2P42B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 1.8a resolution: se3-mono-2 crystal form with three se-met sites (m34, m51, m83) in vhh scaffold
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 29
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p42B00
1IARB 4UV7L 2LU7A 1CGYA 5EU3A 3JTSA 4HJJH 4PJAA 1QEWB 2FSEA 5DEFA 5DMJB 5HGGS 1I1FA 3DSFH 1CDGA 2ICWB 2AEQL 2XN9A 1RZ7H 1IBGH 2YPLE 3GSQA 2Y4SA 3V4UL 3ZT7A 2BVUA 5CWSA 1MI5D 5DVKA 1FNLA 5IVXE 4S11A 4JQVC 1FO0L 1LO0L 4PJHA 3TEUA 1W2KT 3KPSD 4IRSC 4MNGA 1XF3A 1I7TB 3QO1A 5CEZD 3U0PA 4P9HL 1Q1JH 1KCRH 2VXSH 3QCUL 5C0CA 4EXPX 5CP7B 5I74B 5FKPA 3BPCB 4CMMA 3KLHD 5E2VH 2KQNA 1T1WA 1ZTXL 5MEQB 3WE6B 2HN7B 2FB4H 1DEEB 1ZSDB 3I6LE 3O8XC 5BCAA 4TN9A 3MJ7A 3FONA 3NZ8A 3P9WB 4JFOA 5I15L 1FNSL 5D8JL 2JKXA 2A9NH 3AMLA 3O2WH 5DJXA 2YHGA 4O2CB 4PJIE 1NCNA 2VIRB 5E99L 5C08B 3PP4H 5HTSA 4LEXH 1HINH 4OCNC 4PGBA 2W9EL 4XCEA 5EUOA 2FR4B 1AGEB 2GY7B 1ES0A 5JIPA 1OCWH 1KOAA 4MNQA 4ONHA 5BVPL 1MCLA 4I0PA 4UUJA 5EBWA 5IQ7H 3PWPD 4OFPA 2WBJA 4WU7B 5DURB 3VRLE 3KPPA 1AKJD 1I8KA 1T1ZB 4JO2L 3LRSB 4MAUL 3DETC 1Q9LA 3HE7D 4XP1L 4LCWE 2CUIA 4QTHB 4NC1E 2WP3T 1G9ML 2XKSA 3TF7C 2VZVA 1W8OA 4LFHD 3P9LB 4BZ1L 3UEZA 2HFEB 5HHXL 3SKMA 3TNNB 3VFPA 1F4HA 2D2OA 1KTDB 4YQXL 3L3KB 3MRJB 1YJDC 4DWHA 4NO5B 4GBXB 4JPKH 1SJHA 2EYTA 4QGYA 2ZUVA 5E8EA 4UB0H 4MXWL 3T0ED 3IDJA 3VXSE 4G80A 3NZHH 2VXTL 5E8NA 4DN4L 3FT3B 3CZFB 4P3DB 5EA0L 5CGTA 3CH1A 1QLRA 1OWRM 1RZIB 3ARBA 4IDJH 4QHKJ 2BNQA 1UKTA 1S7RA 3U1SL 3RWDB 2VDLL 3B6SA 4TUKL 1R3KB 2XWTA 4P46D 1U9KA 3VWJD 3JWDL 4PJIA 4Z77A 3MOBH 1C16B 1Q94B 3S7GA 3MRGB 5FA4B 3V7AG 1GL4B 2YC1A 1WCBB 3EDEA 3S37X 3OXRA 4WY7L 4PJCB 1T03H 3CD4A 4HLJA 2C7UB 3MRRA 5J4MA 2EIZA 4XNUH 3ZL4L 1MEXH 4KRMB 4JFDE 2DL2A 3JXAA 5DJ0A 3G9AB 1D5BA 4LCWA 2DICA 4NBXB 2NY6C 3DVFA 3BKJL 2I27N 3VGHA 4XPFL 5LXGL 1NCWL 4U1MB 3BAEL 1UH4A 5DEZA 4XP6H 4YDLB 3H9YA 4AM0A 5MEPB 1MJ7L 1QO3A 4Z0XA 3UTOA 5JHLH 2XQYK 5FYKD 4JZJA 2GSIB 4JRXD 1A1NB 5T1LB 1H3UA 4YGVB 5CIPB 2BVQA 3VXSA 3PIQB 1YN6A 1YYMH 3PHOB 1PLGL 2EXYD 2DWDA 4KK8C 1R3IL 2JTDA 3GJFK 5TE6L 5T3XE 1EHXA 1RI8A 4JFQB 1JI1A 2CD0A 4XGZA 4YPGB 3X17A 3ZYZA 4LGRB 4PREA 2BNUB 4JY6B 1YECH 4QWWC 1CE6B 4Z7UB 1XGTB 5IF0A 3X12B 2Z35B 5IB4B 2BRQA 4LPYA 3IDMB 1HKLH 1PG7H 1KTLA 3MLWL 4FZ8L 4ZOEA 2DIJA 4Z9KB 5F7EH 5SV4A 4CW1A 1CLOH 3EO9L 4PS4H 4KK5D 3CK0L 3VE0A 4PJ8D 2FZ3B 2B1AH 3JUZA 4I18A 3GMLB 2DBLH 1N6UA 1UB5A 3BT2L 2IH3B 3OKLB 4G6JL 3RWFA 4KJPC 5C9KA 2O5ZL 4JFDA 5FM4A 3ZKMC 1C7SA 4PRID 2PYED 1U3YA 4CVZB 3B3IA 3L5WA 2Z93B 4HXAH 4OQTA 2R0LL 5F9WB 2GTWA 4H26A 4H1LG 4CGTA 4RFOH 3BP7A 4EVNA 3ZE1E 3TA3C 3D0VA 1I7UA 5ISZE 4HLZH 3QNYB 2HG5B 2YD7A 1DCLA 5IHLB 2PO6D 1CK0L 4FABH 2M2DA 4X8JB 3QUZA 1GGCH 3VH8A 4CBPA 1YDPB 1XF4A 4F7EB 3FO2B 4OLYL 3BXNB 2X44D 3O6ML 4XVSH 5KS9B 4XRCA 5CEXA 2VL5A 4JM4L 2V2TA 5D1ZA 2P1YA 1CTNA 3LCYA 1BEYH 1A6ZA 4W6WB 4DAGH 5DEGB 1CDHA 1LO3L 3MNVA 4HK3N 3G5YB 4CN6A 3DUUB 2BOBB 2MOVA 5SWQA 1N5AB 1P5UA 5F89B 5C9JB 4GS7C 4OF6A 1G1CA 1OL0A 3IXTA 4NCDA 4WHTB 4OFDA 3FZUD 15C8H 1XF2A 5EOCJ 4TSCH 1L9NA 2Z92A 1Z6JT 1F3JB 2HT4C 1AGFA 5FAAA 2OTUA 3A6BL 1HSBB 3L7FA 1YEGH 4RMQA 5FUZH 4P4KB 1TVDA 3OPZL 2LE9A 3HAEH 3WCYA 1MWAL 3VWKD 4QF1B 4TRPH 2FH6A 1MH5B 1YYLL 2YUXA 3QHFL 1WBZA 4YFLF 5E8DH 4JFFD 1F6FB 2J88H 5CJOL 3V5DB 1YPZE 3BPNC 4NUJA 1NAMA 4K3JH 4LP4A 1EAPB 1XMWA 2ITCB 4OSUH 4M9PA 1OOAA 3SE8H 4QTIH 3HRZA 1LEGA 4TNWF 1KN2H 1NKRA 1TVBA 2BSED 1B88A 5CBAB 2QQKL 1TJHH 4MA3A 5F1OB 1ZGLA 2NYYC 5JW5B 4QLRA 4KUCD 3F7PC 4K3HA 5DK3A 1NPUA 3DVGB 4K7PL 4Y0GA 2IAMD 4KI1A 4OTXL 3TPUB 1PVHA 1TJGL 1YJDL 1DVFC 1UWEL 3HE6C 1T6VN 5FECA 1C5CH 5DWUL 1RIHL 1H8OA 1KGCE 1U8IB 4OKDA 5F7DB 1AP2A 3QFDB 3WJJA 1DQMH 3LEXB 4O02L 1C7TA 2VLLB 2ZUQC 1FG2B 2Y1VA 3TWCH 1U8KA 4C4KT 1CL7L 5K59F 3I50H 3FKUS 3G9VA 1CDJA 2CKBH 2EDNA 4JPIB 3QEUB 2W9DH 1F3DJ 1GRWA 1JHTB 1BGXL 2ZG1A 3BD3A 3T09A 3VFGL 2CLVB 1JF1B 2X4NA 4MNHA 4YHIB 1J0JA 2AW2A 1ADQH 4FQ2H 1K4DA 2QHLA 4KKAC 4ISVA 1NBVL 1LO4L 2OZ4A 1XR9A 2BP3A 1HEZA 1KFAH 1NCDL 1HNGA 1YPZA 3QDGD 4N90E 5IFHL 4JFXA 3THML 4GG6F 3PWNB 1RURH 4QHUA 1U92B 4JG1H 5LGJB 1CZ8H 1MJ8H 1QBML 5GRZA 2Q7YB 2YXFA 3RBSA 5DMIL 3CSPA 2Q3ZA 4JM2B 5BRZE 3ZMRA 3UAJD 3WIHA 5ACMA 5TDOB 1J8HD 1JNJA 4HIIB 1MAKA 2BERA 5FHAH 4E41E 3E8UL 1RJLB 2E7MA 1OAYL 1WFNA 2Y5EA 5EO1A 2QLVB 4LHJB 5MEOA 1ED3A 1R24A 3WSQH 4XCNB 2QEJA 2B0SH 3OJDB 1X5HA 3WFHB 4M93C 2PYFB 4XPBL 3QNZB 4HZLA 3QWOB 4U1GB 5D7SL 1BF2A 4NRXA 3MJ9H 4BKLA 2GY5A 1LE9B 1ZVHA 5BV7B 5ADPH 1YN7A 1KELL 3V7MA 1L7TL 4DKFH 4HG4K 5TH2B 1PKQE 1DE4A 1ETZB 1OW0A 1B6UA 4Z95L 2FYYB 4QNPF 4HH9A 3RI5K 5JIIA 2BXYA 3QEQD 3DTXA 4PJ9A 3IT8D 4NZTL 1YEFL 2H3NA 4EDXA 1KG0A 1IAKB 4HUUA 2D4DA 5DFTA 4NKIL 4B41A 5DQDH 4EUPH 3JV6B 4XB8A 2JCCE 3TP4A 3BZEB 2BOCA 1WIOA 3ZKXC 1EV2E 1KSRA 4YR6B 5I8CB 4KQ3L 2Q20A 1IGCL 5LCVH 5E70A 4WU5B 1M4KA 2DQIH 4IS6A 5SX4I 5DTFB 2BK8A 1D6VL 4U7KA 5FEBA 2FO4A 5E1AA 3RL1A 3BFOA 2NY0D 5MERA 3OX8B 5GGRA 4AIZB 1A6UL 3VFWA 4PB0L 4NHCH 4F7CA 3RWIB 1ND0A 1D9KB 3KYAA 4GG8A 3L6FB 1QSFB 4TQEL 