2P3MA

Solution structure of mj0056
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A CTP-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Riboflavin Kinase MJ0056
total genus 16
structure length 136
sequence length 136
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2p3mA01
3ZUGA 2I1LA 5A88A 2OYNA 4UZEA 1N06A 5A8AA 1Q9SA 3BNWA 5A89A 1T6ZA 2X0KA 1NB0A 2P3MA 1T6XA 2VBSA 1N08A 1N05A 1MRZA 4UZFA 1N07A 5TRDA 5FO1A 2VBTA 5FNZA 1P4MA 1S4MA 2VBUA 3OP1A 1T6YA 3CTAA 5FO0A 1NB9A 2VBVA
chains in the Genus database with same CATH superfamily
2I1LA 3OZUA 4UZEA 1H8HA 4ZV4A 4XLFA 2VZLA 2R9VA 2GQFA 1QGYA 4K1XA 5F4JA 5AN9A 4EH1A 4Q7JB 1DARA 1KK1A 1R5OA 3WNCA 2ZZGA 1TTTA 1JB9A 1FX0A 2C2WA 1NDHA 1WU8A 4AF7A 2CF4A 3ZPNA 1WP6A 1QFJA 5H5JA 3SKBA 4Z4WA 4JMQA 1J9ZA 2J7KA 2DERA 5FIUA 4OP7A 2CK3A 4B4DA 2VNKA 3JU4A 3QE2A 1Q86D 1G7CA 2OK7A 1F20A 1W9XA 4RJLA 1YHQB 1S72B 1MABA 1YJNB 1QVGB 1E3ZA 4LBYA 1GVHA 3BNWA 3SJPA 2NPFA 2W6IA 4PC1A 1U2RA 3CP2A 4YELA 4XONA 3I1FA 4XNFA 4B3GA 2B7BA 3ZIAA 3CPWB 4XQFA 1QGZA 3CPXA 4H9GA 4YALA 1ZM4A 1EP1B 3ISXA 4RDKA 4TT3A 3ZBTA 2C4UA 1WDTA 2OK8A 4YXWA 2HLDA 4XMYA 5TR9A 1W0JA 5HKKA 4XOTA 1W35A 1OGJA 3W5UA 1JJ2B 2ZITA 1UD4A 3LQ6A 5EMNA 2CW5A 1NBMA 4RDLA 1W0KA 5A88A 1QG0A 2XZOA 4OPVA 1WTHD 2ZBUA 4P26A 5A8AA 1Q9SA 2YWEA 3ASTA 1E1QA 3OJWA 1FRNA 3GQBA 2CRVA 4PAAA 4YAOA 1M1KD 3U2QA 3BY2A 4QVJA 1EP2B 3T56B 1M90D 3FPPA 2YWFA 4XL9A 4Z4RA 3CD6B 1UD8A 2C78A 2OBTA 4B3FX 4LBZA 3OE7A 3G6EB 4OOXA 4II2A 4ACAA 3ONYA 4U9UA 3CCMB 4X8IA 1T6YA 4Z4YA 4P25A 3BQJA 2JJ1A 1YJ9B 3ZUGA 2D9RA 4XN0A 2FX3A 3T53B 4QVAA 3W2EA 5JBQA 2DYIA 1YJWB 2X8KA 2F4NA 4P22A 4TMWA 1Q82D 1D2EA 1TLLA 4MYTA 1HZEA 4DQLA 1H85A 4BPRA 4HIZA 1KC8D 3AVYA 3OJXA 2ZL6A 3VR6A 1UD6A 3ES9A 3AVVA 1GR1A 4MYUA 4FXUA 1PJ6A 4M0LA 3AVTA 3OZVA 4RCYA 4ZGQB 2VBTA 3CP8A 1GAQA 5BSXA 4YAFA 1EWYA 1S4MA 2HCJB 3Q6RA 3CMMA 3SJZA 2Q6KA 4DQKA 1A8PA 2BPOA 2QTLA 4P1VA 1WOPA 2EIXA 2GJPA 2QTZA 4KKUA 4WZKA 4TSFA 1N06A 1E3XA 4M2LA 3QFCA 3CB4A 2BM1A 1T6ZA 1W34A 4DNTB 3I55B 3Q38A 3CMAB 4P3YA 3VMFA 3ZC3A 1CNFA 1T6XA 2DY1A 2V4DA 2BN4A 4P9SA 3CCEB 1E79A 