2P43B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 1.65a resolution: se3-mono-1 crystal form with three se-met sites (m34, m51, m83) in vhh scaffold
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'GSQVQLVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
molecule tags Hydrolase/immune system
source organism Camelus dromedarius
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p43B00
5DLML 3NN8A 1WCBB 1VHPA 5LAXB 1CQKA 1GL4B 4GXUN 1X5LA 2YD5A 3IKCB 1J1OH 4J3WA 3CD4A 5HDQH 5JORB 4YE4H 4G6AD 4PR5B 3BQUA 2ID5A 2VIRB 4UNTA 1A4JB 4JM4L 5TH2B 1ORSB 4N1CA 5C0FA 4JR9H 1IQDA 2H2SC 2ZCKL 3I75A 5HDOA 1JTTA 3FO9A 3QXTA 3IVKB 2WMPA 5FGCB 2PCPA 2NY2D 4NM8L 3ZSTA 1AD0B 3SDXF 5E2TH 2PO6A 4IS6B 4WV1B 2P1YA 4UIKL 5DF0A 1ZOXA 5ID1A 1A9EB 2XWBA 2IAMA 1O7VA 2DN7A 2QR0B 1NDGB 3DX9A 3FN9A 2AJXH 4G6FD 1ZHNA 1YA5A 2X4RA 4KQ4H 3DUSB 4PV8B 3KPSB 2HN7B 2VABB 3L3IA 1LDPH 3RDTC 2DM7A 3U2SA 2N4IA 3MO1B 4XNMA 3GKZA 3QIUC 1BP3B 3MFFB 4HEME 1A6AB 3P3YA 4S0TD 3ILPA 4GRLD 1E27A 2Y72A 5F7LB 3VE0A 1ORSA 2Z0BA 5EFIB 4FN0A 3MRGB 3G6AA 5CILL 2WIIA 1EAPB 2DKSA 2VKXA 3TBYB 4YPGB 1Q9LB 4R3SA 5E2VH 4XVTH 4YX2L 2PR4H 1I1AD 4PRNB 3U30C 4MQ7B 4MJ5B 5CMAB 3GMLA 4RGNC 1E28B 2FIKA 1TJGH 1ZHLB 3HB3C 3IXTB 1KTLA 3RY6C 3D0LB 1J0YA 5BOZG 3GM0A 2VL5B 1G9ML 3S5LG 3A6OA 5D2LB 5HI4C 3PNWB 5D2NE 5HJ3B 4RDQF 2A0LD 1K3IA 4M1CC 2EDWA 2EKSB 2HRLA 4WTZG 1OVZA 5HYFA 4K8RD 4X4XA 3CUPA 3C60B 1ONQB 3BUTA 4MNQD 4PJ8A 3V0VA 5J1TC 2IFGA 1FL6A 3TIEB 3H7BA 3O4LA 4KDWA 2AK1L 1UZ6F 5HY9A 5DZNA 4JO2L 3P73A 3G6DL 1F90L 3MODH 3WFDL 4Z7WF 2MWCA 5IEHB 5IHLB 3VD9A 4PJFE 1KGCE 4AIOA 1U8HB 1I1YA 5DEZA 1KPRB 1N3NB 2Z31C 1QO3B 2C3VB 3MLZL 4O9HL 4P2QA 3L3JB 4AIXA 1M7IA 3BZFB 3MV7A 1XF5A 3TT1L 4XCEB 4JEGB 3H9ZA 1OHQA 4NM4L 1X5IA 1HWGB 4DN3H 2W0PA 2FEEL 1MQ8A 4NRXB 5T1MA 3LKRA 2R69L 4TQEL 4P5TA 2A6JB 4M6OH 2COQA 1J88A 4C57C 2VDLH 4J3XA 5FHAL 3QXUA 3G9VA 5ICXA 4Z7VB 2CDFB 4P59H 1P7KB 2DYPA 4GBXA 3S97C 3CPLA 3QZWA 2X05A 2GJ6D 1YDPA 3T3MF 4J4PD 4LGRB 4ODBD 4LLVB 4F9LA 5F21B 4HBQA 1G6RL 4Z7VA 4PUBH 1S9VA 5F6IB 4MLSA 1I8LC 2BHYA 2FJGA 3H0TB 4JY4B 3R0MA 5IMLB 2Z4QB 3RHWK 1GCFA 3VFNB 2BNRA 4HUWA 4AL8H 2Z35B 3EZ8A 2CR3A 1FFQA 4XZUA 2N7BA 4NO0A 1QSFA 5GISL 1CXLA 1CFVL 5L7XL 1QVOA 4TNWF 4JGUA 2NY4C 5IV2B 3RUGA 1JPST 1CIUA 5ITBL 1RUAH 2XG4A 5E5MB 4PYGA 4J6RH 4WFHD 1J0JA 1WEJL 3IFNH 1U8KA 3DUHA 4OZFB 4NHCL 5CD5C 1T21B 3FQUB 3G5ZB 4HK0A 4PJBB 4XHJD 5MERA 5L88L 3FB8A 1T5XB 3S37H 1P69B 3W81A 3HN3A 3HI6H 1ZGLM 4GAGH 4NKDA 1CXIA 2A6DB 4U1MA 2VQUA 4M7LT 1UZ8B 1AGCB 2B1AL 1CE1H 1VGKA 2FH6A 3S3JA 1M6OA 4KK6D 1FZJB 1IKFL 1ITCA 1CF8H 3C60C 3HZYA 4HF5L 4LKXA 1FNAA 2DM4A 4LSTH 4Z8FH 2GIYA 1KTRL 1P84K 1XGYL 2MQCA 1FDLH 2NLJB 3E6HA 4QHLA 1DN2A 1Q9LA 1MFEH 2AJYL 4RAUA 4NBXB 4WU5A 3MA7A 4ZNCD 4MCYB 3T1FB 4GKZA 4WY7H 2NY0D 3EYOA 4U4BA 1MIEH 3AXLA 1YEKL 3TEUA 1BAFH 4C83B 2W65B 3FRPA 2Q3ZA 1MRDL 1BZ9B 3AGVA 2NY5H 1TJIL 4GMSH 4OLWL 3MFFA 4K94C 2VR5A 1JHLH 2EIBA 3SY0B 2W60B 1CFNA 4OKDA 2H41A 4XCCH 3IDJA 2O5ZL 4XAKE 3JV5A 1AKJD 1QSFE 1MJJB 3MOQA 2GQHA 3MBXL 1FL5B 4IRSC 4X7SH 4F57L 1HN1A 5ID1B 3QNYA 2HYMA 5ITFA 3S8WA 1MI5D 4Z0BL 1KN4L 4JFFA 1RUQH 4Z76B 3CDYA 5ABDE 3PGCB 4H25B 2Z31D 1UH3A 1WBXA 2D0FA 3GSNL 3RUGF 4JGJA 5FGBA 5SWSB 4XVSH 4PJ5B 2WQRA 2EDKA 5KW9L 1NC2B 1OTTC 3X17A 3JWDL 3BQUB 3FOLB 4YHOL 4XP9H 1B0RA 3VXRB 3FKUS 1UYWL 3PGFL 1CTOA 5JXED 1P4BL 1RVFH 3WUWB 4OM0L 4NWTL 5IW3A 1T1YA 4PLOB 1FG2A 4JRXA 3QCVH 1DANT 2E9BA 4JPWH 1U8NB 3RZCD 1UB6B 3TO4A 1JGLH 3RPIB 3CMOH 5IQ9B 5IVXA 3SPVA 2BVQB 2VWEE 1WLHA 4XP1L 1MLBB 3KPRE 4IRJD 1CVRA 2AJVL 4P2QE 3AREB 5D2LA 3QUMB 4PRHD 1AQKH 2ZKHH 4JFXA 3WKML 1A6WH 2D7NA 1BOGA 4AK1A 1Z9OA 1GJIA 3QPXH 4ETQA 3HFML 3MLSH 3V79C 1QSZA 3QNXB 5IHUH 3C08H 1M7IB 3BZFA 3MV7B 4E42A 3T0EA 1ZMYA 1JFQH 4M5YH 3VD3A 5EC2B 3ESVF 4WI5A 2VMFA 3WHXB 3K1DA 5GGUB 1A64A 3SCMA 1C7TA 4MAUH 5CEXA 1WFOA 