2P39A

Crystal structure of human fgf23
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
SPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 23
publication title Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2p39A00
1JT5A 2MLLB 4LO2C 4ISQA 4X39A 3WO4A 2ZQOA 1XHBA 2IWTB 2D23A 3N0KA 4P0KA 3OGGA 4A7ZA 4GAFA 1JQZA 2VU9A 3LTQA 4IYBA 1NZKA 2D24A 3H6QA 4EFQA 2I1BA 1JLYA 4EB2B 2F2FC 3UD7A 4OWLA 1AVUA 4II0A 3VEQA 3AJ5A 3OBTA 1R8OA 4HJJA 6I1BA 2M49A 3BA7A 3K1XA 4CJMA 2E4MA 4D0ZA 4Z9WB 2BEBA 2D44A 1CE7B 1YBIA 2ET2A 3E8LC 1RG8A 2VLCA 3BRGC 4QO3A 2D7RA 3FJHA 3AKIA 2WRYA 3CA3A 4JQ0A 3N7MA 1FQ9A 2UUSA 2LIQA 4IQPA 4P0JA 3CRIA 3VWCA 3BRDA 3ILAA 9ILBA 1V6VA 4A7YA 1Q03A 1HCDA 4TLPA 1ONKB 3OJVA 4EEEB 1Q1UA 3HSMA 4AN7B 2ERMA 3VSZA 3I2AA 1TFMB 3JUTA 5HPZA 4I1BA 2HW9A 3POKA 5FZYA 4GOVA 1GGPB 2HZ9A 5BQUC 3F1RA 4LO1A 2FGFA 4L4IA 4DCKC 4QKRA 1OQLB 1DZCA 1FV2A 3CA0A 1DFCA 1PZZA 1QXMA 4G1RA 4X38A 4DENA 1UPSA 3NBNA 1TWEA 3ZC9A 3BADA 4I4SA 3HBWA 3ZXGA 3CQAA 4JAWA 4D0TA 3QR5A 3BRFA 3FFZA 3PUBA 4G6MA 3VT1A 1JLXA 1Z4SA 3UJ0A 1K5VA 2D43A 4JP0A 4F34A 1ISWA 2P39A 4ZOTA 4G9NA 1DIWA 1BLAA 1I1BA 2Y9FA 3VUOA 1A8DA 2MIBA 2GZBA 1G9AA 1FGAA 1WBCA 4ZKTB 1PUUB 3PG0A 2Y9GA 1ILR1 5F90A 1IT0A 1VCLA 3FJDA 3RMXA 4R6UB 2K43A 31BIA 1BASA 2NYYA 4GOYA 4G6JA 2ZR1B 2DRZA 3TC2A 5F8WA 3WO2A 1I1EA 1JT3A 3NJ5A 1Z0HA 1W3GA 4I8MA 3V0AA 2Z49A 3PMEA 4XFSA 1FV3A 1V6WA 1D0HA 1IRAX 5G00A 4GAIA 3MPPG 8I1BA 3IIRA 2DRYA 3FJCA 5E24E 2J3PA 3BAUA 3BA4A 5FNWA 2VSAA 2DS0A 2R9KB 3BAOA 3CAHA 3NBCA 2QYIB 1YF8B 2KH2A 1S0CA 1AXMA 1XZZA 4WBCA 4EKXB 3AKGA 3OGFA 4LO0C 3I29B 3CA4A 4OUJA 2RSTA 3RMYA 4Q91A 3BAGA 3A23A 1AVAC 4DEPA 4IHZA 1ISXA 2KLLA 4Q9PA 4J2KA 5EC5A 2D1ZA 4IY8A 1SR4C 3VT0A 5I1BA 1ITBA 3BX1C 1F31A 3O4CA 4YOLA 5F8SA 3FJFA 1G82A 4J23B 3BB2A 1MC9A 4I1EA 5FZUA 4A7KA 2D20A 2VXRA 4I4XA 1G9DA 2HWAA 3ZXDA 2RQ9A 5DVHA 1JT4A 2L5XA 4XKIA 3UJ4A 3QYDA 3FJJA 4JPZA 3H6RB 3HOMA 1HIBA 2NVHA 4P0LA 3D7WB 4USPA 3O49A 1SZ6B 3UD9A 1KNMA 4I4OA 3WMVA 4I7IA 3VT2A 2KI6B 4I2SA 5BP5C 1T9FA 4LO3C 3WINA 1ISVA 3CRGA 1RY7A 2NP0A 2KI4A 5BXTA 3UD8A 2K4AB 1PUMB 4AN6A 5DZUA 4ZLBB 2Z48A 4OEEA 1RZOB 2VSEA 3O44A 2YUGA 3ZX7A 3B9UA 3FJEA 4LO7B 3F62B 1JT7A 4OEGA 3OJMA 3BTAA 1W3FA 1JTCA 5FZZA 4I4UA 4KEKA 4KEIA 2D22A 3LLPA 3V0BA 1M16A 1FWUA 3NBEA 1IHKA 3BAQA 1DQOA 3AJ6A 1BFBA 1IILA 1EPWA 1T4QA 3AKHA 3FUOA 3A07A 3OJ2A 4HR6C 1HCEA 3FJ8A 3O4DA 3CRHA 5JMCA 4KBBA 3FJIA 5DUYA 1V6UA 3FUQA 2E4MC 4X3AA 3S8KA 1ISZA 5BXRA 5JLVA 3W9TA 1W3AA 3IM5A 3WO3A 2BFHA 3ZC8A 3Q7XA 1EYLA 1S0BA 4I37A 4LO2A 2P23A 1CVSA 5BXSA 3OBRA 2FFUA 3N7JA 1S0DA 4KC3A 1II4A 4I96A 3CU1B 1XYFA 1HWOB 4P6AA 2LIEA 1TOOA 2KKIA 1WD4A 2F8XC 4ZA3B 4QBVA 1TTUA 1RMLA 2IHOA 3O4AA 4LO1C 4LO8B 4J2XA 2F2FA 3WMUA 3S8JA 1Z2VA 3IAGC 1WD3A 3WA1A 4OEFA 2NM1A 3P6JA 4JKQA 4D8HA 4Z8SB 1IOBA 4X37A 3HMYA 4J2YA 1HWNB 4I0YA 4KEJA 4I6IA 5DSSB 2GO2A 4JKXB 1DFQA 1QQKA 2RG9B 3AZVA 3CA5A 4PC4A 2QN4A 3I2XA 4EFPA 4EFRA 4OW4A 1L2HA 1ISYA 1S0EA 3AH2A 1IRPA 2Q3NB 2DREA 5EG6C 2NTDA 2FDBM 3SNVA 4LO7C 3KMVA 2AXMA 1V6XA 4QBCA 5BQUA 3V0BB 1J0SA 3FJBA 1XG6A 3RTIB 1TP0A 4ZGRB 3Q7WA 1NUNA 1Q04A 3FGMA 3N7KA 3FJ9A 3O4OA 1AFCA 21BIA 4IONA 1DJSB 4G9MA 7I1BA 1AVXB 4H04A 3JRRA 1BFGA 1G9CA 2K8RA 2Y9WC 4ZBVB 41BIA 4QC4A 1HWMB 4F83A 3CA1A 5GAQA 1BFFA 1HWPB 1EV2A 4ISRA 2ESUA 2VXTI 3R4SA 5D62A 1DZDA 1G9BA 1M2TB 3HALA 4I4QA 1ABRB 3O5WB 1N4KA 1YTOA 4QKSA 1AF9A 4ZFYB 4I4PA 1YYNA 1DQGA 4IZEA 4OWKA 1FMZA 3V0AB 1QQLA 3FJKA 3P53A 4OWJA 3CA6A 3Q7YA 4ZFWB 1P63A 4Q9GA 5EHAA 3PHZA 5F8YA 2Y9XE 1FMMS 3O3QA 1AVWB 1DLLA 2X2SA 2AQZA 4GP3A 1JY0A 5BVPI 3AKFA 4I3NA 3N7LA 1BARA 2HWMA 2ZQNA 3R4UA 2AFGA 1PC8B 5B2HA 2XOAA 4JRAA 3FJAA 3BAHA 3H6RA 4QD2C 1E0OA 3MALA 4ENDA 4IY9A 2Q9XA 5FNXA 5BXPA 3T8SA 3WINC 4LO0A 3HN1A 1WBAA 4J2SA 4I4RA 3UDAA 2BEAA 4XFTA 1BFCA 3P6IA 4QALA 3NBDA 2AAIB 3IM6A 4IZXA 1SR4A 1BLDA 1S0LA 4XFUA 2FFVA 1IJTA 1TIEA 2VUAA 3V79C 1FWVA 3A22A 2NZ9A 2X2TA 3BA5A 3RTJB 1K5UA 4H9WA 2MC2A 5D63A 3AH4A 3O4BA 1MD6A 1PWAA 4HA2A 4L4HA 1TWMA 3AZWA 4QD2B 1R8NA 3IM7A 1BA7A 1S0FA 3EF2A 1S0GA 4FGFA 2D7IA 3RSJA 2FO1A 4USOA 5BP5A 3AH1A 1EVTA 4LO3A 2WBCA 3C9ZA 4GP0A 5D61A 5BOWA 4I4YA 3H6SE 3A21A 1FN0A 1YXWA 4FVVA 4ZFUB 4I4VA 3VSFA 3BAVA 1HKNA