1FDRA 1Q81D 2BGIA 4P12A 5FNZA 3AGPA 4ZCLA 1WPCA 2VNJA 1EFTA 4X7FA 3ASQA 3PA1A 3E1YE 2OTJB 2VBVA 1BLIA 1JNYA 4LBWA 4XOPA 3GSIA 1NRKA 3SLDA 4Y7CA 4Z1MA 5IYNA 2BM0A 4X07A 2F1LA 2NV4A 3U6BA 3PENA 1ZM9A 2X3UA 1K9MD 2B5OA 5IK2A 1VHOA 2WJYA 4RD0A 2WR8A 2XZLA 3WNDA 4PC7A 3MMPA 3V7AA 5J3OA 2ZBVA 1EFRA 3W5HA 1OB2A 1Q7YD 1VQ4B 2PIAA 2WJVA 1S0UA 3VO1A 1D8TA 4AC9A 2RC6A 2WPDA 1K73D 3LO8A 4X06A 2F1MA 3OKXA 3P27A 1QFYA 4P6VF 1OHHA 2XGJA 4RPBA 2CC2A 3AGQA 2ZXHA 3ASRA 3CXCB 1VQKB 3OEHA 3R6KA 4WWVA 1VJSA 1BPLA 1NB0A 1HA3A 4B47A 3MHPA 1WOOA 2OTLB 3A3GA 1IB0A 2V7VA 1MRZA 4UZFA 1N07A 4NNJA 5CDFA 3WBKA 1DDIA 4TKOB 2BF4A 4LBVA 1B23P 2JDIA 3OP1A 4F7DA 2QMUA 2C5HA 4PGOA 2ZL7A 1G7TA 2HMAA 3W2GA 1YIJB 1N0VC 1SKYB 4RDJA 5HZBA 2F43A 4B48A 2XOKA 5IYWA 2DIEA 3MCAA 1HVXA 4QHYA 2BMWA 1YI2B 2CNDA 4NBSA 1N05A 3CC7B 1TUIA 3WY9A 5FO1A 3DDYA 2QEXB 5KNLA 1FNCA 1KK2A 2Q6OA 4TMTA 1WOSA 3CW2A 3LNNA 1EXMA 5DN6A 5FO0A 1VQLB 1IHMA 4XM3A 1EP3B 2VJIA 5IYRA 1E43A 3CMEB 1N8RD 3VNVA 3FKSA 5DS0A 4YAUA 3QSYA 5HXBA 3G05A 3BY1A 3ZZTA 3CRZA 1KJZA 1QX4A 4DK1A 4WZLA 3FPKA 3SEJA 2XNDA 1I7PA 4TMVA 2V7UA 1QVFB 4KKSA 3CCVB 1G7RA 4C43A 3CCLB 5TRDA 2XZPA 3VNUA 1COWA 3HAGA 2ZTGA 3AVWA 1E1RA 1QUFA 2OBSA 2V7XA 1PJ7A 4XLEA 1CNEA 4B44A 4G7XA 2CBXA 4G6IA 4PC3A 3CC2B 1ZM2A 3BH4A 4OPSA 2FVGA 2X6WA 2OYNA 3ZZ0A 3Q6QA 1OGIA 4OOVA 2X6YA 4DK0A 4N3GA 3P26A 1DDGA 1NJID 1XFOA 3JQRA 4C0SA 2E1RA 4G7WA 3OZWA 2AHOA 2P3MA 2DEUA 2WYRA 1V5VA 3SLNA 4TMXA 3GVKA 4RD4A 3V76A 2ZXIA 4X7CA 1OB5A 3J81k 4AVZA 4II3A 3VO2A 4RLZA 4ZCIA 4B43A 1VLYA 4M53A 3ZZUA 4N3NA 3G71B 3CCJB 1P4MA 3GIRA 4NCNA 4XKWA 4IW3B 3WQZA 4XLHA 3AVUA 4QV2A 1BQEA 4YEJA 4ACBA 5IYQA 1KTVA 1ZUNB 3T51B 3W2HA 1XQBA 4B3XA 3GVJA 1KRHA 4G1VA 1B2RA 1FNBA 1ZM3A 3LQEA 4RM0A 5E6TA 2DOGA 4KKTA 3B82A 4QFMA 3G4SB 2GREA 2QN6A 2XNJA 4P2NA 1EFUA 1RQRA 4YHBA 1VQPB 1KZLA 3ZBUA 3ASSA 3FJOA 3OAAA 1V0FA 4FK8A 4FWTA 4J0QA 3QFTA 1VF7A 2ZTNA 3E20A 4Z4VA 1UD5A 2EFGA 4XLAA 2KVOA 4Y9UA 1R5NA 3BCFA 4OOSA 3OOCA 4X0CA 1AMOA 1OB0A 1R5BA 2JN9A 1QFZA 2GK6A 2X6XA 1VLOA 4RD1A 1QGAA 1GO2A 2C77A 3A1PA 4ASUA 3A8JA 1YITB 2BV3A 2C5BA 1KQSB 3WXMA 