1JHTB 1YEIL 5TFSH 1RUPL 3R06B 2BY1A 3QQ3A 3S3PA 4M5ZH 2FX7L 4ODSH 3RZCA 4L4TB 1A6VH 5TQ0H 1FC2D 3L1OL 4JRXD 5BZDA 3CFEA 1LE9A 4OTXH 5HYSB 4Q2ZA 3G5ZA 1MCKA 4NUJB 3PP3K 4G80B 4UT7H 4YBLC 2XWJA 2W9DH 4I77L 1UWXH 5LBSH 2R8SL 4ERSL 4R2GB 1SJEA 2AXGB 4B0MM 5FK9A 2QHLA 2XA8L 1CG9A 4KRMB 3EYUH 5D71H 3GUTB 4RGNE 1RZJH 5DI8A 1MAMH 3RVVD 2VLKD 3SBWA 2OI9B 2IGFH 1JI1A 1FO0L 1NCTA 2Z9TA 5DFWH 6FABL 3UPRB 3HPJB 1T1ZA 4WO4A 4GKZB 4YHYB 2FBJL 1N0XL 1CD9B 3CIQA 3T1FA 4OLZH 1S9VB 1D5MB 1LP9E 5F7WC 4DGYH 4NZUL 1ITBB 2ADIA 3OAUL 4LL9A 5C2UB 2F8VA 4CVXB 1JK8A 4XNUH 1ZA6A 5E8OA 4EIZC 4MDIA 4ZO8A 3VDAA 4PJ7F 3QXAA 43CAB 4ONGH 3ARFB 3QCTH 1A3QA 2FO4A 4ONGL 2BY2A 5FHAH 4GW4A 3TZVB 5E6IC 4X0KB 5H35A 4OBSA 4MQSB 1UZ8A 2JJUA 1WAAF 2BVPB 4CGTA 4U6YA 1NC4B 3QIBA 4NWTH 5JHDD 1K2DB 1QBLL 3OAUH 3RL2A 3Q2CA 1NEZB 3VXMD 3JUZA 4XCFH 5T1LB 3MRIB 5L8JB 2QADD 2GTWB 1UYWH 5DJXA 4JPIA 5CLWA 4U0RB 4M8QA 3CDFA 5ERWB 3P4MB 3V7MA 5FF6B 4OIAA 3QUKB 5HGAB 5E9DE 1L7IL 2QQKH 4BKLB 1NMCC 3P30L 5I16A 1TNMA 3EOTH 5GGQL 4GAYB 1LK3L 4Y5XC 3VWJA 5GGRA 4A6YA 4AQ1B 5IW1B 2P5WD 1KJ3L 4JM2F 1KLUA 1GGBH 2NTSP 4XNZB 3DXAE 1NGWA 4RMVA 1KPVB 4K8RC 5E4EC 5C09E 2A9ML 4NJ9H 3U4BH 3QPQC 1X3DA 2FGWL 3ME0A 1DQDH 2C1PB 4HZAA 2Z93A 3CVHA 1LVEA 1Q72H 1CLZH 3SKMB 3HRZB 2YPKB 3JWOC 4WFFD 4E5XA 1BECA 1OWRM 1JRHH 5F88B 3BAEH 1CLYH 2A9NL 5TQ2H 1KCSL 3ES6B 2QTEA 4ODWB 1IC7H 1RHHB 2CIKB 4BZ2L 5C3LD 1P7QD 4RGMB 5J9PB 4R26L 2XZCH 5DEGA 4IDJL 4M93C 2ITDA 1KCUH 5T3XD 5F88A 1R3LB 4XVJL 4J3SA 2LVEA 3QUZD 1AHWB 2DM3A 1UM4H 1FQ9C 4R96B 4LF3A 4XAWH 4N8PA 1W72L 1T1ZB 1JF1A 2FD6L 1EEYA 3ZT6A 5I17B 4HQQH 4BSJA 4Y89A 1EVUA 1YC7A 5EIQA 5FO9A 2AJVH 3DECA 2ATPA 2FYYB 4PBWD 4IOFD 2RHEA 1R3JA 2PO6C 1CFTB 5DJ6A 2EDLA 5EZIL 1DVFC 2WLZA 1NAMA 1RZKH 2VE6B 1A7RH 5BO1L 3KWWA 3QDGD 3BKYL 2Z4QA 5D1ZD 1NEZA 2AXFA 1UVQB 4M48H 2KH2B 1DBKH 2VZUA 4Y5YC 3M45A 5H37H 1S7SA 1FL3B 1FO0A 4R96A 4YHOH 3FT3B 3D85B 4HFUH 4P2QD 1FFNA 4G3YL 4TVPD 1UEMA 3ARFC 4U3XA 3T65B 1N4XH 3KR3H 4QRRD 3BRFA 2VH5H 3L6FB 1PX3A 3RY4A 4YE4L 5EH1A 5BO1H 4PY8J 3QJHB 2W9LA 5FCUL 4U1NB 5CZKA 2BFVL 5FDYA 4BSVB 1R0AL 4HDIA 2DIAA 1OWWA 4EZMA 5DXWA 4YLQT 4WFGD 3O4LD 4JG1L 3CSBA 1A1OA 1B4JH 4ONHB 4UNVA 4ODHH 3MMEB 2AV1A 5D1XA 3O41A 4C54A 1HNFA 5EBMB 5DQJA 4RGOH 4GXVH 1DUYA 4YHZH 2IBBA 3ZHKA 2APTA 1OARL 5IFHH 5JHLL 4HQQL 1IGYB 2R4RL 1INDL 3EO9H 4JCLA 3NCFB 3I84A 3NCYS 1CD0A 2HTLD 5JXAH 4ZFFA 5EOTB 2J88L 1F8TL 3IS1X 4NQTA 4A6YB 1BAFL 2AEIT 1JZ6A 3LQAL 3HNTL 1RZFL 1NCBH 4OSUL 2AGJH 2R69H 4U0QB 5L2JA 4QCIB 1QA9B 1J5OL 2F53A 2PETA 2Y5TA 1TENA 4G9FB 4RGND 1AE6L 4R4FL 1T4KB 3KAAA 1AQDB 4G8EB 4GKOA 5T1DH 2R0WL 1KFAL 2DQUL 3P4NB 5GS1A 2BSTB 3L7EB 5FECA 4OGYH 4Z7WE 2EH7L 1A4KA 2GFBB 1T03L 4JLRB 3S3SA 5D1ZA 5IG7A 5HHPB 1WTLA 2CRZA 3OKOA 2NXYD 1EZVX 4FQ2L 4HXAL 2R0KL 1CK0L 4GSDL 1NLBL 1XT5A 4YHKL 1X44A 4JFPB 2BNQA 3CSYA 3O81A 1RJZB 1AHWC 2RQ8A 3P11H 1Q38A 7FABH 2ERJB 1KOAA 3SE3A 4DKEH 4QRTB 2P45B 4DZ8B 1W0VA 1PKOA 1T83A 2BY0A 2IF7A 1OM3L 3GEWB 1U8LA 3IDJB 4WO4B 3WD5L 1RJZA 5CD5D 1EHLL 2CO7B 3OKNB 2EIZB 5E00B 1JN6A 2PW2A 3UDWC 1UB6A 1QBML 1U95B 1TNNA 2FL5B 3QUZA 4PJXF 5IBUB 4Y1AB 1HIML 2F54D 4L9DA 3CFIC 4RBPK 1QBLH 3EHBD 1B90A 3FQTA 3TBTB 3AXLB 4LSSL 1LEIA 4I0PD 5ISZE 1KXTB 1VACA 1XR9B 2DF3A 4LSVL 4U6XA 2OK0H 1ZHBB 1RZ8A 4MWFB 4D9QE 4WEBL 1HH6A 4PV9B 5DC0A 4OCXH 2FEEI 2VDOL 4KZEH 4FZEL 1VGKB 3KJ6H 3FO0L 2FJHB 4XT1C 4IRZH 2QKIB 4XAWL 3CH8A 3NMEA 1KXVC 3VGAC 1U3HA 3PL6B 4Q9RH 4LSVH 3BO8B 5IT2L 3RJDA 4FTVA 1EO8L 5DD3H 4PRPE 4YHLH 5KVEH 4LFHG 3RAJH 4OLVH 3U6RB 4MCZB 1DQQA 3MLPA 1MCPL 4P4KA 4R26H 5DFVC 1T6WA 2DRUA 2ZUVA 4PLJD 4XBPB 4UOW0 2J1KA 1NH6A 3TJHD 2C3WA 5DEFA 2NW3B 4U1NA 4BSVA 5IKCB 3GSWA 5E0QA 3UCRA 1JP5A 3CCHB 4L8BA 2N7AA 4UMGA 3CXHK 3C5SA 4JB9L 1J0IA 1IAIH 1WGOA 4F7TB 1M71B 3RP1A 1FFPB 3MODL 3QXVA 4LDOB 3CK0H 3FCTB 3TFKC 4LNVA 5TDOA 5L2KE 1BX2A 1BQHG 5KSVB 2C5DC 