5BB 2PZMA 2W00A 4TL7A 5KQLA 2E1RA 1H2AS 1EFRA 1IY8A 5ADUS 1QORA 1USKA 3GT0A 5F3RA 3J81A 1C8LA 4Q4AA 4PAOA 1J09A 1ZHFA 3BQ9A 1SKYE 1Y48E 2C2HA 2AE2A 2NZXA 4EEKA 4WEQA 2WWIA 4FR2A 4DG8A 1SOWA 3AOEC 3B9RA 4F9EA 1M8FA 1J97A 3UHAA 1CJUC 3ZZMA 1HX7A 1FOEB 2EDCA 4ETNA 1SKBA 1EJ0A 2CW5A 1MG5A 2GWRA 1T24A 3UICA 5IF3A 4M9CA 1HRKA 3RS9A 2JKYA 4KNVA 4H1VA 5KTNA 1V5FA 3WLMA 3MVEA 3UMMA 3CZRA 3ZDXB 5SYMA 4YV1A 1BX3A 2CDAA 2CLSA 1CVRA 5CA0A 5IU6A 4DRXB 2W6OA 4MJXA 3ZY3A 3WMRA 1X7ZA 1FFEA 6Q21A 2F3RA 2ST1A 4Q3OA 2K6GA 4V0RA 3WLRA 2HAEA 1NG1A 1VPLA 5KUTA 1GD1O 1YULA 5KYYA 4PF1A 4PRLA 1JWLA 4LSWA 4OFWA 1LPBB 2P9JA 4Q4HB 5LBTA 3UENA 4RPIA 2BEKA 3B1YA 4G37A 4H3VA 2DUMA 3EMBA 1NUTA 4MKGA 1AKNA 4L4UA 3LIPA 4M1KA 1KZ6A 4BDTA 2XE8A 1Q95A 2OO3A 4R8KA 4MK4A 3KSUA 2M6KA 2QRVB 3LC1O 3DBRA 3NWOA 1XVVA 3P4XA 1E2NA 4HEJA 4HQKA 4J03A 4M8NE 5ALZA 1QVZA 5JXIA 2ZRDA 3FGZA 3V42A 3WGQA 1CWUA 5FWAA 1U9JA 2Q4TA 1Q0SA 3TTTA 3NDJA 4IDFA 1QIDA 1T15A 4RVOA 3E48A 1CYDA 1VE1A 1GAQA 1O94A 2ZT8A 5C7OO 4F3TA 3FPLA 3NHLA 2H5LA 2XUOA 3AW8A 3DONA 4A1FA 3FYTA 2XVXA 4DQLA 1SHTX 3FOEC 2H7CA 2YRXA 3IVGA 3QOYA 4L3WA 2VP3A 3NC0C 4MLZA 3VOBA 2VS1A 1U0BB 1E2LA 1KJIA 3I37X 1VCIA 3TD2A 1W48A 2JH9A 4MW1A 1GYRA 1U0JA 1WSAA 4RFVA 3NHYA 3ZBPA 1F6DA 4JJGA 3RBAA 4CI9A 2Q7OE 3G23A 4AYXA 2RGUA 1IHXA 5KNBD 2HI0A 3PLNA 4DAEA 4FFVA 4KRXA 5JJCA 3T34A 3V8EA 3NV9A 1YOBA 1C30B 3Q6NA 2UUPA 3NBUA 5SV2A 3DLHA 2R6ZA 4EJSB 1RP1A 1WHSB 2XUZA 2ZJ3A 3FTNA 4J0HA 3HXMA 4QVGA 3F6YA 1KEEB 4CN9A 1BWQA 5BY2A 3MXOA 3AVXA 4AKHA 1XP5A 2V3WA 1WMDA 4R5MA 1PEAA 2O2CA 3KR2A 1DAGA 1LBIA 2O7NA 4QXPA 5HRAA 1JJBA 3DBLA 3WLFA 4BNUA 2PX3A 5B1HA 3V00A 3LH5A 2XIQA 4P7KA 3ZHYA 2ERCA 3EMDA 2WYUA 1JBKA 1IUPA 3WLJA 1TMOA 3SHOA 4FX2A 1SG6A 2XTAA 4LY0A 1H3FA 4E14A 2PX4A 4U8GA 3SYNA 2NSLA 2G72A 1K89A 3GEMA 3Q6MA 1GRVA 1C3XA 4KXWA 1ARZA 3G6WA 5D1NA 2PXCA 3W7VA 1IULA 1H0KA 1Y8RB 2B98A 1J8QA 1YQWA 2BFFA 2I4OA 1G6HA 2DHRA 3EGXA 3O6VA 5A4FS 4B6OA 2E48A 1EZ1A 3I72A 3VR1A 2WF5A 1TTQB 1L7MA 2X77A 3WDMA 5MHTA 1VMKA 3RC8A 3V8QA 1QGUA 3QH4A 4ZVOA 1P3DA 5E7MA 4KR6A 1NZJA 4JLPA 1AN0A 5ICEA 1MW8X 3LTNC 2FPUA 2VBFA 3A1TA 1NKVA 3ZBQA 4D9MA 2BN4A 3IP9A 3OU2A 3N1UA 1K7YA 2JLBA 4M0KA 3L06A 4PZZA 4AC9A 4PLPA 2RCYA 4UPDA 2FUG6 2FDRA 2QDKA 1BMDA 1OMOA 3K8ZA 3VKHA 2C3PA 4MW6A 5K9ZA 5BYKA 4WK4B 1TKCA 2V4ZA 2H57A 1W25A 4Z99A 4NF2A 4JX8A 2IOHA 2PX5A 4KE7A 1DBQA 1SUSA 1B8PA 1N6NA 2EIXA 3WIVA 2FRDC 2P4UA 3OY7A 3MGGA 2ACKA 3P0HA 4OA8A 4E6PA 2C7QA 1YJAA 1R0XA 2CBGA 2PX8A 4P8RA 3AF0A 4REMA 5LMZA 3TFOA 3OTQA 1QZZA 2WZQA 3CE6A 4DLLA 1WPGA 1Q50A 3LTEA 4X94A 3NRCA 3TVTA 1Y6QA 2Z09A 4IUYA 4LV6A 1BNCA 4MVJA 5EHNA 2H07A 3Q88A 4ND6A 4E30A 2D2EA 5ALWA 2P6OA 4DM3A 4ENRA 5MN6A 2NSHA 1RI4A 2CXNA 1IFXA 3HCCA 1I3CA 2YJZA 2ZWIA 4Q00A 1G21B 4M7RA 1OW3B 1A9SA 3SM9A 1P1IA 5BT9A 3AFOA 4QT4A 4KQEA 1U5BA 7AT1A 2EFYA 2IPXA 2XKJE 4V02A 2C04A 1BHO1 1U4NA 5EQFA 1LQTA 5EFZA 2ODPA 3LY8A 1ZRHA 3TIXB 5FEUA 1WXFA 3AF6A 1T3SA 4WBNF 1DJMA 4UVGA 1FXUA 1N6OA 2O52A 4RORA 1QCCA 3TGWA 4L4SA 4OKIA 1RJFA 2QQ5A 1LZKA 4HUQA 4OH1A 5HIIA 2H2HA 3G2HA 3G02A 1JVSA 2BFAA 1C0LA 4HNTA 4IDDA 4J6EA 1HETA 2JATA 3E35A 4OSEA 2ZUDA 4RD4A 3LBAA 5EJIA 1MIOA 3U4AA 2MT9A 1ZISA 2XUKA 3K0BA 3GG2A 4PLVA 1N2CE 2XYHA 2JDIA 1GGJA 1P0FA 3TL6A 3P7MA 3ZE2B 4QGSA 5EYPB 4EB6A 3EVZA 1FS5A 1ODSA 1UPTA 1SFRA 2FWBA 4BVKA 3K96A 3U16A 1WPRA 5HK9A 3EAQA 1WEKA 2C00A 1F0KA 1A98A 2GBGA 1IQ0A 2A4MA 3WHPA 3V8MA 3AETA 5K20A 1TTPB 2Z0MA 1PNRA 2DYKA 4MEJA 3AMVA 4Z4GA 3EISA 4B8ZA 4OMUA 4EY7A 3ZDCA 3FAKA 3EAFA 4QUGA 4LCJA 2CGEA 3HY3A 4CG3A 3DO8A 1P0MA 5J47A 3RU7A 5JIBA 2PS3A 4TTJA 1CB7A 2XOKA 2ALJA 2C2MA 4KFCA 1I2MA 4K9OA 1MAVA 2GM9A 1BSVA 2W6NA 2QT0A 5B2FA 3TOCA 3TIVA 1HV8A 