2P3MA

Solution structure of mj0056
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin Kinase MJ0056
publication title A CTP-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 16
structure length 136
sequence length 136
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2p3mA01
5A89A 5FO1A 1P4MA 1N05A 1S4MA 5TRDA 2OYNA 5A88A 1NB9A 1N06A 1N07A 2VBVA 3CTAA 1T6ZA 3BNWA 1T6XA 2P3MA 3ZUGA 5A8AA 1T6YA 5FNZA 2VBTA 4UZFA 1Q9SA 1MRZA 2X0KA 4UZEA 5FO0A 2VBSA 2I1LA 3OP1A 1N08A 2VBUA 1NB0A
chains in the Genus database with same CATH superfamily
1FNBA 1VQMB 4Q7JB 5FO1A 1H8HA 4B48A 1QH0A 1VQ7B 4XMYA 4XN3A 5J3OA 4RJLA 1Y0RA 3OKXA 3U6KA 1VQ5B 3A8IA 4E0FA 4X7DA 3JQRA 2R9VA 3JU4A 4HIZA 1F60A 3AVXA 1DARA 2GPJA 3FPKA 4PC3A 5IYRA 4RDJA 1WOSA 3SKBA 3T51B 1NRKA 4ZV4A 2GK7A 2QEXB 1NDHA 2RC5A 2WZPP 3WBJA 4XLFA 4G1VA 2C4TA 2XNCA 3BH4A 3QFSA 4XL9A 4MYTA 4UZUA 1QGYA 3OP1A 3B8HA 1K9MD 1HA3A 2AHOA 2XNJA 2ZXIA 1I7PA 1G7SA 5TV2A 3CB4A 2R6HA 2WR8A 3G4SB 3W2GA 2WPDA 1WTHD 3V76A 1KTVA 4QFMA 2VZLA 2V7WA 4XN0A 1VQLB 4Y7CA 1TLLA 3VNUA 4Y9UA 4LBZA 3MCAA 3CMMA 1IJFA 4OPSA 2ZITA 4PC1A 4YELA 1EXMA 3CW2A 3NE5B 2W6JA 3HAGA 3W2FA 1JA1A 1FDRA 5J35A 4ZCLA 2ZTNA 2JDIA 3CMEB 2Q6KA 2BV3A 4B3FX 4Z4UA 5HZAA 2YWHA 3AVYA 3A8JA 4OPOA 1NB9A 2Q6OA 3SJZA 4RD0A 2XZLA 4II3A 4U9UA 1E1RA 4M4SA 1OB2A 1IJEA 1COWA 1VQ4B 2HDNB 4RLZA 1EWYA 3WNCA 2CNDA 3Q39A 3CP2A 4YEJA 1VQOB 4WZKA 5HKKA 4XKVA 1XQBA 4P6VF 4Z4VA 2ZXHA 4PC7A 4RDLA 3CCUB 1BQEA 1P4MA 2OTLB 3I55B 5TRDA 3Q38A 4B43A 2X6YA 3A8KA 3J81k 3Q6RA 1K73D 3CD6B 2OYNA 1WPCA 4QVJA 3A3BA 4QHYA 1W87A 1G7TA 2F1LA 4RCZA 1R5NA 5DS0A 4OOVA 2OK7A 1Q7YD 1D1NA 4K1XA 1ELOA 3VMFA 1JB9A 3LNNA 3WYAA 2BGIA 1QFYA 1QGAA 2VNHA 3MMPA 3OEEA 3KEWA 1H8EA 2ZBVA 3E1YE 1PJ7A 4XKWA 4ACAA 3ZC3A 4PC2A 4N3GA 2NPFA 3QSYA 2J7KA 3GVLA 3OJWA 1VQ9B 1D2EA 1W0JA 1VQ6B 1TTTA 4TMWA 1BPLA 3DDYA 1S72B 2CK3A 4AF6A 4RCYA 1ZM3A 5LMZA 2DERA 1I18A 2GJRA 1T6XA 4AVZA 3CRZA 2BMWA 3CCVB 2WJYA 3PA2A 1YLOA 4Z1MA 1F20A 1KRHA 2BPOA 1ZM4A 3ASQA 3BQJA 2X3UA 3CCQB 3AVTA 1M90D 2Q6LA 4UZEA 4C0SA 1EFTA 2QN6A 1K8AD 3FKSA 2YWFA 3SLDA 5HZBA 3G6EB 