2P3MA

Solution structure of mj0056
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
b'MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin Kinase MJ0056
publication title A CTP-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 16
structure length 136
sequence length 136
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2p3mA01
1N06A 1N05A 3BNWA 1NB9A 5FO1A 5A89A 4UZEA 2I1LA 2OYNA 4UZFA 3OP1A 1T6XA 3CTAA 1P4MA 2X0KA 1MRZA 2VBUA 1S4MA 3ZUGA 1NB0A 5A88A 2VBTA 5FO0A 2VBVA 1N07A 5FNZA 5A8AA 1T6ZA 1N08A 5TRDA 2VBSA 2P3MA 1Q9SA 1T6YA
chains in the Genus database with same CATH superfamily
1QH0A 3GQBA 1I8DA 1QUFA 4AF6A 2BV3A 2FVGA 4QFMA 2WZPP 1TVCA 1QUEA 1PJ5A 4LBZA 4RJLA 2HLDA 3BQJA 3AGQA 4PGOA 4P12A 3PA2A 1F60A 1FNMA 3CMMA 4XKVA 1YJNB 1HZEA 1K73D 3CRZA 3ZZUA 4XQFA 2C5HA 2J7KA 2QTZA 1OHHA 1VLOA 1PJ6A 2W6IA 2QGGA 4M4SA 5TR9A 1TTTA 1YHQB 2NPFA 4QUZA 1N08A 1CNFA 1BJKA 1FNDA 1JA1A 4X0CA 3MCAA 1QX4A 1B23P 3WXMA 4HE5A 1Q86D 1I7PA 3Q3AA 1VQNB 1G7SA 1GO2A 3CCVB 4XOTA 2BM0A 3CCMB 4CQJA 4UZEA 2D9RA 1CNEA 1KK2A 4B48A 1BX0A 3ZPNA 2QMUA 2RC5A 4YAFA 2F1MA 3T51B 1IHMA 4XLEA 3LO8A 2ZZQA 3LVBA 2BM1A 3R6KA 5F4OA 1NJID 4IW3B 2ZZGA 2C77A 3CPXA 3J81k 3GIRA 3ASTA 3W2IA 5FA6A 1KJZA 1QGZA 3BCFA 3E20A 1IJFA 1A8PA 3I1FA 3Q6QA 5IYRA 4DNTB 4DNRB 3QSYA 1NRKA 2PMDA 2RC6A 1E64A 1W34A 3B8HA 1E79A 3W5VA 5A89A 1EFUA 4C43A 4RD4A 1EP1B 1QFJA 4RDLA 4B4DA 2OYNA 2AHOA 1W87A 3SJPA 1OB5A 3KEWA 4G6IA 2ZBUA 3VMFA 5KSWB 4TSFA 3BC9A 1AMOA 4GQNA 3B78A 1FRQA 1VQ9B 2JJ1A 1RQRA 4DQKA 4YHBA 5JBQA 2NV4A 3OOCA 2F1LA 4YXWA 1K9MD 4XR6A 1QGYA 2VYQA 4TT3A 2V7UA 1WPCA 1DDIA 4DK0A 1OB0A 4OOXA 4RD6A 3ZC3A 3LQ6A 1VJSA 2ZXHA 1WTHD 4TMZA 1TUIA 1DG1G 5FIUA 5E6TA 4XN0A 3LQEA 4X8IA 3CC2B 4XN3A 3Q6RA 3CMEB 2DERA 4P3IA 1GR1A 1DDGA 4P22A 4Y9RA 4WZKA 1T6ZA 2WPDA 4II2A 2CF4A 4Z4ZA 3AVTA 1XQBA 2E1RA 1S72B 1KD1D 2WSSA 4YEJA 2EFGA 2P3MA 3CCEB 2GJRA 2PLFA 3JQRA 4WQMA 1N06A 4P2NA 1UD6A 3OPOA 1WORA 3CW2A 4PABA 3ZBTA 3WY9A 1BMFA 3ONUA 1BQEA 3CESA 3E1YE 1VF7A 1D2EA 4QVAA 1WOPA 3OJWA 4L8JA 1VQLB 3OAAA 4RD1A 4UZFA 4KKSA 1Y0RA 2V31A 1E1QA 2B7BA 1NB0A 2R9VA 