4BM7A 1H0DB 3QDMB 2OTUB 4N9GB 3ZE0F 4KRNA 1M05A 4XC3L 4FFWD 4PJ5E 2XY1A 4RAVB 1GOGA 4U1KA 5KSAA 1X7QB 1JGDB 4ZAKC 1ZT4B 2Q8BH 3IDNA 3KYNA 4LPYA 3F12B 3QP3A 5IF0B 4AM0B 4MXVE 1FNGA 1JPFA 1VFBB 5T3ZH 2AGJL 3RHWF 1BBDL 2YD7A 1OAKH 3X3FL 2DWEB 2ZUUA 2NW2A 3MGOB 5D7JA 2B39A 4ZS7H 3BN9D 4HXBH 1NSNH 1A2YA 1AGBA 4IBLT 4FQQA 3M1BB 1D5BB 1BWWA 1EGJL 4G7YL 4RFEB 3FHAA 5FA3A 1HSBB 1DBBL 4TUKL 3EAKA 1YEEL 4ZOEA 4RAVA 3GJFB 4WUUB 3GSVB 3QEHB 3LY6A 1T5WB 1X5ZA 4G9FE 5J89A 4LHUA 3J8F7 4JG1H 1QQDA 2ZCLH 4YQXL 2GITA 1T20A 1U8PA 2ENSA 3O0RH 4WUUA 3BT2L 3RI5K 4DEPC 5ECJE 4DCQA 4P46B 3V8OA 4XCYA 5TPWL 4PLJC 3MCG1 5TGBA 3DMMB 4UIMB 4PG2A 3D18B 4JREB 4EVNA 4L1HA 4PREA 1RY7B 2NW3A 3AAZA 5D5MF 1KB5H 5BZWA 4HUXA 4M48L 3CJJA 4ZYKA 5KVFL 4S10A 2LU3A 3KPRB 5AZ2L 1YECL 1KENL 1JHLL 2WBJA 2V2WB 2DMBA 3HMWL 3LEYH 1XGPB 3VFTB 3ULUH 3BP5A 5CEYA 3TBYA 1KEGH 2FX7H 1WBZB 3F12A 1DQMH 4FQCH 2OR8A 4MAUL 1J1PH 3GK8H 1GXEA 1A1MA 3BMWA 5CZVL 4UILH 3O9WC 3HC3L 4OF3A 1X5HA 4L8CB 2BVUA 3HI5L 3HI5H 5DK2B 2H32A 1JK8B 1YYMH 4HJ0D 5DGRA 1N59A 2BNUB 1XR9A 3UO1H 4EUPG 3MYJB 4PGCB 1X5AA 4XP1H 3IXAB 3F58H 3G6JA 5L8KB 2X6MA 1MI5A 3VWKA 4L8DA 1HQRB 5DUPH 2RR3A 5IQ9A 2RAMA 4NC1C 4NP4L 4PRHE 4YXLL 5CUSL 4L29B 4PJGA 5EBWB 1IC5H 1U3HC 2P5ED 4XMLH 1JRHL 1WWAX 1I3GH 4FZ8L 3U79A 1D5BA 4I5BA 3QUKA 3WSQH 2YOCA 4PRNA 3LMJL 4ZTPL 2JJSC 3MLXL 3JWDH 5JOFB 3VRLF 1RIHH 3KPMB 3FO1A 4PJXA 3DV6B 1FNSL 5J3HD 3T8XB 4JFPA 4HBCL 1LD9B 4JG0H 3B5GA 5GZND 2GAZA 1FNSH 3I85A 3SDDD 1PKQB 1FYTD 3O6KL 2Q8AL 4NQSB 3C6SA 3IDNB 3QQ3B 1HH6B 1FV1B 5CS7A 1J0KA 3P9LB 1IGJB 4KDTC 4PUBL 3UZQA 2X2YA 5GGSB 1OTSC 2G2RA 1U8QA 4WWKA 3IU3B 1NLDH 4HPOL 4XBEH 4R8WH 5GIRA 4PY7A 5DT1L 4JO3H 3TESA 1YY9D 5FYKU 4ZS7L 3O2DH 1TIUA 5C08D 2F74B 4F7TA 1MFDH 1MY5A 3PV6B 5AEAA 3A6BL 1PG7W 1VGEH 4J8RB 3UEZA 3BRGC 1FBIH 1DQLH 5L2KD 4KTEH 4CVWA 4JPVH 1W0VB 3PXJA 3TO4B 1RK0B 3MSPA 5E7FA 4O02H 4ZFZA 3HKFA 4Z8FL 1VERA 5JIKA 4CMHC 2WW8A 5D7KE 5IB2B 1QSFD 2BOBB 1IM3A 5C0DB 4R3SB 4NO0D 2CGRL 2VDNL 3LN5B 4L9LA 2L7UA 1RZ7L 5C0AE 2YK1L 3RZCB 5AG8A 3I3BA 4K7PX 4K9EC 2XKNB 3QG6B 1U3YA 1XH3A 3QXDB 5GJSH 3HMWH 2BDNH 5D70L 3ZT7A 4N90E 2I25N 1FL3A 1FO0B 2LABA 3O4OC 4S1RL 1AGBB 4K71B 3QIWB 4HAGA 3K81A 1JL8A 4WENB 2UWEA 3L3HA 3Q5TA 3S96A 2GSIA 1VFAA 1TZHB 3BEVA 1HNGA 1GAFL 3LPGA 4RMWA 1A7OH 4LVOC 2FJFB 1TJHL 4H8WL 5A16B 1SMAA 4QO1A 5GRVK 3WO4B 3SO3B 1DLHA 1P6FA 5DJ8B 4EN3C 2B2XH 2CGRH 2VDNH 3BD4A 4P5TD 4PRDA 1MCEA 4U6HB 4HV8A 3QO1A 1RIVH 4HLZH 4RA3A 3BGAA 2UWEF 3BHBB 4OF6A 1MHEB 5IROC 4O4YL 4D3CL 3MV7D 1RMFL 1QSVA 1HHIA 3EDJA 3O3EA 4L4TD 3DI2B 3ZKNC 3QEHA 4M00A 3ULVF 4PD4K 4Q0XL 4KI5E 5LAXA 1WF5A 3T77A 1ZSDA 3ZYJA 1N6QL 2Y06H 4NN5C 3N85H 1MSPA 2P8MA 1F2QA 3EDEA 1PG7H 5KG9A 1IAMA 2HJFA 3DGGA 4CMMA 5FDWA 4HWBL 2NXZD 3MRBB 1ODAA 2A38A 3LB6C 5DMIH 1CD1A 1CFQB 4OT1L 2BSTA 1Q1JL 5IB4A 4NQEE 3OKLA 3EOBA 3ZE1F 1E4XL 4GKSA 2DI8A 3TA3C 4I18C 3LKNB 3OF6D 2C4FT 5DK2A 2VLRB 3MOBL 3N1QC 5I73C 1F58H 4X8JA 3S4SA 3HG1B 5EU4B 4RQQB 3FB7B 5LGHH 4NWUH 3MLTA 3IFPA 4GH7B 5C0CB 4JO2H 1VEPA 1IZJA 3GHEL 3A6CL 3C60D 1GC1C 1EMTH 1S9KC 3SDAC 1MCNA 3F65A 4OAWA 3P0VL 4CUCA 2XZAL 1UENA 5GJTH 3WNMA 4XNZC 4F7MA 3C5SB 2QHRL 3RIFK 2E6PA 4XMLL 4FQLH 3KNBB 4OGYL 5DUBA 5J9PA 2ZNWA 3LS4L 3MRMA 5K59E 4FXKB 3LSOA 4NQCB 5CLTA 2IAMD 2XTLA 3OJ2C 4GW1B 2OSLB 1CGTA 5GRJH 3T77B 4NBYB 1Q0XL 3HE7C 2FNBA 4LLMA 5F97E 3QIWC 3BUYB 1BQHA 2X4UA 3GGWB 1IEHA 1GZQB 4NDMB 1NGPL 4HKJA 4RGMC 1UC6A 1S7WA 4UUJB 4DUXA 2J4WH 3D48R 4PGDB 3T0EE 3KS0H 1LEGB 3CFJA 3DO7A 3VG9B 4HKBB 2E8ZA 5D6DA 1F11A 4KZEL 5C6TL 3IDUA 2O5XH 3SO3C 5CJQL 5ILTL 4NC0B 3RIFF 1IBGH 5CZVH 5E70A 4HGMA 1BFOA 5IHBA 2OM5A 5DFVD 2D03H 5FA3B 3M07A 5D2LE 5D9SA 2J8UA 1YPZF 1G7HB 3CDGA 3KPSA 1RZIA 3SOBL 1S3KH 5EULV 1JPSL 5FIEA 1G7IA 3D3VD 2QL1A 5T5NG 1UJ3B 5DHYB 5IVXE 1R0AH 2B0SL 1QR1B 3T09A 2UWEB 4R6UA 5E2TL 3MNZB 4WU7A 4JJ5B 3EJYD 2BC4B 