chains in the Genus database with same CATH superfamily
1JT5A 2MLLB 4LO2C 4ISQA 4X39A 3WO4A 2ZQOA 1XHBA 2IWTB 2D23A 3N0KA 4P0KA 3OGGA 4A7ZA 4GAFA 1JQZA 2VU9A 3LTQA 4IYBA 1NZKA 2D24A 3H6QA 4EFQA 2I1BA 1JLYA 4EB2B 2F2FC 3UD7A 4OWLA 1AVUA 4II0A 3VEQA 3AJ5A 3OBTA 1R8OA 4HJJA 6I1BA 2M49A 3BA7A 3K1XA 4CJMA 2E4MA 4D0ZA 4Z9WB 2BEBA 2D44A 1CE7B 1YBIA 2ET2A 3E8LC 1RG8A 2VLCA 3BRGC 4QO3A 2D7RA 3FJHA 3AKIA 2WRYA 3CA3A 4JQ0A 3N7MA 1FQ9A 2UUSA 2LIQA 4IQPA 4P0JA 3CRIA 3VWCA 3BRDA 3ILAA 9ILBA 1V6VA 4A7YA 1Q03A 1HCDA 4TLPA 1ONKB 3OJVA 4EEEB 1Q1UA 3HSMA 4AN7B 2ERMA 3VSZA 3I2AA 1TFMB 3JUTA 5HPZA 4I1BA 2HW9A 3POKA 5FZYA 4GOVA 1GGPB 2HZ9A 5BQUC 3F1RA 4LO1A 2FGFA 4L4IA 4DCKC 4QKRA 1OQLB 1DZCA 1FV2A 3CA0A 1DFCA 1PZZA 1QXMA 4G1RA 4X38A 4DENA 1UPSA 3NBNA 1TWEA 3ZC9A 3BADA 4I4SA 3HBWA 3ZXGA 3CQAA 4JAWA 4D0TA 3QR5A 3BRFA 3FFZA 3PUBA 4G6MA 3VT1A 1JLXA 1Z4SA 3UJ0A 1K5VA 2D43A 4JP0A 4F34A 1ISWA 2P39A 4ZOTA 4G9NA 1DIWA 1BLAA 1I1BA 2Y9FA 3VUOA 1A8DA 2MIBA 2GZBA 1G9AA 1FGAA 1WBCA 4ZKTB 1PUUB 3PG0A 2Y9GA 1ILR1 5F90A 1IT0A 1VCLA 3FJDA 3RMXA 4R6UB 2K43A 31BIA 1BASA 2NYYA 4GOYA 4G6JA 2ZR1B 2DRZA 3TC2A 5F8WA 3WO2A 1I1EA 1JT3A 3NJ5A 1Z0HA 1W3GA 4I8MA 3V0AA 2Z49A 3PMEA 4XFSA 1FV3A 1V6WA 1D0HA 1IRAX 5G00A 4GAIA 3MPPG 8I1BA 3IIRA 2DRYA 3FJCA 5E24E 2J3PA 3BAUA 3BA4A 5FNWA 2VSAA 2DS0A 2R9KB 3BAOA 3CAHA 3NBCA 2QYIB 1YF8B 2KH2A 1S0CA 1AXMA 1XZZA 4WBCA 4EKXB 3AKGA 3OGFA 4LO0C 3I29B 3CA4A 4OUJA 2RSTA 3RMYA 4Q91A 3BAGA 3A23A 1AVAC 4DEPA 4IHZA 1ISXA 2KLLA 4Q9PA 4J2KA 5EC5A 2D1ZA 4IY8A 1SR4C 3VT0A 5I1BA 1ITBA 3BX1C 1F31A 3O4CA 4YOLA 5F8SA 3FJFA 1G82A 4J23B 3BB2A 1MC9A 4I1EA 5FZUA 4A7KA 2D20A 2VXRA 4I4XA 1G9DA 2HWAA 3ZXDA 2RQ9A 5DVHA 1JT4A 2L5XA 4XKIA 3UJ4A 3QYDA 3FJJA 4JPZA 3H6RB 3HOMA 1HIBA 2NVHA 4P0LA 3D7WB 4USPA 3O49A 1SZ6B 3UD9A 1KNMA 4I4OA 3WMVA 4I7IA 3VT2A 2KI6B 4I2SA 5BP5C 1T9FA 4LO3C 3WINA 1ISVA 3CRGA 1RY7A 2NP0A 2KI4A 5BXTA 3UD8A 2K4AB 1PUMB 4AN6A 5DZUA 4ZLBB 2Z48A 4OEEA 1RZOB 2VSEA 3O44A 2YUGA 3ZX7A 3B9UA 3FJEA 4LO7B 3F62B 1JT7A 4OEGA 3OJMA 3BTAA 1W3FA 1JTCA 5FZZA 4I4UA 4KEKA 4KEIA 2D22A 3LLPA 3V0BA 1M16A 1FWUA 3NBEA 1IHKA 3BAQA 1DQOA 3AJ6A 1BFBA 1IILA 1EPWA 1T4QA 3AKHA 3FUOA 3A07A 3OJ2A 4HR6C 1HCEA 3FJ8A 3O4DA 3CRHA 5JMCA 4KBBA 3FJIA 5DUYA 1V6UA 3FUQA 2E4MC 4X3AA 3S8KA 1ISZA 5BXRA 5JLVA 3W9TA 1W3AA 3IM5A 3WO3A 2BFHA 3ZC8A 3Q7XA 1EYLA 1S0BA 4I37A 4LO2A 2P23A 1CVSA 5BXSA 3OBRA 2FFUA 3N7JA 1S0DA 4KC3A 1II4A 4I96A 3CU1B 1XYFA 1HWOB 4P6AA 2LIEA 1TOOA 2KKIA 1WD4A 2F8XC 4ZA3B 4QBVA 1TTUA 1RMLA 2IHOA 3O4AA 4LO1C 4LO8B 4J2XA 2F2FA 3WMUA 3S8JA 1Z2VA 3IAGC 1WD3A 3WA1A 4OEFA 2NM1A 3P6JA 4JKQA 4D8HA 4Z8SB 1IOBA 4X37A 3HMYA 4J2YA 1HWNB 4I0YA 4KEJA 2NS2A 4I6IA 5DSSB 2GO2A 4JKXB 1DFQA 1QQKA 2RG9B 4MZGB 3AZVA 3CA5A 4PC4A 2QN4A 3I2XA 4EFPA 4EFRA 4OW4A 1L2HA 1ISYA 1S0EA 3AH2A 1IRPA 2Q3NB 2DREA 5EG6C 2NTDA 2FDBM 3SNVA 4LO7C 3KMVA 2AXMA 1V6XA 4QBCA 5BQUA 3V0BB 1J0SA 3FJBA 1XG6A 3RTIB 1TP0A 4ZGRB 3Q7WA 1NUNA 1Q04A 3FGMA 3N7KA 3FJ9A 3O4OA 1AFCA 21BIA 4IONA 1DJSB 4G9MA 7I1BA 1AVXB 4H04A 3JRRA 1BFGA 1G9CA 2K8RA 2Y9WC 4ZBVB 41BIA 4QC4A 1HWMB 4F83A 3CA1A 5GAQA 1BFFA 1HWPB 1EV2A 4ISRA 2ESUA 2VXTI 4H75A 3R4SA 5D62A 1DZDA 1G9BA 1M2TB 3HALA 4I4QA 1ABRB 3O5WB 1N4KA 1YTOA 4QKSA 1AF9A 4ZFYB 4I4PA 1YYNA 1DQGA 4IZEA 4OWKA 1FMZA 3V0AB 1QQLA 3FJKA 3P53A 4OWJA 3CA6A 3Q7YA 4ZFWB 1P63A 4Q9GA 5EHAA 3PHZA 5F8YA 2Y9XE 1FMMS 3O3QA 1AVWB 1DLLA 2X2SA 2AQZA 4GP3A 1JY0A 5BVPI 