2YWEA 4N3GA 4ROXA 4X7DA 4XD7A 5A88A 1SM4A 2WR8A 1GJRA 2D3NA 1B2RA 4B44A 2ZZEA 4M2LA 3A3GA 2ZTGA 2QDXA 3OJXA 3GVLA 3JQQA 1H85A 2B7CA 2WJYA 1KMHA 2DCUA 1BPLA 3CCSB 2LZJA 2XOKA 3CCQB 4P6YA 4OOVA 3CD6B 2Q6KA 5BSYA 2X3UA 5HKKA 3BY2A 3NE5B 3CC4B 1EFCA 4XLFA 3AVUA 3OW2B 1ELOA 1T5EA 1WDTA 3VNVA 1W9XA 2ZL5A 4YAOA 4Z1MA 1J9ZA 2WJVA 4C0SA 1R5OA 4RPBA 1P4MA 1ZM4A 2VBUA 3OZVA 1KZLA 3W2GA 3SLDA 4ZGNB 1F20A 1VQ6B 2HDNB 2PIAA 1VQ8B 1VQ7B 3OZUA 1YITB 4LBWA 3V7AA 4ZCMA 5TRDA 2VBSA 4WZEA 4OOSA 1W0JA 1QGAA 2JJ2A 1N0UA 4XLHA 5DN6A 3ZZTA 3I56B 2OK7A 1W2BB 2Q6LA 3FJOA 4F7DA 2I1LA 3W5UA 5H5JA 1V0EA 2ZITA 1I18A 2QEXB 2DY1A 2X8KA 3WBKA 4OPVA 1VQOB 1IB0A 2VBVA 4UAJA 5TV2A 3I55B 1FNBA 4YELA 2FX3A 1WOOA 5A8AA 4QVJA 4XNFA 3PUMA 4FK8A 4M1KA 4B3GA 4P6VF 2CBXA 4LBVA 1SKYB 4Y9UA 2JN9A 2VNKA 2QE7A 4Y7CA 3W2FA 4P9SA 4AVZA 4B3XA 2OTJB 1E3XA 2OBTA 3QFCA 5THXA 1KQSB 5H59A 1UD2A 2V7WA 1W35A 2OK8A 1ZM9A 2F43A 1VLYA 1RQPA 4MYTA 2V4DA 5IYPA 3T53B 4TMWA 4OPSA 2X0KA 4FN5A 3ZUGA 4K1XA 1G7CA 1WP6A 2GJKA 4PC6A 4Z4RA 1UD8A 4II3A 1EXMA 4TKOB 2E1BA 5KW9A 1FDRA 4HIZA 2VJJA 4XMYA 1R5NA 1H8HA 4OPOA 2X53S 1QVGB 4ZGQB 3AVYA 3BY1A 1QVFB 1GVHA 5F4MA 2QN6A 3U2QA 1U2RA 2CRVA 4RPDA 2QTLA 2ZTNA 3ASSA 3GVJA 3VR6A 1WSRA 1SKQA 4XONA 1YIJB 1BX1A 2XNJA 3OP1A 4RM0A 3ZZ0A 3SLNA 3QFRA 4G7XA 1V0FA 2V7VA 1UD5A 2GJPA 4P26A 3ZIAA 4ZCLA 3WNDA 5IYWA 3A8JA 2C78A 1E62A 3G4SB 4QV2A 4XLAA 3OEHA 1IJEA 4AF7A 2V7XA 4H9GA 2OBRA 3MHPA 4LBYA 1YJ9B 3CXCB 4Z4YA 2GK6A 1KK0A 2X85A 5IYQA 1Q82D 3WYAA 2B5OA 1V5VA 1VHEA 4XLCA 4B43A 4RLZA 1QFZA 2X6XA 1COWA 4G5GA 3CPWB 3AGPA 5CDFA 3WNCA 2BVNA 1E43A 1OGIA 5FO0A 5HXBA 1N07A 2OTLB 2BF4A 4XOPA 2DOGA 5B6IA 5J3OA 4FXUA 1OGJA 1WOSA 3GVKA 4UZUA 5HZBA 3W2EA 3WQZA 2GK7A 1ZUNB 4NBSA 4OP7A 1N05A 3FPKA 4RCYA 3BH4A 2R6HA 1D8TA 2YWGA 3U6KA 1JJ2B 3R6JA 3OKXA 3KL9A 3VO2A 4RD2A 3BCDA 4TMTA 3G05A 4P3YA 2BN4A 3ONYA 4AC9A 2V7TA 3OFNA 1UMKA 5KNLA 3ASRA 2HCJB 4X06A 3DDYA 3A8IA 4KKTA 1WSVA 3H9NA 4TMVA 4WZTA 2VBTA 4PC1A 4G7WA 1EWYA 1N8RD 3PA1A 1G7TA 2F4NA 1GAQA 1GAWA 2C2WA 1G7RA 4Q7JB 3A1PA 2XZPA 3CCJB 2C4TA 4R71A 2ZBVA 3OE7A 3OW7A 4PC2A 3AVWA 5DSZA 2XNCA 