3EYVA 3G5XA 2H32H 4JRYD 2PYFA 2EE3A 3HE6D 3QIBB 4GAJH 1I8IA 1JZ2A 1RURH 5AD0A 1G9MC 4RRPG 4LLVA 3L5XH 4KY1H 3LD8C 4U2YA 1HSAB 1A7RL 2E7MA 5E99L 2ENYA 3DOSA 4Y5YA 1HXMA 5DVMA 4MJIA 2AK4E 4YH6A 1F6LL 2JB6B 5GSVB 4CU6A 3GB7A 1M05B 3GMRA 3GSNA 3MTRA 3OB8A 1U2CA 5FO7B 1SY6A 2J3SA 1RJYA 3DVNB 4U31A 4RIRB 4JFFE 3KYAA 4N9OB 2ZJSH 1MLCA 5DHVB 2PYEE 8CGTA 2WIIB 3F7PC 3UAJC 1XCQA 1GC1H 1KFAH 3ZZ1A 3QA3A 1P4IH 4PJ9A 4RMQA 5IKCA 3SPVB 2X4QB 3CXDH 2YPLD 2GSIB 1OAKL 4GLRI 3DV4B 1SBSH 3PWNB 2HA1A 5HY9B 4XMPL 3T0AA 2J5LC 4FNLH 1D6EA 3QEGH 3LIZL 2GSGB 5EZLA 3T4YB 3K4AA 1S7RA 3KXFD 5EZJA 3NIFE 3FOLA 4RMRA 4FQLL 3JV4A 2VR4A 4KJWD 1NCDL 3SQBA 1REIA 5EO9B 1DQDL 5GGUA 4F2MA 2HFEB 3WXWH 3MLRL 4KJPD 1BJMA 1JWSA 1G7LB 4F7CB 4H0HB 4KZDL 3MRRA 1CN4A 4YIQA 5FYLD 1K4CB 3P77B 3EGSB 1ZLWH 4MNQB 5HHNB 3VXUA 2DTMH 2P24A 4MD5A 5DRZA 5HI3D 1HHIB 3O3EB 2OXHA 4YR6A 5LGJA 2ERJC 5JW3L 2R4SL 4JY6B 4JKPH 5KSUB 2F74A 4Z0XA 1AIFA 4ZSOA 4WHDA 1JTOA 4KWUA 1JPSH 1E6OL 4UOJA 3LHPL 4UU9A 4YDIH 1C5BH 4OZHA 3KLAB 2B4CL 4LSDA 1T1WA 2HKHH 2JJTC 3TNMB 4QLRA 1VEOA 2X4OB 4O2FB 5GGVH 5BS0B 3ZDXF 1QLEH 4NQCE 5HPMA 3TJHC 3ULVC 3VFPA 1IQDB 1KBGL 1T66C 2V5RA 1HHGB 5ACZA 1T0MA 2X89D 3O3BA 5DJDA 3U9UB 3ARBA 4CVZB 3B2VH 2V5MA 1SQ2N 2OMBA 3OHXA 4NZJA 3BDYH 5I8EB 43C9B 4CKVX 2WK2A 1KJVB 1NANI 4XXCC 4E42B 3WIHA 3VXOB 1SYSA 4IOFC 3U7YH 1HIMH 2EXYD 3EYUL 4LLWB 5LKNA 1TVBA 2Q20A 5IBUG 2NY2B 4F15B 4APQD 3UTPD 3JV6B 3JZ7A 4ERSH 2AABL 1PZUB 3MRQA 1XCQB 1F3JB 4HIIA 2P48B 1XIWD 3B3IA 3MRDA 4Y19E 3VXPB 4Z7UB 1EEZB 5D2NC 3V0WH 5JUEL 4H1LB 4K23L 1B0GA 2VDKL 4QRQA 3ZLQC 3DVNA 1J7VR 5CFHA 5TDNB 5T5FL 4M6ML 5AAMA 2DQEL 3O4LE 1YMMA 2HLFD 2F8XC 3D9AH 1PKQE 1C08A 3DVFA 3O6MH 1JGVH 1QYGL 3C5ZA 4S0SD 3C2AH 5EUKA 3SKUD 1FV1A 1IGIL 3UMTA 4FRWA 3BWUC 1GPOL 2V6HA 1YDPB 2YA0A 2VQTA 3B9EA 3WKMH 5DDHA 1ZA3A 3BVNB 4BQ6A 4JPVL 2JTDA 2IQ9H 3QEQD 1I7UA 4L4VD 1B4RA 2WWMC 3RVXC 4YHML 3O2WL 4BQ8A 1WWCA 3N85L 5ICZA 2H8PB 1AXTH 5FOBA 3RA7H 4DKFL 2NY1B 5F96H 3V5KA 4OCWH 3MV8E 3MJ9L 4R8WL 4EOWL 4HUVB 3I3EA 3L3JA 1A6ZB 3RTQA 1RUKL 3NZHH 3W0WD 4BYHA 2MPAL 3X11B 3P0YL 4RISH 1ZXQA 5FO9B 3EYQC 3U4AA 5LQBL 1U8OA 3FB5B 5DQDH 5KSVA 1ACZA 5J11C 2VAAB 3OAYH 2IGFL 2BCKA 2P43B 4IOSD 5D6CA 1W2KT 5CD3B 3TF7C 2BOBA 2Z91B 4YO0A 4X9FA 3NA9L 5F8QC 1YQVH 3ZE2F 4KK5C 5DFTA 1HH9A 3TJEH 1H3VA 3QQ4A 1FJ1A 4EN3D 2OLDA 4P23D 3NABL 1IGCH 1MCCA 1ACYH 5K9OA 4HS6B 1M6OB 1MFAL 4ZTPH 1DZBA 3MRMB 5BS0E 3CMGA 1MCBA 1MF2L 3C2SA 3T2PA 1EIBA 4Y4KC 4YGAB 4EI5C 1XIWC 4XC1H 1CE6B 1VSCA 1UKTA 5TQ0L 1FNGB 4NJAL 2GJ6B 4HS3A 2Y36L 4S11A 3DSFL 3L3KA 3WE6B 1HXYB 2YK1H 5DTFA 3ZT5A 2P47B 1JHTA 4OCYH 1KCLA 3ESUF 1F97A 1CGUA 3NCYP 4L4JA 3LKQB 3SE8L 2ICEA 3VMPA 1WZ1L 3MREA 5C0AB 1IKFH 1TPXB 4F2MB 2HTKC 2GCYA 4JZNA 5GHWL 2X41A 3KPLB 1NJ9A 1I8LA 1FORL 5D7SL 4GAGL 5I1LA 1UEYA 2V17H 3BPNB 4GUPB 1FL5A 1HI6A 4ZSOB 1JVKA 3FB6B 3HZKA 1JGLL 3QRGL 4JO4L 4TVSa 3V4UH 5EUOF 2PXYA 1CL7I 3QCVL 3UTZB 5BQ7A 1OPGH 3WL9A 1I4FB 4JKLA 4M43L 1KIUA 5E6YA 5J1AB 2JCCA 2FBOJ 1X5GA 5KOVC 4HKXA 5D7IB 12E8H 3M1BA 4NYLB 1NC2D 2EXYC 1ZA6B 3VWKB 1DQQB 1OSZB 4JM2A 1XGUB 4NQDB 2BRQA 1YY8A 3VG0H 4PS4H 3MRNA 4Q74A 1OTSD 3VCLB 15C8L 5IFJB 2BNUA 3IDXL 3GBNL 4IJ3B 5F1NA 1AJ7L 3FFCD 1T0MB 1HHKA 1KULA 2BNQB 2Y23A 3CSYB 4NWUL 5CBEB 4YXHH 3FN0L 4X99B 1HKLH 5C0CE 5F9JB 2WUBH 3FTGB 3CFBB 2JE8A 4P3CH 5DRNA 5DD0L 1NKOA 2ADFH 4ZAKD 1HHHA 5HGDA 3NA4A 5C6WH 4J2XA 3HMXL 4K8RL 1U8MA 3P4NA 2MPAH 3OKEA 3UJTH 1NGXB 4QTHB 1P7QB 3JV4B 4X6DE 3QDMA 4HWBH 4LLAA 4Q58C 1ZKAA 3MJ9H 4G9DA 4EOWH 3JV0A 1TJIH 4MDJA 2EYSA 4K9EL 1G0DA 5IHZB 4Y4FB 4F37K 1CICB 1TVDA 3MOAH 3PG2A 5E8DH 3QA3B 2G9HA 2BSRA 5EU6B 4K3DH 4XPFH 3LRSB 1FRGL 3JTSB 4KPHH 3ULUE 3SDXE 2AJYH 5MENE 4ALAH 4Y4KB 3PQYA 4W6WB 1OGAA 3KPTA 2VWEC 4AZ8A 5E08H 1K4DB 5KS9B 1GPOH 1RAMA 2P5EE 4LSTL 4ZUTB 1W0WB 5IWLA 1MNUL 2FIKB 1JYXA 1WIUA 1M7DB 3WNPA 4F7CA 2IALB 3MLZH 3BIBX 