4WZLA 3OOCA 5A89A 1VHEA 3ASTA 1VQNB 3JQPA 5TY0A 2FX3A 2OTJB 1KK0A 2W6IA 4TT3A 4B4DA 1D8TA 1KJZA 3WBKA 4FWTA 4OPVA 1W0KA 4M1KA 2QGGA 4NBSA 1YJWB 2B7CA 1N0UA 4WWVA 3BNWA 3CCRB 4XNFA 1DDGA 2D74A 1KK3A 4TKOB 5TR9A 2QDXA 1HVXA 1T6YA 3AVWA 4YALA 1VHOA 5H59A 2DY1A 3CC2B 1ZM9A 2WZNA 1MRZA 1BX0A 4M0LA 4Z4RA 1Q82D 3OAAA 4DK0A 3LQEA 1PJ5A 4Z4TA 3VNVA 2C4UA 3PUMA 3BC9A 4TMTA 5HXBA 1NBMA 4X0CA 3E20A 5IK2A 3W2EA 2D3NA 4YXWA 4X06A 2OBRA 2QMUA 4P9SA 3A1PA 1T6ZA 4XM3A 2XEXA 3OPOA 2WYRA 1VLOA 2VNKA 3WNBA 1SKQA 3GQBA 1FNMA 5A8AA 1VLYA 3H94A 3GSIA 1QVGB 1EFCA 1WSVA 4P6YA 1W9XA 3ZIAA 3ZBUA 1Q86D 2V7QA 3ZZTA 4XD7A 1XB2A 1EFUA 1UD4A 2BM0A 2ZL6A 5B6IA 2JIZA 2ZTGA 5IYPA 1KK1A 2X53S 1S4MA 1GO2A 4B44A 1AMOA 3CESA 2CW5A 2ZL7A 4AF7A 3OE7A 1OB5A 3T53B 1QG0A 4II2A 4ACBA 4AC9A 4MYUA 1R5OA 4NNJA 4Z4WA 4X7FA 3V7AA 4B3GA 3Q3AA 4Z4YA 2V4DA 5IYNA 1ZM2A 2X6WA 2ZL5A 1BX1A 2ZZEA 2OK8A 4KKSA 2I1LA 2WJVA 4YHBA 4XONA 3CCLB 1OGIA 4X7CA 3W2HA 1BMFA 2B5OA 3OZWA 3CC4B 4OOSA 3LQ6A 1KMHA 2XZOA 3CMAB 3BCFA 1UD2A 2BN4A 4XLEA 1RQPA 1E3XA 3VR6A 4GQNA 1UD3A 4B47A 5DN6A 1N07A 1GVHA 2RC6A 4RD3A 2OBTA 4QV2A 4RPBA 2PLFA 4G7XA 2V7VA 4UAJA 3G71B 2PIAA 1GAQA 3GVJA 1H42A 4ZCIA 1YJ9B 1DG1G 5FIUA 3ZZ0A 1KZLA 2VBVA 2V7XA 1E63A 2F1MA 1E43A 4PAAA 5KW9A 4R71A 1GJRA 2BF4A 2F4NA 1BJKA 1FNDA 1N05A 2DIEA 3CCJB 5BSXA 4NCNA 1BLIA 3BY1A 2GK6A 1GR1A 1J9ZA 1GAWA 1WP6A 2XZPA 2Z6BD 3LVBA 3OW7A 2BVNA 2FVGA 1NJID 2HLDA 4Z4SA 2V7TA 1G7CA 2YWGA 4DK1A 2HCJB 1H85A 4P1VA 1V0EA 3A35A 3U2QA 4RDKA 4RD4A 2QTLA 4P2NA 2D3LA 4TMZA 1K28D 4TSFA 3CC7B 2DEUA 1QVFB 5AN9A 3ISXA 1KC8D 5E6TA 2C78A 1UD6A 1EP1B 4YAOA 4PABA 1N08A 3G05A 3U6BA 4G7WA 4WQMA 1WORA 4QVAA 1Q81D 2CF4A 2YWEA 3R6KA 1EP3B 4XORA 5F4OA 3GIRA 5THXA 4RM0A 3BY2A 3QFCA 2D9RA 1CNEA 1OGJA 4WZTA 4N3NA 5FL7A 4LBVA 1W34A 4DQLA 5F4MA 2DCUA 3R6JA 3AVVA 4C43A 3H9NA 5GV7A 2P3MA 1OB0A 2C5HA 3WY9A 4DNRB 4ZGQB 5IYQA 5BSYA 1TVCA 3PVDA 3QFTA 4PGOA 3W5UA 4ZCMA 4B3XA 1WDTA 4DQKA 2DOGA 3W2IA 2VBSA 1XE1A 2C2WA 3AVUA 1NB0A 3CCSB 1G7RA 2HMAA 1KQSB 4HE6A 2BM1A 4M2LA 2BGJA 3I1FA 3T56B 4F7DA 1IHMA 3CPXA 5L46A 4OOXA 1WOOA 2CBXA 2M5SA 3LO8A 