4JLRB 4MQTB 1J1PL 3SKOB 3CU1A 5C0NC 2ZJSH 1PKQA 5TDNB 2UYLA 4C83A 5T5FH 5F1IA 5E6ZA 5C3TA 1OAZL 1XCTA 1NAKH 5EH1A 4XP9H 5L9DL 4LLAA 1MCCA 3OKOB 2AXFB 3QZWG 1JPFA 1K9TA 1U8HB 2AAVA 2MQ3A 2NY5C 5ICXB 4QHMB 1PX3A 3ARVA 4YK4C 5B38G 4L8SB 2FIRT 2F53B 3Q6GH 2JCCA 4POYA 3RY6A 2QSQA 3KR3H 5GGSY 3BZDA 3GNML 3FO1B 4OIIL 4EN3C 1QKZL 3ARWA 2JLLA 1NBZA 3E3QC 4WO4D 2GAZB 3KPRD 5DD5H 3DMMC 4GKSA 2BVTA 1INDL 4YFDB 1H0DB 1B0GA 3MRCB 3GIZH 4K7PY 4H1LA 4LF3A 4M4PA 1N64L 1MFAH 4HKBA 1INEL 3W2DH 6CGTA 2X1PA 4HGWA 1UG9A 2ERJB 2CXGA 1UZ8A 2B1HL 1CGWA 3AM8C 3E0GA 4NQVB 4NQED 1T21B 1W72H 1CXHA 3LV3B 2VXUH 2CDFB 5J11C 3I02A 4X6BA 1E6OL 3MODH 2ITDB 1U95A 2XY1A 1P69B 2C1OA 1UA6H 3VXPA 2FL5A 3B9VA 4CMHC 3H3PL 3VRIB 4UBDC 4L1HA 4YDIL 3RIFK 2IPKA 3AREB 4D9QD 2AJYH 1HCVA 1H15A 3MJ8A 4MQSB 1KYOJ 1CFVH 1KXTB 4U0RC 1RK0B 1M1SA 2J8HA 3FFDA 5DJDA 3L3GB 5FYJL 5IT2H 5DK0A 4FP8H 3SE9L 5KSAB 3C87A 2X4PB 1KLUB 1VFAB 3UJJL 3RVTC 1XIWA 3F58H 3Q0HA 4L4VA 5ID1B 1IGTA 3VXME 1FNGA 4Y19E 4QO1A 2E9IA 1MCPL 5HY9A 3CIQA 4KRNA 3SDCC 4WWKC 5JUEH 3F8UB 4WW2B 1G7LA 5KJRH 1EJOH 3BVNB 1NGXA 4RZCB 3IB4A 4LAQH 4F9PC 1PYWB 3VFOB 1IGML 3CX5J 3SY0B 4Q74A 5C08D 3G6AA 4KQ4L 1AQDA 1CGTA 3RUGB 1N59A 2X70B 4GLRI 2I26N 1UVQA 2R1YA 1ZLWK 2IADA 4PJGB 4OCYH 5DURD 3PV6B 3X14A 3LD8C 2IG2L 3FQRB 3W0WE 4KK8D 4PRAB 1CGXA 1VADB 3GHEH 5D7IF 1MRCH 4IDLA 2XWBA 2XZQH 1U41A 3SCMC 4XNZB 1JPTH 1I8IA 2EE6A 4L8DA 4W4OC 5GSVA 2A6DB 5H8DA 3RZWA 2DJ4A 1RZJH 2BSRA 4N0CC 4F7MA 4LCCC 5EN2B 4GBXD 2YN5A 1UM5H 1TETH 3MGTA 2YPVL 4R4BA 5E4EC 3V2AR 1U91B 3CCHA 1S8DA 3FTGA 4PY8I 3VXMA 4CDHA 4Y19A 1T83A 3RWGA 3VFRA 3ZE2F 4OZIF 3LEYH 3U2SB 5IHZB 5C0RH 4F58H 1TQCB 4D0DA 4LBEB 4PGCA 3UTTD 1GC1C 2UWEB 3BN9C 4NQXB 5E8PA 1J18A 1ZXQA 5I1DB 4QRUA 5E08H 4JKKA 4PUBL 4U1KA 1MFBH 3BE1H 3AS0A 3B5TA 1I85C 4R0LA 4G3YL 5GGQL 4L3AA 5GRWA 5J57B 4M7LL 5JQHC 5FUOL 4MA1B 2XRAL 3FO9A 4JB9H 5DRZA 1W0WA 1P4LB 5I16B 1BZ7A 2HTLC 3W0WA 1OAXL 3EZJB 1L7IH 3C5SA 4NBYB 3STZB 5HHME 3MV7E 2C4XA 3VG0H 1CL7I 1JNLL 4E5XA 2JB5L 4W6YB 5KVMC 1UWGL 3MC0A 1HHJA 3PWLA 3OKMA 2G9HA 1CG9B 3TBYB 4IMLA 4NYLA 3T08A 2R23A 5K9JH 5T1LD 1YMHB 4Z7QF 1L9MA 3L7EB 3SE4C 1FORH 4J3VA 1ZA6A 1FVCA 2ADFH 1KEML 2NY5L 4Q7DA 3WHE0 1UJ3A 2HT4D 1A7PH 3TBTB 4JN1H 4Q9QH 1CFSB 5FGBA 3WO3B 4ODVL 3OAZK 1X5YA 1PQZB 4XBPA 1OGAA 1A02N 2AQ1A 2AXJA 4PRDB 1F58H 2EH7H 2DQGL 5CUSH 1KXVC 3VA2C 3D2UD 4LFHG 4X83A 3S35X 3GI9L 3UTSE 3GSVB 3HC0A 2VXVL 1RUAH 1NBYA 2VKXA 3GSNB 3QO0B 1I9IL 4B53A 3G6JB 2OJEB 5DDHA 3OKNB 4XMLL 5CJBA 3BN3B 4U31A 3ARDC 4KDTC 5E2TH 5MHSD 4Y4HC 2Z91A 2Y07H 5JHDB 4RDQG 5IJKA 1IGIL 5HYQA 2APBA 1GSMA 3RGVA 2ZCHL 4D0BB 3NA9H 4H0HB 5E00A 3P4LA 4O2EA 2NPLX 3WIIL 4PB9H 5DRXA 3TNMB 1YEDA 1N6VA 4X6DE 1NC2B 3FT4A 3D3VE 4Q6IA 3UTZA 4KK6D 3MGOB 2K1MA 2P8LB 5HGDB 3HS0A 1A0QH 4PV8B 4F57H 4LK4A 3ARFA 5ETUB 5FYJD 3UBXG 3RVUD 2V2XB 1Y6KR 1IQWH 2HJFB 4QY8A 4TOYH 4LSRL 2R0ZH 2MTPA 3P9MB 4P4RA 3FMGL 5DFWH 3BKCL 3GBNL 5B38A 3DRTB 3K46A 2ADJA 1DN2A 3BIAX 3KYNA 2FH8A 3PDGA 3H9SB 1IGJB 5IIEA 2DQFB 5KSBF 4WFHD 1JK8B 1YEKL 4Y5YA 3I85A 3S5LG 2P7TB 4M8QB 4P59H 4X9GA 3UTSA 1HH9A 4I9WE 1MLCB 5D2LF 1CLZL 2JB6B 3MLTB 1E6JH 1NCCL 4U05A 1S7QB 1URLA 2FHBA 5E9DB 4Z7WE 4GG6A 2C3WA 4P4KD 1VEPA 5DUBB 4IIQB 2ILLA 1ZHLB 2YSSB 5EBMB 3HC3H 5D5ME 1JJUA 1KPVA 4NM4H 4HULB 1XR8B 3FN9A 3V8OA 4ZFOL 3GGWB 3UTQA 1A8JH 4X6DA 4G8GB 4ODSH 4LLUB 3LS4L 1OAQH 2YZ1A 1JGEA 2F54B 5KBNC 5IBTL 3KHQA 2EDLA 3AU1A 4HZAA 4RA0C 4C56B 2OJZL 2NXYC 1H3XA 4YBLC 3TBSB 1O5DT 2FBJH 4MVBC 4O00A 3TCLA 5D9SB 1U3JA 4WW1B 4HS3A 3MV8E 1NGPH 1T7VA 1JF5A 4FFVD 3UMTA 2IMMA 4ZQKA 2P8MA 2W60B 5C6PB 2E7CA 3V6ZB 3UJIH 4M5YH 3VFUB 1FG9C 4DVRH 1MFEL 3SQOH 4HWEH 4HC1H 2F5BL 1ODAA 1AXTH 5CZKA 4ORGA 4OCRH 1HIML 4QRSA 1QRKA 3R1GL 1WK0A 2XI9A 4I3SH 4PJEF 5CMAB 5F7WC 4DCQA 2VLJE 3TO2B 4HX1A 1J1XL 4G7VH 1GC1L 2QR0B 3C2AL 4ZAKC 2LTQC 4MHHI 5L6YL 4JZOB 1YUHB 4Z7WA 3QCTL 4OZGB 4G8EA 5DGRA 1EUUA 1J87A 3ET9F 3TCXA 5IESL 4NQDB 4HS8L 1D5MA 5D5MA 3DO7B 3X13B 5AD0B 4F9LC 4HIJB 4L9LC 1AHWB 1QPXA 5DO2C 5KVGL 3TJEL 1A14H 1MCIA 4LDEB 1MI5E 4RISL 4LCYB 4NT6A 3D0LA 3FB6A 1FLRL 3L3IA 4IEFB 5F9OH 2HFGL 3KPSE 2DS4A 3DGCR 5CEZE 5EO9A 4P49A 4EKXA 1RZJC 2VAAA 3MTRA 5TQ2H 3T3MF 3C8HA 3MV8A 1DQQB 4QRRD 2D9CA 1SYSB 4PJXF 3HPLB 1P5VA 2Z8WC 1VGEH 3ETBF 4X4XA 2DQTL 2R2CA 1S7VB 3O6KH 5IW1B 4ALAL 5CBEB 5KAQG 2Z31A 2ATPA 5BW7C 43C9B 4U1SA 2R56L 2VXQL 3FQXB 1RUML 2KBGA 3WXWL 1E0OB 4KROC 25C8L 2QQLL 4P23B 5IMOB 1HH6B 2GITB 1VKXB 2VLJA 2YKLL 2C1PA 4S10A 4QRQB 4FRWA 1UWXH 5GISH 4JFEB 3CC5B 2ICWJ 4RFEB 1DJSA 3RTQC 2DYPB 3BKYH 3SKNA 5DVLA 3RL2A 3PWPE 2GT9A 3MCLH 4NZRH 4XXDB 1UXSB 5HJ3B 1ZS8A 5JW3L 1W0YT 4KKCC 4I3RH 2V9QA 2BMKA 3KYOB 1AFVH 4OD2A 4HAFA 1FL3B 2H2PD 4YWGL 4Q9RL 5J56B 2YA0A 3VCLA 4QHNA 7FABL 4HUXA 4POZD 1CICD 1JYNA 4UIMB 4ONGL 2DWEA 2JELL 3ULUC 4KUZH 3KPSA 2AJZB 4H5SA 1S7TA 2EXWD 3K4DA 2ATKB 1G9EA 3T0EE 5J9PB 4FQ1L 3O2DA 1X5AA 3O6LL 1FPTL 1CBVH 5C7XL 4FFYL 4CN1A 3O45A 4WUKL 1KIUA 5FA3A 3CVHL 5B8CC 2M8XA 3DHJA 1M6OA 5DHVA 1S78D 1S5HB 4JHWH 3T0BA 4ZUSB 1PZ5B 3HNSL 3P2TA 