5GS1C 4FQJH 4P3CL 3BKCL 5GS2D 3TIDB 5KBNC 4XPBH 1J1PL 4L8SA 3H9SB 1QFHA 2VC2H 3MNVB 4D9LH 3C5JB 4OUUB 3W2DL 3GJFA 4LLYA 4J8RA 3FQXB 3LH2H 4L4VE 5HHOB 1JNLH 4FQHB 4U1IB 4U7SA 4XGZA 4NQED 3T3ME 4NQXA 4BH8B 4GG6B 2YRPA 5LBSL 4LVOB 1QNZH 2Q86A 2R8SH 3MX0A 5EB9A 1MRCL 2MKWA 5AD0B 2BC4A 2CDFA 2VXVL 5GGTL 2OTPA 3OR6B 3NFSL 1U8QB 1MJ7H 1NDGA 4ONFH 1I7UB 2DLHA 3O4OB 1R3IH 5GZOC 3W2DH 3EFFB 4X9GA 3PDGA 3OQ3B 3UTTD 5I1HL 4G6JL 5J12B 1BQSA 4NQDE 4YHLL 5KVEL 3LKPA 4GT7A 4PRBB 4HUUA 2CLRA 3JWNC 5DRNB 5GHWH 2PW2B 1G7HA 1NGZA 2I27N 4H25A 4EBQH 5JQ6L 5B3JF 3SJVA 5C0BB 4NQVA 1C08B 3FQRA 3RVUC 2D7MA 3TV3L 2FJGB 3KJ6L 2BVTA 5DC9B 3ZYIA 5IMMB 3ULUF 1BJ8A 4IJ3C 2R2EB 2PXYC 3P73B 4BUGA 2F15A 1LMKA 2Y9RT 4NZTL 3MBEB 4K3DL 4XPFL 4WEBH 5BS0D 3NGBB 4D0BA 4GKNA 1FIEA 1M71A 2D4DA 3MRDB 1C5DA 1U6AL 4J3TA 1MHPH 3MRBA 2ZUYA 1FNHA 3RL1A 4HPOH 5GS0C 4TSAL 5SWSE 2VDQL 2PN5A 2KZWA 1ORQA 5I73B 25C8L 2AEPL 2F54E 3CGTA 4JKPL 3CVHB 4YDLC 4RX4A 2W91A 2LTQC 4XCEA 5DQ9A 2E7LC 4QKXB 4EUPB 3WD5H 3S35H 1HCVA 2VLKB 5J3HC 3MREB 3ZKXB 3MA9H 4HMCA 5KJRL 1I1YB 1RHFA 5CP3H 4HC1A 4I9WE 4KZDH 4NNXB 4YNYA 3N9GL 5IK3B 5GRZA 3LKNA 4O2EB 1Q9KA 4HV8B 2L4OA 4PJFF 5GSRA 4DAGL 2DAVA 1IAIL 2OR9L 35C8H 3L3DB 3B8SA 5LWYH 1YEGH 4NCDA 4PP2B 1WCQA 1HHJA 2YPLB 3E2HB 4E41A 3MLYL 3OJVC 1WT5A 5LXGH 1JPTH 4M7JL 3RX5A 1LO0L 4ZTOH 5F3HB 4OCWL 2XN9E 1OW0A 4LRNH 5JIIA 2NNAB 1MRDH 4B50A 1F4WL 5I1CL 4WI4A 3F5WA 1OCWH 4OFYD 1KTKE 4DCQB 1DCLA 5TE6L 2A73A 1R3HA 4L4VB 5HHOE 4OAWB 2Y1VA 4KJQD 1E0OB 4NUGH 3OAYK 5FA4A 4Y8DC 4OFIA 1F6FB 3FAWA 5IMLA 2UZYB 5F1IB 4M7LH 3GJFK 1XGUA 2F5AH 3KWWB 4G9FD 4R7DA 1IFHH 2X1QA 3ILPB 1CFSB 2Z8SA 4YWGH 1UJ3C 1ZLVK 3IKKA 2XFXA 3E6FB 5GZNC 1EH9A 2R2HA 1A14L 4LSRL 2FHCA 4ODHL 3TBSA 2V2TB 2A2QT 1GIGL 3MFGB 3S35X 1Z3GL 5DSCA 4EUPH 3ARGA 4Q6IB 4X4YB 5FCUH 3RJQB 4LCUB 2GK0A 3UTSA 3ALWA 3VXRD 3G5VB 1PEWA 2R39A 5BVPL 2FEDC 4J3UA 4HFUL 3FO9B 3M8OL 2BVEA 3C9NA 1QFUL 3RVTD 4JZOB 5L7XH 1SEQL 5D93B 3VRJB 3RDTD 3BH8A 1J8HB 1OF2A 3VXSE 3I6GB 3L5JA 1FLRH 2C4XA 4IEFB 4LLDA 1KELL 4ZFFB 4Z7UE 1BOYA 1MCLA 3Q3GB 3PWPA 4LLYB 1INEL 4H20H 1F4YL 3BISA 5FUCC 4OLXH 3P11L 1J12A 2HMIC 5MP6L 1GIGH 3EIFA 3PL6C 3ZHLA 4YDLB 3B43A 3WHE0 2EIEA 5EPMB 4HS3B 3GSUB 3CZFB 3NACL 1UJTA 4HG4J 1P5VA 2X4NB 4Z18A 3MRLB 5B39G 2YR3A 1S9WA 1IT9L 1IL1A 3MV8B 3GO1H 1I85C 1JYNA 2B4CH 1JWUB 3E1F1 1RV6X 1H3WM 4EDXB 2CPCA 1NMAL 5EIIB 1J5OH 3O2WH 1SJEB 2AXGA 4XBPA 5IESH 2EDBA 1VFMA 5EN2A 4Y4FA 5IB5B 3RX8A 3HE7D 1IILE 5EU5B 5F7HA 1R3KA 1FVCA 4NKIL 3TT1H 4Y2OA 3G6JB 3O2DA 3MZTA 3FB5A 5T1LA 2DKUA 5BV7B 1LHZA 3MYJA 4O9HH 4WW1B 5CJOL 3VFGH 4GQ9H 4JHAH 1JUFA 2RJMA 2AXJA 1DBAH 4Z7OF 3EZJB 4NOFA 4TUJA 3KHOA 3RGVA 3T0DA 4LEXH 2R2HB 1ZLVH 1P7HL 2X4PA 1JGEB 5C6PB 1T2QH 3MLRH 4CVXA 4IIQC 1W8NA 3FFDA 4ZFZB 3DBXA 1K8DA 3BIKA 5F9WB 3T0XA 2CK2A 4UUJA 2VH5L 1BVKA 5CJOH 1BQLL 2AABH 4RFNC 1B3JA 4YC2C 1YY8B 3VH8G 1G9NL 5DGQA 2AKRB 4R9HA 4F9LC 2XNAB 2AEPH 2PYED 5CEZH 3FRPG 2MHAA 2FATH 4OD2A 3PWLA 1JWMB 2CDGB 5TE7H 3VFVA 4Y5VA 2R29H 1Y18A 3C5ZB 1DUZA 4FQ1H 2OZ4L 3UTOA 3QUYA 4O2CA 4IMLB 4HIXH 2ZOKB 1L7TL 3UYPA 2YPLE 5F7MC 4JHWH 5TGBB 3HAEG 5C0JA 2AJSL 3MR9A 4APQC 1OAZH 4J1UB 1MUJB 1GC1L 5HVGB 3VXTA 2CO6B 5JR1H 2EYTB 2UYLA 4JQXC 4G80A 2B7DT 4FZEH 4PGBA 1N7ML 1U91B 5DZLA 2GAZB 1QR4A 4L3CB 3BFOA 5D7KD 3EO0A 5JR1L 2OMNA 1AR1C 5DD1L 3BD3A 4BZYA 1OAYH 5T3ZD 1GVIA 5CGMA 1I1FA 3H6JA 2AJXL 3QBTB 1RJLA 3SKNB 4LHJB 5E2WL 1CL7H 4UT9L 1NFDA 4ZDHA 5CEZD 3UYOD 5KVGL 2AXHA 2OZ4H 5I1HH 4X8XA 2YPVL 4YHNA 4QHKJ 4XPGH 3EUUA 4BZ2H 1A5FL 3LAFA 4LAJH 4R0LB 3MRPA 1FPTL 3GNMH 1Q9WB 4U1SB 3EYSH 1U9KA 4ZYKB 4GW5B 3CFDB 1A8JH 4KJWC 3V95A 5IBTL 1ZGLP 2OL3H 1E4WL 3ZHDA 4L3CA 4EI5D 3KYOB 5EZOH 4ELKA 1RFDL 3RY6A 2A9MH 2VXTH 1OT2A 5T1KD 3QDGE 4KI1A 4M5ZL 1UCBH 1KC5L 4NSKB 1IGTA 5I1EL 1KN2L 3GSUA 1A14H 4R4BA 4YFDB 3ZTJG 2CKNA 2APWA 3ZKMC 2Z91A 4L8CA 5F70A 2R9HC 3UPRA 3MJ9A 