1I8DA 5A88A 1QFJA 4DNTB 3PA1A 5DSZA 4YAFA 1T5EA 1RQRA 1QGZA 1SM4A 3Q6QA 1FRNA 1CNFA 1S0UA 3FJOA 3SEJA 4P25A 2VNIA 4XLHA 1JJ2B 2GQFA 2QE7A 3CPWB 3B78A 4PC6A 3BCDA 1E62A 4FN5A 2F43A 5F4JA 2XGJA 1R5BA 2X0KA 5FO0A 4X05A 2VBUA 2XOKA 3D26A 1WSRA 1E1QA 1E3ZA 1QX4A 3WXMA 4ROXA 4G5GA 1WOPA 2BSAA 1UMKA 1VQKB 2EIXA 1E79A 1V5VA 4WZEA 1N06A 4P26A 3PENA 2V7UA 4Z4ZA 2GJPA 1DDIA 2X85A 2QA4B 3CP8A 3OEHA 3MHPA 1W35A 3I56B 2CRVA 5KNLA 1A8PA 1B23P 3OFNA 1EFRA 1XFOA 3ASPA 1E64A 1YIJB 2CC2A 1VF7A 2PMDA 4EH1A 4RD1A 1YHQB 5GV8A 3ONYA 1U2RA 1ZUNB 3CXCB 1QUEA 2DYIA 2PE3A 1PKVA 1KD1D 5H5JA 2ZBUA 5FA6A 3ASSA 3PUNA 5IYWA 4XR6A 3OZVA 3QFRA 3KL9A 1VQ8B 3VO2A 4P3YA 4ZGNB 2VJIA 3ONUA 4FK8A 1PJ6A 2JJ1A 4RD2A 1MABA 4LBWA 4JMQA 4M53A 4XLCA 1EP2B 5FNZA 3RY8A 4H9GA 2VBTA 1FRQA 1KK2A 1Q9SA 4UZFA 3ZZUA 3W5HA 1W2BB 4FXUA 1IB0A 1V0FA 4XLAA 3CCMB 2KVOA 4LC0A 4KKUA 4Y9RA 1VJSA 1QFZA 1Y0YA 5JBQA 1YX2A 3P27A 2X6XA 4YAWA 1YITB 4X8IA 5CDFA 1YJNB 3WQZA 1N0VC 4J0QA 2VYQA 2V31A 2OBSA 4BPRA 4XOPA 1VQPB 3ZBTA 2ZZFA 3OJXA 4KKTA 3ZUGA 1AIPA 4P22A 3VO1A 1OHHA 1FNCA 2DETA 3GVKA 3AGPA 4RPDA 2JJ2A 2EFGA 1TUIA 1CQXA 2X8KA 4TMXA 3CCEB 2B7BA 2VJJA 2NV4A 1WU8A 2LZJA 2ZZQA 3AGQA 3ZPNA 2C77A 4G6IA 4LBYA 4ASUA 4P12A 3P26A 3QE2A 4RD6A 1FX0A 2E1RA 3SJPA 2JN9A 1HZEA 1SKYB 4G1BA 5EMNA 2QTZA 1UD5A 4CQJA 3ES9A 3A3GA 1JA0A 4X07A 4XOTA 3OW2B 1M1KD 3SLNA 2GREA 3CTAA 2C5BA 3WNDA 4TN1A 1N8RD 2XNDA 2VNJA 3FPPA 3W5VA 4L8JA 4OP7A 1B2RA 4TMVA 2ZZGA 4IW3B 2GJKA 1QUFA 2WSSA 1UD8A 3JQQA 2Q6IA 4X7EA 1YI2B 2E1BA 3B82A 3ASRA 4HE5A 4QUZA 3OZUA 4XQFA 5KSWB 4P3IA 4YAUA 1JNYA
chains in the Genus database with same CATH topology
5A89A 5FO1A 1P4MA 1N05A 1S4MA 5TRDA 2OYNA 5A88A 1NB9A 1N06A 1N07A 2VBVA 3CTAA 1T6ZA 3BNWA 1T6XA 2P3MA 3ZUGA 5A8AA 1T6YA 5FNZA 2VBTA 4UZFA 1Q9SA 1MRZA 2X0KA 4UZEA 5FO0A 2VBSA 2I1LA 3OP1A 1N08A 2VBUA 1NB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A89 A;  5FO1 A;  1P4M A;  1N05 A;  1S4M A;  5TRD A;  2OYN A;  5A88 A;  1NB9 A;  1N06 A;  1N07 A;  2VBV A;  3CTA A;  1T6Z A;  3BNW A;  1T6X A;  2P3M A;  3ZUG A;  5A8A A;  1T6Y A;  5FNZ A;  2VBT A;  4UZF A;  1Q9S A;  1MRZ A;  2X0K A;  4UZE A;  5FO0 A;  2VBS A;  2I1L A;  3OP1 A;  1N08 A;  2VBU A;  1NB0 A; 