3UDWA 1DBKH 3D6GA 4X6CE 2N4IA 1OP3H 3C5ZB 4KTYA 4S1SH 3DROB 4F2MA 1D9KD 4LVOC 1GGIH 3RVTD 1FV1B 2ZUWA 3L3HA 4PJFB 2KZ1B 4WUUA 4DKDC 1OM3H 3MA7A 1PJ9A 1T20A 3MCG1 2DMBA 1WZ1H 1HHHA 4PTTA 3PWPA 2FD6L 2VKWA 4U7MA 1I3GH 4KMLB 1QD0A 1AKJA 4CU6A 2YUVA 3EUUA 1RZ8A 1QR1A 5GZND 3HE7A 3JSSA 4P0DA 1A4JB 3MLYH 1GZPA 3U83A 1X7QA 4UT9L 5GS1C 4M8VA 3S37H 1NC4B 1UYWH 3LKRB 4OZHF 5ITFB 1KCSH 1INQA 2YMXH 3I2CH 5ANME 5H2BA 3WL9B 2HAZA 1VCAA 2F53D 2FEDD 4EI5B 3BRDA 4MQ7B 2QBWA 5I8KL 3VI4E 1JHLL 4OV5B 5IEHA 5FYKE 4PV9B 3T0XA 3NH7L 1A6VH 4JRXE 5CJXC 4DGVL 4Y4FB 3FB5B 1OAUL 1A6AB 4KZDH 2B8OT 4P3CH 3T0EA 4KC3B 1UM4L 3GB7A 3P11H 4XH2B 4IJ3C 4IMKC 2E9JA 3OKEB 2D4FA 5ACLA 3GBML 5E5RB 1DBAH 1I7ZA 3K81A 3QIUC 2NY4C 2OMNA 1I1AB 5EFIA 3CDFA 4P46A 4OFYD 1KLGB 3RY5A 1LO2L 1FJ1B 2CH8A 4UTAH 1PEWA 1LP9B 1K3ZA 4X6CA 1S3KL 4XP5H 1HHKB 3BZ4B 3UO1H 3F7RA 4MZ3A 5ACZA 3UBXA 4P2QB 5KSUA 1G7PB 3MA9L 3UCRA 1JP5A 1S7XB 1WEJL 5D2NC 4DKEL 5D93B 3LKPB 4MB3A 4NKMA 4LQ1A 1TTGA 5ENWB 3ROOB 1QTYT 4I2XA 5B4MD 4U1LB 3MRQB 4H8WC 2JF1A 4PRIE 2PYEE 1YY8B 1XGPA 3S5LA 5DZLA 3LB6C 4ZSOB 4K3GA 3QIBD 5BVJB 4K9EC 5KSAD 5ANMA 4GRMA 1JNNL 2OL3L 4X5LA 5M95B 2BZDA 3WXVH 3GFUA 4UQ2B 1EMTL 3FOMB 3RDTB 5JXAH 1UENA 5AUMB 3FCTA 2AXHA 2FATL 4JRXA 1EGJL 2G60L 4U1JA 1NGQH 1CXFA 3WNLA 5D7JC 1GPOH 3HA0A 3NFPA 2W1NA 1S5IL 4X80L 4UILH 3N9GL 2BJML 4K7FB 1NCBH 1XF1A 2MSPA 1MJUH 2Q6WB 1IC7H 2EKSB 4Y4KC 1AY1L 3GSRA 4UDTB 5F96H 2EEDA 4KKNA 4Z7NF 1LNUB 3EYUL 1YEHL 1KEGH 5GJSH 1V7MH 3NIDE 4I1NB 4R3SA 3VFMA 4ZDHA 4NNXA 2VYRE 4A6YB 2PW2B 4PJ8A 4NC2B 1A21A 2J12B 1A6WL 4FQXB 1FH5H 4R2GC 1A6TB 4Y16B 4X99A 1HNFA 5B3JE 2AJSH 3VXNB 4NN6C 1TVHB 1B2WL 4Q9BA 4E42B 1XZ0A 3ORJA 3SDXF 2X4TA 3D69A 2D03H 1AJ7L 1F4AA 2WWMD 4PRIA 2PYEA 4HWBL 3NCYP 4S1DD 5E7BA 2AEPH 1CTOA 2FHFA 4L8CA 2D31B 3GSWA 4LASH 5DQJA 2OCFD 5F7NC 3CFBA 4J3SA 3SDYH 3U9UB 2ARJA 4FTVD 4JFFE 4U1HA 3ULVC 2XACC 3JWOH 3ISWA 3GHBL 3M17B 5FOBA 2CPCA 1ZLSL 3STLA 5L2KB 2PO6A 4R97C 2YRLA 2DDQL 1NMAL 2VDOL 2FECL 5CJ8A 2V9TA 1T0PB 4ZFFA 1PFCA 5IGXL 3MRIB 5FCUL 3BSZL 1IEHA 5F7FA 2DQUL 4KI5D 3RWEA 4YEEA 3GI8H 4RGMC 1CVSC 1EXUB 4AQ1B 4I4WB 3ARDD 4N9GA 5GRUL 1IAIH 3HMWH 3ULUL 3DX6A 3TVMB 4KVCH 1FSKC 1IEBB 3ZT5A 3DX7B 1FFNA 5DJYA 4KKLD 5EUKB 5FGCB 2XY2A 4JO4L 5DF0A 1UFUA 1I4FA 3U6RB 4HDIB 4LVNB 4I0PC 2X4OB 3RA7L 5EU6B 3SGDH 2WBJC 4LGSB 4JVPA 5HYSB 3HFML 2DQCL 1NCAH 2B2XL 5F93C 5I1AA 1EHLH 2WQ8A 1PAMA 2OTWA 3HZMB 5D7LE 1QR4A 2HFFA 2HLAA 4X7EC 2J3SA 4BZ2H 3WD5H 4PBWD 5DR5L 3VWKA 3PE9A 4PR5A 3KDMA 4NJAH 4ODXB 2ARWA 2J5LB 2X9XA 3V6BR 3LN5B 4M6NL 1T3FA 4JFFA 4R96A 3QDGE 2C5DC 2HVKA 4DKAA 4MJ5A 2JIXB 3ZKND 1UB6B 4YHPB 3GJEA 3J7HA 1Q0XH 1NBQA 4HMDA 4GW4A 4R26L 4NQCA 2YA1A 2AKRA 3CSYA 4P5TB 3F7QA 3M1BA 1CDUA 3ARBC 4YXLH 3IDNB 2IAMA 1J8HE 3NIFF 3Q5OA 4XPHL 4ODUB 2DL9A 3WDJA 4JGUA 3WNKA 3LKSB 1V7NH 2VZ3A 1F4YH 1YNTA 4OLUH 1FRGH 3K74B 4BELD 4Z7OF 3LKQB 1QNZL 3VD9A 2C3XA 3P30L 4P9MH 3M45A 4U49A 4KXZI 5KS9F 2ZPKH 3MMEA 3VFTB 1YEIL 3DURA 1AO7B 1NL0H 1JPST 3IFOA 3M8OH 3O2VH 3WFBH 5DSCB 3FOLA 3AS3A 4O5LL 4LDOB 5L2JB 3HR5A 4YIQA 4NC1C 3HZKB 1WWCA 4JAMA 3WNOA 3CFEB 3F7VB 5JHDD 5J3HD 4M93B 4F15C 2YK1H 2RQ8A 3P0VL 5A16A 3QXTA 4XC3L 2QADC 2VDRL 4Y5XC 1OGTB 4JJHA 2H45A 5F3BA 4NQSA 1F13A 1PSKH 2GKIA 4JZJC 1FFOB 1NC2D 5AYUH 3QDGA 5D6CB 4DUWA 4KVNL 1CQKA 3QXAA 4BH8B 5JIHA 4KY1L 3E2HC 2HTKD 4ENED 4G6KL 2J8UE 4K9EL 4RMWA 8CGTA 1UJTA 1A2YB 2NY2B 3QRFM 2BNRD 1XCQA 5JTWA 4LLVB 1J8HA 4HIHB 1VHPA 4UDUB 3VI3E 4JFZH 2H1PL 4JQIH 2Q8AH 3RWHB 3QUYB 1WZKA 1CWVA 2EH8H 3DVNB 5TFSL 3QULA 5GZOD 3GSUB 3EYVB 3L1OL 5FO9A 3MRMB 4I18C 1RUQH 3NABL 2HRPH 4XCCH 5B39B 1FNEB 3SJVB 3GMRA 4ODTL 3Q1SH 4FXGB 2OR7A 4UV4L 4F37F 1CU4L 4GKOA 1OTSC 2EICA 1AGBB 3IJHA 2QSCH 3BP5B 3ILQD 2VISB 2W0KA 4AQOA 1LE5A 5E9DD 4ZFZA 1CFTA 2VZTA 1CDBA 2XKNA 5I8EB 2O26U 3M07A 1I9JL 4KMTL 5DI8A 1J5OL 3QEQA 2H2SC 1NMBH 1MJJA 4GAYB 5JOPD 1Q9OB 1KJ3L 1XGUA 3ZTJH 1LMKA 5EOTA 4APQA 1DQLH 3MQIA 1EZVY 1CFQA 1EA9C 1Z5LB 5HDQH 2JJVA 1SBSH 1EK3A 4JKMA 2XFXB 4G8GD 3K8KA 3QUZC 4MJ6B 3KJ4C 4XVJH 2F54D 1NFDE 2PR4L 5FYLD 4C56D 3T65B 2CIKA 4BH7B 1F02I 2HT2C 4C54A 1KCUL 2J8UA 5EPMA 2NW2A 4IOIB 4OUUB 4TNVK 4M62H 2X1XR 5D1ZC 1ZOXA 3KPRE 2L7JA 4UIKL 4D8PB 3ULVL 3U4EA 3PJSB 5C0EB 4AEIL 1K2DA 1N5YH 2AJ3B 1LEIB 3NTCL 4JJ5A 1EIBA 1PY4A 4XCYA 5IVZA 1WLHA 1J0IA 4FQJH 2NNAA 1NUFA 3BGMB 5DRWA 1J1OH 5IBLC 1IT9L 4JM2F 4NQEE 3DUSB 3QCVH 3IU4H 3F5WB 4ZOBA 1EEZA 2CIIA 3MV9A 2AJVL 5ALCH 3S97C 4FQIH 5J6GA 3HCVB 4JFPB 4QRPB 5AG8A 3DOSA 1IC5L 3V52L 5GGTA 1MCOL 3RVVC 3MREB 2AJUH 3T3PE 1YEEH 3I75B 4JO3L 4LLQA 1NGYB 4HPOH 4D9QE 3BEVB 5A40E 4M1DL 4NQDD 1BFSA 1DBJH 4NM8L 1E28B 5I1CL 4JKPL 3QNXB 1R3LB 1JF6A 3HUJE 5BJTB 1N2RA 5SWZB 3KG5A 4JR9H 3GMNB 3TN0B 4K7PX 5DS8A 2CMRH 3GKWH 5DJ8A 1P7HL 2BVOB 1LK2B 4D0CB 4JANB 4XPGH 5JPMB 2A6IA 2AK4D 4BJLA 2VDKL 1YMMB 4HWUA 5INDA 1RZGA 1OQXA 4XC1L 3QJHB 4P2CG 4HWZA 1QFHA 5MI0C 3ZDXF 2VZUA 3KPRA 5D96C 1BZ9A 5CZXD 4EDWH 1QQDA 5A2LH 2Q87A 3HAEB 2QJDA 1U93B 3QIWB 4PJDF 3WJJC 5GGSA 5F88B 4JDVA 4XTRC 3DGGA 3MRDA 1MIMH 1TTFA 3MJGX 