2BPOA 1EP2B 3CC7B 1VQMB 4U9UA 2OBSA 2DIEA 2WZNA 4G1VA 2XZLA 1R5BA 2X6YA 1DARA 1JNYA 1HVXA 4Z4SA 2VNJA 1YI2B 5FL7A 4G1BA 1VQPB 5IYNA 1CQXA 1W0KA 2VJIA 1K8AD 2XGJA 2Q6OA 1S4MA 2XNDA 4ACBA 1WU8A 1S0UA 4RCZA 4X7EA 1FNCA 1PKVA 4PC3A 5BSXA 3CCRB 3SJZA 3LNNA 2VNIA 1AIPA 1HA3A 2BGIA 2CNDA 1TLLA 3CCLB 3AVXA 1Q9SA 1T6YA 4X7FA 3SKBA 1XFOA 3ISXA 2XEXA 2C4UA 5HZAA 2V7QA 1XB2A 3GSIA 4NNJA 5EMNA 1Q7YD 1Y0YA 4X7CA 3ES9A 1ZM2A 4XM3A 3P26A 4P1VA 4Z4VA 4B3FX 4KKUA 3QFTA 4YAWA 1KRHA 1QFYA 4RD0A 2DYIA 4XL9A 3T56B 4M0LA 3A3BA 3D26A 3HAGA 3JU4A 3QE2A 3VNUA 2C5BA 3JQPA 1JB9A 4DK1A 1NBMA 1M1KD 3ASQA 3RY8A 4ASUA 2GQFA 2BGJA 3H94A 2Q6IA 3P27A 4RDJA 3OEEA 1KK1A 1E3ZA 1ZM3A 3SEJA 4ACAA 4DQLA 4Z4WA 2CK3A 3WNBA 4B47A 5AN9A 2WYRA 1YJWB 3PENA 2ZZFA 3OZWA 2D74A 4J0QA 3WBJA 2X6WA 4X05A 3MMPA 1T6XA 1UD4A 2JIZA 3Q39A 3A8KA 4PAAA 1VQKB 4M53A 4EH1A 1VHOA 3CP8A 3A35A 3CMAB 4TMXA 2EIXA 4JMQA 2JDIA 5GV8A 1UD3A 4RDKA 4XKWA 2BSAA 3V76A 2CC2A 3B82A 4XORA 2VNHA 2ZL7A 4PC7A 1MABA 4E0FA 3FKSA 3U6BA 5F4JA 2W6JA 1H42A 2DETA 1VQ5B 2DEUA 3PUNA 1NB9A 1H8EA 1OB2A 2CW5A 1KC8D 4LC0A 3ASPA 3PVDA 3ZBUA 1K28D 2M5SA 3W2HA 2XZOA 3QFSA 4QHYA 4HE6A 4ZCIA 1QG0A 1FX0A 5GV7A 4N3NA 4X07A 2KVOA 4FWTA 1E63A 5IK2A 3AVVA 4Z4TA 4WWVA 2YWHA 1VQ4B 5J35A 2VZLA 1NDHA 5LMZA 2GPJA 3CCUB 5DS0A 4BPRA 1EP3B 4WZLA 1XE1A 3VO1A 4RD3A 5L46A 1Q81D 1KTVA 1D1NA 1N0VC 3W5HA 3BNWA 3G71B 5FO1A 1EFRA 4YAUA 1JA0A 2Z6BD 3FPPA 1M90D 2QA4B 1FRNA 4P25A 3CTAA 1YLOA 2ZL6A 4ZV4A 3G6EB 2GREA 2ZXIA 3Q38A 4NCNA 1BLIA 1PJ7A 1MRZA 2D3LA 3CB4A 1YX2A 5TY0A 4YALA 1EFTA 5FNZA 4Z4UA 2HMAA 2PE3A 2BMWA 1KK3A 3CP2A 4MYUA 4TN1A 1E1RA 2YWFA
chains in the Genus database with same CATH topology
1N06A 1N05A 3BNWA 1NB9A 5FO1A 5A89A 4UZEA 2I1LA 2OYNA 4UZFA 3OP1A 1T6XA 3CTAA 1P4MA 2X0KA 1MRZA 2VBUA 1S4MA 3ZUGA 1NB0A 5A88A 2VBTA 5FO0A 2VBVA 1N07A 5FNZA 5A8AA 1T6ZA 1N08A 5TRDA 2VBSA 2P3MA 1Q9SA 1T6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N06 A;  1N05 A;  3BNW A;  1NB9 A;  5FO1 A;  5A89 A;  4UZE A;  2I1L A;  2OYN A;  4UZF A;  3OP1 A;  1T6X A;  3CTA A;  1P4M A;  2X0K A;  1MRZ A;  2VBU A;  1S4M A;  3ZUG A;  1NB0 A;  5A88 A;  2VBT A;  5FO0 A;  2VBV A;  1N07 A;  5FNZ A;  5A8A A;  1T6Z A;  1N08 A;  5TRD A;  2VBS A;  2P3M A;  1Q9S A;  1T6Y A; 