1KD1D 4Z4UA 3H94A 4X05A 1IJFA 5BSYA 4YAWA 3A3BA 5GV8A 1RQPA 2GPJA 5TY0A 1N08A 1CQXA 2DCUA 4XLCA 1E63A 2BVNA 3BCDA 5LMZA 3CCSB 3D26A 4LC0A 4HE5A 1YLOA 1V0EA 4RPDA 4R71A 3PA2A 1VQ5B 2QGGA 3I56B 4XD7A 3R6JA 2PE3A 2YWGA 3CTAA 4XKVA 2ZZQA 4Z4TA 2E1BA 3A8IA 2VJJA 1AIPA 1UD2A 2WZNA 1W87A 3KEWA 1WSVA 1W2BB 2XEXA 1BMFA 5FA6A 1E62A 4ZGNB 2QA4B 3PUMA 3QFRA 3OEEA 4PABA 2GJRA 2XNCA 5THXA 3CESA 4ROXA 4XORA 2V7QA 2M5SA 3QFSA 4AF6A 5IYPA 3LVBA 1GJRA 5TV2A 3H9NA 4RCZA 5DSZA 4DNRB 5KW9A 2GK7A 1GAWA 3OW2B 2Q6LA 1PJ5A 4UZUA 1JA1A 4PC6A 2VYQA 1VQOB 4CQJA 1QUEA 2VBUA 1FNDA 5HZAA 1I8DA 3CCRB 1UMKA 4X7EA 4Z4SA 4G1BA 4TMZA 3A8KA 1FNMA 3OW7A 4G5GA 3BC9A 5FL7A 3ONUA 1E64A 1K28D 2D3NA 1XE1A 2HDNB 2Z6BD 4WZEA 4XR6A 2RC5A 5KSWB 2GJKA 1K8AD 2C4TA 1SKQA 3RY8A 5L46A 2X0KA 4UAJA 4GQNA 3KL9A 3WNBA 2QDXA 1H8EA 2ZZFA 4L8JA 1ELOA 3OPOA 4X7DA 4P3IA 5B6IA 3JQPA 3JQQA 3AVXA 3U6KA 4ZCMA 3GVLA 3PVDA 3WYAA 4QUZA 2JJ2A 2VNIA 4TN1A 3CCQB 2D74A 3PUNA 2QE7A 4M1KA 4Z4ZA 1NB9A 1QH0A 2W6JA 2B7CA 1F60A 2X85A 4RD3A 4WQMA 1YX2A 2R6HA 3B8HA 3W5VA 2BSAA 1WSRA 1KMHA 4XN3A 1XB2A 1VQ6B 5GV7A 1BJKA 1IJEA 2VNHA 1EFCA 4OPOA 3Q39A 3CCUB 1VQNB 1VQ9B 1UD3A 2V7TA 1G7SA 2VBSA 2YWHA 4FN5A 4Y9RA 3B78A 1VQ8B 1PKVA 1T5EA 1TVCA 1VQ7B 2DETA 5H59A 3OFNA 2LZJA 2WZPP 4E0FA 1SM4A 3NE5B 3WBJA 1VHEA 2ZL5A 2WSSA 2ZZEA 1DG1G 2PMDA 1N0UA 2D3LA 3CC4B 1Y0YA 4PC2A 2BGJA 2PLFA 5A89A 4M4SA 1H42A 1BX0A 1JA0A 2V31A 2JIZA 1I18A 1Y0RA 5F4MA 4HE6A 4RD6A 2V7WA 2Q6IA 3W2FA 4WZTA 1BX1A 2X53S 4RD2A 1KK3A 3Q3AA 2OBRA 3A35A 1FRQA 4P6YA 5J35A 3W2IA 1VQMB 1D1NA 5F4OA 3ASPA 1KK0A 1WORA
chains in the Genus database with same CATH topology
3ZUGA 2I1LA 5A88A 2OYNA 4UZEA 1N06A 5A8AA 1Q9SA 3BNWA 5A89A 1T6ZA 2X0KA 1NB0A 2P3MA 1T6XA 2VBSA 1N08A 1N05A 1MRZA 4UZFA 1N07A 5TRDA 5FO1A 2VBTA 5FNZA 1P4MA 1S4MA 2VBUA 3OP1A 1T6YA 3CTAA 5FO0A 1NB9A 2VBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUG A;  2I1L A;  5A88 A;  2OYN A;  4UZE A;  1N06 A;  5A8A A;  1Q9S A;  3BNW A;  5A89 A;  1T6Z A;  2X0K A;  1NB0 A;  2P3M A;  1T6X A;  2VBS A;  1N08 A;  1N05 A;  1MRZ A;  4UZF A;  1N07 A;  5TRD A;  5FO1 A;  2VBT A;  5FNZ A;  1P4M A;  1S4M A;  2VBU A;  3OP1 A;  1T6Y A;  3CTA A;  5FO0 A;  1NB9 A;  2VBV A; 