1T66C 1H5BB 4HH8A 3O3DB 3FB7A 4NQEA 3AGVA 3EHBC 4P23D 2PW1B 3KNBA 3CNKA 2P8PB 5IMMA 1KJ2A 3KVQA 2NCMA 2VOTA 5L8LB 3KPMA 3L3OB 4LSUH 3T0VA 4JFED 1K4CB 5JR1L 2DYPD 3TBVB 3WHE1 43CAB 5ESVB 3I3DA 4JO1H 5CSBA 2L4OA 4GOSA 1QEWA 4AZ8A 5IHUH 2DKUA 1T5XB 4PBVC 4KDVA 5FOJA 4G8FB 4HGMA 1ZLVK 4WHYG 4OF3A 3QA3B 2ICWA 4M7JL 2PN5A 2NY4D 2CJUH 3HUJA 2HWZH 3VGGA 3LRGA 5HYEA 1KTRL 1DUZB 4DFHA 2ZKHH 2CKBB 1I7TA 1E4WH 3BP6B 3SDAB 5MP6L 5CP7A 4RGNC 5I1KH 4U6YB 4LVHB 4QOKB 2AJXH 1KF9B 3MRNB 1Q1JL 5MEQA 3WE6A 2HN7A 3ARPA 1DEEA 1ZSDA 3RPIB 3CFJB 2GCYB 4M7ZB 5F70A 3O9WB 4GW1B 1HDMB 3UTTE 3LQZB 2FB4L 4GRWE 4R4FL 4MX7B 1MF2L 4O2CA 2FECI 2VIRA 1QFWL 2CGRL 5C08A 4X7SL 3WIFB 4YDJB 4DGYL 2YS4A 3L95B 1AGEA 4FFZH 4HBQA 1ZA3B 1AD0B 5LJYH 1I9RH 3RX5A 4DEPB 1OW0C 2X4QA 1EVUA 5KVFH 4PJCE 4RWYL 4QYOB 1HYRC 4PRBB 3GUTA 3K4ZA 4WU7A 3EFFB 3REVB 3FQTB 1T1ZA 4PJ9C 3LRSA 2DTML 3AB0C 1UZ6F 2OXHA 4QTHA 4KKBC 1WAAE 1UKQA 3TPKA 3P9LA 2VZOA 4K8RH 3PXHA 2HFEA 5C86A 1NC4D 3TNNA 3MV11 4NJ9H 4Y4KD 2EE9A 1KTDA 2DI8A 2DJSA 3BGFB 1OARH 3L3KA 3IFLH 3MRJA 4EI5D 1X6LA 4OQTL 1X4ZA 3ZSSA 2X40A 3QG6B 4GBXA 4NO5A 3N1FC 4Y4FD 5I1IH 4JPVH 1FC1A 1MCBA 3UTPD 1XFPA 1UQSB 1G6VK 4OCSH 3H42L 3FT3A 4X7CC 4LPVA 3CZFA 4P3DA 1E27B 1RZIA 4L3CB 2A9MH 1GGTA 1C12B 1D5ZB 1WBXB 4P5KB 3RWDA 2R1WB 4Q6YA 5SWSB 1R3KA 2XN9D 1I1AD 4IDJL 4Z7UE 4UTBL 3UC0L 2HKFH 5HI4D 4EUPB 5T3XL 1C16A 3OR6B 1Q94A 3HI6L 3MRGA 5FA4A 3ULVD 1CGSH 1WCBA 4P2QD 3BO8B 2XXCB 2O5YH 1AQKH 5C0CD 4I8DA 2CLRB 4PJCA 3UYOD 2XQBH 4S1QL 2V5MA 2C7UA 2CRZA 1I1YB 3WKMH 5MHSE 1NH6A 2L7UA 2HKHL 1WAAA 5DLML 1JZ2A 1TQBB 1MEXL 2Q8BL 3T2OA 1TNNA 2GJZB 4XPTL 4U1MA 4M1CD 2M1KA 3RY6C 1AGDB 5MEPA 4YBQD 4TVPD 3B2UC 2R15A 5EC2B 3QR2A 2GSIA 1T2QH 5ADOH 3KWWB 5T1LA 2CLZB 3IXAB 5KZCB 4YGVA 5CIPA 1NAML 3PIQA 4LQFH 4RIRB 5FYJE 1FZJB 1ORSB 3PHOA 4JY5H 4UAOC 5E6IB 1MFDL 3MRHB 2AI0H 1WFTA 4JFQA 4YHML 4YPGA 5I6XB 1DZBA 1Y0LB 2BNUA 4JY6A 1CE6A 4W4NA 1XGTA 4Z7UA 5C6WH 3X12A 2Z35A 3LS5H 4WEMB 5IB4A 3ECBB 3IDMA 4WFHE 5EB9A 1C1EH 1NJ9B 2NXZC 3Q2CA 1UCTA 3SKUD 3NCMA 5C0BB 4L3EB 3NCBB 3PGFL 1RHFA 2OR9H 2FZ3A 4FQXD 3AS2A 4LSPH 3GMLA 4Y2DB 4DZ8B 2EC8A 1CLOL 5I1LB 4Y16D 3RNKB 4PLJC 2IH3A 1YNLH 2DQJL 3OKLA 5I19H 2C4FU 4PTUB 1JYVA 5HHPB 4M7KL 1DQJB 2R2HB 3OB8A 2BNQD 1CN4A 1A3RH 3OQ3B 1SM3L 1X4YA 4P48A 3OSKA 3NACL 4Z0BH 5IW6B 4CVZA 5D71L 4MXQC 2Z93A 4DQOH 3U0WL 1W72B 4M61B 4G42B 1XIWC 1HK6A 3KLDA 1IM9B 1FYTB 4HXAL 3QNYA 4OI9A 1DANT 2HG5A 5L2KD 5CJQL 1WITA 4X8JA 2OZ4L 1T89A 2K7PA 4FQHB 5LQBH 1YDPA 3MNZB 3QDJB 2DKMA 4F7EA 2BSTB 2CK0H 3ULSB 3FO2A 3U7WH 5C07B 4LP5A 4N8PA 3BXNA 3VXQB 4OM0L 5KS9A 1SEQH 4JZNB 4OD1H 3TVMD 2CRYA 4DW2L 4NHUB 4FZEH 3RHWF 3WIHL 1A7QL 5DEGA 1DQTA 3G5YA 3DUUA 2BOBA 3FT2B 3T0AA 1N5AA 1Q72L 5F89A 2ENSA 5C9JA 2AV7B 1WICA 4WHTA 1QRNB 4YAQB 5EU6D 2XXMB 1HZHH 4XNQB 1YY9D 3QUXC 1KENL 1F3JA 5ITBH 4WV1B 5L8JB 1XAUA 4HJ0C 2D0FA 1HSBA 5C6TH 4OGAD 5DXWA 2CRMA 4P4KA 1AC6A 5ILTL 3OGOE 1JZ4A 1JWMB 4NIKB 4XBEH 3S36X 1BIIB 4L1DA 4QF1A 1YEGL 1MH5A 4GO6B 5FUZL 4WCYH 1G1YA 5TPWH 1ZAGA 3V5DA 3PL6B 1F6AB 1EAPA 2JIXD 3HPJB 2VH5H 2ITCA 5TF1H 3GO1L 3OG6B 4P5TD 5CBAA 2NZIA 5JW5A 3RZCB 4TPRH 1X5XA 4XNYH 5GGVH 3T2NH 1OTSD 4M02A 5CLWA 3DVGA 4QTIL 1RV6X 3UPAA 3TPUA 4QRRE 2N1KA 3H7BB 4I0CC 4NN7C 3QXDB 1L0QA 2ESVB 3MCKB 3QQNA 1U8IA 4HXBH 1X5KA 4X6FB 3U0TB 1UH3A 5F7DA 2FCBA 3QFDA 4X9BA 3LEXA 4PY7B 5EZJB 3ALWA 1L4IA 4ERSL 5I8OH 2VLLA 1RZFL 3B2VH 3TH2T 1FG2A 2I24N 1FZMB 5HSFA 1HWHB 1U42A 5HHOB 3NMEA 2Y36H 5DC0A 4PG9B 2FGWL 4JPIA 3QEUA 3OZ9L 4AEFA 2NY3B 2LV4A 1JHTA 3HMXH 1K6QH 4D3CL 4OGYH 2DF3A 2CLVA 4R90H 1JF1A 4YHIA 2J2ZA 2A38A 1MPAH 2A73B 4NUGL 2DRUA 3BKML 3E1F1 1KB5H 3U4BL 2MKLC 1UACH 4P2OB 3UYRL 4OLVL 4FQ2L 2EYSB 3T4YB 3PWNA 3K8LA 1Y18B 3MRLB 4XCFH 4PJ7E 1K5NB 1KFAL 1UJ3C 3INUH 5LGJA 1S9XB 4R7NB 2Q7YA 1H3PL 5JW4R 3O4OB 1BJ1J 5FGBC 2NY2D 4JM2A 4LRIA 5JO5B 5TDOA 3C08H 3C5JB 4HIIA 4JG1L 3GM8A 5F6HI 4XBGB 1RJLA 4CADB 5FDYA 1KIPB 1BM3H 4J3OC 1NFIB 3QUYD 5CCKH 3V6OE 5FHAL 1G7MB 3NPSB 4JDZB 4XCNA 1RUKL 4GXVH 2CUHA 4AMKH 3OJDA 2MCG1 3WFHA 1RHHB 4HKJB 2PYFA 3QNZA 3QWOA 2VQUA 3X3GH 2MCPH 4PY8J 1LE9A 3SJVD 2B5IC 5TH2A 2GIYA 1ETZA 5JMRA 4S2SB 1DP0A 5IJKC 3A67H 3LVEA 3L5XL 4MXVF 2EEAA 3F65A 1AD9B 2FYYA 2NY7H 1M7XA 2J6EH 5FF6B 3RKPA 1QFWI 4HF5H 3MACH 4OCWH 1TZGL 3RGVC 4F33B 4ZS6C 1KJVB 5J12C 1FN4B 5GS0C 2OP4H 1IAKA 4RWHA 5KANI 5T33H 1AC0A 3VMPA 4Q6IC 4TUOB 1HXMB 1S9WB 1XGRB 3RX7A 2DLIA 3TT3L 3V9FA 4OZGF 2CDGB 4XZUB 2F53E 3JV6A 2AGJH 2ZSVB 1MVUB 3ARFC 1R5WB 3RVXD 4AG4H 3MPCA 3BZEA 2OK0L 1I3RB 3AMKA 5SX5K 2GYSA 3HN3A 3IAGC 3AAZB 2DLFH 1QP1A 5HYJB 4YR6A 5I8CA 1R5VB 1XGYL 2XG4A 4WU5A 1ORQB 5HPMB 1ZHKB 3QHZL 1C5DB 4ACPA 1B0WA 5DTFA 5TE4L 3MRPB 5LCVL 4JY4B 4YH6A 4YPJA 3V6OA 1QUNA 1RIUH 4Y5YC 3DNKA 2E5EA 4EOWH 3OX8A 4DZBB 1YQVH 2A6JB 4AIZA 5EZIH 1LEKB 1NKOA 3RWIA 5T1MB 1D9KA 1RUPL 1FIEA 3L6FA 1QSFA 4QRPD 4K3DL 4JLRA 2PETA 2XWJB 3SDDB 3SKOA 1JV5B 1DLFL 1CGVA 2IFGA 5TDNA 1MCWW 1Q9KB 1JPSH 4RGND 4R4ND 5IQ9B 3H8NA 1T1XB 5HGAB 4JRYB 2WUCH 4TUJB 3UPCA 3OKOA 3PWVB 4OFVA 3LQMA 4KHTH 5FYKH 