3AKFA 4I3NA 3N7LA 1BARA 2HWMA 2ZQNA 3R4UA 2AFGA 1PC8B 5B2HA 2XOAA 4JRAA 3FJAA 3BAHA 3H6RA 4QD2C 1E0OA 3MALA 4ENDA 4IY9A 2Q9XA 5FNXA 5BXPA 3T8SA 3WINC 4LO0A 3HN1A 1WBAA 4J2SA 4I4RA 3UDAA 2BEAA 4XFTA 1BFCA 3P6IA 4QALA 3NBDA 2AAIB 3IM6A 4IZXA 1SR4A 1BLDA 1S0LA 4XFUA 2FFVA 1IJTA 1TIEA 2VUAA 4MZHA 1FWVA 3V79C 3A22A 2NZ9A 2X2TA 3BA5A 3RTJB 1K5UA 4H9WA 2MC2A 5D63A 3AH4A 3O4BA 1MD6A 1PWAA 4UY4A 4HA2A 4L4HA 1TWMA 3AZWA 4MZFB 4QD2B 1R8NA 3IM7A 1BA7A 1S0FA 3EF2A 1S0GA 4FGFA 2D7IA 3RSJA 2FO1A 4USOA 5BP5A 3AH1A 1EVTA 4LO3A 2WBCA 3C9ZA 4GP0A 5D61A 5BOWA 4I4YA 3H6SE 3A21A 1FN0A 1YXWA 4FVVA 4ZFUB 4I4VA 3VSFA 3BAVA 1HKNA
chains in the Genus database with same CATH topology
1JT5A 2MLLB 4LO2C 4ISQA 4X39A 3WO4A 2ZQOA 1XHBA 2IWTB 2D23A 3N0KA 4P0KA 3OGGA 4A7ZA 4GAFA 1JQZA 2VU9A 3LTQA 4IYBA 1NZKA 2D24A 3H6QA 4EFQA 2I1BA 1JLYA 4EB2B 2F2FC 3UD7A 4OWLA 1AVUA 4II0A 3VEQA 3AJ5A 3OBTA 1R8OA 4HJJA 6I1BA 2M49A 3BA7A 3K1XA 4CJMA 2E4MA 4D0ZA 4Z9WB 2BEBA 2D44A 1CE7B 1YBIA 2ET2A 3E8LC 1RG8A 2VLCA 3BRGC 4QO3A 2D7RA 3FJHA 3AKIA 2WRYA 3CA3A 4JQ0A 3N7MA 1FQ9A 2UUSA 2LIQA 4IQPA 4P0JA 3CRIA 3VWCA 3BRDA 3ILAA 9ILBA 1V6VA 4A7YA 1Q03A 1HCDA 4TLPA 1ONKB 3OJVA 4EEEB 1Q1UA 3HSMA 4AN7B 2ERMA 3VSZA 3I2AA 1TFMB 3JUTA 5HPZA 4I1BA 2HW9A 3POKA 5FZYA 4GOVA 1GGPB 2HZ9A 5BQUC 3F1RA 4LO1A 2FGFA 4L4IA 4DCKC 4QKRA 1OQLB 1DZCA 1FV2A 3CA0A 1DFCA 1PZZA 1QXMA 4G1RA 4X38A 4DENA 1UPSA 3NBNA 1TWEA 3ZC9A 3BADA 4I4SA 3HBWA 3ZXGA 3CQAA 4JAWA 4D0TA 3QR5A 3BRFA 3FFZA 3PUBA 4G6MA 3VT1A 1JLXA 1Z4SA 3UJ0A 1K5VA 2D43A 4JP0A 4F34A 1ISWA 2P39A 4ZOTA 4G9NA 1DIWA 1BLAA 1I1BA 2Y9FA 3VUOA 1A8DA 2MIBA 2GZBA 1G9AA 1FGAA 1WBCA 4ZKTB 1PUUB 3PG0A 2Y9GA 1ILR1 5F90A 1IT0A 1VCLA 3FJDA 3RMXA 4R6UB 2K43A 31BIA 1BASA 2NYYA 4GOYA 4G6JA 2ZR1B 2DRZA 3TC2A 5F8WA 3WO2A 1I1EA 1JT3A 3NJ5A 1Z0HA 1W3GA 4I8MA 3V0AA 2Z49A 3PMEA 4XFSA 1FV3A 1V6WA 1D0HA 1IRAX 5G00A 4GAIA 3MPPG 8I1BA 3IIRA 2DRYA 3FJCA 5E24E 2J3PA 3BAUA 3BA4A 5FNWA 2VSAA 2DS0A 2R9KB 3BAOA 3CAHA 3NBCA 2QYIB 1YF8B 2KH2A 1S0CA 1AXMA 1XZZA 4WBCA 4EKXB 3AKGA 3OGFA 4LO0C 3I29B 3CA4A 4OUJA 2RSTA 3RMYA 4Q91A 3BAGA 3A23A 1AVAC 4DEPA 4IHZA 1ISXA 2KLLA 4Q9PA 4J2KA 5EC5A 2D1ZA 4IY8A 1SR4C 3VT0A 5I1BA 1ITBA 3BX1C 1F31A 3O4CA 4YOLA 5F8SA 3FJFA 1G82A 4J23B 3BB2A 1MC9A 4I1EA 5FZUA 4A7KA 2D20A 2VXRA 4I4XA 1G9DA 2HWAA 3ZXDA 2RQ9A 5DVHA 1JT4A 2L5XA 4XKIA 3UJ4A 3QYDA 3FJJA 4JPZA 3H6RB 3HOMA 1HIBA 2NVHA 4P0LA 3D7WB 4USPA 3O49A 1SZ6B 3UD9A 1KNMA 4I4OA 3WMVA 4I7IA 3VT2A 2KI6B 4I2SA 5BP5C 1T9FA 4LO3C 3WINA 1ISVA 3CRGA 1RY7A 2NP0A 2KI4A 5BXTA 3UD8A 2K4AB 1PUMB 4AN6A 5DZUA 4ZLBB 2Z48A 4OEEA 1RZOB 2VSEA 3O44A 2YUGA 3ZX7A 3B9UA 3FJEA 4LO7B 3F62B 1JT7A 4OEGA 3OJMA 3BTAA 1W3FA 1JTCA 5FZZA 4I4UA 4KEKA 4KEIA 2D22A 3LLPA 3V0BA 1M16A 1FWUA 3NBEA 1IHKA 3BAQA 1DQOA 3AJ6A 1BFBA 1IILA 1EPWA 1T4QA 3AKHA 3FUOA 3A07A 3OJ2A 4HR6C 1HCEA 3FJ8A 3O4DA 3CRHA 5JMCA 4KBBA 3FJIA 5DUYA 1V6UA 3FUQA 2E4MC 4X3AA 3S8KA 1ISZA 5BXRA 5JLVA 3W9TA 1W3AA 3IM5A 3WO3A 2BFHA 3ZC8A 3Q7XA 1EYLA 1S0BA 4I37A 4LO2A 2P23A 1CVSA 5BXSA 3OBRA 2FFUA 3N7JA 1S0DA 4KC3A 1II4A 4I96A 3CU1B 1XYFA 1HWOB 4P6AA 2LIEA 1TOOA 2KKIA 1WD4A 2F8XC 4ZA3B 4QBVA 1TTUA 1RMLA 2IHOA 3O4AA 4LO1C 4LO8B 4J2XA 2F2FA 3WMUA 3S8JA 1Z2VA 3IAGC 1WD3A 3WA1A 4OEFA 2NM1A 3P6JA 4JKQA 4D8HA 4Z8SB 1IOBA 4X37A 3HMYA 4J2YA 1HWNB 4I0YA 4KEJA 2NS2A 4I6IA 5DSSB 2GO2A 4JKXB 1DFQA 1QQKA 2RG9B 4MZGB 3AZVA 3CA5A 4PC4A 2QN4A 3I2XA 4EFPA 4EFRA 4OW4A 1L2HA 1ISYA 1S0EA 3AH2A 1IRPA 2Q3NB 2DREA 5EG6C 2NTDA 2FDBM 3SNVA 4LO7C 3KMVA 2AXMA 1V6XA 4QBCA 5BQUA 3V0BB 1J0SA 3FJBA 1XG6A 3RTIB 1TP0A 4ZGRB 3Q7WA 1NUNA 1Q04A 3FGMA 3N7KA 3FJ9A 3O4OA 1AFCA 21BIA 4IONA 1DJSB 4G9MA 7I1BA 1AVXB 4H04A 3JRRA 1BFGA 1G9CA 2K8RA 2Y9WC 4ZBVB 41BIA 4QC4A 1HWMB 4F83A 3CA1A 5GAQA 1BFFA 1HWPB 1EV2A 4ISRA 2ESUA 2VXTI 4H75A 3R4SA 5D62A 1DZDA 1G9BA 