3MT0A 3QTTA 3ZW7A 3LVRE 4XB1A 1MH9A 3NTXA 4IIEA 3SYRA 1N5JA 3O95A 2EZ9A 3Q5EA 2PU7A 2QSJA 4US1R 2G9NA 1FYFA 1E2QA 3UK2A 4CGYA 1IOLA 3W5AA 1C9NA 3HEMA 5TQVA 1WVMA 3S5UA 3M2TA 1I4DD 3EXFA 4TMVA 2W71A 1VB3A 3JYNA 1J5PA 2QVLA 3A6HA 1MH1A 3QJ5A 4B6SA 2VC2B 2YYSA 2H1OA 2HJHA 1UOEA 4DIOA 1COWA 2DLCX 1IQPA 1NF8A 2IQ5A 2EJVA 2NO9A 2DBVO 4U7PB 1F14A 2KBFA 4PG5A 5T4FA 2J9FA 2JGKA 3E7FA 3RAGA 4AT1A 1T4DA 3D3WA 2CC2A 2R7LA 4FWBA 4IF6A 2HU2A 4YR7A 4DXAA 1NVUQ 4DA9A 3T5MA 5I7UA 4HDRB 1P0IA 2X5OA 3EIUA 2RMKA 3DE5X 5LYYA 4KOEC 1S1MA 2FPPB 1F1BA 2XDQB 5B37A 2XQVA 1WHTB 1FDSA 2B4AA 1FTYA 2X4GA 2F3QA 2PCJA 3KZKA 4HPJB 5IK2D 1E6WA 1COWD 1SBHA 2OB2A 4QYSA 1BOOA 4LQLA 5FPSA 1KK0A 1GZVA 5FWYB 1V0JA 1GL9B 3T1TA 1DUIA 1ILEA 3VPSA 3JASA 4UZEA 4XYMA 4I81A 1SBTA 4PICA 4XTCS 1KR2A 3ZLBA 3TNLA 2ZQYA 3T5CA 3ZNPA 4BTVA 1DKUA 1G2IA 2HF8A 4Z8YA 2VAPA 5FL7D 1Y80A 3I9MA 2ZJ5A 1NVVQ 2AIRA 3NIGB 3JQRA 2AEMA 3KXKA 4UUPA 3WYCA 2YC4C 2F8MA 4IDBA 1UEJA 1M5RA 2IIPA 2ZI5A 1KSFX 3PT5A 4M88A 5LB4A 1KWGA 2ZUUA 3JAKB 4Q4JA 3L7IA 3RS5A 1QWOA 1NRXA 1G2QA 2O4UX 1KO7A 2H9AA 3WJ2A 3CW8X 3VPXA 4ED9A 3KC2A 3LKVA 4GPZA 4HTFB 3RSZA 4E51A 2VLBA 1SO8A 2ZQZA 1XQXA 4RXUA 4Y2SA 3R74A 5IG2A 5L4NA 2FN4A 3O2JA 1VE5A 3SIWA 1YA8A 3W5UA 4PYLA 3FDIA 1T4BA 3OLQA 1VLJA 5B1IA 5COBA 5IMBA 4F2HA 4QQKA 4B43A 4HO1X 1FNCA 1WSDA 3ONEA 5HCNA 1UBKS 1T4CB 3TRIA 1YA4A 2I65A 3DT9A 5EWJA 4PGFA 2N47A 4F72A 3BE5A 4ZVTA 3G5MA 1I6KA 1XQYA 1M73E 4I19A 3HGTA 5DTIA 2AZTA 5JR3A 4XQCA 2XQKA 1LF0A 5EAIA 1FP6A 3VU0A 4AG5A 1A8IA 1ISFA 1AUOA 1SIUA 2PZFA 3ICWA 3G79A 1QIJA 3PC2A 4FFMA 4L73A 4BECA 5LMNB 2QXYA 4FFPA 3KJQA 5LQMA 3GUUA 2JK0A 5SYNA 1VYVA 2IZ5A 1IMJA 2J45A 3V1LA 4B3TB 2DP4E 1IPFA 3H8VA 3MOIA 2CVHA 4DMMA 5BQ3A 1WV1A 5HKBA 1FFCA 1JQAA 2WBLC 3GUZA 4KDFA 1DEAA 2PZJA 1N6IA 4QGFA 1NJSA 3FVVA 4ARUA 1AX9A 2OV4A 1D1PA 2F67A 4NHEA 1PX0A 1E5XA 4H60A 1JALA 2P7IA 2VUIB 1OJ7A 4S1PA 3WIUA 2VHUA 2QTCA 1NVXQ 4FMDF 3RYIA 3GPCA 3TDNA 3I9V1 1I4EB 3ZXXA 4Z4HA 1OBVA 3QTBA 5CAEA 4QRIA 3UAVA 3HMQA 1Z56C 4C07A 3M1YA 3P9RA 5E2BA 2EEPA 2O8DA 4BQPA 5FO0A 4BZPA 3OTOB 1MV5A 1Z8FA 1UXKA 3UJ8A 3RDPA 2ZRQA 4G0PA 2PQMA 2JIBA 4WZAA 1FUEA 3KALA 3RU2A 4K03A 4EA9A 3E3MA 5CT9A 1H4TA 2VN8A 1H23A 3ETHA 5TPWB 1R4NA 4Z4QA 2P6MA 2PPLA 2BFCA 3SDBA 3UYLA 3W4IA 3ADBA 3MMZA 1DC5A 4L95C 1NJ5A 1IB6A 1V35A 2WE7A 4V2IA 1TTTA 5A0VA 1OD6A 2F3UA 5WRFA 3DVQX 3EMKA 3FB1A 2V0CA 2WJAA 4KQWA 1SOAA 3GEEA 5B57C 3BB1A 4F04A 5IM4F 4RGBA 3MRSA 1NI3A 2HRRA 3HFJA 2HV9A 3R6LA 4MIEA 2WTUA 1U7WA 4PXYA 2SKDA 3DB1A 4PO9A 5BRNA 3TH5A 3T4XA 4FLMA 3DUFB 3DBIA 5D6NA 2COUA 1ORWA 3GU3A 4A8JB 2NTYC 3AF1A 2AOUA 4KXVA 3RT7A 2QG6A 1ZVKA 2OMKA 4RLFA 3I0MA 1PNOA 3ZHVA 3SF8A 1PQ4A 3MTGA 2O0KA 5ITSA 2CLKB 4DPMA 4YRDA 4EPYA 1BU8A 2EDAA 4WINA 3ZD8A 1TUBB 4WW0A 4NBTA 4D80A 1EMDA 2AKEA 5E4YA 1A97A 3AWIA 3WMGA 1K5PA 1XWIA 5CEJA 1PQUA 4O5OA 3HG7A 3OY2A 2XWSA 2YMLA 5ALYA 5C37A 1VRCA 4H31A 1ZHOA 2QR3A 3GJ0A 3JYQA 3LC2O 4W5WA 2WAYA 4CIBA 4PO1A 3B3GA 2DU8A 2R00C 3JQBC 4ENWA 1RC0A 3JSAA 4RKEA 1RYMA 1Z2EA 4EHKA 1FTNA 1LB1B 1AHPA 1U1IA 4V03A 3A31A 3U7FB 4ZQCB 4OOEA 3FYCA 3C1OA 2M32A 1PJAA 1ESMA 3A6LA 3IULA 1DDOA 1E6KA 1R3UA 2VPQA 2AC7A 3FOBA 2RB4A 3G5AA 1R8JA 1NOIA 2H3EA 4WKNA 4L76A 3ZJVA 4EFMA 3HS3A 2XECA 2FW8A 1KOFA 4TMFA 1HOTA 4JBWA 1MXHA 1LNZA 1TW3A 1N4DA 1W1UA 1FUYB 2VHXA 2XI4A 1GVNB 2V96A 2EKQA 3O74A 3WLHA 3IEUA 3IE2A 3WGGA 4D74A 3UGJA 2OBBA 1P17A 2X2OA 1OAOC 1XGKA 4LPSA 2OCKA 4EHFA 1IEXA 3ZK9A 1W36B 4BO2A 3WSVA 4I9GA 2C4HA 1UT6A 2LCIA 1FXSA 2ZUFA 4MRNA 2VYVA 3HKDA 4JLDA 5FLYA 3EY9A 4X90A 2ZBDA 2JLWA 4NEQA 2D0OB 3CRNA 4G5XA 3S1AB 3EQ6A 2DERA 1J8VA 2RCNA 3N9IA 1FLVA 1WA5A 2FW7A 1MO4A 3L6RA 4RA6B 3TRJA 1LFAA 1ZCJA 1PK7A 5ALJA 3ZU3A 