4XAWH 4OV6F 3MFFB 3BH8B 2AXFA 2W0FB 4IHOB 3BWUC 2EE3A 1U8HA 4HPYH 4FHBD 2C3VB 3EYFB 5SWZD 5D2NB 5ICXA 2DB8A 4QHMA 2VR4A 4G6AC 4L8SA 2F53A 5L88H 4BYHA 4CVWA 1A7BA 1DANU 3QUKB 1YMMD 4PD4J 3ARXA 3FO1A 4OLWH 3QSKB 4FN0A 1MHEB 1BPVA 3OTTA 3Q6GL 2R4RH 1G6RH 1W0VB 5DGQA 2GAZA 4HV8B 4ZPTB 5HHVL 1NDGB 4K94C 1F4XL 3DARA 5HVHB 1H0DA 3MRCA 4AEHL 3QIWD 4NPYB 4XNMB 4WFED 3VXTB 4NFDA 5DD5L 4HIEB 1DBML 5HI5C 3TIDB 3MFGB 4ZFGH 4YHLH 4NQVA 4KMQA 4OFYA 1T21A 1JRHL 3LV3A 2CDFA 2WW8A 1CD8A 4YC2C 2YUZA 3RUGE 2XT1B 2ITDA 1B4RA 2QHRL 4LAJH 3N85L 1G9NH 4PJ5B 3A0OA 3RY4A 5LBSL 3WLWC 4PJGE 3MODL 2J7LA 1A3QA 3VRIA 4YHOL 4O2FB 3WFCL 8FABB 3PP3K 3AREA 4LSVH 1UA6L 3ZE0E 4UV7H 3EOAB 1BOYA 1RK0A 4N9OB 3L3GA 1IC4L 1QLFB 3TIEB 1K85A 5KSAA 1CFVL 2X4PA 1A6PA 4PJAB 2F58H 2NW3B 1KLUA 1VFAA 4FTVE 2AEQH 3NFNB 4R2GB 2VLKB 3RJQB 4HKZB 4NN6B 3RNQB 5ID1A 3PQYB 4YHZL 4OJFL 3WN5B 3NAAL 3SDAD 2NLJB 5IV2B 1MOEA 1FO0H 1LO0H 3FRUB 4MJIB 5DHYB 4QOKD 4P9HH 1N4XL 2DJUA 4XNXL 3C8KB 5HI3C 3QCUH 3S9DB 4KI5E 3BDXA 4ELME 2Z31C 1LO5B 4YUEL 3O9WD 4XPAL 4WW2A 3BVNA 4RZCA 2UWEE 1PYWA 4G7YL 3VFOA 4DTGL 3SY0A 4NZJA 4RFNB 1BLNB 1IZKA 1MUJB 1T1WB 5KJRL 1EJOL 5EZOL 5I15H 1BBDL 1FNSH 4Y8DC 4ODHL 2X10A 2NMSA 2RCSL 1Q9WB 3RUGA 5E8OB 3MUZ1 4DN3H 3U30C 2X70A 2W9EH 3LZFL 4D9RD 4PJGA 1FBIL 4LLYB 1LP9F 3PV6A 2ICEB 2CR6A 3P0YL 5A1AA 3FQRA 35C8L 4OCYL 3O3AB 4PRAA 4MAUH 1P2CB 1ACYL 1G0XA 1VADA 4YO0B 4MD5B 3VDCA 4KTDL 1G9MH 4XWGL 3VRJB 4NSKB 2BX5A 4BZ1H 3JV5A 4FTVA 2A6DA 5HHXH 3Q48A 2D7OA 3VXOB 3GSXB 1NDMB 5SX4H 5EN2A 4XI5D 5D7IB 1JPTL 4YQXH 1U91A 5GS0L 3KLHC 2FLRT 5TGBB 5K33A 5H37G 2YPLB 1QLEL 3U2SA 5IHZA 3S35L 2I60H 5IVXB 4G9DB 4LNRB 4CJ0A 3PDOB 4DN4H 4LBEA 1HILB 4M1GH 3SOBL 5E8EB 2UWEA 4NQXA 5SWSD 3PDDA 5C0RL 4OZIB 4F58L 5I1DA 4GRWF 5CINL 3ZDZF 2WSKA 1ZWIB 3U1SH 2VDLH 2OQJB 4L4VD 2BY0A 1QSZA 3MLRL 3LPWA 2VJXA 1BQSA 4HEME 4PGEB 4U2YA 2H32H 4YDKL 3B6SB 5GHWL 1U3HB 1TZIB 1X5LA 3VMNA 3G6JE 3HE7C 3QI9B 5CP3A 1P4LA 5I16A 3VJ6B 2RHEA 5DRNB 5JHDE 2ICES 3STZA 1FVEB 3RU8L 3TLRA 3ZL4H 1NLDL 1KV3A 3IDXL 4BZYA 4EXKA 4Z76B 1L7IL 3BKJH 3ME0A 1BQUA 2KPNA 4XPFH 3TBYA 5LXGH 1NCWH 2GEEA 5EOCL 3VG0L 3BAEH 2PKDA 1P4BH 4OBSA 3T0EC 2WQRA 2XZCH 1YMHA 1MJ7H 3OAYH 5KZCD 3L7EA 1TITA 4F15B 3KJ6L 1LVEA 3V5KB 4Y5XB 3LDBC 1G0YR 3TBTA 1MQKL 5E6ID 1CFSA 2BNRE 4F3FB 2LABA 2W07A 4P46C 3OR7B 1PQZA 1T04B 5FM5M 3VWJC 5DMKB 3NCJL 2VSCA 1EO8L 1PLGH 1R3IH 2GQHA 5IOPB 5J0BA 2EE2A 1A64A 5F7YC 2XA3A 1EFXB 4PRDA 3F62A 1OSZB 3VD7A 4AK1A 4QKXB 5C0BD 4L3ED 3MRKB 2QQNH 3GSVA 3MLWH 4FZ8H 4K71C 4WGWB 4PREB 4Y2DD 2F8XC 5J1TC 3BPLC 1J88A 3EO9H 3CK0H 3GSNA 3QO0A 3LRHA 3G6JA 2OJEA 3OKNA 5E9DE 1I1RA 1CXIA 3Q5TA 4BFEA 4G6JH 5JHDA 5I73C 1FZOB 1OP9A 2O5ZH 5JOPE 3OWEA 1BMGA 3MNWB 4D0BA 5JLZB 4GH7B 2Y07L 3B9AA 1XF5A 4ZODA 4U6TA 3TNMA 4KRPB 1FYTD 5DJ6B 2R0LH 5F9AC 1NC2A 4G8GE 1MFNA 2GTZB 1CE1L 3NA9L 1YNKL 2F54E 2P8LA 3MGOA 5HGDA 5FYLE 5DMGD 4C56E 2R69L 4PV8A 2R1XB 1HKFA 2E6JA 3QDJD 5ETUA 5IMLB 2EXYC 1WVZA 2V2XA 5C07D 4IOFD 2APVA 2IANB 3A6CL 1KXQE 5HHNB 2HJFA 1OSPL 2O5XH 2D7MA 3P9MA 4OLYH 1IE5A 1N0XL 3O6MH 1IQWL 2HT3D 3CFIC 3DRTA 1R3HB 4JM4H 4TOYL 4CU8A 4URTB 3H9SA 1IGJA 2DQFA 1JK8A 3K2MC 3U4AA 2A1WL 2CSPA 3ESUF 4XP4H 4KK5C 1M7IB 4RX4D 4ELKB 4PJ8C 2P7TA 3ELAT 4M8QA 3QYCA 5I9QB 1LO3H 1QRND 4Q0XL 5F1SA 1EHAA 4P99A 4O58L 1MLCA 4CRPA 5FUCE 2OI9C 1EZVX 3ULUE 2JB6A 3MLTA 4R8WL 5KSBB 5F72S 4RCAA 3GMPB 1S7QA 4LPCA 4FXKB 3W9DB 5E9DA 2ZCLL 1QVOB 4QRTB 5CGYD 5C8JB 2X6MA 5DUBA 4IIQA 1ZHLA 4NQDE 3IFPB 1RIVH 5C0AB 1OGAD 1H9VA 5EBMA 5D2LB 3EJYD 1GZQB 1XR8A 3OPZH 3GGWA 4NN5B 1MWAH 2PO6C 3PL6D 4G8GA 1YYLH 2APTA 3QHFH 4LLUA 3NIGE 3EW3B 2F54A 1A7NH 1RQ5A 4HUWB 5CJOH 4C56A 3TBSA 2AK4E 3RWCB 2IALB 1N6QL 3RZCD 5ISZB 5D9SA 3V4PH 4MD0B 3P4NB 4NDMA 4WW1A 3E6HB 2QQKH 3C09B 2B39A 3DX8B 1WUNT 2FBJL 2W60A 5CEZL 3HNVL 2FX8L 3WUWB 3ZLQC 3V6ZA 4F8QA 3VFUA 2ESVD 1KPUB 5I17B 4K7PH 4HK3J 4OTXH 3O2DL 3RGVD 1CCZA 1UM6L 1TJGH 1YJDH 1UWEH 3OB0K 2EDXA 2DQEH 5DWUH 1RIHH 4DVRL 1Z2KA 1Q0YH 3FZUC 5MI0B 1JYWA 3PGDB 4BQCA 3TO2A 4O02H 1RMFL 1ZVSB 4ZTPL 3TO4B 3P77B 2QR0A 3C60B 5JNYB 1CL7H 5KVEH 1IKNA 2NY3D 4JZOA 5DD6B 4PJEB 1YUHA 4OZGA 2P44B 2P24B 3IDYC 1JRHI 3VWKC 5C0GB 1BGXH 4NQDA 3VFGH 3PNWB 3DO7A 4NGHL 3X13A 5AD0A 3X11B 4HIJA 5J13C 1AHWA 4P2OD 4LCYA 1NBVH 4BUHA 1LO4H 1P7KB 4QHKI 1NCDH 3R0NA 5IFHH 1U8MB 4GKNB 3THMH 5DJCB 3LH2H 2I9LB 4M6OL 3IDGB 2IAMC 3L9RB 1DQQA 2BY2A 1IAOB 1BQHB 3EZ8A 1SYSA 5DMIH 1DUYB 5HYSG 2UV3A 3HPLA 5TQ2L 4OLZL 4M00A 1S7VA 5GRJH 5IW1A 5CBEA 3E8UH 3O81A 43C9A 4EQ3A 1OAYH 3FQXA 1U36A 4ONOA 3WS3B 4P23A 4PJXB 3O6KL 3CXHK 2IQ9H 5IMOA 1HH6A 2GITA 4ZO8A 1VKXA 5DZOA 5IG7B 2W38A 4PJFE 5MEOB 4QRQA 1QFUH 4JVWA 3EIFA 4JFEA 4XPBH 3CC5A 4RFEA 5J6HB 3JWDC 2DYPA 3TZVB 2ENYA 1KELH 1TJIL 1L7TH 2V5TA 4XXDA 1UXSA 5HJ3A 3GRWA 3BD4A 3BKYL 1KCVL 4Z95H 3AXLB 2KDGA 3UPRB 5BO1L 3KYOA 3PWUB 4UT7L 1FL3A 1H8NA 3GMMB 1OTUD 3CFCL 2PTUA 4NZTH 1YEFH 1E4XL 1MFCL 2X4RB 1HYSD 4UIMA 5BMFL 1KB9K 3L3DB 5KTEL 4NKIH 4Z78B 2AJZA 2JK5B 2OSLB 5A2IH 3W11D 5HYJD 3UAJC 5JA8B 4RQQB 1OPGL 4MSWB 2ATKA 