1M2TB 3HALA 4I4QA 1ABRB 3O5WB 1N4KA 1YTOA 4QKSA 1AF9A 4ZFYB 4I4PA 1YYNA 1DQGA 4IZEA 4OWKA 1FMZA 3V0AB 1QQLA 3FJKA 3P53A 4OWJA 3CA6A 3Q7YA 4ZFWB 1P63A 4Q9GA 5EHAA 3PHZA 5F8YA 2Y9XE 1FMMS 3O3QA 1AVWB 1DLLA 2X2SA 2AQZA 4GP3A 1JY0A 5BVPI 3AKFA 4I3NA 3N7LA 1BARA 2HWMA 2ZQNA 3R4UA 2AFGA 1PC8B 5B2HA 2XOAA 4JRAA 3FJAA 3BAHA 3H6RA 4QD2C 1E0OA 3MALA 4ENDA 4IY9A 2Q9XA 5FNXA 5BXPA 3T8SA 3WINC 4LO0A 3HN1A 1WBAA 4J2SA 4I4RA 3UDAA 2BEAA 4XFTA 1BFCA 3P6IA 4QALA 3NBDA 2AAIB 3IM6A 4IZXA 1SR4A 1BLDA 1S0LA 4XFUA 2FFVA 1IJTA 1TIEA 2VUAA 4MZHA 1FWVA 3V79C 3A22A 2NZ9A 2X2TA 3BA5A 3RTJB 1K5UA 4H9WA 2MC2A 5D63A 3AH4A 3O4BA 1MD6A 1PWAA 4UY4A 4HA2A 4L4HA 1TWMA 3AZWA 4MZFB 4QD2B 1R8NA 3IM7A 1BA7A 1S0FA 3EF2A 1S0GA 4FGFA 2D7IA 3RSJA 2FO1A 4USOA 5BP5A 3AH1A 1EVTA 4LO3A 2WBCA 3C9ZA 4GP0A 5D61A 5BOWA 4I4YA 3H6SE 3A21A 1FN0A 1YXWA 4FVVA 4ZFUB 4I4VA 3VSFA 3BAVA 1HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT5 A;  2MLL B;  4LO2 C;  4ISQ A;  4X39 A;  3WO4 A;  2ZQO A;  1XHB A;  2IWT B;  2D23 A;  3N0K A;  4P0K A;  3OGG A;  4A7Z A;  4GAF A;  1JQZ A;  2VU9 A;  3LTQ A;  4IYB A;  1NZK A;  2D24 A;  3H6Q A;  4EFQ A;  2I1B A;  1JLY A;  4EB2 B;  2F2F C;  3UD7 A;  4OWL A;  1AVU A;  4II0 A;  3VEQ A;  3AJ5 A;  3OBT A;  1R8O A;  4HJJ A;  6I1B A;  2M49 A;  3BA7 A;  3K1X A;  4CJM A;  2E4M A;  4D0Z A;  4Z9W B;  2BEB A;  2D44 A;  1CE7 B;  1YBI A;  2ET2 A;  3E8L C;  1RG8 A;  2VLC A;  3BRG C;  4QO3 A;  2D7R A;  3FJH A;  3AKI A;  2WRY A;  3CA3 A;  4JQ0 A;  3N7M A;  1FQ9 A;  2UUS A;  2LIQ A;  4IQP A;  4P0J A;  3CRI A;  3VWC A;  3BRD A;  3ILA A;  9ILB A;  1V6V A;  4A7Y A;  1Q03 A;  1HCD A;  4TLP A;  1ONK B;  3OJV A;  4EEE B;  1Q1U A;  3HSM A;  4AN7 B;  2ERM A;  3VSZ A;  3I2A A;  1TFM B;  3JUT A;  5HPZ A;  4I1B A;  2HW9 A;  3POK A;  5FZY A;  4GOV A;  1GGP B;  2HZ9 A;  5BQU C;  3F1R A;  4LO1 A;  2FGF A;  4L4I A;  4DCK C;  4QKR A;  1OQL B;  1DZC A;  1FV2 A;  3CA0 A;  1DFC A;  1PZZ A;  1QXM A;  4G1R A;  4X38 A;  4DEN A;  1UPS A;  3NBN A;  1TWE A;  3ZC9 A;  3BAD A;  4I4S A;  3HBW A;  3ZXG A;  3CQA A;  4JAW A;  4D0T A;  3QR5 A;  3BRF A;  3FFZ A;  3PUB A;  4G6M A;  3VT1 A;  1JLX A;  1Z4S A;  3UJ0 A;  1K5V A;  2D43 A;  4JP0 A;  4F34 A;  1ISW A;  2P39 A;  4ZOT A;  4G9N A;  1DIW A;  1BLA A;  1I1B A;  2Y9F A;  3VUO A;  1A8D A;  2MIB A;  2GZB A;  1G9A A;  1FGA A;  1WBC A;  4ZKT B;  1PUU B;  3PG0 A;  2Y9G A;  1ILR 1;  5F90 A;  1IT0 A;  1VCL A;  3FJD A;  3RMX A;  4R6U B;  2K43 A;  31BI A;  1BAS A;  2NYY A;  4GOY A;  4G6J A;  2ZR1 B;  2DRZ A;  3TC2 A;  5F8W A;  3WO2 A;  1I1E A;  1JT3 A;  3NJ5 A;  1Z0H A;  1W3G A;  4I8M A;  3V0A A;  2Z49 A;  3PME A;  4XFS A;  1FV3 A;  1V6W A;  1D0H A;  1IRA X;  5G00 A;  4GAI A;  3MPP G;  8I1B A;  3IIR A;  2DRY A;  3FJC A;  5E24 E;  2J3P A;  3BAU A;  3BA4 A;  5FNW A;  2VSA A;  2DS0 A;  2R9K B;  3BAO A;  3CAH A;  3NBC A;  2QYI B;  1YF8 B;  2KH2 A;  1S0C A;  1AXM A;  1XZZ A;  4WBC A;  4EKX B;  3AKG A;  3OGF A;  4LO0 C;  3I29 B;  3CA4 A;  4OUJ A;  2RST A;  3RMY A;  4Q91 A;  3BAG A;  3A23 A;  1AVA C;  4DEP A;  4IHZ A;  1ISX A;  2KLL A;  4Q9P A;  4J2K A;  5EC5 A;  2D1Z A;  4IY8 A;  1SR4 C;  3VT0 A;  5I1B A;  1ITB A;  3BX1 C;  1F31 A;  3O4C A;  4YOL A;  5F8S A;  3FJF A;  1G82 A;  4J23 B;  3BB2 A;  1MC9 A;  4I1E A;  5FZU A;  4A7K A;  2D20 A;  2VXR A;  4I4X A;  1G9D A;  2HWA A;  3ZXD A;  2RQ9 A;  5DVH A;  1JT4 A;  2L5X A;  4XKI A;  3UJ4 A;  3QYD A;  3FJJ A;  4JPZ A;  3H6R B;  3HOM A;  1HIB A;  2NVH A;  4P0L A;  3D7W B;  4USP A;  3O49 A;  1SZ6 B;  3UD9 A;  1KNM A;  4I4O A;  3WMV A;  4I7I A;  3VT2 A;  2KI6 B;  4I2S A;  5BP5 C;  1T9F A;  4LO3 C;  3WIN A;  1ISV A;  3CRG A;  1RY7 A;  2NP0 A;  2KI4 A;  5BXT A;  3UD8 A;  2K4A B;  1PUM B;  4AN6 A;  5DZU A;  4ZLB B;  2Z48 A;  4OEE A;  1RZO B;  2VSE A;  3O44 