#chains in the Genus database with same CATH topology
 1QH0 A;  3GQB A;  1I8D A;  1QUF A;  4AF6 A;  2BV3 A;  2FVG A;  4QFM A;  2WZP P;  1TVC A;  1QUE A;  1PJ5 A;  4LBZ A;  4RJL A;  2HLD A;  3BQJ A;  3AGQ A;  4PGO A;  4P12 A;  3PA2 A;  1F60 A;  1FNM A;  3CMM A;  4XKV A;  1YJN B;  1HZE A;  1K73 D;  3CRZ A;  3ZZU A;  4XQF A;  2C5H A;  2J7K A;  2QTZ A;  1OHH A;  1VLO A;  1PJ6 A;  2W6I A;  2QGG A;  4M4S A;  5TR9 A;  1TTT A;  1YHQ B;  2NPF A;  4QUZ A;  1N08 A;  1CNF A;  1BJK A;  1FND A;  1JA1 A;  4X0C A;  3MCA A;  1QX4 A;  1B23 P;  3WXM A;  4HE5 A;  1Q86 D;  1I7P A;  3Q3A A;  1VQN B;  1G7S A;  1GO2 A;  3CCV B;  4XOT A;  2BM0 A;  3CCM B;  4CQJ A;  4UZE A;  2D9R A;  1CNE A;  1KK2 A;  4B48 A;  1BX0 A;  3ZPN A;  2QMU A;  2RC5 A;  4YAF A;  2F1M A;  3T51 B;  1IHM A;  4XLE A;  3LO8 A;  2ZZQ A;  3LVB A;  2BM1 A;  3R6K A;  5F4O A;  1NJI D;  4IW3 B;  2ZZG A;  2C77 A;  3CPX A;  3J81 k;  3GIR A;  3AST A;  3W2I A;  5FA6 A;  1KJZ A;  1QGZ A;  3BCF A;  3E20 A;  1IJF A;  1A8P A;  3I1F A;  3Q6Q A;  5IYR A;  4DNT B;  4DNR B;  3QSY A;  1NRK A;  2PMD A;  2RC6 A;  1E64 A;  1W34 A;  3B8H A;  1E79 A;  3W5V A;  5A89 A;  1EFU A;  4C43 A;  4RD4 A;  1EP1 B;  1QFJ A;  4RDL A;  4B4D A;  2OYN A;  2AHO A;  1W87 A;  3SJP A;  1OB5 A;  3KEW A;  4G6I A;  2ZBU A;  3VMF A;  5KSW B;  4TSF A;  3BC9 A;  1AMO A;  4GQN A;  3B78 A;  1FRQ A;  1VQ9 B;  2JJ1 A;  1RQR A;  4DQK A;  4YHB A;  5JBQ A;  2NV4 A;  3OOC A;  2F1L A;  4YXW A;  1K9M D;  4XR6 A;  1QGY A;  2VYQ A;  4TT3 A;  2V7U A;  1WPC A;  1DDI A;  4DK0 A;  1OB0 A;  4OOX A;  4RD6 A;  3ZC3 A;  3LQ6 A;  1VJS A;  2ZXH A;  1WTH D;  4TMZ A;  1TUI A;  1DG1 G;  5FIU A;  5E6T A;  4XN0 A;  3LQE A;  4X8I A;  3CC2 B;  4XN3 A;  3Q6R A;  3CME B;  2DER A;  4P3I A;  1GR1 A;  1DDG A;  4P22 A;  4Y9R A;  4WZK A;  1T6Z A;  2WPD A;  4II2 A;  2CF4 A;  4Z4Z A;  3AVT A;  1XQB A;  2E1R A;  1S72 B;  1KD1 D;  2WSS A;  4YEJ A;  2EFG A;  2P3M A;  3CCE B;  2GJR A;  2PLF A;  