#chains in the Genus database with same CATH topology
 1FNB A;  1VQM B;  4Q7J B;  5FO1 A;  1H8H A;  4B48 A;  1QH0 A;  1VQ7 B;  4XMY A;  4XN3 A;  5J3O A;  4RJL A;  1Y0R A;  3OKX A;  3U6K A;  1VQ5 B;  3A8I A;  4E0F A;  4X7D A;  3JQR A;  2R9V A;  3JU4 A;  4HIZ A;  1F60 A;  3AVX A;  1DAR A;  2GPJ A;  3FPK A;  4PC3 A;  5IYR A;  4RDJ A;  1WOS A;  3SKB A;  3T51 B;  1NRK A;  4ZV4 A;  2GK7 A;  2QEX B;  1NDH A;  2RC5 A;  2WZP P;  3WBJ A;  4XLF A;  4G1V A;  2C4T A;  2XNC A;  3BH4 A;  3QFS A;  4XL9 A;  4MYT A;  4UZU A;  1QGY A;  3OP1 A;  3B8H A;  1K9M D;  1HA3 A;  2AHO A;  2XNJ A;  2ZXI A;  1I7P A;  1G7S A;  5TV2 A;  3CB4 A;  2R6H A;  2WR8 A;  3G4S B;  3W2G A;  2WPD A;  1WTH D;  3V76 A;  1KTV A;  4QFM A;  2VZL A;  2V7W A;  4XN0 A;  1VQL B;  4Y7C A;  1TLL A;  3VNU A;  4Y9U A;  4LBZ A;  3MCA A;  3CMM A;  1IJF A;  4OPS A;  2ZIT A;  4PC1 A;  4YEL A;  1EXM A;  3CW2 A;  3NE5 B;  2W6J A;  3HAG A;  3W2F A;  1JA1 A;  1FDR A;  5J35 A;  4ZCL A;  2ZTN A;  2JDI A;  3CME B;  2Q6K A;  2BV3 A;  4B3F X;  4Z4U A;  5HZA A;  2YWH A;  3AVY A;  3A8J A;  4OPO A;  1NB9 A;  2Q6O A;  3SJZ A;  4RD0 A;  2XZL A;  4II3 A;  4U9U A;  1E1R A;  4M4S A;  1OB2 A;  1IJE A;  1COW A;  1VQ4 B;  2HDN B;  4RLZ A;  1EWY A;  3WNC A;  2CND A;  3Q39 A;  3CP2 A;  4YEJ A;  1VQO B;  4WZK A;  5HKK A;  4XKV A;  1XQB A;  4P6V F;  4Z4V A;  2ZXH A;  4PC7 A;  4RDL A;  3CCU B;  1BQE A;  1P4M A;  2OTL B;  3I55 B;  5TRD A;  3Q38 A;  4B43 A;  2X6Y A;  3A8K A;  3J81 k;  3Q6R A;  1K73 D;  3CD6 B;  2OYN A;  1WPC A;  4QVJ A;  3A3B A;  4QHY A;  1W87 A;  1G7T A;  2F1L A;  4RCZ A;  1R5N A;  5DS0 A;  4OOV A;  2OK7 A;  1Q7Y D;  1D1N A;  4K1X A;  1ELO A;  3VMF A;  1JB9 A;  3LNN A;  3WYA A;  2BGI A;  1QFY A;  1QGA A;  2VNH A;  3MMP A;  3OEE A;  3KEW A;  1H8E A;  2ZBV A;  3E1Y E;  1PJ7 A;  4XKW A;  4ACA A;  3ZC3 A;  4PC2 A;  4N3G A;  2NPF A;  3QSY A;  2J7K A;  3GVL A;  3OJW A;  1VQ9 B;  1D2E A;  1W0J A;  1VQ6 B;  1TTT A;  4TMW A;  1BPL A;  3DDY A;  1S72 B;  