A;  2YUG A;  3ZX7 A;  3B9U A;  3FJE A;  4LO7 B;  3F62 B;  1JT7 A;  4OEG A;  3OJM A;  3BTA A;  1W3F A;  1JTC A;  5FZZ A;  4I4U A;  4KEK A;  4KEI A;  2D22 A;  3LLP A;  3V0B A;  1M16 A;  1FWU A;  3NBE A;  1IHK A;  3BAQ A;  1DQO A;  3AJ6 A;  1BFB A;  1IIL A;  1EPW A;  1T4Q A;  3AKH A;  3FUO A;  3A07 A;  3OJ2 A;  4HR6 C;  1HCE A;  3FJ8 A;  3O4D A;  3CRH A;  5JMC A;  4KBB A;  3FJI A;  5DUY A;  1V6U A;  3FUQ A;  2E4M C;  4X3A A;  3S8K A;  1ISZ A;  5BXR A;  5JLV A;  3W9T A;  1W3A A;  3IM5 A;  3WO3 A;  2BFH A;  3ZC8 A;  3Q7X A;  1EYL A;  1S0B A;  4I37 A;  4LO2 A;  2P23 A;  1CVS A;  5BXS A;  3OBR A;  2FFU A;  3N7J A;  1S0D A;  4KC3 A;  1II4 A;  4I96 A;  3CU1 B;  1XYF A;  1HWO B;  4P6A A;  2LIE A;  1TOO A;  2KKI A;  1WD4 A;  2F8X C;  4ZA3 B;  4QBV A;  1TTU A;  1RML A;  2IHO A;  3O4A A;  4LO1 C;  4LO8 B;  4J2X A;  2F2F A;  3WMU A;  3S8J A;  1Z2V A;  3IAG C;  1WD3 A;  3WA1 A;  4OEF A;  2NM1 A;  3P6J A;  4JKQ A;  4D8H A;  4Z8S B;  1IOB A;  4X37 A;  3HMY A;  4J2Y A;  1HWN B;  4I0Y A;  4KEJ A;  4I6I A;  5DSS B;  2GO2 A;  4JKX B;  1DFQ A;  1QQK A;  2RG9 B;  3AZV A;  3CA5 A;  4PC4 A;  2QN4 A;  3I2X A;  4EFP A;  4EFR A;  4OW4 A;  1L2H A;  1ISY A;  1S0E A;  3AH2 A;  1IRP A;  2Q3N B;  2DRE A;  5EG6 C;  2NTD A;  2FDB M;  3SNV A;  4LO7 C;  3KMV A;  2AXM A;  1V6X A;  4QBC A;  5BQU A;  3V0B B;  1J0S A;  3FJB A;  1XG6 A;  3RTI B;  1TP0 A;  4ZGR B;  3Q7W A;  1NUN A;  1Q04 A;  3FGM A;  3N7K A;  3FJ9 A;  3O4O A;  1AFC A;  21BI A;  4ION A;  1DJS B;  4G9M A;  7I1B A;  1AVX B;  4H04 A;  3JRR A;  1BFG A;  1G9C A;  2K8R A;  2Y9W C;  4ZBV B;  41BI A;  4QC4 A;  1HWM B;  4F83 A;  3CA1 A;  5GAQ A;  1BFF A;  1HWP B;  1EV2 A;  4ISR A;  2ESU A;  2VXT I;  3R4S A;  5D62 A;  1DZD A;  1G9B A;  1M2T B;  3HAL A;  4I4Q A;  1ABR B;  3O5W B;  1N4K A;  1YTO A;  4QKS A;  1AF9 A;  4ZFY B;  4I4P A;  1YYN A;  1DQG A;  4IZE A;  4OWK A;  1FMZ A;  3V0A B;  1QQL A;  3FJK A;  3P53 A;  4OWJ A;  3CA6 A;  3Q7Y A;  4ZFW B;  1P63 A;  4Q9G A;  5EHA A;  3PHZ A;  5F8Y A;  2Y9X E;  1FMM S;  3O3Q A;  1AVW B;  1DLL A;  2X2S A;  2AQZ A;  4GP3 A;  1JY0 A;  5BVP I;  3AKF A;  4I3N A;  3N7L A;  1BAR A;  2HWM A;  2ZQN A;  3R4U A;  2AFG A;  1PC8 B;  5B2H A;  2XOA A;  4JRA A;  3FJA A;  3BAH A;  3H6R A;  4QD2 C;  1E0O A;  3MAL A;  4END A;  4IY9 A;  2Q9X A;  5FNX A;  5BXP A;  3T8S A;  3WIN C;  4LO0 A;  3HN1 A;  1WBA A;  4J2S A;  4I4R A;  3UDA A;  2BEA A;  4XFT A;  1BFC A;  3P6I A;  4QAL A;  3NBD A;  2AAI B;  3IM6 A;  4IZX A;  1SR4 A;  1BLD A;  1S0L A;  4XFU A;  2FFV A;  1IJT A;  1TIE A;  2VUA A;  3V79 C;  1FWV A;  3A22 A;  2NZ9 A;  2X2T A;  3BA5 A;  3RTJ B;  1K5U A;  4H9W A;  2MC2 A;  5D63 A;  3AH4 A;  3O4B A;  1MD6 A;  1PWA A;  4HA2 A;  4L4H A;  1TWM A;  3AZW A;  4QD2 B;  1R8N A;  3IM7 A;  1BA7 A;  1S0F A;  3EF2 A;  1S0G A;  4FGF A;  2D7I A;  3RSJ A;  2FO1 A;  4USO A;  5BP5 A;  3AH1 A;  1EVT A;  4LO3 A;  2WBC A;  3C9Z A;  4GP0 A;  5D61 A;  5BOW A;  4I4Y A;  3H6S E;  3A21 A;  1FN0 A;  1YXW A;  4FVV A;  4ZFU B;  4I4V A;  3VSF A;  3BAV A;  1HKN A; 
#chains in the Genus database with same CATH topology
 1JT5 A;  2MLL B;  4LO2 C;  4ISQ A;  4X39 A;  3WO4 A;  2ZQO A;  1XHB A;  2IWT B;  2D23 A;  3N0K A;  4P0K A;  3OGG A;  4A7Z A;  4GAF A;  1JQZ A;  2VU9 A;  3LTQ A;  4IYB A;  1NZK A;  2D24 A;  3H6Q A;  4EFQ A;  2I1B A;  1JLY A;  4EB2 B;  2F2F C;  3UD7 A;  4OWL A;  1AVU A;  4II0 A;  3VEQ A;  3AJ5 A;  3OBT A;  1R8O A;  4HJJ A;  6I1B A;  2M49 A;  3BA7 A;  3K1X A;  4CJM A;  2E4M A;  4D0Z A;  4Z9W B;  2BEB A;  2D44 A;  1CE7 B;  1YBI A;  2ET2 A;  3E8L C;  1RG8 A;  2VLC A;  3BRG C;  4QO3 A;  2D7R A;  3FJH A;  3AKI A;  2WRY A;  3CA3 A;  4JQ0 A;  3N7M A;  1FQ9 A;  2UUS A;  2LIQ A;  4IQP A;  4P0J A;  3CRI A;  3VWC A;  3BRD A;  3ILA A;  9ILB A;  1V6V A;  