4JC5A 4FE7A 4TL9A 2PKCA 1S7CA 4KXLA 4QTYA 3NWJA 3PQDA 3GZNA 1WF3A 3DZJA 4TRNA 3MCAA 3SR0A 3U4DA 3L79A 4EPTA 2YWFA 4Y30A 2PH5A 5LU8A 2W6IA 4YMGA 4CRWB 3HZHA 2JHGA 2OFXA 2FMKA 5E1MA 1E4YA 4LC9A 3VC7A 2UZ1B 1ZA1A 3RT1A 2CL5A 2WLSA 3E9ZA 1HDGO 4C4AA 5BUCA 3V6LA 3NHAA 4L7VA 3X3HA 2QZJA 3BZBA 4QGAA 4ARIA 4F3YA 3AVTA 1NE2A 4REQB 2NACA 2XCTB 4OUKX 5DWVA 4KPYA 4Y7CA 3F7TA 1MW9X 1N3LA 3Q40A 3C6ZA 3I6ZA 1NNEA 5JU6A 3AUFA 2PH7A 3QVJA 1MAWA 1KGSA 4PFJA 2JA2A 4P5PA 2XMZA 1QIHA 1U9IC 1WUKS 2QPAA 3ASYA 4WWHA 4X93A 3SOZA 3TOXA 1GDTA 4WLNA 4M21A 2HLDD 4AG6A 3TLCA 3BXZA 3RSSA 1T4GA 5IM5A 3T5DA 1E3IA 4ZTZB 2OV6A 3UCEA 4PGHA 5C0OE 5DHTA 2VJAA 2FN9A 3N59A 3FSEA 3N74A 4DQUA 3AEUA 1KJ9A 1Y5RA 2B36A 1I4OA 1U8FO 2E0IA 3STHA 3IIEA 3WLSA 3MGKA 1JFLA 1SVIA 2V74B 3FNBA 3JWEA 1P7CA 3O3MB 4WD3A 3JWPA 1KKMA 1S8OA 2AF4C 5F76A 2GI4A 3PQ7A 2FY8A 5L7TA 1IM2A 4U7WA 3W5JA 3JTEA 1H5QA 3K8YA 1ZIYA 3LKDA 1NDQA 4CKXA 2UV8A 4LJ7A 5HJEA 2YN0A 4NCAA 2Q49A 3L05A 2DWCA 2XRFA 1M2KA 3BG5A 2FA9A 3INRA 1J2UA 4JLAA 1ABEA 1H3NA 4BN4A 2PMKA 4X1KB 4RHFA 1S01A 3QW2A 1RXSA 5SZKB 5LNK6 1B4DA 3DKRA 2FWMX 1T6NA 3P9ZA 3IRUA 1VLLA 1Z0SA 3I8XA 3L8FA 1SQGA 4R98A 4LJSA 5FL3A 3CUYA 1KF0A 1J8YF 3NDIA 4FU0A 4ZYZA 1JEYA 1K75A 3KK0A 3HO8A 5I7SA 2ODTX 1ZC3A 1KHHA 4GXNA 1Q0PA 3ZQ6A 5C51B 5DH9A 2UYHA 4WN3A 4KV7A 4PLHA 2C7PA 3R6GA 1F1JA 1O4VA 2ZE7A 2GZ2A 4W9MC 1PZGA 1P73A 3HCFA 3LI2A 4R2LA 4X6UA 5DHRA 5IC5A 5D2CA 1FZQA 2RGCA 3E5MA 3O4FA 5FWNA 3AEZA 3QVUA 1RRFA 1U7DA 4M0FA 5JRJA 1WDWB 3PLAE 4AK9A 3PENA 3WZMA 4BLOA 5H59A 4BB5A 3TNDA 3KQNA 2PTHA 3I05A 1G19A 4L0MA 4K0RA 5HSGA 3VYUB 4N3GA 4F3CA 1ZD1A 3THXB 2PT5A 5G4KB 1NL3A 3T41A 3WGTA 3QVOA 1PTJC 1VP9A 5ALQA 1QZXA 2H4FA 4PLCA 4X7BA 4LHXA 1P6UA 3U4QB 1RWWA 1V43A 5FJJA 1ST2A 4UBOA 1XELA 3I2FA 1MO2A 1DZIA 4MRMA 4HAYA 3FWPA 2B0JA 3FUVA 4CTNA 5IXJA 5JC1A 2Z57A 2FQQA 4LGCA 2DX7A 2H8KA 5EMKA 1A8PA 1E5DA 3QELB 1XG5A 1JR3D 3S27A 1ORTA 1AUVA 1HG0A 1RJEA 2YNMC 4P82A 4IIGA 3HKBB 5FYQA 4EJ2A 1YJCA 4ERXA 2JIDA 2CHFA 2FEAA 1KJNA 1KH1A 4KAAA 4YFYA 1MKYA 2GYWA 3HUUA 2JGIA 3CPJB 4B76A 1VECA 4C21A 1SVLA 2WU3A 1CE8B 2C4UA 1AU9A 1M1NB 2E1PA 1MZVA 4MR8B 2OKCA 3H6HA 4EI7A 1VPWA 3NG1A 1XN1A 4E4TA 1H2HA 4EGFA 1FFYA 1XKTA 2X6TA 4IUBS 4GECA 4GBGA 1TYDE 3PQFA 2VH2A 4OAQA 4QPZA 2VF7A 1W8DA 5ICMA 4DJAA 2G7MC 1KY4A 1JQJC 3MWKA 1SU7A 3OZDA 4JJKA 4M0EA 4CR8A 3M82A 1DJNA 4B0PA 2I34A 2MR6A 1QRAA 1ULZA 2OPBA 1R5BA 3KTOA 4AMVA 4EFLA 4INJA 1DIAA 2PBLA 1HDEA 3HN7A 1OTXA 1H6CA 2LR0A 1QYWA 3UWDA 1BZYA 2OV3A 4B6FA 1SC1A 2DBQA 5B7QA 2FPRA 4YYZA 3LF2A 4LNUA 5BMVB 2DETA 2WIKA 1J2JA 5LL6P 2YZ7A 1NN1A 1I01A 5E6SB 2X42A 2B5VA 1G0NA 1XVTA 4BNZA 2GTPA 1US8B 3AL2A 3DYIA 3MJCA 4JLUA 2CLFB 3HGQA 4B71A 2XCSB 1UANA 1UPCA 2RC5A 3NAMA 1UUFA 2CDBA 4RF5A 5AI8A 5D7BA 2F4VB 1UZLA 5M29A 1L4HA 3MJRA 3O1HB 3B48A 3ZV5A 1PR5A 4CQMB 2Z30A 3V4OA 1U0NA 4FGJA 1TYCA 3QNMA 1A8QA 1B76A 4CTJA 1VKHA 4BNWA 1HYEA 3IJ5A 5A5GA 4XH9B 3V9AA 3ME5A 4P0PB 2QYHA 3NMUF 1Y0BA 3WGIA 5F1YA 4K6GA 4CV3A 1C0KA 2IHVA 1A82A 2CKMA 3JQGB 1ICEA 3RR2A 3VFDA 3WRXA 2UDPA 5JADA 5JALA 1OJLA 4QL3A 2JGMA 2R97A 4N40A 1QHFA 2EGUA 1BGWA 2BGTA 1SGWA 3JAKA 4Q4JB 1OHHD 2V7GA 3F67A 3ROGA 4J0GA 1KR5A 3NDRA 4MPRA 5A03A 4QBHA 1TOAA 3TOVA 1GU0A 3EIWA 1WY7A 2OAQ1 1P4JA 2XT9A 1JLMA 1S2NA 4DYHA 5DMHA 2XJ9A 3T1NA 1N36B 1IXZA 4EATA 1P5ZB 2WSLA 1Y7TA 2AQKA 1GZ5A 4PZ0A 3RAJA 2WZDA 1X1RA 1CIJA 1EXVA 4L6IA 5LQAA 5FUQA 2LKCA 3O8OA 5M34A 2FP4B 1U3VA 2Y4OA 2WVGA 4QPJC 2ADFA 3OIYA 4QYWA 4GE3A 2YDYA 3I64A 1TAUA 4A91A 3EXHA 5I51A 5JNTA 4NOKA 3QEJA 4EHLA 3I0ZA 3A10A 1EAMA 2FEPA 2OV2A 1Y9JA 1RTTA 1GSIA 2Z1DA 4E70A 3LYHA 2C31A 2XCQA 2ZB7A 1RSZA 2BDUA 5IBPA 5NLLA 1OXUA 2CVQA 4YJ2F 1QE3A 3BD8A 3QYFA 2IEBA 