3JQR A;  4WQM A;  1N06 A;  4P2N A;  1UD6 A;  3OPO A;  1WOR A;  3CW2 A;  4PAB A;  3ZBT A;  3WY9 A;  1BMF A;  3ONU A;  1BQE A;  3CES A;  3E1Y E;  1VF7 A;  1D2E A;  4QVA A;  1WOP A;  3OJW A;  4L8J A;  1VQL B;  3OAA A;  4RD1 A;  4UZF A;  4KKS A;  1Y0R A;  2V31 A;  1E1Q A;  2B7B A;  1NB0 A;  2R9V A;  2YWE A;  4N3G A;  4ROX A;  4X7D A;  4XD7 A;  5A88 A;  1SM4 A;  2WR8 A;  1GJR A;  2D3N A;  1B2R A;  4B44 A;  2ZZE A;  4M2L A;  3A3G A;  2ZTG A;  2QDX A;  3OJX A;  3GVL A;  3JQQ A;  1H85 A;  2B7C A;  2WJY A;  1KMH A;  2DCU A;  1BPL A;  3CCS B;  2LZJ A;  2XOK A;  3CCQ B;  4P6Y A;  4OOV A;  3CD6 B;  2Q6K A;  5BSY A;  2X3U A;  5HKK A;  3BY2 A;  3NE5 B;  3CC4 B;  1EFC A;  4XLF A;  3AVU A;  3OW2 B;  1ELO A;  1T5E A;  1WDT A;  3VNV A;  1W9X A;  2ZL5 A;  4YAO A;  4Z1M A;  1J9Z A;  2WJV A;  4C0S A;  1R5O A;  4RPB A;  1P4M A;  1ZM4 A;  2VBU A;  3OZV A;  1KZL A;  3W2G A;  3SLD A;  4ZGN B;  1F20 A;  1VQ6 B;  2HDN B;  2PIA A;  1VQ8 B;  1VQ7 B;  3OZU A;  1YIT B;  4LBW A;  3V7A A;  4ZCM A;  5TRD A;  2VBS A;  4WZE A;  4OOS A;  1W0J A;  1QGA A;  2JJ2 A;  1N0U A;  4XLH A;  5DN6 A;  3ZZT A;  3I56 B;  2OK7 A;  1W2B B;  2Q6L A;  3FJO A;  4F7D A;  2I1L A;  3W5U A;  5H5J A;  1V0E A;  2ZIT A;  1I18 A;  2QEX B;  2DY1 A;  2X8K A;  3WBK A;  4OPV A;  1VQO B;  1IB0 A;  2VBV A;  4UAJ A;  5TV2 A;  3I55 B;  1FNB A;  4YEL A;  2FX3 A;  1WOO A;  5A8A A;  4QVJ A;  4XNF A;  3PUM A;  4FK8 A;  4M1K A;  4B3G A;  4P6V F;  2CBX A;  4LBV A;  1SKY B;  4Y9U A;  2JN9 A;  2VNK A;  2QE7 A;  4Y7C A;  3W2F A;  4P9S A;  4AVZ A;  4B3X A;  2OTJ B;  1E3X A;  2OBT A;  3QFC A;  5THX A;  1KQS B;  5H59 A;  1UD2 A;  2V7W A;  1W35 A;  2OK8 A;  1ZM9 A;  2F43 A;  1VLY A;  1RQP A;  4MYT A;  2V4D A;  5IYP A;  3T53 B;  4TMW A;  4OPS A;  2X0K A;  4FN5 A;  3ZUG A;  4K1X A;  1G7C A;  1WP6 A;  2GJK A;  4PC6 A;  4Z4R A;  1UD8 A;  4II3 A;  1EXM A;  4TKO B;  2E1B A;  5KW9 A;  1FDR A;  4HIZ A;  2VJJ A;  4XMY A;  1R5N A;  1H8H A;  4OPO A;  2X53 S;  1QVG B;  4ZGQ B;  3AVY A;  3BY1 A;  1QVF B;  1GVH A;  5F4M A;  2QN6 A;  3U2Q A;  1U2R A;  2CRV A;  4RPD A;  2QTL A;  2ZTN A;  