4M48L 3U79A 4GRWH 3QG7L 5J9PA 3UTPE 4YFLI 5IB2B 2XTJB 3BJ91 1UCBL 4YDVB 1JUFB 1BHGA 1DN0B 2ADIB 4QEGA 5JW4N 4NC0B 1IGCH 2COQA 3WKNA 1S5HA 5CS7A 4ZUSA 2XN9E 1PZ5A 5BRZB 3MLVH 3MXVH 5A3ID 3ZTNL 2E8YA 1D6VH 4NFBA 4E41B 4JHWL 3C5ZA 1U8QB 3DROA 4XHJD 4MNGE 3ULVE 1FV1A 4PJFA 4ZPVB 4QXUL 4P2QE 3SDDD 4H25B 5C0CE 4PB0H 3ESVF 4U3CA 4U1IB 3P73B 4TQEH 4ZS7L 4HT1L 1H3WM 4WDIB 3I9GL 4JRYD 3JV4B 4APQC 4RGOL 1A4JA 1WZ1L 1OAZH 3SGJC 2XA8L 3MSPA 2Q86B 4ZSOE 5L9DH 2A6KB 5CILH 1NC4A 1JZ3A 3LKRA 3MLYL 4KV5E 3WL9A 4QT5B 4TSAL 1WT5A 3C6LB 4EI5A 4MQ7A 3CJJA 1BVKB 1FDLL 3C2SA 4PV9A 5A2KH 4PGDA 4Y4FA 5GS3A 3FB5A 1A6AA 4OZHB 3RBGA 4F7PB 4HMCA 4W70A 4NZDA 4LHUB 1MLBB 3GNMH 3MLXL 1U8LB 4XH2A 4OIIH 5B39G 1QKZH 3PGCA 4W81A 2WM0A 1MY5A 1ZANL 3OKEA 4KZDL 3NOIA 2MFNA 3P11L 3GK8L 1INDH 2NY0C 4LOUD 2R0KL 4J7RA 1IVLA 1VEOA 4U2ZA 3ROLB 1I1AA 1N64H 2YOCA 4JHAL 1KLGA 1INEH 1FJ1A 5C70A 1LP9A 5BXFB 2H9GB 1HHKA 3BZ4A 2B1HH 3H9HB 3H0TB 1C5BL 1SY6A 3VGBA 1EDQA 2YR3A 4P2QA 1G7PA 3LMJL 5I1GL 3RIAK 1S7XA 5IVNA 4WEUD 2HMID 2J1KA 4PJ5D 1VGKB 2HYMA 1E6OH 3LKPA 3AVEA 1RK1B 1B4JL 3WNMA 5ENWA 1Y6MR 3ROOA 1TXKA 5EIQA 2BNQE 5EBGA 4U1LA 4PPTA 3MRQA 4P3WA 3H3PH 4Z5RB 1YY8A 4ZSOA 3K2UL 4KJYB 3B9KB 5BVJA 3N1GC 4XWOD 5IM7B 1HQRB 2VLKD 4OD3L 4WUUD 3SE9H 5J1AB 4UQ2A 2X4UB 3RDTA 3FOMA 3MJ6A 5L2KE 3PQYD 5AUMA 4HLZG 3UJJH 4WO4C 2C3GA 4MJID 4PJBF 2V17L 3FAXA 1MCPH 1DFBH 3F6IA 4K7FA 4HW6A 5F6IB 2Q6WA 1I8MB 3K80A 5FXCH 2EKSA 5CZVL 1J12A 2BXZA 4HGKC 5FGCE 1NCBL 4UDTA 3PHSA 3W82A 1T2XA 2EZ0D 3CFDB 1LNUA 3KLAB 3MOAL 4KQ4H 4A6YA 4XHQA 1IL1B 5EU6E 1A1OB 2PW2A 2V9RA 2ICCA 3RPKA 4FQXA 1A6TA 3LEVL 4Y16A 4WWID 2RIKA 5HD8D 3VXNA 4LRNL 1TVHA 3IKCB 7CGTA 3ZDYE 4E42A 1QSEB 1FH5L 3QP3A 1TPXB 2VITB 5I18L 2R1YB 2D31A 4OCXL 3U82B 1AR1D 4H0GA 3QQ3B 1MCSA 1G7JB 4KWUA 2IG2H 1CXKA 3HAEG 3QUXB 4OI8A 3IVKB 3U9UA 2UUDK 4CDGC 1G0DA 3ARGB 3SDXB 2G75B 4WEBL 4H20L 3M17A 3EFDL 5L2KA 4Z7VF 5I74C 1X6NA 1JWSB 5J06A 1N0LA 3REWB 3MRIA 2BY1A 4E9LA 1PKOA 2MHAB 4CVXB 3VFNB 5GGUB 2WAHA 2YZ8A 3G6DH 3O3BB 1EXUA 4I4WA 4OF5A 2VDPL 1AGCB 4MWFB 2RGSA 3TVMA 4G6ML 2I5YL 1FAKT 1IEBA 3DX7A 1OP5H 2LVCA 5EUKA 4HFUL 1TCMA 3O3EB 1YA5A 2VNCA 4X6EB 1KIQB 4KVCL 3CUPB 5F97E 3U6RA 4H0IA 5EWIL 4HDIA 5HDBF 5IK3B 4PUBH 2X4OA 5EU6A 1BBJB 5FK9B 4QRUB 1NGWB 4NN7B 1U3HD 5HYSA 1JBJA 1D5XB 1F90L 4G3YH 5GGQH 3QI9D 1J7VR 5GRVK 4Q97A 3HZMA 1QBLL 3QPXL 1FGVL 4TULL 4ZD3L 1MRFL 1EHLL 3JVGA 3QDMB 2IFFH 4KJWD 1OAXH 4LL9A 5J1SC 4ODXA 5D4QA 2G2RB 3QDHA 4ODBD 4NKOB 3LN5A 4YZFF 4GBXC 5JZ7D 1NSNL 3SPVB 1JNLH 2JB5H 1EBPA 2JIXA 1UB6A 1YC7A 4YHPA 1BWWA 1J05B 2CQVA 4GUPB 4P5TA 5AZEH 3SKJL 2R4SL 1Q0XL 4PYGA 5HGBB 1KEMH 1BFOB 2NY5H 3P4MB 1YZZA 1MAML 2Y23A 4ODUA 5IFJB 4D94A 4MB4A 1T0MB 2NY1B 3LKSA 2HJLB 5I1JL 4ODVH 3LKQA 3BWAB 3RFZC 4LARL 2DKSA 2DQGH 3VFTA 4F7TB 2C3HA 1IRAY 2FX7H 3SJVE 1AO7A 4UINH 3D25B 3D85B 4NKQB 5DSCA 3S34L 2IQAB 5L2JA 2VXVH 3HZKA 5HXMA 1IFHL 2XKUA 3CFEA 3F7VA 1I9IH 2HLFD 3SGEI 2DMKA 5GGTL 3ZYOA 5D6DA 1RVFL 4YDLC 3WHXB 1OGTA 2V6HA 1KIRB 1IGIH 4WI4A 4KRPD 1OTTD 2DOCA 2YK1L 1FFOA 1QPPA 2ZCHH 5D6CA 1CD9B 3WIIH 4RBPK 3L5HA 3UBXI 3MV7B 4BH8A 5EIVA 4EUPG 2YXMA 5AYUL 4YXHL 3KHOA 1XGQB 1KTKE 1A2YA 2BDNL 2ZP0T 2IAND 4KTEL 2FJHB 4JREB 4LLVA 5EDXA 4HIHA 1S7SB 3HI1B 2YUWA 4UDUA 5JA9A 4XT1C 4MJ4A 1E4XI 3B43A 1MNUL 3RWHA 4UOJA 3QUYA 3RI5F 1ONQB 1HHIB 3FMGH 4UU9B 2IBGA 3DVNA 3QZWB 3GSUA 3EYVA 2CO6B 3MRMA 3WNNA 4NQCD 5D72L 5C2BL 1YEKH 1N7ML 4LEOB 5B39A 1FNEA 3SJVA 4QRPE 4FXGA 3K1KC 4MDJB 1AGBA 1JTTA 1Z9MA 2KH2B 1KJ2L 3BP5A 2VISA 3N1PC 5BOZG 1ZGLP 4NFCA 4RGNE 1CLZH 1N3NB 5I8EA 1YQ2A 3KPOB 1NCCH 3CLFL 5F9WC 3AUVA 5C0AD 4LLDB 4GAYA 1Q9OA 3ARZA 5I2IB 4N0UB 1Z5LA 1NMBL 5SWZE 2XFXA 3HLAB 4KK6C 4Y5VB 1T89C 4MJ6A 1DQLL 1DTUA 1SBSL 3ZKQD 3LQAC 5J8OA 3T65A 3PHQB 1YMME 3LS4H 3RVUC 4BH7A 5D1QB 3OAUL 5IBTH 1RULH 4IOIA 4GRLB 4OUUA 2OJZH 2OTPA 3D3VB 4X7FC 4D8PA 4ZOAA 3PJSA 4U6VL 5C0EA 4AY0A 5J89A 5I1EL 2AJ3A 1LEIA 5KVDL 1S7UB 2WANA 3SBWA 4WFEE 4YHYB 4HEPG 4N8VB 1JGUL 1RZKC 4OIBA 1FVDB 3V7AE 1IKFL 3NCEB 3QAZB 2E7HA 1N5YL 1Z0NA 2B7DT 1J0YA 3DUSA 5T1KB 3F5WA 1J1OL 3BIKB 3R1GH 4G9FB 3HCVA 4O51B 3TO4D 4JFPA 4QRPA 1DSFL 3D39B 3C60D 4S1RL 2PCPB 6FABL 3MREA 1AI1L 1J1XH 1VFMA 5GRYA 3I75A 1GC1H 1AR2A 4YNYB 4KAQH 3MBEB 3WDIA 4P4KC 3C2AH 5I0ZA 1NGYA 3GJFH 5L6YH 3W5NA 4Q2ZA 1KCLA 3BEVA 3CXDH 1E28A 3QNXA 5IEKB 5E6YA 1R3LA 5IESH 3MUJA 3GSOB 2I25N 4X4ZA 4HS8H 4C4KO 5BJTA 5SWZA 3VG9B 1DBJL 3T2PA 3OJMB 1EVTC 4N5UA 3TN0A 4FQQB 2D0HA 5TDPB 2BVOA 1LK2A 4RNRB 2Z8RA 3TJEH 4D0CA 4JANA 2Y72A 5JPMA 4RISH 4U0QB 1YMMA 4LIQH 1FLRH 4FFVC 1FL5B 3QJHA 2HFGH 5D70H 1OT2A 3MUGB 3CZJA 2DTSA 3HAEA 3QIWA 1U93A 5F88A 4APQD 5FO8B 1KNOB 4XMPL 4JDTH 3BYYA 1WJ3A 1H5BA 3O3DA 4RMRA 2DN7A 1K8DB 2DQTH 4AH2B 4ALAH 2PW1A 2P8PA 2R56H 2VXQH 4PJDB 1RUMH 3WXWH 3EKCA 3L3OA 4TTDD 25C8H 5GSRB 3MLSL 4MA8L 4TTGA 1K4CA 2YKLH 3TBVA 3TZVD 4BFBD 43CAA 5ESVA 4D9RE 2WUBL 5IROA 3HZYB 3O6FB 3BDYL 3ZYJA 5CGMA 4NZUL 4M5ZL 1X4XA 3FHQA 3QPQC 1FGNL 3IJYB 1T5XA 2VLRB 4G8FA 3WNPA 4HQQL 1WC7B 4H88H 3QA3A 5JW3H 2E6QA 3J8F7 4ZUTB 