3ECSA 3QE9Y 1R0KA 3WFJA 2P2NA 4PHCA 4WUTA 4BL5A 2NQ2C 1ZD5A 5I47A 2W6ID 4ES6A 1GU1A 5AI0A 3GEPA 3OZSA 5ESDA 3PNMA 1MUUA 1MD9A 1VRWA 4GP6A 4OJQA 1ONPA 3GFBA 4G9GA 5J2UB 5K01A 2V6JA 3HJAA 2ZUWA 1DC8A 2D3WA 1J5XA 1Z6QA 2EU8A 5FTNA 2Q3DA 3AL3A 1A9ZA 2AKYA 2AN9A 1PYOA 2Q1XA 4H17A 4KPFC 5E3HA 4EZIA 4JLMA 1P5HA 2XT6A 2EWMA 3ADKA 4O1IA 3QQ5A 3UMGA 1LXCA 5I8ZA 5K8UA 1PLLA 4K9KA 2OZLA 3C6XA 3KEMA 2NVOA 1LDMA 5JHHB 4H1WA 2XXJA 2W0MA 1Z75A 3LHIA 1ZITA 3LYUA 3V8NA 3WNDA 2GUGA 1T36B 4HFRA 2JJ8A 1FP1D 3A1CA 3GHHA 2HDHA 3O1IC 2YWCA 4WFIA 4K87A 3U5TA 2DWQA 3IMFA 3R0QA 1UODA 4Z7JA 5ECYA 3HCRA 2WIBA 1CNEA 4GOMD 2R6AA 1L7OA 1O97D 3L46A 4I5IA 3ONVA 4V0OA 4KHPB 2PCLA 1YI8A 2CB9A 3S55A 4AO7A 1B2LA 2AE1A 3H2SA 3H9GA 4BO3A 5LJLA 3N8GA 5CNJA 3UTCA 1IHOA 2OCXA 1M6VA 4P98A 3R7WA 2CYAA 3B7PA 3L4BA 4B09A 2K7FA 1Z73A 1FLDA 4MWEA 1JV2B 2CXTA 1VIMA 1XZDA 2OWEA 3IHTA 1H2EA 3K5HA 3LUHA 2XUPA 3ISTA 1QO7A 4HFJA 1JH9A 2A5JA 3L4JA 2YMMA 2AG1A 1GM5A 2H0QA 3SBOA 3DFUA 2VRNA 1Z62A 2P5SA 1N1GA 1C4KA 2G5GX 1T9KA 2O23A 2WUDA 3AB3A 3DZKA 4KVGA 1L5MA 4R31A 1H8HA 5FWXA 3ZVMA 2GZMA 3EFHA 3ORHA 2XMGA 4ZP1A 5LBIA 3W5SA 4R2KA 1VA4A 3FOZA 1LRKA 4OYHA 4QGBA 1Z6XA 1EDZA 4EB6B 1E0DA 2QRQA 2WF8A 4CI0B 5M2QA 1UM9B 2RG7A 1WAMA 2Z5LA 2P2ZA 3WWCA 1KXJA 3E22A 3R41A 4LGVA 4MS4B 3ZV4A 4D4LA 3DHYA 1PWXA 2IYZA 1DKOA 1J9EA 5AM5A 4M1WA 1DXHA 1XCPA 4P31A 3R9WA 1Q1AA 1DLIA 4Q16A 3N87A 1RACA 1KA9H 2MYNA 2XZLA 1UMCB 5JAZA 1BKSB 2ZI4A 3RG2A 2A0UA 3JWHA 4GX1A 4A92A 3ASZA 5DX0A 4YJGA 2ID8A 1E3MA 2IYWA 4LQDA 4F4CA 1U7HA 2BFBA 2DMRA 2W2OA 4KACA 4WNCA 3OQIB 3K2EA 3HM9A 3UFXB 2AFHA 4XD7A 4KQCA 2Y71A 3HBLA 1T4MA 1GG8A 2CXPA 1EVKA 2OAGA 5IARA 3HDQA 3EFOB 4BIMA 3ZY6A 1XRMA 4ZJZA 5DVZA 4FOTA 1J8DA 4PRYA 3B3FA 4BO0A 4HEA1 4IPTA 2VSFA 4ND8A 2EW2A 4PPNA 3AF4A 2R66A 4G0ZA 3ZN2A 2AS0A 3BRSA 1IVSA 2F48A 2RJOA 4YRAA 1T3GA 2JHPA 1A9XA 4FR5A 4DDMA 4IHQA 3NANA 3COZA 3CRVA 3C6MA 1GPAA 1QTIA 3CVOA 4H27A 1EINA 3S99A 1ZN7A 3EXG1 3W77A 4KV9A 1YZUA 1EB9A 4MQMA 4UXIA 4DM7A 1ZCFA 5ES3A 3SC2B 4F91B 5CCBA 1CR4A 3TE7A 1J06A 4E21A 3HXOA 1QKKA 1XDSA 2ON6A 3KOZA 3RK4A 3VR3D 2Q0QA 3VDMA 4GBJA 1P1CA 1RHJA 1F8UA 2YIJA 1XZJA 3FMFA 4RA9B 3ZCXA 3AJAA 5IDVA 1AJEA 3S1SA 2FKNA 4ND7A 4K3UA 5G1PA 2IEGA 5LLTA 2WTXA 1NYLA 4KU4A 4UEKA 3GCGA 4YRLA 5SYAA 5BV8A 3Q2OA 4EYQA 5F7OA 1K6EA 3W9UA 4HADA 2HA6A 4L4RA 2DTEA 3FIJA 1H69A 3I52A 4NJMB 1Y89A 3CU5A 5DNVA 2GAAA 3U9TA 2NSDA 2DY1A 1EHYA 2QMOA 4HN2A 3X1DA 2PRJA 2GO7A 1AKUA 4P0TA 2FFAA 1YZYA 2O3TA 3RSLA 2H1LA 4F11A 2O8DB 2Y76A 4U4AA 5CXQA 3KPUA 1LD3A 4U9HS 1JDNA 1R8QA 2PFSA 1K6IA 3MOGA 1KYQA 4GC9A 4QOEA 4PN7A 1SRQA 1HQYE 2IYLD 4F97A 5K3OA 3MINB 3BWYA 2DKFA 2XB4A 4D98A 5AM3A 2ZCJA 1G1MA 3I53A 1G5QA 4P4NA 1JTVA 1L7QA 3PNOA 1HNXB 4K26A 3OI7A 3JV7A 3IDZA 1FNMA 3B3JA 4FYWA 4IOKA 4IZ6A 4UVDA 1Q2XA 1Y7LA 4XZ3A 3NS7A 4YJHB 4DR2B 4EUNA 2AOTB 1T2VA 2VF4X 4BIIA 1CW2B 1K5GA 2PY6A 1EA5A 3GUYA 4J9UE 4OCZA 4US0R 5I7AA 4XAQA 1XQ6A 2HJGA 2I3DA 1IHPA 4O4LF 1KZ1A 2CXUA 2GM4A 4ZOLB 2VBIA 2GPNA 1BWPA 3RROA 4H6PA 4L9AA 3GRZA 4INOA 4Z7QB 3WP1B 1DIBA 4K8RB 4LXIA 4KN5A 2AOTA 5BV7A 3KQLA 5EXPA 4EQ6B 3C6QA 2J5XA 3T3DA 3NTOA 1F2TB 2ZBEA 4XUDA 2LDBA 2BGGA 4O4HA 5JD3A 2PLWA 1XC7A 4OLHA 1G5FA 2A0XA 3IAS1 4D97A 4ZYWA 1TCBA 1GIAA 2QN8A 3SR3A 1T5LA 5HXAA 1KQFA 2RBKA 1KBQA 2D2IA 2J6CA 1XUOA 2XRMA 4JP3A 3U7JA 4HN9A 2GASA 1VBMA 1ISGA 2VWQA 4C03A 1U0SY 3IXMA 4D0NA 2B94A 2NP7A 2HCFA 1H85A 1EWYA 2IDMA 2WB2A 4RL6A 1NV8A 3H13A 1WEHA 2A14A 1L5VA 3LPAA 3WBFA 3AVQA 3K6JA 2J6IA 3KLNA 3BTUA 1V8BA 3KR1A 4PLGA 3Q12A 4R6XA 3V34A 4B80A 4CM1A 2MCFA 2PLNA 2RHCA 4OHRA 4UAVA 5H4GA 4FHEA 4HMQA 1K5DA 1Q16A 4AUKA 3U4QA 5C34B 4QPNA 2OHOA 2CFCA 3CLRD 1MVOA 2QRNA 2M1XA 1A8SA 2HADA 1L7PA 