3ASS A;  3GVJ A;  3VR6 A;  1WSR A;  1SKQ A;  4XON A;  1YIJ B;  1BX1 A;  2XNJ A;  3OP1 A;  4RM0 A;  3ZZ0 A;  3SLN A;  3QFR A;  4G7X A;  1V0F A;  2V7V A;  1UD5 A;  2GJP A;  4P26 A;  3ZIA A;  4ZCL A;  3WND A;  5IYW A;  3A8J A;  2C78 A;  1E62 A;  3G4S B;  4QV2 A;  4XLA A;  3OEH A;  1IJE A;  4AF7 A;  2V7X A;  4H9G A;  2OBR A;  3MHP A;  4LBY A;  1YJ9 B;  3CXC B;  4Z4Y A;  2GK6 A;  1KK0 A;  2X85 A;  5IYQ A;  1Q82 D;  3WYA A;  2B5O A;  1V5V A;  1VHE A;  4XLC A;  4B43 A;  4RLZ A;  1QFZ A;  2X6X A;  1COW A;  4G5G A;  3CPW B;  3AGP A;  5CDF A;  3WNC A;  2BVN A;  1E43 A;  1OGI A;  5FO0 A;  5HXB A;  1N07 A;  2OTL B;  2BF4 A;  4XOP A;  2DOG A;  5B6I A;  5J3O A;  4FXU A;  1OGJ A;  1WOS A;  3GVK A;  4UZU A;  5HZB A;  3W2E A;  3WQZ A;  2GK7 A;  1ZUN B;  4NBS A;  4OP7 A;  1N05 A;  3FPK A;  4RCY A;  3BH4 A;  2R6H A;  1D8T A;  2YWG A;  3U6K A;  1JJ2 B;  3R6J A;  3OKX A;  3KL9 A;  3VO2 A;  4RD2 A;  3BCD A;  4TMT A;  3G05 A;  4P3Y A;  2BN4 A;  3ONY A;  4AC9 A;  2V7T A;  3OFN A;  1UMK A;  5KNL A;  3ASR A;  2HCJ B;  4X06 A;  3DDY A;  3A8I A;  4KKT A;  1WSV A;  3H9N A;  4TMV A;  4WZT A;  2VBT A;  4PC1 A;  4G7W A;  1EWY A;  1N8R D;  3PA1 A;  1G7T A;  2F4N A;  1GAQ A;  1GAW A;  2C2W A;  1G7R A;  4Q7J B;  3A1P A;  2XZP A;  3CCJ B;  2C4T A;  4R71 A;  2ZBV A;  3OE7 A;  3OW7 A;  4PC2 A;  3AVW A;  5DSZ A;  2XNC A;  2BPO A;  1EP2 B;  3CC7 B;  1VQM B;  4U9U A;  2OBS A;  2DIE A;  2WZN A;  4G1V A;  2XZL A;  1R5B A;  2X6Y A;  1DAR A;  1JNY A;  1HVX A;  4Z4S A;  2VNJ A;  1YI2 B;  5FL7 A;  4G1B A;  1VQP B;  5IYN A;  1CQX A;  1W0K A;  2VJI A;  1K8A D;  2XGJ A;  2Q6O A;  1S4M A;  2XND A;  4ACB A;  1WU8 A;  1S0U A;  4RCZ A;  4X7E A;  1FNC A;  1PKV A;  4PC3 A;  5BSX A;  3CCR B;  3SJZ A;  3LNN A;  2VNI A;  1AIP A;  1HA3 A;  2BGI A;  2CND A;  1TLL A;  3CCL B;  3AVX A;  1Q9S A;  1T6Y A;  4X7F A;  3SKB A;  1XFO A;  3ISX A;  2XEX A;  2C4U A;  5HZA A;  2V7Q A;  1XB2 A;  3GSI A;  4NNJ A;  5EMN A;  1Q7Y D;  1Y0Y A;  4X7C A;  3ES9 A;  1ZM2 A;  4XM3 A;  3P26 A;  4P1V A;  4Z4V A;  4B3F X;  4KKU A;  3QFT A;  4YAW A;  1KRH A;  1QFY A;  4RD0 A;  