2CK3 A;  4AF6 A;  4RCY A;  1ZM3 A;  5LMZ A;  2DER A;  1I18 A;  2GJR A;  1T6X A;  4AVZ A;  3CRZ A;  2BMW A;  3CCV B;  2WJY A;  3PA2 A;  1YLO A;  4Z1M A;  1F20 A;  1KRH A;  2BPO A;  1ZM4 A;  3ASQ A;  3BQJ A;  2X3U A;  3CCQ B;  3AVT A;  1M90 D;  2Q6L A;  4UZE A;  4C0S A;  1EFT A;  2QN6 A;  1K8A D;  3FKS A;  2YWF A;  3SLD A;  5HZB A;  3G6E B;  4WZL A;  3OOC A;  5A89 A;  1VHE A;  3AST A;  1VQN B;  3JQP A;  5TY0 A;  2FX3 A;  2OTJ B;  1KK0 A;  2W6I A;  4TT3 A;  4B4D A;  1D8T A;  1KJZ A;  3WBK A;  4FWT A;  4OPV A;  1W0K A;  4M1K A;  2QGG A;  4NBS A;  1YJW B;  2B7C A;  1N0U A;  4WWV A;  3BNW A;  3CCR B;  4XNF A;  1DDG A;  2D74 A;  1KK3 A;  4TKO B;  5TR9 A;  2QDX A;  1HVX A;  1T6Y A;  3AVW A;  4YAL A;  1VHO A;  5H59 A;  2DY1 A;  3CC2 B;  1ZM9 A;  2WZN A;  1MRZ A;  1BX0 A;  4M0L A;  4Z4R A;  1Q82 D;  3OAA A;  4DK0 A;  3LQE A;  1PJ5 A;  4Z4T A;  3VNV A;  2C4U A;  3PUM A;  3BC9 A;  4TMT A;  5HXB A;  1NBM A;  4X0C A;  3E20 A;  5IK2 A;  3W2E A;  2D3N A;  4YXW A;  4X06 A;  2OBR A;  2QMU A;  4P9S A;  3A1P A;  1T6Z A;  4XM3 A;  2XEX A;  3OPO A;  2WYR A;  1VLO A;  2VNK A;  3WNB A;  1SKQ A;  3GQB A;  1FNM A;  5A8A A;  1VLY A;  3H94 A;  3GSI A;  1QVG B;  1EFC A;  1WSV A;  4P6Y A;  1W9X A;  3ZIA A;  3ZBU A;  1Q86 D;  2V7Q A;  3ZZT A;  4XD7 A;  1XB2 A;  1EFU A;  1UD4 A;  2BM0 A;  2ZL6 A;  5B6I A;  2JIZ A;  2ZTG A;  5IYP A;  1KK1 A;  2X53 S;  1S4M A;  1GO2 A;  4B44 A;  1AMO A;  3CES A;  2CW5 A;  2ZL7 A;  4AF7 A;  3OE7 A;  1OB5 A;  3T53 B;  1QG0 A;  4II2 A;  4ACB A;  4AC9 A;  4MYU A;  1R5O A;  4NNJ A;  4Z4W A;  4X7F A;  3V7A A;  4B3G A;  3Q3A A;  4Z4Y A;  2V4D A;  5IYN A;  1ZM2 A;  2X6W A;  2ZL5 A;  1BX1 A;  2ZZE A;  2OK8 A;  4KKS A;  2I1L A;  2WJV A;  4YHB A;  4XON A;  3CCL B;  1OGI A;  4X7C A;  3W2H A;  1BMF A;  2B5O A;  3OZW A;  3CC4 B;  4OOS A;  3LQ6 A;  1KMH A;  2XZO A;  3CMA B;  3BCF A;  1UD2 A;  2BN4 A;  4XLE A;  1RQP A;  1E3X A;  3VR6 A;  4GQN A;  1UD3 A;  4B47 A;  5DN6 A;  1N07 A;  1GVH A;  2RC6 A;  4RD3 A;  2OBT A;  4QV2 A;  4RPB A;  2PLF A;  4G7X A;  2V7V A;  4UAJ A;  3G71 B;  2PIA A;  1GAQ A;  