2IA5A 2RHHA 4ME6A 4R68A 4QKQA 5D1HA 1C1DB 4TS4A 1AGNA 5KMGA 1C3OA 1Z16A 3ZGLA 3M34A 1U8TA 3T4EA 2FETA 3FOFC 4Q37A 3ZH2A 2DGDA 1BIFA 2VP5A 4KO1S 3M6IA 2J59A 1S02A 3QLJA 4QYIB 1W93A 1Q3HA 2W6CX 1G17A 1Y3CE 1X7WA 1G64A 3ORFA 3CKYA 1MIHA 2VP9A 4DV3B 1P0QA 1CSEE 3D2LA 4ZGGA 2OESA 4QQNA 2WWRA 2F1RA 4WT7A 3I9FA 4X65B 4QE3A 1EGHA 1H0RA 2HUPA 3H5LA 4TZ6A 2XE7A 3DSRA 5ED0A 1FJ2A 2C7BA 3VSEA 4MQEB 3BN3A 2NZ2A 2X76A 5GJCA 1CQJB 4OYLA 3AY7A 3VZDA 1PUXA 1ZW1A 2OO5A 3CKMA 1KI8A 3AUXA 4R8LA 3C70A 4FZ5A 3RRBA 4BKOA 5IT9A 3FYUA 3SR4A 2FZGA 4BP1A 3R0ZA 4FGUA 2EFEB 1SKUA 4EY3A 4LJ6A 2QAGC 3DCNA 4JMLA 5TLSA 1MAAA 1O3YA 1HC7A 1MJFA 5FWDA 3H2HA 3DOCA 4UD2A 2Y1DA 4FS3A 5HFNA 2IEYA 3TKAA 4UNPA 3ZYZA 4DYDA 2ZXFA 4PAQA 3TCKA 2QRUA 2VG8A 1XRLA 5K3AA 1AGPA 1E2GA 5C8YB 3E5HA 5AW5A 1H1LB 3B5IA 2PL1A 1PHRA 1JDBC 2WOOA 3EOBI 3KTDA 3M4ZA 1RFGE 1DB3A 1I3LA 1RPTA 1P2SA 2N0SA 2H5JA 2PHZA 1EE2A 3CUUA 4F2WA 4UBLA 1Z2PX 2QUBA 3E9YA 4JP5A 4LZZA 4PR0A 1O57A 2C2KA 4O2BB 5DI9A 3LX5A 4PQFA 3W90A 1K7FB 1VSBA 2OUIA 4G5SA 1A1VA 3H5RA 2VYQA 3BMNB 3OQ6A 4F12A 1Y33E 4G0VA 4YP6A 3M4XA 2H63A 3JYOA 3UJ9A 1O54A 2OLEA 1DMSA 3KAQA 4MDEA 1JDTA 1RIIA 4GVXA 4MS3A 5EJGA 4BHTA 3WGOA 3DNMA 3VSDA 2VPPA 1BH2A 1CS0B 1ZNQO 3GLVA 3WWOA 5BN4A 1R88A 5IJ9B 1PS0A 2IHYA 4FYYA 4HWOA 4JLOA 1X7DA 1UPXA 2RI6A 2VH1A 1UWCA 3H0KA 1E2KA 3R7WB 1EWQA 1YXMA 1T5TA 1GA4A 3R3UA 3VC3A 5JZBA 5BW8A 2XTZA 1RRGA 1XSEA 2GD2A 1W0JA 1M1XB 1MRNA 2RJ3A 3GEHA 4RK0A 2OM6A 4TQUS 2P2DA 1PDOA 3RF6A 3HRIA 2DPLA 4TV9F 1D6MA 4C7VA 4DKXA 4ETWA 3ZQUA 1G20A 1TYBE 5C81A 3FNRA 4Y6PA 1NTOA 5BWNA 1KVQA 1QK3A 1VYUA 4WEOA 2HRZA 3IOBA 3L01A 1ZNWA 3DZGA 4QGGA 2QP9X 1V1JA 4A2QA 4B44A 4C0XA 2EGHA 4WCFC 4TMWA 5JPIA 5JAQA 1QRRA 2NTJA 2ZLBA 4LOKA 1E9FA 4KIFA 5J5AA 3QEAZ 1VCMA 3TTVA 3EZ9A 1WZ2A 1U5BB 2J5KA 1OWPA 3RH0A 4UHFA 2SCUA 3MPOA 3ZHQA 3SHFA 5GGXA 1GTSA 2O20A 3QBVA 4AZTA 4FFBA 1XVAA 2H11A 5FLEX 4CFYA 1UXGA 5DK4A 2EQAA 3RUDA 2ZRBA 3M89A 1VMDA 3SP1A 4CMGA 1QZ3A 1L5FA 4P93A 4N82A 5A2QA 2H9YA 1NVGA 4CKWA 2ZETA 1HDCA 2NO0A 3QEOA 2QGZA 4CLHA 2HO4A 1IZYA 4RLHA 1G4HA 1Y1KE 2X13A 4CIYA 2B4YA 5HVNA 1HGXA 2V6IA 2AXEA 2ZQ5A 1IWOA 1F60A 2C3YA 2F43A 5IJ0A 1YDFA 1JT9A 2BHNA 1UJ6A 2A1UA 3H0CA 4V1CA 2D5BA 2IU0A 4TTVA 1RXCA 4KP7A 1ZZGA 2J9GA 2JARA 3OFVA 2JANA 4Z9AA 1CUIA 4R51A 2OCLA 2RARA 1FUUA 3CQ9A 2IHKA 3IE0A 1MT0A 1HL3A 3NVDA 2X22A 3SSMA 5BNIA 2OENG 1EFUA 1N5RA 3QELA 1TRHA 4RU1A 4J2OA 4B4VA 5HRUA 4H1TA 3U13A 3QUAA 3KQHA 4HSEA 1UPBA 2I8AA 3U81A 3NU1A 1II8B 2HPVA 4LIPD 3A3NA 5AICA 2CZCA 5EZYB 4Q4HA 2NXWA 5JD5A 3MGCA 4RPHA 5AT1A 1W4RA 2J4CA 3GN1A 3KWFA 1KDZA 5KBYA 1G98A 3KS9A 3CVUA 2EP7A 1QGUB 4OMFG 1XTPA 1OT3A 3A1DA 3FETA 2O2JA 4A6DA 2GFIA 4BLTA 1H65A 2JH3A 4HQNA 1RBYA 2B7LA 4IQ8A 3NYWA 4WERA 3Q0IA 2DKNA 5SY9A 1GARA 3BWVA 4XIFA 4EYKA 1ESCA 3N5KA 5EXXA 2EG5A 3QMMA 3ZOZA 1AQJA 4JLVA 4ZJUA 2RKOA 1VIYA 5F35A 1IUNA 3GFTA 5BSFA 2XEXA 3P94A 1U3GA 2JCXA 2I6QA 1UXJA 2G0AA 5KOYA 2ZWAA 5HJ5A 3ZHBA 3KBOA 3OZXA 4C4RA 3ZW9A 4JL6A 4TWJA 4BQIA 3SSAA 4IRUB 3L5OA 4R1SA 4M37A 3M0EA 4H7KA 4PHHA 1IATA 4MGEA 5LBUA 3G9ZA 1CXZA 1YR9A 2BKLA 3C5CA 4ER0A 5JZ9A 3D8RA 4XRGA 1EIZA 1CQIA 3FN4A 4NK4A 3V1NA 3V8PA 2MTBA 3RRMA 3QG5A 1PZMA 2PRSA 4IYRA 3ZHCA 3IAM6 4GI2A 1E6CA 2A67A 1NSTA 4P2BA 1LPAB 2AJCA 3O93A 3TLGB 1F2UB 3DLAA 3L0DA 4HAIA 3DE3X 4UUMA 1S0UA 2WJIA 2ZU0C 1JLKA 3GP5A 4G1EB 4RHTA 2HZBA 5FBLB 1GR0A 3ZGVA 4FZVA 1GT91 3NNDA 4C4SA 1DJLA 5BORA 5JS8A 4A15A 1NPYA 1UK8A 2A88A 2PZBA 1SR8A 3A70A 2GZAA 3A9CA 2YW9A 3C24A 3CEPB 4DC0A 4XARA 1HKHA 1M6HA 5DHFA 5EUBA 1T9ZA 4PC7A 2G5CA 2KB0A 4E5MA 3NUGA 1N0HA 3TXYA 1R8XA 4PY2A 1XMOB 1S89A 1CE8A 4U63A 2BY4A 2ODBA 2OKGA 4CMBA 2Y93A 1O08A 2QAGB 4MEBA 1L5GB 3CA8A 1GITA 3WRWA 