3V0WL 5JQ6L 4QGTA 3MV9D 4YWGH 4HUKB 4Q9RH 2DD8L 4GMTH 4YJZL 2VQ1B 1DUZA 5CAYB 1EBAA 2CKBA 4NWTH 4JM2C 4PLNC 3BP6A 1MRDL 3SDAA 4UNVA 4ONGH 4EI6B 2I07B 4U6YA 1VERA 4QOKA 2XTJD 1MI5B 3MRNA 4J2XA 4FQ1H 3IDIB 5E94B 1ZLUK 3RPIA 1ADQA 3CFJA 3LIZL 2GCYA 3O6LH 4RAUB 3O9WA 1P9MA 4YHKL 4GW1A 2AJXL 4FFYH 1HDMA 4WUKH 2P43B 5DD0L 3LQZA 1KB5B 5SWSE 2D7NA 3CVHH 2W0LA 4MX7A 5BRZD 3C9NB 3NA4A 4U1GC 5EU7E 3U9PH 5HVWA 4E41D 5BV7C 4YDJA 1VFOA 3HNSH 4L4VE 1Z3GL 1CLYL 1HN1A 32C2B 3I6KB 3U7AA 1ZA3A 4BQ6A 1AD0A 4WVRA 4QYOA 5DD3L 3K8MA 4PRBA 4X4YB 3PWJB 2VAJA 1GOGA 3EFFA 3EYQC 3FQTA 3REVA 2OM5A 1JWUB 5I75B 2V2WB 3DIFB 4P5MB 5KVFL 1UADC 1I7RB 2FD6H 2H2PC 3NFSL 2XPGB 3BMVA 2QSVA 2Z8VC 4POZC 1CICC 3K3QA 4NQUA 3KYKL 3UJTL 2GK0B 1CLCA 1NLBL 4YGAB 4UT9H 3MJ9A 4J6RH 3AROA 1M7DB 3KPLB 1JMXA 2EXWC 3QG6A 3WFZA 4BSJA 3ALPA 1KJMB 4EZMA 4LLWB 5I8KH 1JHLH 3B5HA 1UQSA 1IILE 4LHUD 3NH7H 3PXJA 2DQDL 1OAUH 4PJAF 3U7YL 4W68A 1E27A 2EDWA 1S78C 3V6OC 4ZO6A 5C1MB 3RAJL 1UM4H 4L3CA 4XVTL 1C12A 1D5ZA 1WBXA 3O41B 4P5KA 3LQAL 2F19L 2R1WA 5I71B 5SWSA 1VA9A 3GBMH 4GKZB 5BQ7B 4KK9D 1MY7A 1RJYB 4NCC1 1D9KC 4ZXBB 3RWJA 4EUPA 2VDML 1WWAX 5BS0B 2HVJB 1LO2H 2ZCKL 4PJHF 3Q3GB 5C0BE 1E4JA 4L3EE 2IBZY 3BO8A 4OZFH 1AXSB 1NMCB 1RZKL 2P48B 3JWNC 4L8BB 2CLRA 2YEZB 3TV3L 3VWJB 3DRQB 1CGSL 3NN8B 4FQCL 3MA9H 5GZNC 1WEJH 2GI7A 4Z18A 1JL8A 3BQUB 4DKEH 1I1YA 1EO5A 3CVIL 1F4WL 4MJ2A 4DVBB 3MZTA 3TJHD 2NZ9D 4WI6A 1A1MB 4MS8D 1A7RL 3B9KD 4L8SC 1ZE3C 2GJZA 1JVKA 3JV0A 4JN2B 1EUTA 2FEDC 2I9TB 3F12B 4WI2A 3HR6A 3QUMH 1IQDB 3O3UN 1AGDA 1FYTE 4Y7MA 5EUOF 5L0QB 3EJJX 3BW9B 3RVWD 1JPGB 5EC2A 1WBYB 1JNNH 1T1YB 3V4VL 2CRIA 2OL3H 3KWWA 3FRPG 5H35B 2CLZA 3IXAA 4WTXA 1EMTH 4MA7L 4LPXA 2Z4QB 3QDJE 4RIRA 1EGJH 5DJ2B 1T2QL 1FZJA 1ORSA 2G60H 2UZIL 2UVEA 5C07E 2LAAA 5E6IA 3MRHA 2ERJC 1IAIM 3DX9B 3EOYG 5DMYA 3H3KA 4MAYB 1MHHB 5CHNB 1S5IH 1JGLH 4X80H 2NR6D 5HYIA 2IMNA 3N9GH 2BJMH 1Y0LA 3ECBA 1G7HB 2R9HD 1NJ9A 2F5AH 5IVXF 5C0BA 5KN5B 4L3EA 3RRQA 5LGHL 3S36L 1QRNE 4L5FL 4RMUA 3EYUH 1YEHH 1G6RB 1ZEAL 1ZHBB 2EDHA 4LNVA 4Y2DA 3CSBA 4JG0L 4DZ8A 5I1LA 3RNKA 5B4MC 4PYHA 4WJ5B 2JJUA 4KZEL 4PTUA 1A6WH 5HHPA 1DQJA 1G7IB 2R2HA 1QSED 4UOW0 3QIBC 4ZUVB 5IW6A 1B2WH 5KSAC 2UY7A 5D1XB 1OGAE 1AJ7H 4POUB 1W72A 4M61A 4G42A 4HWBH 1TFHA 4P2RB 4PJIF 3ARRA 4Z0BL 3ARGD 1IM9A 3DV4B 1FYTA 4DQOL 2EC9T 5K9QG 4OAWB 2VDQL 1ZMYA 4L8CB 3GMQB 3GHBH 1ZLSH 1NUGA 1EERB 3HI5L 4FQHA 4NRYB 3MNZA 1IGFL 3QDJA 3VRLF 2BSTA 2DDQH 1NMAH 4Y89A 3ULSA 2VDOH 4HUVB 4WW2C 5C07A 5FFLA 2FRGP 5F7KC 3VXQA 5FCUH 4JZNA 2EYRB 5LQBL 1NEZB 4JPWL 2DQUH 4LSQH 2ESVE 2P5WB 5HGHB 3EO0B 4NHUA 5GS2H 5GRUH 5E2UL 2ICWI 3GZKA 4X5WB 1SEQL 3ULUH 3FT2A 2HRLA 4FZEL 3S96B 4RX4A 5I30L 2AV7A 4JO4H 2GSGB 2R2EB 2CK2A 1QRNA 4YAQA 1X5JA 5AG9A 1FO0B 4XNQA 1FC2D 2CXKA 4WV1A 3MRFB 2VABB 1FQ9C 1BOGB 3MR9B 3WO4B 1A5FL 2WWMC 1BAFL 5BV7L 4S1DC 2HP4A 2DQCH 2B2XH 2YPKB 5FGSA 5K59E 2YD5A 1H3TA 1EAJA 3QDMD 5E24E 3V0VB 2LVEA 3X3FL 1JWMA 4XNZC 1BIIA 1CDIA 4F80A 5E95B 5DR5H 3ILPB 2E27L 3LN9A 3PL6A 1F6AA 3CSGA 3HPJA 1BFVL 4WCYL 4WENB 1BVZA 5DFVD 5JW4Q 1DLHB 1R0AH 3GDBA 1R6VA 4KI5C 3RZCA 1TQCC 4JFFB 4R26H 3UZVB 3TGXA 4KPHH 5KW9L 3QHTC 4K23H 4GG6E 2R8SH 2P46B 1U8OB 4NBZB 3H7BA 3GEWB 4K8RD 3MLUH 3QXDA 2ESVA 4KKLC 4TPRL 2NY1D 3MCKA 3D9AL 4X6FA 3U0TA 4XPHH 2E6PA 2Q1EA 3WFEL 4XMKH 4PY7A 4EBQL 3ZKSD 3CMOL 5EZJA 3BZFB 4I77L 1X44A 1QNZH 1RAMA 3LKNB 4ETYA 1FZMA 3P30H 3D85D 5HHOA 3U48A 1VPOL 1U8NB 4PG9A 4AT6B 1DR9A 4S0TD 3NPZB 1T6WA 1A7OL 2Y36L 3W5MA 3TT1H 4OGZA 4S0SD 4PP1D 4O5LH 3R4DA 2A73A 1F8TL 1R5IB 1FZKB 4R90L 4NO3B 2VLMD 2P4AB 3BDBA 1IAMA 4P57B 5DUMH 3P0VH 3ZKNC 2VDRH 4QNPE 5D7LB 4P2OA 3OJVC 1N26A 3WUZA 2EYSA 1MQ8A 1HQ4B 2H32B 2YBRB 1ZLWH 3T4YA 1Y18A 2PXYB 3MRLA 1K5NA 1S9XA 4R7NA 4H8WH 1KPRB 1DL7L 1UKSA 3RKDD 5JO5A 5T3ZL 4KY1H 3G5ZB 3INUL 3C5JA 4G6KH 5H94B 4K9EH 4XBGA 1QYGL 1FNFA 4CADA 1KIPA 3UXFA 1NFIA 1I75A 4NKDB 2XZAL 3VFVB 4L29B 4JDZA 3ZE1F 4JE4B 2H1PH 3MRBB 4X9IA 1RHHA 4HKJA 5ESQB 4N0FB 5TFSH 2D7TH 2W91A 2W65B 3L1OH 2EO9A 1JFQL 1MIEL 3NABH 4EIGB 3X3GL 4DFIA 1K3IA 4S2SA 2O61B 4ODTH 5F8RC 4UV4H 5J3HC 2DLHA 4N5ED 1AD9A 4P2YA 1ZHNB 4PRPB 5K9OB 2V7NB 4X5XB 2DQHL 1BQLL 5FF6A 4JRYE 4F33A 1KJVA 1FN4A 2NY7L 1LDPL 4XVUD 4KJQD 4KMTH 1J5OH 3MXWL 4TUOA 1HXMA 1KJ3H 5GJTL 1S9WA 4Y1AB 1XGRA 4ONFL 5F7LB 4IRJB 2CDGA 4XZUA 2OP4L 1JI2A 2FWOB 5GRVL 2ZSVA 1MVUA 2HTKC 1T0NB 1R5WA 4ENEC 1I3RA 1WQVT 3WEXB 4RMSA 2XG5A 3QEGL 3AAZA 5D1QD 1MAJA 5HYJA 1CFQB 2FO1A 4GRLD 2PR4H 2L0DA 1R5VA 2AGJL 2APWA 4J4PD 3D3VD 1PD6A 4NWUL 1ORQA 5HPMA 1ZHKA 3EGSB 2ADGB 1KCUH 1C5DA 3DBXB 5GIRB 2BVEA 3QPQD 4UIKH 3ULVH 3MRPA 2CR3A 3T1FB 4JY4A 4AEIH 3ZHLA 1C08B 3NTCH 3T4AB 5GZOC 1WISA 5EC1B 2ZUYA 5L7XL 4O9HH 3EO1B 3SO3B 4YEFA 5T1KD 4DZBA 1YPZF 3FRPA 2A6JA 2DLEA 1EX0A 1IT9H 1LEKA 2EDYA 1RIUL 2XNAB 2ZZUT 5CSZB 4C55A 4G9FD 5T1MA 5EIIB 1TMCB 3D39D 2XWJA 3ILQC 3SDDA 4FFWD 1JV5A 2AJVH 2HH0H 3UYPA 4JM2D 4PJ5E 2FJGB 5FO7B 2VC2L 4GSDL 3MBED 1Q9KA 5IQ9A 3KXFB 4IIQC 3OAZH 1IC5H 3V52H 5JDSB 1MCOH 1T1XA 5HGAA 2A77H 4JRYA 4TUJA 4JO3H 3PWVA 2FBOJ 