3GVJ A;  1H42 A;  4ZCI A;  1YJ9 B;  1DG1 G;  5FIU A;  3ZZ0 A;  1KZL A;  2VBV A;  2V7X A;  1E63 A;  2F1M A;  1E43 A;  4PAA A;  5KW9 A;  4R71 A;  1GJR A;  2BF4 A;  2F4N A;  1BJK A;  1FND A;  1N05 A;  2DIE A;  3CCJ B;  5BSX A;  4NCN A;  1BLI A;  3BY1 A;  2GK6 A;  1GR1 A;  1J9Z A;  1GAW A;  1WP6 A;  2XZP A;  2Z6B D;  3LVB A;  3OW7 A;  2BVN A;  2FVG A;  1NJI D;  2HLD A;  4Z4S A;  2V7T A;  1G7C A;  2YWG A;  4DK1 A;  2HCJ B;  1H85 A;  4P1V A;  1V0E A;  3A35 A;  3U2Q A;  4RDK A;  4RD4 A;  2QTL A;  4P2N A;  2D3L A;  4TMZ A;  1K28 D;  4TSF A;  3CC7 B;  2DEU A;  1QVF B;  5AN9 A;  3ISX A;  1KC8 D;  5E6T A;  2C78 A;  1UD6 A;  1EP1 B;  4YAO A;  4PAB A;  1N08 A;  3G05 A;  3U6B A;  4G7W A;  4WQM A;  1WOR A;  4QVA A;  1Q81 D;  2CF4 A;  2YWE A;  3R6K A;  1EP3 B;  4XOR A;  5F4O A;  3GIR A;  5THX A;  4RM0 A;  3BY2 A;  3QFC A;  2D9R A;  1CNE A;  1OGJ A;  4WZT A;  4N3N A;  5FL7 A;  4LBV A;  1W34 A;  4DQL A;  5F4M A;  2DCU A;  3R6J A;  3AVV A;  4C43 A;  3H9N A;  5GV7 A;  2P3M A;  1OB0 A;  2C5H A;  3WY9 A;  4DNR B;  4ZGQ B;  5IYQ A;  5BSY A;  1TVC A;  3PVD A;  3QFT A;  4PGO A;  3W5U A;  4ZCM A;  4B3X A;  1WDT A;  4DQK A;  2DOG A;  3W2I A;  2VBS A;  1XE1 A;  2C2W A;  3AVU A;  1NB0 A;  3CCS B;  1G7R A;  2HMA A;  1KQS B;  4HE6 A;  2BM1 A;  4M2L A;  2BGJ A;  3I1F A;  3T56 B;  4F7D A;  1IHM A;  3CPX A;  5L46 A;  4OOX A;  1WOO A;  2CBX A;  2M5S A;  3LO8 A;  1I8D A;  5A88 A;  1QFJ A;  4DNT B;  3PA1 A;  5DSZ A;  4YAF A;  1T5E A;  1RQR A;  1QGZ A;  1SM4 A;  3Q6Q A;  1FRN A;  1CNF A;  1S0U A;  3FJO A;  3SEJ A;  4P25 A;  2VNI A;  4XLH A;  1JJ2 B;  2GQF A;  2QE7 A;  3CPW B;  3B78 A;  4PC6 A;  3BCD A;  1E62 A;  4FN5 A;  2F43 A;  5F4J A;  2XGJ A;  1R5B A;  2X0K A;  5FO0 A;  4X05 A;  2VBU A;  2XOK A;  3D26 A;  1WSR A;  1E1Q A;  1E3Z A;  1QX4 A;  3WXM A;  4ROX A;  4G5G A;  1WOP A;  2BSA A;  1UMK A;  1VQK B;  2EIX A;  1E79 A;  1V5V A;  4WZE A;  1N06 A;  4P26 A;  3PEN A;  2V7U A;  4Z4Z A;  2GJP A;  1DDI A;  2X85 A;  2QA4 B;  3CP8 A;  3OEH A;  3MHP A;  1W35 A;  3I56 B;  2CRV A;  5KNL A;  1A8P A;  1B23 P;  3OFN A;  1EFR