2XCOA 5G3YA 1VFPA 2P4EA 1WUTA 4JUDX 5CK4A 1BEUB 1LI5A 1D0SA 1UBMS 3MAGA 2I4IA 3EBOA 1MAUA 2HFKA 1VB5A 1Z7YA 4UTXA 5HKLA 1EP3B 4TXMA 3KP1A 3TINA 1PAUA 1QZTA 2KJQA 5T3YA 4AY5A 3FLMA 1NW7A 2WT4A 3DJFA 2FJUA 3OM0A 2NT4A 1ZSNA 4OMCA 1XKQA 3E3OA 4RH0A 3SZUA 2QL6A 5F7JA 5JT1A 4CF3A 1LK5A 3CM0A 4YUVA 3RASA 1N6HA 1I5EA 3LT2A 5KNBA 2OC4A 1MB4A 3THXA 4LZNA 2ORED 3X1YA 5IYZA 1KP3A 1YMVA 2OYSA 3KKLA 4FZRA 2F7SA 2OCDA 3K2IA 3NFRA 4MWTA 3BFPA 4R6WA 2PS1A 4TLDA 4WFKA 1FDVA 1WCWA 1YS7A 2HH9A 2OG2A 4PG7A 4UULA 1DV2A 2PRKA 1DQRA 2PKQO 4C5CA 5JECA 2FSGA 5T4BA 4H4EA 4F3RA 2ONKA 3P5SA 4TL6A 2A7XA 3TTYA 4XCQA 2E5LB 3ZUGA 1Q11A 1Y6JA 2FLVA 5AI9A 1NBMA 1VPDA 4XVUA 2IEDA 1AKVA 3UGQA 3JQAA 1SBIA 1VLMA 4MO2A 1BFUA 2AUNA 3GLRA 4IHAA 3ZDEA 2NTVA 2JI6A 4P08A 4AJLA 4D57A 4HLUC 4QTZA 1E7QA 1XRPA 4DLZA 4CNQA 1XL0A 1ZGCA 4UMDA 3OCJA 2ESRA 4RD6A 5C4MA 4NABA 4A0HA 3SICE 3TLKA 1A5TA 5DX1A 2EZTA 1GSOA 1ZGHA 1ZOLA 4YLGA 4AULA 2RD2A 2OAP1 3EVDA 2FSHA 4Z51A 4KH0A 4TTTS 4RHCA 1MGPA 1GZ4A 1DO8A 2XF8A 3E8SA 1DRJA 3BWMA 5PNTA 3AF2A 4GD3Q 5LZ2A 1ULSA 3T1OA 4I1PA 1XTTA 2QTGA 2BI8A 5KCMA 2H4ZA 5EJ5A 3GOHA 3TCXB 1NNSA 1E66A 1L3BA 3KXPA 3TW6A 1A9TA 3I01A 1C7IA 1P4HA 1SUIA 2J1LA 1OPXA 1FXWA 3ZS9A 3WDSA 4V1CI 1VYHA 3GBSA 1ACJA 1W581 1AK2A 4FT2A 5E7QA 4HX5A 1DKNA 3GVPA 4ALLA 3REOA 2CMDA 1GR1A 1X87A 8MHTA 1X92A 1JLSA 3ZU6A 4JHXA 3T12A 3UK7A 1Z35A 3Q3EA 1KY5A 4KWEA 1YS1X 2Y68A 2REQB 4X1OA 4BMDA 1CU1A 5CM2Z 4D0LB 1U1EA 1LX7A 2D3TA 3BMCB 4G0MA 2ORYA 1GT6A 2WSBA 4HDMB 2QTFA 4ASUA 1LC3A 2J0EA 3TUZC 4NAHA 2OCPA 3C1TA 3DYVA 3LK7A 2OSVA 4Q02A 4ZVMA 2YZNA 4O4IB 1XMXA 4UFNA 3UB2A 2NSYA 5EPOA 4MIYA 3LSTA 2FZ4A 5DW3A 5A9RA 2F3PA 4NZPA 2QTMA 2WKSA 2X7JA 1RWBA 3NXSA 4TRRA 3EEIA 4YREA 4BRUA 1BVUA 5FR2A 1T8SA 1RKBA 3KKMA 1AZWA 3BGOS 3SYTA 1Y9EA 2DBZA 2DQYA 1ZK0A 3H9CA 3QF4B 3VNSA 3VNUA 3PX3A 2BGUA 2HNBA 4GF5A 2G71A 1ZOSA 2B7BA 3RC9A 2NTNA 3W8EA 4JBYA 1JNXX 4C6SA 1KO1A 2QRGA 2VPIA 3I3OA 1WXHA 2UZIR 1C3LA 2X14A 2Q29A 1KYXA 3BE6A 1USUA 4PTLA 1G3QA 4ZDWA 5BN4B 2WSSD 1ABFA 3T7RA 3PNSA 1W44A 3AHJA 4QTXA 4XI9A 5CJ2A 2J3MA 2VKQA 3SZRA 2UAGA 5JPCA 1UAGA 4ZOEA 4J8PA 1M6EX 5EE3A 4LQ4A 3BMQA 5F73A 1YQDA 2F8LA 3KPYA 1LX6A 3N0VA 3RABA 3WGLA 1QGED 1FK8A 1VLZA 3HKDB 1BYUA 1RJ9A 1DFHA 2GN9A 1ZQ1A 1E7YA 2XD4A 4Y2VA 1TQHA 3X2EA 1E1CB 5BOVA 2COEA 2QPLA 4Y9DA 3U61B 2DPMA 2JF0A 2GCIA 2QP3A 3M2PA 3MFQA 2GXAA 2IPOA 2NZJA 3P2OA 3KETA 5A9TA 5AW8A 1SUPA 3VTAA 3DZBA 3K9CA 2YJ3A 1P9LA 2HT6A 4TT3D 1P8JA 1F2TA 3IQFA 2GBFA 2ACVA 4EI8A 4EG6A 4CLOA 1EG2A 2XY4A 3J81k 1QO0D 1R0CA 4QDKA 1C29B 3K1JA 5BWCA 1K66A 1PWEA 2PJUA 1SZJG 1XCJA 4HNSA 4M1QA 3DV0B 4IQ4A 2EXXA 4RNCA 5TQJA 3G8CA 1PJLA 1CDDA 1KL7A 1HPLA 1TKAA 1TTHA 2GN2A 2W8BB 1UBOS 3DTVB 3IQEA 4RIIA 3VC1A 5BN5A 1IZ7A 1OX6A 5D84A 1GQYA 4MAAA 4EI2A 3GT7A 2C9ZA 2WJ3A 4JGIA 5KAMA 3SVZA 3ETLA 2JZCA 4COKA 5F33A 1C9YA 1O4WA 2PX0A 3PJFA 4KLCA 3GMSA 4FOLA 2P0AA 1SA0B 1OCEA 1SHJA 4KYUA 1BRMA 3DMNA 4L22A 4RUKA 3BJZA 1NI4B 2I4LA 3EGIA 2I22A 1DNPA 4MR7B 4UTOA 3FPGA 3FY4A 5FEMA 1RAIA 1D5WA 3HSYA 5BQXA 4L9WA 1H1DA 3IEIA 1AKEA 3KCQA 4RE6A 2Q9UA 5JTTA 2O8EB 4B1FA 2UXBB 3CBGA 3WG9A 3P9NA 4TROA 4WVFA 1ECGA 1THTA 3UM9A 4AL4A 2YJNA 4JBXA 2ZJ6A 4NMXB 1QOZA 4TWZA 2VXYA 4YP1A 1PG2A 3HCWA 4KJZA 5JD4A 4ECAA 1BHJA 4IGIA 1NONA 3T1VA 2EVWX 1LPSA 5FA8A 3V2HA 1YUMA 4F21A 1THGA 2QZPA 3K2QA 5C7LO 2OORC 5BXYA 2RK6A 5EJ2A 4EHJA 1EK5A 5LUAA 4X61A 4F71A 3I30X 4OQ4A 3L7BA 3HR4A 3BGIA 1FFXA 4S12A 1XZLA 4D2IA 1BJRE 4Q4LA 4N48A 1SBQA 4KXUA 5J4KA 3FMIA 5BO5A 5IDQA 2GJ8A 1Z9BA 3KVOA 2V7VA 4KE6A 4Y6SA 3JRXA 3S2IA 2O5EA 1KORA 4L15A 4AMGA 2Z8YM 1NUQA 4WX2B 3QUBA 3R0JA 5IC4A 4AUNA 2HQ1A 3UY4A 2NUTB 2P41A 4R8MA 1JEAA 1HYGA 2AX3A 3NC4A 3KB2A 4IVQA 