#chains in the Genus database with same CATH topology
 2I1L A;  3OZU A;  4UZE A;  1H8H A;  4ZV4 A;  4XLF A;  2VZL A;  2R9V A;  2GQF A;  1QGY A;  4K1X A;  5F4J A;  5AN9 A;  4EH1 A;  4Q7J B;  1DAR A;  1KK1 A;  1R5O A;  3WNC A;  2ZZG A;  1TTT A;  1JB9 A;  1FX0 A;  2C2W A;  1NDH A;  1WU8 A;  4AF7 A;  2CF4 A;  3ZPN A;  1WP6 A;  1QFJ A;  5H5J A;  3SKB A;  4Z4W A;  4JMQ A;  1J9Z A;  2J7K A;  2DER A;  5FIU A;  4OP7 A;  2CK3 A;  4B4D A;  2VNK A;  3JU4 A;  3QE2 A;  1Q86 D;  1G7C A;  2OK7 A;  1F20 A;  1W9X A;  4RJL A;  1YHQ B;  1S72 B;  1MAB A;  1YJN B;  1QVG B;  1E3Z A;  4LBY A;  1GVH A;  3BNW A;  3SJP A;  2NPF A;  2W6I A;  4PC1 A;  1U2R A;  3CP2 A;  4YEL A;  4XON A;  3I1F A;  4XNF A;  4B3G A;  2B7B A;  3ZIA A;  3CPW B;  4XQF A;  1QGZ A;  3CPX A;  4H9G A;  4YAL A;  1ZM4 A;  1EP1 B;  3ISX A;  4RDK A;  4TT3 A;  3ZBT A;  2C4U A;  1WDT A;  2OK8 A;  4YXW A;  2HLD A;  4XMY A;  5TR9 A;  1W0J A;  5HKK A;  4XOT A;  1W35 A;  1OGJ A;  3W5U A;  1JJ2 B;  2ZIT A;  1UD4 A;  3LQ6 A;  5EMN A;  2CW5 A;  1NBM A;  4RDL A;  1W0K A;  5A88 A;  1QG0 A;  2XZO A;  4OPV A;  1WTH D;  2ZBU A;  4P26 A;  5A8A A;  1Q9S A;  2YWE A;  3AST A;  1E1Q A;  3OJW A;  1FRN A;  3GQB A;  2CRV A;  4PAA A;  4YAO A;  1M1K D;  3U2Q A;  3BY2 A;  4QVJ A;  1EP2 B;  3T56 B;  1M90 D;  3FPP A;  2YWF A;  4XL9 A;  4Z4R A;  3CD6 B;  1UD8 A;  2C78 A;  2OBT A;  4B3F X;  4LBZ A;  3OE7 A;  3G6E B;  4OOX A;  4II2 A;  4ACA A;  3ONY A;  4U9U A;  3CCM B;  4X8I A;  1T6Y A;  4Z4Y A;  4P25 A;  3BQJ A;  2JJ1 A;  1YJ9 B;  3ZUG A;  2D9R A;  4XN0 A;  2FX3 A;  3T53 B;  4QVA A;  3W2E A;  5JBQ A;  2DYI A;  1YJW B;  2X8K A;  2F4N A;  4P22 A;  4TMW A;  1Q82 D;  1D2E A;  1TLL A;  4MYT A;  1HZE A;  4DQL A;  1H85 A;  4BPR A;  4HIZ A;  1KC8 D;  3AVY A;  3OJX A;  2ZL6 A;  3VR6 A;  1UD6 A;  3ES9 A;  3AVV A;  1GR1 A;  4MYU A;  4FXU A;  1PJ6 A;  4M0L A;  3AVT A;  3OZV A;  4RCY A;  4ZGQ B;  2VBT A;  3CP8 A;  1GAQ A;  5BSX A;  4YAF A;  1EWY A;  1S4M A;  2HCJ B;  3Q6R A;  