4A7Y A;  1Q03 A;  1HCD A;  4TLP A;  1ONK B;  3OJV A;  4EEE B;  1Q1U A;  3HSM A;  4AN7 B;  2ERM A;  3VSZ A;  3I2A A;  1TFM B;  3JUT A;  5HPZ A;  4I1B A;  2HW9 A;  3POK A;  5FZY A;  4GOV A;  1GGP B;  2HZ9 A;  5BQU C;  3F1R A;  4LO1 A;  2FGF A;  4L4I A;  4DCK C;  4QKR A;  1OQL B;  1DZC A;  1FV2 A;  3CA0 A;  1DFC A;  1PZZ A;  1QXM A;  4G1R A;  4X38 A;  4DEN A;  1UPS A;  3NBN A;  1TWE A;  3ZC9 A;  3BAD A;  4I4S A;  3HBW A;  3ZXG A;  3CQA A;  4JAW A;  4D0T A;  3QR5 A;  3BRF A;  3FFZ A;  3PUB A;  4G6M A;  3VT1 A;  1JLX A;  1Z4S A;  3UJ0 A;  1K5V A;  2D43 A;  4JP0 A;  4F34 A;  1ISW A;  2P39 A;  4ZOT A;  4G9N A;  1DIW A;  1BLA A;  1I1B A;  2Y9F A;  3VUO A;  1A8D A;  2MIB A;  2GZB A;  1G9A A;  1FGA A;  1WBC A;  4ZKT B;  1PUU B;  3PG0 A;  2Y9G A;  1ILR 1;  5F90 A;  1IT0 A;  1VCL A;  3FJD A;  3RMX A;  4R6U B;  2K43 A;  31BI A;  1BAS A;  2NYY A;  4GOY A;  4G6J A;  2ZR1 B;  2DRZ A;  3TC2 A;  5F8W A;  3WO2 A;  1I1E A;  1JT3 A;  3NJ5 A;  1Z0H A;  1W3G A;  4I8M A;  3V0A A;  2Z49 A;  3PME A;  4XFS A;  1FV3 A;  1V6W A;  1D0H A;  1IRA X;  5G00 A;  4GAI A;  3MPP G;  8I1B A;  3IIR A;  2DRY A;  3FJC A;  5E24 E;  2J3P A;  3BAU A;  3BA4 A;  5FNW A;  2VSA A;  2DS0 A;  2R9K B;  3BAO A;  3CAH A;  3NBC A;  2QYI B;  1YF8 B;  2KH2 A;  1S0C A;  1AXM A;  1XZZ A;  4WBC A;  4EKX B;  3AKG A;  3OGF A;  4LO0 C;  3I29 B;  3CA4 A;  4OUJ A;  2RST A;  3RMY A;  4Q91 A;  3BAG A;  3A23 A;  1AVA C;  4DEP A;  4IHZ A;  1ISX A;  2KLL A;  4Q9P A;  4J2K A;  5EC5 A;  2D1Z A;  4IY8 A;  1SR4 C;  3VT0 A;  5I1B A;  1ITB A;  3BX1 C;  1F31 A;  3O4C A;  4YOL A;  5F8S A;  3FJF A;  1G82 A;  4J23 B;  3BB2 A;  1MC9 A;  4I1E A;  5FZU A;  4A7K A;  2D20 A;  2VXR A;  4I4X A;  1G9D A;  2HWA A;  3ZXD A;  2RQ9 A;  5DVH A;  1JT4 A;  2L5X A;  4XKI A;  3UJ4 A;  3QYD A;  3FJJ A;  4JPZ A;  3H6R B;  3HOM A;  1HIB A;  2NVH A;  4P0L A;  3D7W B;  4USP A;  3O49 A;  1SZ6 B;  3UD9 A;  1KNM A;  4I4O A;  3WMV A;  4I7I A;  3VT2 A;  2KI6 B;  4I2S A;  5BP5 C;  1T9F A;  4LO3 C;  3WIN A;  1ISV A;  3CRG A;  1RY7 A;  2NP0 A;  2KI4 A;  5BXT A;  3UD8 A;  2K4A B;  1PUM B;  4AN6 A;  5DZU A;  4ZLB B;  2Z48 A;  4OEE A;  1RZO B;  2VSE A;  3O44 A;  2YUG A;  3ZX7 A;  3B9U A;  3FJE A;  4LO7 B;  3F62 B;  1JT7 A;  4OEG A;  3OJM A;  3BTA A;  1W3F A;  1JTC A;  5FZZ A;  4I4U A;  4KEK A;  4KEI A;  2D22 A;  3LLP A;  3V0B A;  1M16 A;  1FWU A;  3NBE A;  1IHK A;  3BAQ A;  1DQO A;  3AJ6 A;  1BFB A;  1IIL A;  1EPW A;  1T4Q A;  3AKH A;  3FUO A;  3A07 A;  3OJ2 A;  4HR6 C;  1HCE A;  3FJ8 A;  3O4D A;  3CRH A;  5JMC A;  4KBB A;  3FJI A;  5DUY A;  1V6U A;  3FUQ A;  2E4M C;  4X3A A;  3S8K A;  1ISZ A;  5BXR A;  5JLV A;  3W9T A;  1W3A A;  3IM5 A;  3WO3 A;  2BFH A;  3ZC8 A;  3Q7X A;  1EYL A;  1S0B A;  4I37 A;  4LO2 A;  2P23 A;  1CVS A;  5BXS A;  3OBR A;  2FFU A;  3N7J A;  1S0D A;  4KC3 A;  1II4 A;  4I96 A;  3CU1 B;  1XYF A;  1HWO B;  4P6A A;  2LIE A;  1TOO A;  2KKI A;  1WD4 A;  2F8X C;  4ZA3 B;  4QBV A;  1TTU A;  1RML A;  2IHO A;  3O4A A;  4LO1 C;  4LO8 B;  4J2X A;  2F2F A;  3WMU A;  3S8J A;  1Z2V A;  3IAG C;  1WD3 A;  3WA1 A;  4OEF A;  2NM1 A;  3P6J A;  4JKQ A;  4D8H A;  4Z8S B;  1IOB A;  4X37 A;  3HMY A;  4J2Y A;  1HWN B;  4I0Y A;  4KEJ A;  2NS2 A;  4I6I A;  5DSS B;  2GO2 A;  4JKX B;  1DFQ A;  1QQK A;  2RG9 B;  4MZG B;  3AZV A;  3CA5 A;  4PC4 A;  2QN4 A;  3I2X A;  4EFP A;  4EFR A;  4OW4 A;  1L2H A;  1ISY A;  1S0E A;  3AH2 A;  1IRP A;  2Q3N B;  2DRE A;  5EG6 C;  2NTD A;  2FDB M;  3SNV A;  4LO7 C;  3KMV A;  2AXM A;  1V6X A;  4QBC A;  5BQU A;  3V0B B;  1J0S A;  3FJB A;  1XG6 A;  3RTI B;  1TP0 A;  4ZGR B;  3Q7W A;  1NUN A;  1Q04 A;  3FGM A;  3N7K A;  3FJ9 A;  3O4O A;  1AFC A;  21BI A;  4ION A;  1DJS B;  4G9M A;  7I1B A;  1AVX B;  4H04 A;  3JRR A;  1BFG A;  1G9C A;  2K8R A;  2Y9W