4BGUA 4YXFA 5JHGB 1CUFA 1WP4A 2AG0A 2HUNA 2O7QA 4DDUA 1URPA 2G09A 3SJZA 2AEFA 1Z7BA 1IEQA 3GA0A 3OEED 4HGRA 1M7HA 3IPRA 3HL0A 4XIYA 1DAFA 5KYTA 3M6LA 5C4IA 1QVVA 4IMJB 3AEYA 2OGTA 3LP6A 2ZUEA 3OE1A 2QDXA 3GMIA 3DL7A 2P75A 1I7NA 3LECA 3IERA 4YB8A 2AFIB 3H11A 1E3QA 4YAGA 1OI2A 4TV9B 4I5GA 4OFXA 4U2FA 4ZXFA 2PH1A 2MSEB 5AVSA 3QPUA 3AT1A 3H1GA 4TN5A 1Z4PX 3ONNA 3UKJA 3WP0A 2WK1A 3OF2A 4N3NA 3W6OA 4XD2A 3SNHA 3NUZA 2AJ8A 4A8HA 5DGIA 4HNVA 1L4KA 2B6NA 4RJKA 1QSGA 3ACCA 3AEKA 3V1KA 5HG0A 1N92A 3UH0A 1SQ5A 3Q5GA 1MXFA 1LSJA 2AD1A 2R6DA 1FBTA 1XTVA 3OG9A 1C7QA 3NBMA 1NXOA 4FS8A 2FZVA 2IW1A 5PGMA 3AERB 5ULLA 1DOZA 3CF2A 2I6TA 1WMAA 2MINB 1VLQA 2LWIA 1X9HA 4YR9A 1PEYA 1TJ5A 1G7CA 2HA3A 2RGAA 2Y0BA 3PEFA 4MJ3A 5KNCA 4LXGA 2ZJ7A 3EW9A 3OPVA 2RONA 2ANCA 3L40A 4Q7MB 4LK2A 4U8HA 5FLKA 3WJ7A 2Z6UA 1JE1A 1JYSA 4K40A 5AHRA 2E5FA 2YW2A 3IUPA 3FNHA 3I9KA 3RQSA 1XWWA 2EYUA 1STOA 2I6UA 4EGAA 3O8RA 2F55A 3WLTA 2X5NA 5JJLA 4UJ5A 4X6XA 4GQAA 2EP5A 3VVCA 1ODKA 4NYIQ 1MC5A 5ESXA 4BFVA 4W5TA 1H3EA 2C88A 1L4FA 4GL4A 5FOUA 3LPCA 1I7LA 2E6UX 3ELDA 4F4UA 1MG0A 4DCCA 4NOJA 1M9NA 3MB5A 2H6EA 4JJEA 1KTIA 1XMQB 3JQ7A 2PWBA 2YWGA 4W5RA 1QJ4A 4UW9A 1VFNA 1OLXA 2OAEA 1CR6A 5I7HA 5NULA 1WOMA 2FE4A 7REQA 5GVSA 1DXOA 1Q20A 3AW9A 1KVUA 1JEDA 1ZK3A 3P0FA 3LMKA 4RXTA 4XR9A 5DRTA 4LDQA 2X6RA 3G7SA 3NHPA 3THYA 2RAUA 3DJYA 3T3PB 4C5AA 2NQTA 2ECKA 5ITZB 4NDNE 2BPOA 3OIFA 2PSSA 5DLEA 1QKJA 3GRPA 2IK8A 3LGSA 2G8NA 4H9GA 1U98A 1E9BA 1DMRA 4H7DA 4QUDA 4JWKA 3DKKA 2GLTA 2I2BA 3MF4A 3V7FA 4AJ4A 3KDAA 3NGLA 4OB7A 4GRDA 3OQ1A 4INPA 2ZS8A 4G0WA 3I62A 1KSHA 3IHWA 3HJUA 1ZIXA 2D74A 5E9JA 4HFMA 3H5WA 3V1YA 3AU8A 1RAFA 5CB8A 1T9DA 2DH5A 4LJ8A 4MDYA 3RREA 1K6MA 4OXKA 1XBTA 1QFMA 1YVRA 2JAHA 4UTNA 2JIMA 2G9VA 4WK0B 1KYIA 2ZSJA 5K51A 5J2UA 3GAMA 3AR8A 4GC5A 3B9QA 3BSYA 4EUHA 4CWAA 3IDQA 3QIAA 4K9LA 4ZU6X 1AS2A 1GZDA 2O2YA 3QQPA 2C20A 3P71T 3PFKA 1BW9B 3S68A 2BFDB 3OPYA 5A6VA 5JXHA 1NDHA 4ER6A 4DUYB 2ZWOA 4DR1B 1JG7A 1Y8ZA 1J70A 2BR5A 2AW3A 4Y2RA 3SJBA 2F8SA 1GG2A 2GFQA 4YIHA 3N8IA 3DTVA 3L7CA 3M4YA 1AZSC 4LXQA 3TD9A 3BVPA 1FMTA 4YCCA 1OF1A 5ADHA 3GD5A 5K45A 3LC7O 1N9GB 5FTKA 1N1MA 3F4KA 4Z1MA 2VPYA 3O8BA 4NCJA 3UHJA 3OZWA 4Q93A 4CR7A 2FR8A 3NHSA 3BXOA 1PT8A 3GA7A 1FDIA 4UBJA 4WXPA 3LBIA 4RIHA 4YUXA 4OL0A 5KQPA 1DC4A 4XDGA 4J2HA 3AKEA 1V2GA 5J4LA 3L7AA 3NOOA 2FPIB 3CFYA 3FFBA 3H3XA 4LOLA 1QHIA 5LZ9A 3GDOA 4FZJA 3GCWA 2NXCA 1XYGA 3GY0A 1SWVA 1A69A 4WECA 1Q6YA 5FF9A 1OWLA 3ANYB 4GLJA 1RPJA 3EDCA 3QKSA 1ZMOA 3FLAA 2IE0A 3JQ9C 4NTZA 2CDCA 4WK6A 1O2DA 4MVJD 3UXYA 4AXXA 2SNIE 2QLMA 4EFNA 1XDDA 3NLLA 3KJHA 2HREA 5BN3A 2VFAA 5K0FA 2C5GA 4CLRB 1MC1A 5KKAA 3HVUA 4UVEA 1YACA 1NC3A 3EARA 3M6FA 1KY3A 4OPMA 4W7IA 4UBNA 1Q15A 3PNKA 3PQEA 4LTMA 4ZAGA 2IBMA 2V58A 3VMMA 2O0LA 3QOXA 4AZSA 4OQDA 3NALA 2M6RA 2D2FA 4PX2A 2MSCB 2C2BA 1RYNA 2FX5A 4GOLD 1SOMA 2OGSA 1GTMA 3NP7A 1Y8RA 7MDHA 3RO7A 3SVTA 1DCTA 2N3ZA 5IDWA 1DAOA 1DHTA 4IEFB 3JR3A 1LPPA 4MHOA 1VJ1A 3MB8A 4NC9A 4LF9B 4K9RA 3F7MA 4LCEA 1YC5A 3TLEA 3QVVA 5CPBA 2XTMA 1WKBA 4TN1A 3IUYA 4U9IS 4G56A 2ZOSA 2QV7A 2G77B 2NV2B 4INAA 3N3AC 4NMMA 4XEUA 1ULBA 3DBOB 3KVVA 5ENDA 4LNHA 3HPQA 4O8ZA 4IHKA 2CT8A 1IG0A 3PGKA 4JYMA 4DSNA 2QR2A 3C3DA 4RO0A 1K97A 5CA1A 4LXHA 5H81A 4R41A 1XXHA 2HXGA 5JZVA 10MHA 3DGFC 1XZ8A 3VPGA 1J2TA 5CTJA 2WSSA 4GR9A 1R0WA 1JSRA 5BRAA 1KKUA 1XMVA 1NE7A 4PINA 1CZKA 4EF6A 4DA6A 2AW5A 2ZR7A 4YDSA 1U04A 4TWAA 4BO1A 4YMUA 4HX2A 2Q0HA 3JATB 3UAWA 4TV8A 1ORRA 3O3NB 2DR3A 3ZE1B 1FFBA 2A78A 1YQQA 3JVEA 4I36A 3UBMA 3RVSA 1P7PA 2C4TA 1LUAA 3VJKA 7GPBA 4KJXA 2CLOB 4G9EA 3AUTA 3LP8A 1DKLA 1RE0A 1T0UA 1R6BX 1KRHA 3JX9A 2ZIUB 1SXJD 1JQ3A 2HLDA 1H9AA 2XLCA 2YNMD 3PNBA 2B8TA 3D6TB 1KPHA 