3CMM A;  3SJZ A;  2Q6K A;  4DQK A;  1A8P A;  2BPO A;  2QTL A;  4P1V A;  1WOP A;  2EIX A;  2GJP A;  2QTZ A;  4KKU A;  4WZK A;  4TSF A;  1N06 A;  1E3X A;  4M2L A;  3QFC A;  3CB4 A;  2BM1 A;  1T6Z A;  1W34 A;  4DNT B;  3I55 B;  3Q38 A;  3CMA B;  4P3Y A;  3VMF A;  3ZC3 A;  1CNF A;  1T6X A;  2DY1 A;  2V4D A;  2BN4 A;  4P9S A;  3CCE B;  1E79 A;  1FDR A;  1Q81 D;  2BGI A;  4P12 A;  5FNZ A;  3AGP A;  4ZCL A;  1WPC A;  2VNJ A;  1EFT A;  4X7F A;  3ASQ A;  3PA1 A;  3E1Y E;  2OTJ B;  2VBV A;  1BLI A;  1JNY A;  4LBW A;  4XOP A;  3GSI A;  1NRK A;  3SLD A;  4Y7C A;  4Z1M A;  5IYN A;  2BM0 A;  4X07 A;  2F1L A;  2NV4 A;  3U6B A;  3PEN A;  1ZM9 A;  2X3U A;  1K9M D;  2B5O A;  5IK2 A;  1VHO A;  2WJY A;  4RD0 A;  2WR8 A;  2XZL A;  3WND A;  4PC7 A;  3MMP A;  3V7A A;  5J3O A;  2ZBV A;  1EFR A;  3W5H A;  1OB2 A;  1Q7Y D;  1VQ4 B;  2PIA A;  2WJV A;  1S0U A;  3VO1 A;  1D8T A;  4AC9 A;  2RC6 A;  2WPD A;  1K73 D;  3LO8 A;  4X06 A;  2F1M A;  3OKX A;  3P27 A;  1QFY A;  4P6V F;  1OHH A;  2XGJ A;  4RPB A;  2CC2 A;  3AGQ A;  2ZXH A;  3ASR A;  3CXC B;  1VQK B;  3OEH A;  3R6K A;  4WWV A;  1VJS A;  1BPL A;  1NB0 A;  1HA3 A;  4B47 A;  3MHP A;  1WOO A;  2OTL B;  3A3G A;  1IB0 A;  2V7V A;  1MRZ A;  4UZF A;  1N07 A;  4NNJ A;  5CDF A;  3WBK A;  1DDI A;  4TKO B;  2BF4 A;  4LBV A;  1B23 P;  2JDI A;  3OP1 A;  4F7D A;  2QMU A;  2C5H A;  4PGO A;  2ZL7 A;  1G7T A;  2HMA A;  3W2G A;  1YIJ B;  1N0V C;  1SKY B;  4RDJ A;  5HZB A;  2F43 A;  4B48 A;  2XOK A;  5IYW A;  2DIE A;  3MCA A;  1HVX A;  4QHY A;  2BMW A;  1YI2 B;  2CND A;  4NBS A;  1N05 A;  3CC7 B;  1TUI A;  3WY9 A;  5FO1 A;  3DDY A;  2QEX B;  5KNL A;  1FNC A;  1KK2 A;  2Q6O A;  4TMT A;  1WOS A;  3CW2 A;  3LNN A;  1EXM A;  5DN6 A;  5FO0 A;  1VQL B;  1IHM A;  4XM3 A;  1EP3 B;  2VJI A;  5IYR A;  1E43 A;  3CME B;  1N8R D;  3VNV A;  3FKS A;  5DS0 A;  4YAU A;  3QSY A;  5HXB A;  3G05 A;  3BY1 A;  3ZZT A;  3CRZ A;  1KJZ A;  1QX4 A;  4DK1 A;  4WZL A;  3FPK A;  3SEJ A;  2XND A;  1I7P A;  4TMV A;  2V7U A;  1QVF B;  4KKS A;  3CCV B;  1G7R A;  4C43 A;  3CCL B;  5TRD A;  2XZP A;  3VNU A;  