C;  4ZBV B;  41BI A;  4QC4 A;  1HWM B;  4F83 A;  3CA1 A;  5GAQ A;  1BFF A;  1HWP B;  1EV2 A;  4ISR A;  2ESU A;  2VXT I;  4H75 A;  3R4S A;  5D62 A;  1DZD A;  1G9B A;  1M2T B;  3HAL A;  4I4Q A;  1ABR B;  3O5W B;  1N4K A;  1YTO A;  4QKS A;  1AF9 A;  4ZFY B;  4I4P A;  1YYN A;  1DQG A;  4IZE A;  4OWK A;  1FMZ A;  3V0A B;  1QQL A;  3FJK A;  3P53 A;  4OWJ A;  3CA6 A;  3Q7Y A;  4ZFW B;  1P63 A;  4Q9G A;  5EHA A;  3PHZ A;  5F8Y A;  2Y9X E;  1FMM S;  3O3Q A;  1AVW B;  1DLL A;  2X2S A;  2AQZ A;  4GP3 A;  1JY0 A;  5BVP I;  3AKF A;  4I3N A;  3N7L A;  1BAR A;  2HWM A;  2ZQN A;  3R4U A;  2AFG A;  1PC8 B;  5B2H A;  2XOA A;  4JRA A;  3FJA A;  3BAH A;  3H6R A;  4QD2 C;  1E0O A;  3MAL A;  4END A;  4IY9 A;  2Q9X A;  5FNX A;  5BXP A;  3T8S A;  3WIN C;  4LO0 A;  3HN1 A;  1WBA A;  4J2S A;  4I4R A;  3UDA A;  2BEA A;  4XFT A;  1BFC A;  3P6I A;  4QAL A;  3NBD A;  2AAI B;  3IM6 A;  4IZX A;  1SR4 A;  1BLD A;  1S0L A;  4XFU A;  2FFV A;  1IJT A;  1TIE A;  2VUA A;  4MZH A;  1FWV A;  3V79 C;  3A22 A;  2NZ9 A;  2X2T A;  3BA5 A;  3RTJ B;  1K5U A;  4H9W A;  2MC2 A;  5D63 A;  3AH4 A;  3O4B A;  1MD6 A;  1PWA A;  4UY4 A;  4HA2 A;  4L4H A;  1TWM A;  3AZW A;  4MZF B;  4QD2 B;  1R8N A;  3IM7 A;  1BA7 A;  1S0F A;  3EF2 A;  1S0G A;  4FGF A;  2D7I A;  3RSJ A;  2FO1 A;  4USO A;  5BP5 A;  3AH1 A;  1EVT A;  4LO3 A;  2WBC A;  3C9Z A;  4GP0 A;  5D61 A;  5BOW A;  4I4Y A;  3H6S E;  3A21 A;  1FN0 A;  1YXW A;  4FVV A;  4ZFU B;  4I4V A;  3VSF A;  3BAV A;  1HKN A; 
#chains in the Genus database with same CATH homology
 1JT5 A;  2MLL B;  4LO2 C;  4ISQ A;  4X39 A;  3WO4 A;  2ZQO A;  1XHB A;  2IWT B;  2D23 A;  3N0K A;  4P0K A;  3OGG A;  4A7Z A;  4GAF A;  1JQZ A;  2VU9 A;  3LTQ A;  4IYB A;  1NZK A;  2D24 A;  3H6Q A;  4EFQ A;  2I1B A;  1JLY A;  4EB2 B;  2F2F C;  3UD7 A;  4OWL A;  1AVU A;  4II0 A;  3VEQ A;  3AJ5 A;  3OBT A;  1R8O A;  4HJJ A;  6I1B A;  2M49 A;  3BA7 A;  3K1X A;  4CJM A;  2E4M A;  4D0Z A;  4Z9W B;  2BEB A;  2D44 A;  1CE7 B;  1YBI A;  2ET2 A;  3E8L C;  1RG8 A;  2VLC A;  3BRG C;  4QO3 A;  2D7R A;  3FJH A;  3AKI A;  2WRY A;  3CA3 A;  4JQ0 A;  3N7M A;  1FQ9 A;  2UUS A;  2LIQ A;  4IQP A;  4P0J A;  3CRI A;  3VWC A;  3BRD A;  3ILA A;  9ILB A;  1V6V A;  4A7Y A;  1Q03 A;  1HCD A;  4TLP A;  1ONK B;  3OJV A;  4EEE B;  1Q1U A;  3HSM A;  4AN7 B;  2ERM A;  3VSZ A;  3I2A A;  1TFM B;  3JUT A;  5HPZ A;  4I1B A;  2HW9 A;  3POK A;  5FZY A;  4GOV A;  1GGP B;  2HZ9 A;  5BQU C;  3F1R A;  4LO1 A;  2FGF A;  4L4I A;  4DCK C;  4QKR A;  1OQL B;  1DZC A;  1FV2 A;  3CA0 A;  1DFC A;  1PZZ A;  1QXM A;  4G1R A;  4X38 A;  4DEN A;  1UPS A;  3NBN A;  1TWE A;  3ZC9 A;  3BAD A;  4I4S A;  3HBW A;  3ZXG A;  3CQA A;  4JAW A;  4D0T A;  3QR5 A;  3BRF A;  3FFZ A;  3PUB A;  4G6M A;  3VT1 A;  1JLX A;  1Z4S A;  3UJ0 A;  1K5V A;  2D43 A;  4JP0 A;  4F34 A;  1ISW A;  2P39 A;  4ZOT A;  4G9N A;  1DIW A;  1BLA A;  1I1B A;  2Y9F A;  3VUO A;  1A8D A;  2MIB A;  2GZB A;  1G9A A;  1FGA A;  1WBC A;  4ZKT B;  1PUU B;  3PG0 A;  2Y9G A;  1ILR 1;  5F90 A;  1IT0 A;  1VCL A;  3FJD A;  3RMX A;  4R6U B;  2K43 A;  31BI A;  1BAS A;  2NYY A;  4GOY A;  4G6J A;  2ZR1 B;  2DRZ A;  3TC2 A;  5F8W A;  3WO2 A;  1I1E A;  1JT3 A;  3NJ5 A;  1Z0H A;  1W3G A;  4I8M A;  3V0A A;  2Z49 A;  3PME A;  4XFS A;  1FV3 A;  1V6W A;  1D0H A;  1IRA X;  5G00 A;  4GAI A;  3MPP G;  8I1B A;  3IIR A;  2DRY A;  3FJC A;  5E24 E;  2J3P A;  3BAU A;  3BA4 A;  5FNW A;  2VSA A;  2DS0 A;  2R9K B;  3BAO A;  3CAH A;  3NBC A;  2QYI B;  1YF8 B;  2KH2 A;  1S0C A;  1AXM A;  1XZZ A;  4WBC A;  4EKX B;  3AKG A;  3OGF A;  4LO0 C;  3I29 B;  3CA4 A;  4OUJ A;  2RST A;  3RMY A;  4Q91 A;  3BAG A;  3A23 A;  1AVA C;  4DEP A;  4IHZ A;  1ISX A;  2KLL A;  4Q9P A;  4J2K A;  5EC5 A;  2D1Z A;  4IY8 A;  1SR4 C;  3VT0 A;  5I1B A;  