1RU9H 5DK0B 3K8LA 2Q6WB 1AC0A 1ZTXH 3HFMH 3MLSL 1INQA 4PJIA 3ROLA 1UH4A 2NCMA 2CLRB 1HWHB 5CKAA 4KUZH 2DMKA 4W6YB 2RB8A 2L7JA 5C0AD 4AH2A 3IRPX 1Q0XH 1VESA 4HK0B 4PJBA 4OGAD 3R4DA 5JDJA 2BHZA 2D7QA 4ZXBC 3RWCA 3WEXA 4U1HB 5TE4H 3CLEH 1FNEA 2C7UA 3LKRB 4NRXA 4XX1E 3VGHA 4LQ1A 2R56L 1GGCH 4LSUH 4UB0L 3S34L 3VRLE 1DSFL 4JFDA 1MEXL 2DQFA 1EO5A 4XBEL 4GG6A 1CFTA 3DX7B 1KT2A 4P46A 3RWEA 4HH9B 2MQ3A 4IIQA 1EHAA 4JY5L 4YHZL 3QFJD 3HPLA 2ADJA 4UAOC 4R7DB 2JCCF 4L3EA 1JF5A 4PLNC 3CNKA 4JFEA 3TIDA 4OZIB 4KTDL 4MA3B 4Z77B 2XKUA 3EYOB 5IBLC 1EDQA 1OAXL 4LAQL 1DBJH 4JFEE 3O2VL 1HKLL 3O3DB 3QI9C 4HBCH 5DD6A 4WI8A 4CDGC 1F58L 3SHSA 3SKJL 4Y16B 3EDDA 2FX9L 1RZJC 4R2GD 1EO7A 3LQZA 4XBGA 3GSWB 2UUDK 3HA0A 1FZJA 4BSWA 3LMJH 1DBKL 4JFDE 4XPAL 3PDOB 1UXSA 5BVPH 1IL1B 4TSBH 2OCFD 2AJZB 4PG2C 4WHTB 1ZLWK 2A77L 3MV9A 4XWGH 2KDGA 3WFBL 4PJ7E 4M43H 4E5XB 4LCCB 4PGJA 1FFOB 4LU5H 3E3QC 3QIUD 3MLUL 3T2NH 4Y5XA 2DWDA 2R1WB 5D2LF 3PWVA 4GRLC 5D1QD 2JB6A 2V7NB 5GSVA 5K9JL 4EI5B 1FORH 1TPXC 4YZFE 5I2IA 4Y2DD 2B1HH 3RX7A 3LKSA 3RVWC 3FOMB 3C08L 1MFEL 2DM2A 1PSKL 4PLKC 3HG1A 5EU4A 2FD6H 1KGCD 4PJDB 4WWKC 5H37G 1S7TB 5CSBA 4KMTH 1IEAA 1NGPH 5B39A 4HPYL 3H7BB 3BXNA 3I6KB 4GS7C 4K71C 4LNRB 2EKJA 2Z35A 4ZD3H 5I9QC 2QV2A 3GK8L 2XWBB 5JDSB 1IE5A 4QTIH 3FMGH 4G5ZL 1I3VA 2XYCA 4IMLA 2VSDA 3WO4C 4X0KA 4I2XE 2GY5A 4N8CH 1U92B 3WJJC 5AZ2H 4M7JH 4Y1AA 4LCYA 4X6BB 2K7QA 2VLRD 3AB0B 3FT4B 5ITBH 2XNAA 1KB5L 3ORJA 5CJXA 2OR9H 4JFOB 4ZXBB 1JNLL 1SJVA 3QQNA 4ZS6C 2ED8A 2FX9H 1NJ9B 2ZUSA 2UUDH 3ARSA 1GZQA 2V2XB 3GSQA 3HC0B 5KSBF 5DZOA 3VWKC 4JZJA 3CZFA 4M3KB 3QPQD 4OI8A 1I9JH 2Y07L 1I7TB 5IG7B 4X98B 2NZ9C 1BLNA 3X3GL 3B9KD 5I8OH 3T3PE 1J1XH 3PWPB 5EUOA 2CQVA 2BK8A 3B8YA 2AEQH 2UVEA 4RCAA 1MCOL 1RUKH 1YEEH 2HT2C 3HZMB 1U8HA 4TOYL 2IAMB 4Y16A 3QJFB 1IM9B 3RWGB 4QCIA 1C5CL 2M26A 3A6BH 2XWJB 3PHQB 4HKZB 3MOAL 4AENB 1FZMA 4I48A 1FL6B 1JPGA 3TIEA 5EU5A 1JYVA 2I5YH 2V2WA 1LGVA 3F7QA 4UDUB 5ADOL 4LBEB 1IM9A 2GK0B 4UTBL 2W9EL 3UTSB 2A0LC 3OZ9L 4M1CD 1ZVSB 4LVNB 3LKSB 4Z95L 4KXZH 1U8MB 4D94A 2P8PB 4NRZA 4QRPD 5CINH 1A47A 3D0LA 1J1XL 3HMXH 3DJ9A 4H8WC 3TFKD 1ZTXL 5ANME 3BH9A 3OKKB 4HUWB 2MCPH 5HVHB 1ORQB 3TYFA 3ARUA 1I85A 5A2JH 1FNEB 1FSKB 4MB3A 2RFXA 1IM9D 4C56B 4ZFOA 1MWAL 3HCVB 3G6AB 1YEFL 3RWJB 1OD7A 4EI6B 4YEEA 1A21A 5EU6A 4HIHB 3BD5A 4BSWB 3G5YB 3UPCA 3O9WD 2GY7B 4LCIL 5ISZD 1UWGH 1GOHA 4AEEA 1G7PA 2VXVH 3KPNB 3X12B 1D5ZB 1OF2B 3W9EA 4XMKL 5SX4I 4YHPB 4JDVB 1QFWI 4U1GB 3EYFA 4JZOA 4WTXA 3A67L 1II4E 2FEDD 2R1YB 3EKCA 4YDKH 2NY3B 3LKOA 4MNHB 1LK2A 4KQ3L 5D8JL 2YRLA 3WO3B 2AI0L 4DZBA 3VI3F 2PR4L 3ET9F 3C6SB 1CGWA 4AL8L 1RZIB 1JFQL 3QEUA 1WWWX 4IRSA 1UQSA 1R5WB 3LVEA 3AS3A 3WUZA 1I9IL 3LN9A 2VIRA 5C3TA 1KBGH 5MEND 4JN2B 2NX5A 3PABA 3HNVL 3HC3H 5JOFA 1FZKA 4L5FH 4Y1AD 3RKPA 3PP3H 4X6EA 1B0GB 2FLBT 4OM1H 1VGEL 3PWPE 3S5LA 1MFDL 4YDIL 2ATKA 3ULVD 5C07D 4G7VL 5CKGA 4NJAH 5AUMB 4FOMA 2P5WB 3CVHH 3ZKXC 3WFHA 2LVCA 3QYCA 1QBMH 1CD8A 3GSOA 3PUCA 4XNYH 3VFRA 3UTSE 1B0WA 2BRRH 3OXRA 4NSKA 4L8SC 5ETUA 3FONA 5FYJL 5GRVL 4JAMB 1YUHB 1EAPA 1G1CA 1Z0NA 5MI0C 1Y6NR 5ACZB 3NCEB 1WT5C 5C0BA 4ZUVB 4Z0BH 1K5NA 4GQPH 2I9TA 3V9FA 3U2SB 4GQ9L 1G7JB 1T89A 3FRUA 3K2UH 1DQJB 1FE8H 4HH8A 3ZYZA 4X5WB 1YN6B 3UAJD 2G2RB 4UINH 1V3MA 3TZVA 1I7ZB 1DVFD 5HI5C 3D18A 3X3FH 4MVBD 2VDRH 1FJ1B 4RNRB 2VXUL 3STBA 2YS4A 4FQHA 4U1IA 4CN6A 3G5YA 5HGBA 4JDTH 1N5YL 3TYGL 4KKAC 5JXAL 4P2RA 2UYLB 5DJ0A 2APFA 4MDIB 3VFNA 4HF5H 2C3HA 4P2OA 5I8KL 3BEWB 4OIBA 4X80L 3TYFB 4ZXBA 3F6LA 4QHKI 2ZJSL 3D9AL 1XF1A 4F58L 4Q97A 4N0UA 3WNKA 2JIXD 2D3VA 4AY0A 2I9LB 4M4RA 5MP6H 5MENB 5F7NC 2WUCH 5F44A 4EDXA 4Q7DA 2P8LA 1PDKA 5D7LD 2F58L 4XC1L 2UY7A 5JZ7C 5HYJE 1WEJH 5D93C 5ANMB 4TVPL 1MCWW 4PTTB 4UDUA 5FYJH 1JZ8A 5GGTA 1JNNH 1AO7E 1X4XA 5DVNA 4LMQI 4HUNB 4UZGA 5FK9B 4R0LA 5JLZA 1PY9A 3B83A 5JW4Q 3GNML 1AD9A 1LE9B 4LVHC 4NUJA 4PJCF 