1COW A;  3HAG A;  2ZTG A;  3AVW A;  1E1R A;  1QUF A;  2OBS A;  2V7X A;  1PJ7 A;  4XLE A;  1CNE A;  4B44 A;  4G7X A;  2CBX A;  4G6I A;  4PC3 A;  3CC2 B;  1ZM2 A;  3BH4 A;  4OPS A;  2FVG A;  2X6W A;  2OYN A;  3ZZ0 A;  3Q6Q A;  1OGI A;  4OOV A;  2X6Y A;  4DK0 A;  4N3G A;  3P26 A;  1DDG A;  1NJI D;  1XFO A;  3JQR A;  4C0S A;  2E1R A;  4G7W A;  3OZW A;  2AHO A;  2P3M A;  2DEU A;  2WYR A;  1V5V A;  3SLN A;  4TMX A;  3GVK A;  4RD4 A;  3V76 A;  2ZXI A;  4X7C A;  1OB5 A;  3J81 k;  4AVZ A;  4II3 A;  3VO2 A;  4RLZ A;  4ZCI A;  4B43 A;  1VLY A;  4M53 A;  3ZZU A;  4N3N A;  3G71 B;  3CCJ B;  1P4M A;  3GIR A;  4NCN A;  4XKW A;  4IW3 B;  3WQZ A;  4XLH A;  3AVU A;  4QV2 A;  1BQE A;  4YEJ A;  4ACB A;  5IYQ A;  1KTV A;  1ZUN B;  3T51 B;  3W2H A;  1XQB A;  4B3X A;  3GVJ A;  1KRH A;  4G1V A;  1B2R A;  1FNB A;  1ZM3 A;  3LQE A;  4RM0 A;  5E6T A;  2DOG A;  4KKT A;  3B82 A;  4QFM A;  3G4S B;  2GRE A;  2QN6 A;  2XNJ A;  4P2N A;  1EFU A;  1RQR A;  4YHB A;  1VQP B;  1KZL A;  3ZBU A;  3ASS A;  3FJO A;  3OAA A;  1V0F A;  4FK8 A;  4FWT A;  4J0Q A;  3QFT A;  1VF7 A;  2ZTN A;  3E20 A;  4Z4V A;  1UD5 A;  2EFG A;  4XLA A;  2KVO A;  4Y9U A;  1R5N A;  3BCF A;  4OOS A;  3OOC A;  4X0C A;  1AMO A;  1OB0 A;  1R5B A;  2JN9 A;  1QFZ A;  2GK6 A;  2X6X A;  1VLO A;  4RD1 A;  1QGA A;  1GO2 A;  2C77 A;  3A1P A;  4ASU A;  3A8J A;  1YIT B;  2BV3 A;  2C5B A;  1KQS B;  3WXM A;  1KD1 D;  4Z4U A;  3H94 A;  4X05 A;  1IJF A;  5BSY A;  4YAW A;  3A3B A;  5GV8 A;  1RQP A;  2GPJ A;  5TY0 A;  1N08 A;  1CQX A;  2DCU A;  4XLC A;  1E63 A;  2BVN A;  3BCD A;  5LMZ A;  3CCS B;  3D26 A;  4LC0 A;  4HE5 A;  1YLO A;  1V0E A;  4RPD A;  4R71 A;  3PA2 A;  1VQ5 B;  2QGG A;  3I56 B;  4XD7 A;  3R6J A;  2PE3 A;  2YWG A;  3CTA A;  4XKV A;  2ZZQ A;  4Z4T A;  2E1B A;  3A8I A;  2VJJ A;  1AIP A;  1UD2 A;  2WZN A;  1W87 A;  3KEW A;  1WSV A;  1W2B B;  2XEX A;  1BMF A;  5FA6 A;  1E62 A;  4ZGN B;  2QA4 B;  3PUM A;  3QFR A;  3OEE A;  4PAB A;  2GJR A;  2XNC A;  5THX A;  3CES A;  4ROX A;  4XOR A;  2V7Q A;  2M5S A;  3QFS A;  4AF6 A;  5IYP A;  3LVB A;  1GJR A;  5TV2 