1ITB A;  3BX1 C;  1F31 A;  3O4C A;  4YOL A;  5F8S A;  3FJF A;  1G82 A;  4J23 B;  3BB2 A;  1MC9 A;  4I1E A;  5FZU A;  4A7K A;  2D20 A;  2VXR A;  4I4X A;  1G9D A;  2HWA A;  3ZXD A;  2RQ9 A;  5DVH A;  1JT4 A;  2L5X A;  4XKI A;  3UJ4 A;  3QYD A;  3FJJ A;  4JPZ A;  3H6R B;  3HOM A;  1HIB A;  2NVH A;  4P0L A;  3D7W B;  4USP A;  3O49 A;  1SZ6 B;  3UD9 A;  1KNM A;  4I4O A;  3WMV A;  4I7I A;  3VT2 A;  2KI6 B;  4I2S A;  5BP5 C;  1T9F A;  4LO3 C;  3WIN A;  1ISV A;  3CRG A;  1RY7 A;  2NP0 A;  2KI4 A;  5BXT A;  3UD8 A;  2K4A B;  1PUM B;  4AN6 A;  5DZU A;  4ZLB B;  2Z48 A;  4OEE A;  1RZO B;  2VSE A;  3O44 A;  2YUG A;  3ZX7 A;  3B9U A;  3FJE A;  4LO7 B;  3F62 B;  1JT7 A;  4OEG A;  3OJM A;  3BTA A;  1W3F A;  1JTC A;  5FZZ A;  4I4U A;  4KEK A;  4KEI A;  2D22 A;  3LLP A;  3V0B A;  1M16 A;  1FWU A;  3NBE A;  1IHK A;  3BAQ A;  1DQO A;  3AJ6 A;  1BFB A;  1IIL A;  1EPW A;  1T4Q A;  3AKH A;  3FUO A;  3A07 A;  3OJ2 A;  4HR6 C;  1HCE A;  3FJ8 A;  3O4D A;  3CRH A;  5JMC A;  4KBB A;  3FJI A;  5DUY A;  1V6U A;  3FUQ A;  2E4M C;  4X3A A;  3S8K A;  1ISZ A;  5BXR A;  5JLV A;  3W9T A;  1W3A A;  3IM5 A;  3WO3 A;  2BFH A;  3ZC8 A;  3Q7X A;  1EYL A;  1S0B A;  4I37 A;  4LO2 A;  2P23 A;  1CVS A;  5BXS A;  3OBR A;  2FFU A;  3N7J A;  1S0D A;  4KC3 A;  1II4 A;  4I96 A;  3CU1 B;  1XYF A;  1HWO B;  4P6A A;  2LIE A;  1TOO A;  2KKI A;  1WD4 A;  2F8X C;  4ZA3 B;  4QBV A;  1TTU A;  1RML A;  2IHO A;  3O4A A;  4LO1 C;  4LO8 B;  4J2X A;  2F2F A;  3WMU A;  3S8J A;  1Z2V A;  3IAG C;  1WD3 A;  3WA1 A;  4OEF A;  2NM1 A;  3P6J A;  4JKQ A;  4D8H A;  4Z8S B;  1IOB A;  4X37 A;  3HMY A;  4J2Y A;  1HWN B;  4I0Y A;  4KEJ A;  2NS2 A;  4I6I A;  5DSS B;  2GO2 A;  4JKX B;  1DFQ A;  1QQK A;  2RG9 B;  4MZG B;  3AZV A;  3CA5 A;  4PC4 A;  2QN4 A;  3I2X A;  4EFP A;  4EFR A;  4OW4 A;  1L2H A;  1ISY A;  1S0E A;  3AH2 A;  1IRP A;  2Q3N B;  2DRE A;  5EG6 C;  2NTD A;  2FDB M;  3SNV A;  4LO7 C;  3KMV A;  2AXM A;  1V6X A;  4QBC A;  5BQU A;  3V0B B;  1J0S A;  3FJB A;  1XG6 A;  3RTI B;  1TP0 A;  4ZGR B;  3Q7W A;  1NUN A;  1Q04 A;  3FGM A;  3N7K A;  3FJ9 A;  3O4O A;  1AFC A;  21BI A;  4ION A;  1DJS B;  4G9M A;  7I1B A;  1AVX B;  4H04 A;  3JRR A;  1BFG A;  1G9C A;  2K8R A;  2Y9W C;  4ZBV B;  41BI A;  4QC4 A;  1HWM B;  4F83 A;  3CA1 A;  5GAQ A;  1BFF A;  1HWP B;  1EV2 A;  4ISR A;  2ESU A;  2VXT I;  4H75 A;  3R4S A;  5D62 A;  1DZD A;  1G9B A;  1M2T B;  3HAL A;  4I4Q A;  1ABR B;  3O5W B;  1N4K A;  1YTO A;  4QKS A;  1AF9 A;  4ZFY B;  4I4P A;  1YYN A;  1DQG A;  4IZE A;  4OWK A;  1FMZ A;  3V0A B;  1QQL A;  3FJK A;  3P53 A;  4OWJ A;  3CA6 A;  3Q7Y A;  4ZFW B;  1P63 A;  4Q9G A;  5EHA A;  3PHZ A;  5F8Y A;  2Y9X E;  1FMM S;  3O3Q A;  1AVW B;  1DLL A;  2X2S A;  2AQZ A;  4GP3 A;  1JY0 A;  5BVP I;  3AKF A;  4I3N A;  3N7L A;  1BAR A;  2HWM A;  2ZQN A;  3R4U A;  2AFG A;  1PC8 B;  5B2H A;  2XOA A;  4JRA A;  3FJA A;  3BAH A;  3H6R A;  4QD2 C;  1E0O A;  3MAL A;  4END A;  4IY9 A;  2Q9X A;  5FNX A;  5BXP A;  3T8S A;  3WIN C;  4LO0 A;  3HN1 A;  1WBA A;  4J2S A;  4I4R A;  3UDA A;  2BEA A;  4XFT A;  1BFC A;  3P6I A;  4QAL A;  3NBD A;  2AAI B;  3IM6 A;  4IZX A;  1SR4 A;  1BLD A;  1S0L A;  4XFU A;  2FFV A;  1IJT A;  1TIE A;  2VUA A;  4MZH A;  1FWV A;  3V79 C;  3A22 A;  2NZ9 A;  2X2T A;  3BA5 A;  3RTJ B;  1K5U A;  4H9W A;  2MC2 A;  5D63 A;  3AH4 A;  3O4B A;  1MD6 A;  1PWA A;  4UY4 A;  4HA2 A;  4L4H A;  1TWM A;  3AZW A;  4MZF B;  4QD2 B;  1R8N A;  3IM7 A;  1BA7 A;  1S0F A;  3EF2 A;  1S0G A;  4FGF A;  2D7I A;  3RSJ A;  2FO1 A;  4USO A;  5BP5 A;  3AH1 A;  1EVT A;  4LO3 A;  2WBC A;  3C9Z A;  4GP0 A;  5D61 A;  5BOW A;  4I4Y A;  3H6S E;  3A21 A;  1FN0 A;  1YXW A;  4FVV A;  4ZFU B;  4I4V A;  3VSF A;  3BAV A;  1HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...