3WMSA 3K74B 4YHIB 3BKYH 4JN1L 5F1KC 1TCRB 4MLIA 4NGHL 3WHXA 4JFYB 1MFCL 2YXFA 4S2SA 3DUUA 3SEPA 3IAGC 2MJWA 1J8HA 1NAML 4RWYL 5HHME 4C56A 3OTTA 2P5WE 4OF0A 4NO3A 3P0YH 1IBGL 3DXAD 3L7FA 1MCJA 4F58H 2LV4A 1XGTA 5D1QB 1JRHI 3AREA 4NQEB 1HDMB 5KANG 3MR9B 4FQXD 1JZ5A 4F15C 3GJFH 4OJFH 1SYVA 4OGXL 3V6OE 4QT5A 1GGCL 1CT8A 3RA7L 1SBBA 2XI9A 1L7TH 5EORL 3TH3T 3TBSB 3KPQA 1FIGH 1Y18B 3NCBB 5DJCB 3VMOA 5BV7C 5JXEC 4IDJH 1T1YB 3UJJH 4F8QA 1XR8A 4BFBD 3UBXB 4G8GB 1T7YA 1U8NA 4DN3L 4FXGB 1C7SA 2ARJB 1XF4A 1XF2B 4LQFL 3QUYC 4KUZL 2YKLH 4K2UL 3P40A 4M8VA 5JW3H 3BPLC 2WANA 3DX8A 2I24N 3C2AL 3C09B 3MLYH 3QH3B 1X9QA 5LXGL 1LDSA 3RRQA 4PGZA 3RWEB 2K9UA 4Z78A 4G43B 5K93A 1NAKL 5IQ7L 1IARB 1EMTL 5ACLA 1KC5H 5I1EH 3C6LC 3N9GH 4MQXD 4NPYA 4RAHA 1AGCA 4YHKH 4BQ9A 1TQCC 3RTQC 3QUYD 5CCKH 1EEYB 4QOKA 4JFXB 2E8YA 2G5RA 2FHFA 2P44B 4FFWC 3ULVE 4PTTA 3QNZA 1E4KC 3RFZC 4LCUA 3EOYG 3BKMH 3QAZC 1YYLH 4K2UH 2WWKT 5EA0L 3M17A 4O00A 3HI1A 4LKCB 4O2EA 3BPOB 5EO1B 3TH4T 3BZEA 5DEGB 2EIZA 2VO5A 3OKNA 1IAOA 3ZE2E 1R6VA 3TNNA 1NCAH 1T22B 5E2VL 1BZ9A 5M95B 4OF7A 1H5BC 4QT5B 1H3PL 4DZ8A 5F71A 1ZLUK 3GIVB 3GMPA 2FB4L 3NN8B 1B88A 5D1ZC 2LE9A 5CHNA 1Q0YH 3O6FD 3VFWA 4MAYA 4KK8D 5E24E 5J6GA 2OYPA 4NZUH 2XQYK 4JFHE 4ZPVB 4XNQB 3TVMB 3RNKB 3PJSA 3HRPA 2Q7NA 5C0CA 1I7ZA 1P4LB 5DMKA 3W39B 3OBAA 1V3KA 1HXMB 3B5TA 5E2UL 3AY4C 2E6JA 4XX1G 3V5DA 4FQ1L 2AI0H 5DRXB 4PJAB 3O6FC 4XP5H 1ERNA 1B9ZA 3DHJA 1R24A 4JRWA 2F8OA 3PWNA 2FHBA 4R2GC 1XGRB 3ZE1E 2ESVB 2B20A 1ZS8B 4PGEA 2PYFB 4LIQE 3FQRB 1NC4A 1JPFB 1VFBA 2HVJB 2D9QB 4KHXH 4Y4HA 5I1DB 1M7XA 1KACB 5BRZA 1EBPA 1F4AA 3MYZA 2BMKA 5JA8B 3QXAB 3RIAF 1S3KL 4CJ1A 1ZHKB 3U7WH 4HGWA 5I8CB 1DL7L 4LCWA 5E03A 5ALBL 3FMGL 1WUNT 4BK5A 3V7AG 3MLWH 4LKXB 2M2DA 2A6KB 4F3FB 4P3DB 2DICA 3GMRB 3KVQA 3EFDL 2IPKA 4ZD3L 3BPNC 4OQ1A 4P2OB 3WFZA 4LIQH 4S1SH 3SQOH 4CDHA 2EH7H 3MRHA 5IOPA 3S36X 2ZSVB 2QADB 4WVRA 5HHQA 4Z0XB 4DK6A 1C12A 4X5XB 2PF6A 5CINL 3T65A 3B3IB 1W8OA 1AQKL 2ZKHL 3PDDA 1AO7D 3C6LB 4Z95H 3FQXA 3WV0A 5E6IB 4N0YL 1FBIL 3OZ9H 3VFUA 3WNOA 2BHUA 4JJ5A 3L95A 4OLYL 5FYJE 2HLFC 2J88H 1OTUC 3G04B 3MBED 4JFQA 2IMMA 4WJ5A 4YHNB 5IV2A 4UAOB 3OKDB 5TQ2L 1KYOK 4KK8C 1WWBX 4TOYH 1CR9L 1HOCB 4QHNB 4FQPA 4N68A 3NACH 4M1DH 4XZUB 4HT1H 3SDDC 3O9WA 4OZGF 2WWMD 4NQDD 1ES0A 2RBLA 3EO0B 4M62L 3IYLW 3ARVA 2IG2L 4NFDA 3OWEA 3LEVH 2OTUA 1T89C 4N9GA 4C56E 3KJ4C 3MZGB 2O5YL 3DV4A 5DJCA 2DBLL 4MA8L 3H42L 3QUXD 5SWZD 2ZG3A 5HHXH 1OP9A 5GQBA 4H5SB 1XZ0A 3MRQB 2QSQA 5DS8A 5FYKH 2EDFA 1Q1JH 12E8L 4B7IA 3WCYA 1J86A 1HINH 4U1SA 5GZOD 1MEXH 1ND0B 2D7OA 1PG7L 2DOCA 3BX7C 4GRMB 1Z3GH 2ICWB 3NOIA 1OLLA 4MAYB 3VXOA 1EAJA 1K8IA 4KK9C 1CGYA 3DUUB 2E9IA 2VKWA 3UO1L 3RVUD 3HNSH 3PL6A 2EIDA 5IJKC 5E8NB 4POYA 1WCBA 4L5FL 3P9LA 1OOAA 4P3WA 3REWB 3D3VE 2H26B 3MGTB 5DO2D 1PKQA 4Y4KD 2XQBL 2BJMH 4LBEA 3BZEB 1QPPA 4P5MA 2VLJA 4NFBA 3WIHH 1KPUB 1EX0A 2B1HL 4PJXB 5FM5O 4Y19B 3K4DA 1EVTC 4NO5B 1ZHNB 2X4RB 4PV8A 4QHUA 4HX1A 3AB0C 3JTTB 1GZPA 4S1QL 3CFKB 2PW1B 5CP7A 4RA0C 1NBYB 4XB7A 1CLYL 3IFNL 4D8PA 2XFXB 3E6FA 4JFZL 4XWGL 2QHRH 2ZSWA 5AWNL 5MEOA 3I75B 3U36B 3WS6C 3TWCL 4G42B 1I8KB 3P0VH 2GT9A 1B6DA 1MJUL 2NY5C 1ZLSL 5KTEH 1S9YB 5FYLL 2JJWA 4PGCA 1OSPH 3I3DA 3H42H 1YEIH 5TFSL 1MWAH 2X1WL 4WU5B 1FVDA 1H8OA 1KCRL 4XPBL 3BHBA 4G42A 3UX9B 1JGEA 1RQ5A 1DBJL 4M03A 1KUMA 3P30H 2VXQL 2HRPL 4M62H 4HLZG 4NQCA 3I9GL 5C71A 3EOAA 1IAKB 5CP7B 3QPXL 1O7SA 3QDJE 5BV7H 4M1DL 5FXCH 3QDGB 4OGAC 2W0LA 4KJYB 4KTEL 4YFEA 1IEBA 3FRUB 2E7BA 4XI5D 1K85A 2AJUH 3F62A 5K9KB 4LNRA 5D1QA 2PCPB 1QHOA 1D6EB 4RFOL 4OZIE 1NCCL 1LILA 4ZSOE 4IRJB 3MUY1 2R56H 1AXTL 5F93C 4K9EH 2Q3AA 5DURD 3P9MA 3R1GH 1NLDL 3ARDD 3IAPA 3MV9D 3CX5K 4LDLB 2FX8L 5E8NA 4M7KH 3UBXI 4NM4H 5JORA 1F4HA 1YPZA 3TV3H 1G9NH 5F7EH 2HLAA 3GMQA 4EBQL 5JQ6H 1JGVL 1QYGH 4LVNC 5D7IF 3WIFA 1U8PB 4M61A 5DD0H 1VKXB 4OCNC 3L95B 5C8JB 5K9QI 1UKQA 4L1DA 