3DMTC 1EBUA 4JIMA 4R9UC 5KX5F 4R7ZA 1F2UA 4B45A 4JQZA 5EJ9A 3BA1A 3SEQA 5BR1A 4LF8B 3O3OB 1Z08A 4JC0A 4ONEA 1R27A 3IP7A 3HVJA 5DLDA 3TQOA 1WB9A 4OTZA 5ESRA 3OIVA 4KVAA 3FHCB 4M8KA 2H1VA 3X1XA 1DZ3A 2A86A 2IFTA 1XTRA 3QUQA 4RBNA 2GKOA 3PHJA 1ZJYA 4URZR 4BNGA 1UAAA 4HPWA 1HZZC 1K8QA 1FQJA 2VYCA 2XVZA 3GJ6A 1E63A 4IH1A 3VI4B 3ZU5A 2G63A 4M53A 3A4VA 3NTUA 3W3ZB 1OFUA 2XQFA 1D2EA 5LQRA 5IN4A 3GZTB 4KRFA 2ZDQA 4YAFA 2WVJA 3K05A 1U80A 4BAGA 4L07A 1C41A 4DGSA 4DMHA 3A32A 1EM8B 2VZLA 1H4VB 3ZUPA 3K5WA 4CKCB 3U9SA 1S8AA 4EARA 5BURA 1WDKA 1L5OA 5FPHA 1SEPA 1VE7A 3KOXA 2BFFB 4ICIA 5FR1A 4QODA 1AQYA 1DLJA 1SVUA 1YL5A 4MICA 3KEQA 1K3TA 3OZEA 1E1DA 2Z95A 2JNWA 3DE1X 3RS3A 1NVAA 2TYSB 5HQ3A 5DIFA 1K27A 3KQYA 1ZN8A 5JCJA 1EWTA 1U1CA 2P67A 3C6BA 4HH3C 3K16A 4UHKA 2DHDA 3TNYA 3UFBA 3LFTA 4F9GA 4ENQA 4HNRA 1U63A 3PXDA 5AM4A 5HTOA 5COQA 2C77A 2WYIA 4X20B 5DSXA 2GA9A 5E6SA 2QF7A 1N5DA 3EQ8A 1BDJA 3ZYCA 4ER5A 4IDCA 3IQHX 1R7RA 3PFFA 1UEXC 5HUHA 1UQRA 3MLBA 5ALRA 1PJSA 1RKXA 1Z29A 2XDAA 3A1WA 3NYRA 4NL4H 2ZSAA 3ANXA 2GM5A 2V0NA 1KU6A 1T6XA 3MSXA 3OJWA 4PSVA 3AFNA 3K31A 4ZVVA 1KDYA 3I3SR 2VDUE 2X1VA 3LT1A 1FJHA 2VXCA 1VM6A 1XLVA 4BLSA 4EP1A 3QUTA 3QA3E 2I71A 4DGQA 4CLOB 1R0YA 3FUCA 4BBPA 4LYJA 3NIWA 1IOWA 1BKDR 2FYTA 3OT4A 3RFXA 3VO9A 4BLRA 4JELA 1JA9A 2HCTA 2VZ0A 2Z4TA 2CY0A 4PGGA 3K53A 5GONB 1E9DA 4ND2A 2DJIA 4DWWA 3KUCA 3F6PA 1V7CA 1Z0JA 3PLRA 1E1CA 4R9VA 1GNVA 4WACA 3C16C 4MAFA 3ZU4A 3BCHA 4LYGA 4QDTA 4BTLA 2Y27A 2R48A 3DGEC 2FFJA 4O29A 4I55F 2J0VA 4OQNA 4R3WA 4JV5B 2AOVA 5GQSA 13PKA 1U0HC 2CD9A 2QUKA 2FV8A 1W2HA 4JFAA 4BMVA 3GLKA 3GLQA 3I1YA 3LV8A 5CLGA 3RQIA 4AJEA 4BV2A 3TW8B 4I4LA 3ZJTA 4LSMA 2O8FB 1AC5A 2Z2YA 3E9DA 1QP7A 5KSOA 2E4YA 3JD3A 2J3KA 3DAGA 2ZYUX 3LA6A 4ZKEA 3T6KA 1P4GA 1ST3A 3O75A 4DZZA 3V80A 2XNHA 4PN3A 1ZI9A 1EX1A 4FB5A 3KQTA 1KYVA 1GGVA 4ZTUB 3SC6A 3CH6A 4B40A 3BAZA 3E9QA 4KBFA 1KWKA 5JRZA 2ZJ2A 1VMEA 4D4HA 1Q2UA 3E7WA 4CCYB 4QLBA 1WP9A 2F1HA 1NNUA 2Q4DA 2ACWA 1C8VB 2YUTA 4IWYA 4R2JA 1X1BA 4LGYA 2XUJA 1XTKA 4JVSB 4OSOA 4U6QA 3TN7A 4A8PA 4ARBA 3K6SB 1I0LA 1RIFA 1OVMA 2DT8A 2VNIA 1XNRB 4TXHA 4EFKA 5I9MA 3O4JA 1O8CA 3IDOA 4LV8B 1WZIA 1XLTC 2W37A 3O03A 3ZGOA 1HEYA 1GILA 3WYNA 2ZYVX 4EMUA 1Z83A 1A2BA 1YJ8A 4OI2A 3GF4A 2IWRA 2H5EA 4RLSA 1VIAA 1ADYA 3KSMA 1O5IA 1W73A 4X92A 3THSA 4UQLA 2PT9A 4LDAA 3CUEF 3HKEB 4BZZA 3E7XA 3F46A 3G7NA 3E3NA 3WYEA 4EI9A 2V9ZA 1MX5A 2FOIA 1ZR4A 4JI8B 1J22A 3CMMA 2H2DA 3R0IA 4PWZA 3T5GA 3UEOA 2X2EA 1ZVJA 4PQRA 2PXXA 1IB0A 2HTEA 2J0QA 1L7EA 2B8JA 3BZUA 5ILQA 4JI6B 5KKNB 4KKVA 8ABPA 3MAJA 3NEPX 2EZUA 5KU1A 3W7BA 3MS2A 4ARAA 1TF7A 4G1FA 2Q3MA 3DA8A 3H9UA 4C7OA 3SLKA 4A36A 4XJTA 5IVPA 4Z53A 4KO8A 4BN5A 3RIYA 4V0SA 4EKDA 1T1JA 4KLAA 5JS2A 1IU9A 3QKRB 3L7LA 5ALIA 1JHOA 1PGJA 1Z0KA 5AM1A 3BCSA 1GA1A 4G0OA 1WCIB 3L1HA 4QHSA 4ALKA 1U3WA 4EVIA 2XCRB 4LC1A 2BAGA 5ALHA 2Q1YA 2ZIFA 1S4QA 3PQ6A 3HFSA 1YB4A 1T2EA 3T9CA 1NG9A 3WO0A 2G70A 3M33A 4MAMA 3HABA 3SZOA 1O87A 1H8ED 2ZIXB 1YVUA 2WSYB 4C2TA 3I58A 4BZQA 1ZGJA 4UAUA 4J91A 1U2ZA 3R8CA 3RYFA 3H9EO 3QYJA 4DZRA 5C1BA 5FPKA 1YGPA 2YDXA 3QWAA 1QOPB 4GNKA 1JHQA 4NENB 4EM6A 2XVAA 4G0UA 2BOVA 2GNAA 4GMDA 4MUNA 2H92A 4FLFA 3VZQA 4RIGA 1TUBA 3EJWA 3A1VA 1FRNA 3KKOA 2NO5A 3LQ4A 2YCLA 3MS4A 3OFJA 4JLJA 1CR0A 1Y81A 3A6ZA 1CY8A 3P26A 5JNUA 4OHZA 3OE4A 1RRPA 1W96A 2PYZA 5CX1B 1R9MA 1YVEI 2WD8A 5HX7A 5LXTF 4FYJA 1NLYA 4IGFA 3D3QA 3BEOA 2GFHA 4RGYA 2XWPA 4ALIA 2PUDA 4LJAA 3ENQA 2RGEA 4P38A 3UO8B 3WL5A 4NYIR 1T2NA 2B1QA 4GZLA 3N75A 1DCKA 1GVHA 3CLSD 4IEEA 4YRBA 3KUUA 1ULTA 1MP0A 1S2GA 2P9FA 5IYZF 4B75A 2OHHA 2OG1A 4E12A 4H6WA 3RKUA 3GJRA 1RJWA 3MJHA 2M1ZA 2VAXA 2RKBA 3D4OA 2XNDA 5FPYA 3TW8A 4CM3A 5KC9A 3NM5A 3DMDA