2DYI A;  4XL9 A;  3T56 B;  4M0L A;  3A3B A;  3D26 A;  3HAG A;  3JU4 A;  3QE2 A;  3VNU A;  2C5B A;  3JQP A;  1JB9 A;  4DK1 A;  1NBM A;  1M1K D;  3ASQ A;  3RY8 A;  4ASU A;  2GQF A;  2BGJ A;  3H94 A;  2Q6I A;  3P27 A;  4RDJ A;  3OEE A;  1KK1 A;  1E3Z A;  1ZM3 A;  3SEJ A;  4ACA A;  4DQL A;  4Z4W A;  2CK3 A;  3WNB A;  4B47 A;  5AN9 A;  2WYR A;  1YJW B;  3PEN A;  2ZZF A;  3OZW A;  2D74 A;  4J0Q A;  3WBJ A;  2X6W A;  4X05 A;  3MMP A;  1T6X A;  1UD4 A;  2JIZ A;  3Q39 A;  3A8K A;  4PAA A;  1VQK B;  4M53 A;  4EH1 A;  1VHO A;  3CP8 A;  3A35 A;  3CMA B;  4TMX A;  2EIX A;  4JMQ A;  2JDI A;  5GV8 A;  1UD3 A;  4RDK A;  4XKW A;  2BSA A;  3V76 A;  2CC2 A;  3B82 A;  4XOR A;  2VNH A;  2ZL7 A;  4PC7 A;  1MAB A;  4E0F A;  3FKS A;  3U6B A;  5F4J A;  2W6J A;  1H42 A;  2DET A;  1VQ5 B;  2DEU A;  3PUN A;  1NB9 A;  1H8E A;  1OB2 A;  2CW5 A;  1KC8 D;  4LC0 A;  3ASP A;  3PVD A;  3ZBU A;  1K28 D;  2M5S A;  3W2H A;  2XZO A;  3QFS A;  4QHY A;  4HE6 A;  4ZCI A;  1QG0 A;  1FX0 A;  5GV7 A;  4N3N A;  4X07 A;  2KVO A;  4FWT A;  1E63 A;  5IK2 A;  3AVV A;  4Z4T A;  4WWV A;  2YWH A;  1VQ4 B;  5J35 A;  2VZL A;  1NDH A;  5LMZ A;  2GPJ A;  3CCU B;  5DS0 A;  4BPR A;  1EP3 B;  4WZL A;  1XE1 A;  3VO1 A;  4RD3 A;  5L46 A;  1Q81 D;  1KTV A;  1D1N A;  1N0V C;  3W5H A;  3BNW A;  3G71 B;  5FO1 A;  1EFR A;  4YAU A;  1JA0 A;  2Z6B D;  3FPP A;  1M90 D;  2QA4 B;  1FRN A;  4P25 A;  3CTA A;  1YLO A;  2ZL6 A;  4ZV4 A;  3G6E B;  2GRE A;  2ZXI A;  3Q38 A;  4NCN A;  1BLI A;  1PJ7 A;  1MRZ A;  2D3L A;  3CB4 A;  1YX2 A;  5TY0 A;  4YAL A;  1EFT A;  5FNZ A;  4Z4U A;  2HMA A;  2PE3 A;  2BMW A;  1KK3 A;  3CP2 A;  4MYU A;  4TN1 A;  1E1R A;  2YWF A; 
#chains in the Genus database with same CATH homology
 1N06 A;  1N05 A;  3BNW A;  1NB9 A;  5FO1 A;  5A89 A;  4UZE A;  2I1L A;  2OYN A;  4UZF A;  3OP1 A;  1T6X A;  3CTA A;  1P4M A;  2X0K A;  1MRZ A;  2VBU A;  1S4M A;  3ZUG A;  1NB0 A;  5A88 A;  2VBT A;  5FO0 A;  2VBV A;  1N07 A;  5FNZ A;  5A8A A;  1T6Z A;  1N08 A;  5TRD A;  2VBS A;  2P3M A;  1Q9S A;  1T6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...