A;  1XFO A;  3ASP A;  1E64 A;  1YIJ B;  2CC2 A;  1VF7 A;  2PMD A;  4EH1 A;  4RD1 A;  1YHQ B;  5GV8 A;  3ONY A;  1U2R A;  1ZUN B;  3CXC B;  1QUE A;  2DYI A;  2PE3 A;  1PKV A;  1KD1 D;  5H5J A;  2ZBU A;  5FA6 A;  3ASS A;  3PUN A;  5IYW A;  4XR6 A;  3OZV A;  3QFR A;  3KL9 A;  1VQ8 B;  3VO2 A;  4P3Y A;  4ZGN B;  2VJI A;  3ONU A;  4FK8 A;  1PJ6 A;  2JJ1 A;  4RD2 A;  1MAB A;  4LBW A;  4JMQ A;  4M53 A;  4XLC A;  1EP2 B;  5FNZ A;  3RY8 A;  4H9G A;  2VBT A;  1FRQ A;  1KK2 A;  1Q9S A;  4UZF A;  3ZZU A;  3W5H A;  1W2B B;  4FXU A;  1IB0 A;  1V0F A;  4XLA A;  3CCM B;  2KVO A;  4LC0 A;  4KKU A;  4Y9R A;  1VJS A;  1QFZ A;  1Y0Y A;  5JBQ A;  1YX2 A;  3P27 A;  2X6X A;  4YAW A;  1YIT B;  4X8I A;  5CDF A;  1YJN B;  3WQZ A;  1N0V C;  4J0Q A;  2VYQ A;  2V31 A;  2OBS A;  4BPR A;  4XOP A;  1VQP B;  3ZBT A;  2ZZF A;  3OJX A;  4KKT A;  3ZUG A;  1AIP A;  4P22 A;  3VO1 A;  1OHH A;  1FNC A;  2DET A;  3GVK A;  3AGP A;  4RPD A;  2JJ2 A;  2EFG A;  1TUI A;  1CQX A;  2X8K A;  4TMX A;  3CCE B;  2B7B A;  2VJJ A;  2NV4 A;  1WU8 A;  2LZJ A;  2ZZQ A;  3AGQ A;  3ZPN A;  2C77 A;  4G6I A;  4LBY A;  4ASU A;  4P12 A;  3P26 A;  3QE2 A;  4RD6 A;  1FX0 A;  2E1R A;  3SJP A;  2JN9 A;  1HZE A;  1SKY B;  4G1B A;  5EMN A;  2QTZ A;  1UD5 A;  4CQJ A;  3ES9 A;  3A3G A;  1JA0 A;  4X07 A;  4XOT A;  3OW2 B;  1M1K D;  3SLN A;  2GRE A;  3CTA A;  2C5B A;  3WND A;  4TN1 A;  1N8R D;  2XND A;  2VNJ A;  3FPP A;  3W5V A;  4L8J A;  4OP7 A;  1B2R A;  4TMV A;  2ZZG A;  4IW3 B;  2GJK A;  1QUF A;  2WSS A;  1UD8 A;  3JQQ A;  2Q6I A;  4X7E A;  1YI2 B;  2E1B A;  3B82 A;  3ASR A;  4HE5 A;  4QUZ A;  3OZU A;  4XQF A;  5KSW B;  4P3I A;  4YAU A;  1JNY A; 
#chains in the Genus database with same CATH homology
 5A89 A;  5FO1 A;  1P4M A;  1N05 A;  1S4M A;  5TRD A;  2OYN A;  5A88 A;  1NB9 A;  1N06 A;  1N07 A;  2VBV A;  3CTA A;  1T6Z A;  3BNW A;  1T6X A;  2P3M A;  3ZUG A;  5A8A A;  1T6Y A;  5FNZ A;  2VBT A;  4UZF A;  1Q9S A;  1MRZ A;  2X0K A;  4UZE A;  5FO0 A;  2VBS A;  2I1L A;  3OP1 A;  1N08 A;  2VBU A;  1NB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...