A;  3H9N A;  4RCZ A;  5DSZ A;  4DNR B;  5KW9 A;  2GK7 A;  1GAW A;  3OW2 B;  2Q6L A;  1PJ5 A;  4UZU A;  1JA1 A;  4PC6 A;  2VYQ A;  1VQO B;  4CQJ A;  1QUE A;  2VBU A;  1FND A;  5HZA A;  1I8D A;  3CCR B;  1UMK A;  4X7E A;  4Z4S A;  4G1B A;  4TMZ A;  3A8K A;  1FNM A;  3OW7 A;  4G5G A;  3BC9 A;  5FL7 A;  3ONU A;  1E64 A;  1K28 D;  2D3N A;  1XE1 A;  2HDN B;  2Z6B D;  4WZE A;  4XR6 A;  2RC5 A;  5KSW B;  2GJK A;  1K8A D;  2C4T A;  1SKQ A;  3RY8 A;  5L46 A;  2X0K A;  4UAJ A;  4GQN A;  3KL9 A;  3WNB A;  2QDX A;  1H8E A;  2ZZF A;  4L8J A;  1ELO A;  3OPO A;  4X7D A;  4P3I A;  5B6I A;  3JQP A;  3JQQ A;  3AVX A;  3U6K A;  4ZCM A;  3GVL A;  3PVD A;  3WYA A;  4QUZ A;  2JJ2 A;  2VNI A;  4TN1 A;  3CCQ B;  2D74 A;  3PUN A;  2QE7 A;  4M1K A;  4Z4Z A;  1NB9 A;  1QH0 A;  2W6J A;  2B7C A;  1F60 A;  2X85 A;  4RD3 A;  4WQM A;  1YX2 A;  2R6H A;  3B8H A;  3W5V A;  2BSA A;  1WSR A;  1KMH A;  4XN3 A;  1XB2 A;  1VQ6 B;  5GV7 A;  1BJK A;  1IJE A;  2VNH A;  1EFC A;  4OPO A;  3Q39 A;  3CCU B;  1VQN B;  1VQ9 B;  1UD3 A;  2V7T A;  1G7S A;  2VBS A;  2YWH A;  4FN5 A;  4Y9R A;  3B78 A;  1VQ8 B;  1PKV A;  1T5E A;  1TVC A;  1VQ7 B;  2DET A;  5H59 A;  3OFN A;  2LZJ A;  2WZP P;  4E0F A;  1SM4 A;  3NE5 B;  3WBJ A;  1VHE A;  2ZL5 A;  2WSS A;  2ZZE A;  1DG1 G;  2PMD A;  1N0U A;  2D3L A;  3CC4 B;  1Y0Y A;  4PC2 A;  2BGJ A;  2PLF A;  5A89 A;  4M4S A;  1H42 A;  1BX0 A;  1JA0 A;  2V31 A;  2JIZ A;  1I18 A;  1Y0R A;  5F4M A;  4HE6 A;  4RD6 A;  2V7W A;  2Q6I A;  3W2F A;  4WZT A;  1BX1 A;  2X53 S;  4RD2 A;  1KK3 A;  3Q3A A;  2OBR A;  3A35 A;  1FRQ A;  4P6Y A;  5J35 A;  3W2I A;  1VQM B;  1D1N A;  5F4O A;  3ASP A;  1KK0 A;  1WOR A; 
#chains in the Genus database with same CATH homology
 3ZUG A;  2I1L A;  5A88 A;  2OYN A;  4UZE A;  1N06 A;  5A8A A;  1Q9S A;  3BNW A;  5A89 A;  1T6Z A;  2X0K A;  1NB0 A;  2P3M A;  1T6X A;  2VBS A;  1N08 A;  1N05 A;  1MRZ A;  4UZF A;  1N07 A;  5TRD A;  5FO1 A;  2VBT A;  5FNZ A;  1P4M A;  1S4M A;  2VBU A;  3OP1 A;  1T6Y A;  3CTA A;  5FO0 A;  1NB9 A;  2VBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...