1XH3B 2PNDA 1A9EB 3MFFA 4JKWA 3BH8A 2W0FA 4IRSB 4IHOA 4LSTL 2Y25A 2MQ0A 4M1DH 4AIOA 2WUCL 4NM8H 2C3VA 3EYFA 3HNTL 5I1CH 4JKPH 1CIDA 1NQBA 1XT5A 3EOTL 1SYVB 2VLKE 4WUUE 3WJLA 2FHCA 3QUKA 5CFHA 5JOFB 3O8XB 3PQYE 4G5ZL 3EDKA 1MHEA 2ZUSA 4MJIE 5L88L 1N2RB 3OMZA 1W0VA 4HV8A 5I1HL 2VDKH 5IB3B 4ZPTA 4QXTB 4XC1H 5DD1L 1NDGA 4AL8L 3EYQD 3PABB 1NFDB 4NPYA 4XNMA 3VXTA 2BC4B 4WI9A 3CU7A 3FQNB 2CDEB 5DVMA 1EH9A 4HIEA 1A4KA 2ZG3A 4NCC2 4FG6D 3GKZA 3TIDA 4WO4B 1MWAB 1LDSA 4J3TA 5FUCC 2APFA 2P5EB 1DBBL 2BRRL 4YHLL 1IKNC 4U33A 1RU9L 4MQXD 1CR9L 1J0HA 2A0LD 4PJ5A 4MLIA 4UT6H 3VXRB 4R6UA 1H8SA 3O6FD 4O2FA 5IMMB 5JR1H 8FABA 1ZT1B 1G9NL 2PTVA 4GAGL 5DVOA 4HC1A 2AQ2A 3EOAA 2VLRD 3CX2A 2UVFA 1AHWC 2VL4A 1QLFA 4LSVL 3TIEA 3E6FB 3EDJA 3WUWG 5CLTA 4O4YL 2NW3A 2AV1B 3NFNA 4M7JH 4FA8A 2VLKA 1QSFD 4HKZA 3RNQA 5DT1L 1R3JB 3PQYA 5D7IE 2F58L 3WN5A 3FQWB 4MB5A 1CD0A 1OD7A 2NLJA 5IV2A 3HUJB 3FRUA 4MJIA 5DHYA 3HZVB 4K07A 5CZXC 3TYGL 3C8KA 5MP6H 4I2XE 1QG3A 4LCIH 3KPNB 1LO5A 3F7YB 2OR8A 1V3MA 2F74B 1ZT7B 4JQXA 1FFPB 1UXWB 3QQ9D 3ZE2E 4OZIE 4J3WA 4P23C 4HSQA 1JYXA 1BLNA 1MUJA 1QA9B 4CU7A 2CKNA 5F9JB 4R4FH 1Q9WA 4FQLL 1FL6B 2JCCF 5T3ZD 4NP4L 1MF2H 5E8OA 4CVUA 1QFWH 2CGRH 2ZNXA 4X7SH 3KLSA 4DGYH 2HA1A 3QRGL 1H3GA 3IU3B 1IC1A 3OXSB 2NY6B 5I76B 1OWWA 4DN3L 4LLYA 3JTTB 2A83B 3G04B 1CD1B 2ZG2A 3BI9X 2ICEA 4RWYH 3ZZ1A 2Y6SD 4GXUN 1A3LL 1I3UA 3GSNL 2ZSWB 3O3AA 3KYMB 1EO7A 2X4QB 1P2CA 2DTMH 4WTZG 3R8QA 1BQHG 4ZO9A 3GUTB 4YO0A 4MD5A 3O4LB 5MENB 3VRJA 1FIGL 4NSKA 3VGEA 5KSVB 1GHFH 3VXOA 3GSXA 1NDMA 2YWYA 3BPOC 5D7IA 4OQTH 5TGBA 3VW3H 1IM3B 4OGXL 2YPLA 1RFDL 4OZ4B 3ARED 5IVXA 4G9DA 4LNRA 3DXAB 4LKCB 3PDOA 3H42H 1HILA 4Z7QE 2I60L 2P45B 2B4CC 4LSSH 4OZIA 1DDHB 2X1QA 2HFTA 1HOCB 3C5ZC 1RD6A 1ZWIA 4ZXBD 4V1DB 5K9KB 4M1GL 3QEHB 2OQJA 5BS0D 5DJAB 2ZOKB 1OLLA 4UTBH 1WV7T 4U3HA 3UC0H 1F42A 2YD4A 5T3XH 4PGEA 3UTTB 2H8PB 1OQOA 1S7WB 4GRWB 1MHPH 3HI6H 5TQ0H 1B0RB 1U3HA 1TZIA 3QI9A 3A6OA 3BQUD 1HCFX 4XAKD 4S1QH 3TA3B 3QBTB 1FYHB 5EOQL 3VJ6A 5DRNA 1P6FA 1FVEA 4CN4A 5JDJA 2YD3A 4LLMB 4PP2B 4ZO7A 2HKHH 9CGTA 4Z76A 1WT5C 5DLMH 3T8XB 4EI5C 2J4WH 3WLBB 3Q6FB 5E2WH 4Y8AA 2Q8BH 3AS1A 4TSBH 4XPTH 4Y4FC 2AEWA 3WS6A 4IRZL 2UY6A 3EYSL 5ERWB 1KC5L 3OHXB 3S8WA 4GMSL 2PF6A 3FO0H 1P4BL 1DEDA 2ED9A 3V5KA 2DIBA 4Y5XA 2X2YA 2IANE 2XZCL 5FYLL 1NAMH 3DSNA 3VXUB 4F3FA 1JGVH 4MAYD 1BWMA 4GS7B 1I1AC 4PGZA 3OR7A 1T04A 4OF8A 5DMKA 1IEAB 1MFDH 1P7QB 1T22B 5HI4C 5IOPA 1EFXA 5AZ2L 1JHKL 4YHMH 2Z9TA 1OSZA 5EU4B 2X4SB 1D5IL 3G08B 3MRKA 5D93C 4HIXH 4NQCE 5DYOB 4A2MA 2VERN 5F7HA 1OAKL 3HB3C 3PGFH 1B3JA 5F7MC 5KSBE 2KQMA 2QQNL 3AFLA 1T7XA 5F1NB 1CXEA 3OL2A 2VE6B 3D2UB 2YRZA 3BYTA 1S9VB 2DQJH 3BPNB 3H6JA 5C0IB 2EEBA 1FZOA 1CF8H 4LHUG 4M7KH 5C0AE 5D1XD 4M1CC 1SM3H 5D2LE 4JFYB 3NACH 4P2RD 3MNWA 5JLZA 3LOWA 4YBQC 2EDRA 5D71H 3W9EB 3RDTC 3ZTJG 5DJ6A 3U0WH 2BFVL 4EJ1C 2GTZA 3UP1A 1DVFB 3HE6B 2R1XA 5CJQH 3KGRA 5JORB 5IMLA 2F8OA 2OZ4H 5INCB 4LPUA 2Z0BA 2IANA 4WNQB 5HHNA 3DJ9A 1MREL 1GAFH 4Z8FL 4LU5L 3G5VB 1B90A 2ZUQB 2P5WD 3QT2A 4KHXL 5B21A 3B8YA 4OM0H 1R3HA 2MPAL 2O5XL 4OKVB 4DW2H 3WIHH 1A7QH 1ULVA 3QH3B 1M7IA 4PRHB 4ELKA 1BD2B 3FJTA 4FQXC 1FAIH 1Q72H 3D5OF 4Y16C 3FHAA 4XP4L 5KSBA 4F8TA 3GMPA 1KENH 1L0XA 4JHBA 4PJEE 4Q58C 4FXKA 3W9DA 3RP1A 2BVYA 4JKLA 1QVOA 4J23A 4QRTA 5C8JA 4YX2H 1KBGL 2PTTB 1SJEB 4N8CL 1WWBX 3IFPA 4TNVF 5C0AA 5D2LA 1GZQA 1OB1B 5ILTH 2XOTA 3GRWL 1RIVL 2AK1L 3CDGB 1JN6B 2IH1B 2ID5A 4BSWB 4GQ9L 1MHCB 1RSFA 4PG2A 4QXWA 2DMCA 5LWYL 3MROB 4HUWA 3QQ4B 3RWCA 2IALA 1LD9B 2IPTL 5ISZA 1A7NL 2CUMA 4MD0A 3P4NA 3GO1H 5KG9B 2KKQA 3S88L 3E6HA 5AWNL 2K9UA 3DX8A 3TVMC 3WUWA 3QEQE 5I17A 1KPUA 3V4PL 4ETQB 3OKKB 4J8RB 1BJ8A 4BFIB 3T3ME 4LVNC 5C92A 2X05A 3D18B 3UROR 4PJXE 1F2QA 3PGDA 1YY9C 5C71A 5JXED 2WK2A 2DQEL 4HFWB 4GAJH 1ZVSA 3B9DA 4MCZB 4ERSH 3TO4A 2B4CL 3K7UA 1Q0YL 1RZFH 3C60A 3P77A 4K2UL 5JNYA 3W39B 1AE6H 5D7KD 4OGAC 5DD6A 4PJEA 2FGWH 3JVGC 3OZ9H 4DGIL 2P24A 5KVEL 5C0GA 2X7LB 5DQ9B 4D3CH 1QOKA 2J5LC 5C2UB 4YXKH 3H9SD 2OX5A 3PNWA 2IEPA 3BUYB 4D9LL 3ZKXB 3X11A 4NUGH 1GIGL 5D7LD 3BKMH 3MV9E 3EYOB 3OKYA 5JPNB 4HJGB 2Y06H 3U4BH 4P5TC 2PXYD 3TFKC 1P7KA 2GFBB 3UYRH 1U8MA 2WIIB 4GKNA 4OLVH 5DJCA 2WWKO 4X98B 2I9LA 1WTGT 1JTOA 3IDGA 3L9RA 3ES6B 2Y5TB 4MD4B 4OT1H 1N8ZB 4WTZA 1IAOA 1BQHA 1H3PH 2XTJE 4ZYKB 1CFNB 3LH2L 2YWZA 1QHPA 1DUYA 3SHSA 5BZWB 3O0RH 4GQPH 2R29L 2ZUTA 2XZZA 1UC6A 5TF0A 5J7CC 2EDQA 4YBHA 1GH7A 1SEBB 4HHAB 3C8DA 4NNPL 2VZSA 4CNIB 2IGFL 4X6DF 4QRRB 2WINB 3WS3A 4PJXA 5GRJL 1RUKH 4H1LH 1SMOA 3HC4L 1QSVA 5IG7A 2JE8A 5ALBL 2MWCA 4B5EA 5IR1B 5TE7L 4EIZC 4OB5L 3IKKA 2IQ9L 5J6HA 4U1NB 4MYWB 3TZVA 1SY6L 3AY4A 1JMZA 1QFUL 4UNTA 4PRPD 1D3CA 5D6DC 1V3KA 4YK4B 3FN0H 3L5XH 3AXLA 4PLKD 3UPRA 5T1DH 4U4BA 3PWUA 3T77B 2GUOB 1TZGH 3GMMA 4EN3B 4FS0A 2JJTA 4Y1AD 5EORL 4NRZB 1P1ZB 4IRJD 2AABL 3DMMB 2EKJA 2X4RA 4E0RB 3G5XB 3MLZL 3L3DA 2VDNH 2BHUA 3QWRA 3TT3H 1MCHA 4Z78A 2NY2C 2JK5A 2OSLA 3I3BA 3VA6A 3Q5YA 3B9EA 4RQQA 4MSWA 3V79C 4OZHE 4DK3A 3EJZD 4TNWK 3OF6A 3PUCA 4TVPL 5IB2A 2ORBL 4OF0A 2OK0H 1GGBL 2F9BT