2AV1B 2IBZX 5D1XB 1DJSA 5J06A 5KG9B 5D72L 2ATKB 2GUOB 1MCFA 1HSAA 2VB5A 4Q6YA 2GW5A 3O8XB 5L6YL 1NCNA 1TITA 2W07A 3FT3A 5ESAA 5CBAB 2QJDA 1YMMB 5IMMA 5CUSH 4MX7B 1LNUB 4HJ0C 4E0RA 3MJ8A 3BEWA 3N1MC 3U82B 4QTIL 2VZSA 1F45A 4KRPC 2NY4B 4M61B 3VJ6A 4AM0A 3B4NA 5CGTA 4QXGH 4MXQC 2C1PA 3X11A 5IB3B 1LE5B 2GHWB 4K07A 3NFNB 3H9HB 1OP5H 4ORGA 3TBWB 5IJVA 4U1JB 5DR5L 1G6RB 4FFVD 3RWIB 4Z76A 5BW7C 5IIEB 4JPKH 2DJUA 1Q9WA 4MA1B 5FKAB 4I1NB 4AEHH 3VGAB 5E08L 3KPMA 2ESVA 3P9MB 4P48A 3WNLA 1GYAA 2DI9A 3MPCA 3F7VB 4R7NB 5DVKA 5BJTA 3G08A 5AYUH 1QUNA 1MQKL 1U3ZA 2AK4A 4PLKD 3U48A 5DRXA 5J0BA 3VFTA 5GRXG 1ND0A 2ILLA 3VW3L 1AGFB 4RWHA 1KEGL 3MJGX 4FFYH 3RWJA 1TETH 1NCAL 2EE9A 2DLIA 4BFIB 4K7FA 5MEQA 4JN1H 4KDTA 1P4BH 5EOCH 2P8MB 3IXAA 3V6FB 3UJTL 3JVGA 4HGKC 2ZCKH 2IALA 4CRPA 1QSED 5KW9H 4JM4H 4QRQB 1BQLH 3RBGA 4D0CB 4L9LC 4X6DB 1UKSA 3KPSE 3PXHA 4TVPH 3K2MC 3TP4A 2J8UE 3GHBL 3FN0H 4R97C 4OZFH 4YQXH 3X14A 2G9HB 2CSPA 2IG2H 3IDXH 5C07B 4U1MB 4DUWA 2A6DA 1H15B 1YNLH 4YJZL 2R1XA 4XAKD 1QRNA 3GMOB 4OLEA 4PJEE 4Y5VC 1DBAL 2H3NA 1FG2B 1IKNA 1IFHL 4YDVA 2MSPA 2VOTA 4GKSB 4M7LL 5KS9E 2DMCA 1OLZA 1NGXA 3LQAC 1FZKB 4NUGL 1CLOL 3MUGA 1F00I 4DW2H 1B0RB 1KJMB 3WIIL 4LSUL 4UB0H 1A7NL 4Y1AE 5BZWB 3QWRD 3HLAB 2X4PB 3W0WE 5TE4L 2BVPA 3TN0A 2HJFB 3QUZB 4FXLA 4M6OL 5HVFB 4WY7L 1GSMA 2BXZA 3K1KC 1EJOL 4AG4L 3C6LA 3DYOA 4N0YH 3AY4A 4X99A 4ISVB 3SGKC 4M7ZB 5DRWB 2FZ3A 5J6GB 5F6HJ 2EE6A 2Z92A 3VJ6B 3FOMA 2GITB 2Z8VC 4MJ2A 1ZGLA 3VCLA 4MHHG 4U1KB 3C8HA 1MFBL 4QRUA 2WIMA 5C0DA 1OTUD 2X9XA 5E8EB 3V52H 6CGTA 4GXVL 4F7PA 3HG1E 1AP2A 2JCCB 1JWMA 4P5KA 3WDHA 1C16B 4P5TC 2JJSA 4PRBA 1YN7B 5DJAB 5H94B 2IH3B 3C5ZC 2VR9A 5JO5A 3DX6A 4LVHB 3QEQA 1D3CA 2FJFA 1KJ2A 3Q0HA 3BDXA 3OXSA 5HYSG 3MQIA 3AS0A 3S88H 3MXWL 3S96B 1RURL 1EFXA 5EPMA 4YAQB 3NABH 4GAJL 1VADB 4QRPB 4ONOA 1TTUA 3GBMH 1X6LA 5CJBA 4S2SB 1YMMD 3JWDC 1JMXA 4DWHA 3OKEB 3LDBC 3BO8A 4PB0H 4FFZL 3SKNA 1IGJA 4M3JA 5HGHA 1MJ8H 4UT9H 5J1SC 4I0KA 1NFIB 2XY2A 4YDJA 3VH8A 1UG9A 2ICWI 3D6GA 4LCWD 3QUML 2NYYD 3SCMB 4XXCA 5FB8A 1RJCA 3VFPB 2JELL 3FB8B 1BX2B 4DN4L 4OGZA 2YN5A 2VDOH 4X6DF 5F1NB 4L3EE 1ZAGA 5C6TH 3OXSB 2C3XA 3FT2B 4DVRL 4X80H 5I71C 5E4IA 3SDCB 2D0GA 1IGFH 2X4SA 1Y6KR 5JOPD 3MRNB 4KJYA 4HMEA 2XG5A 2VLKE 4POZD 5MHSE 1A7QL 3TYGH 1WIOA 4UV7H 2E7HA 4KTYA 4IOIA 5I15L 2UWEE 5C07E 1F3DH 3QZWG 3VXMB 4P5KB 1S7SB 2IADA 1GH7A 1EA9C 5C0CD 4PJDE 4PJBE 3PIQB 1CTNA 3OKYA 2CK0L 4W4OC 4X7CC 1Z0MA 2HFFB 4GFTB 4PJIF 3VXRA 1TQCB 2HFGL 4JFYA 2DQJL 3MROA 2BY3A 3RTQB 5HDQL 3TCXA 5GRUH 3HR5B 3IFOB 3F5WB 5F9OL 1G7QA 4M7ZC 5I1GL 4LSPL 2HFEA 1NBYA 1CBVL 4BUHA 5D7JB 3LZFL 2NW2B 4P23C 1PG7X 1LK3H 4WUKL 2DQJH 1GGYA 2MCPL 5E9DD 1KJ2B 2BRRL 5M94B 3TZVC 2IH3A 2YKLL 3U4EB 2AK4B 1IRAY 5HYJB 1U8KB 4OZFA 4JRYE 3T2OA 4TNWK 2GJZB 3EYQD 2R0LL 1QFWL 1AO7B 3C6LD 3IJHA 3UJJL 5I15H 3KDMB 1N2RA 1ZT1A 4OLVL 4UDTB 4Y2DB 4YX2H 3TN0D 3UPAA 2EDEA 3B9KB 4ELME 3B6SB 4OZ4B 4PRPD 4QRUB 2OL3B 4LLQA 4OLUH 4XPHL 3ZDZF 3W9DA 1T7WA 1W72A 1T0NB 1N26A 5BXFA 4H1LA 1C5CH 3L3GB 3HAEH 2AK4D 1BVLB 4MNGB 2FR4A 1DUYB 1F02I 5B21A 4FP8H 1QQDB 4LLMB 1KIRB 4P4RB 2H32B 4M93B 2XTJB 4FG6C 3O41B 2PTTB 4PJBF 2AJZA 4Z5RA 4PFEA 4MB4A 3NPZB 1PW3A 3Q3GA 2LAAA 1RIVL 3C8KA 2PNDA 1N6UA 3SKOA 2EC8A 2MQ0A 3CDCA 2B2XL 2EEAA 1BGXH 5CWSB 4ZUWA 4YXHL 5IR1B 3AFLA 4LGPB 1AGFA 2YPLA 2F53B 1A02N 5T5NF 2X5PA 1RZGA 3WN5B 2VLMD 1BJ1H 2CMRL 2QSCH 4ZOCA 3UTTE 1CWVA 2CKBL 2NX5B 1NCUA 1QSEA 1T83C 1TQBC 3M8OH 3BW9A 2A83A 4NO2A 4PG9B 3RWIA 1Q94A 2ITCA 5DVOA 5CAYB 5IW6A 1NL0H 5FFLA 2X1XR 1HQ4A 4OQTH 5CSGA 1ZA3B 3BVNA 3NZ8A 1AXSB 4EN3B 3GI8H 2WINB 1UWGL 3NFNA 3D0VA 3D2UB 4JAMA 5I74B 4C56D 4ODSL 4TUJB 4XWOC 3H7LA 4BFGA 5I9QB 5SWZE 1NFKA 4FQ2H 4WWID 1UA6H 2R1YA 5IB4B 1IAIM 2NY4D 2C1OA 5I75B 3VXSD 4FHBD 1AGDB 3GGWA 4Y7MA 5FYLE 2BJML 3RQ3A 5FUZH 1JMZA 5IVZA 4L8BB 2DQGH 1NCBL 1SHMA 4N8VG 2NR6D 5B8CA 2ZG1A 2X7LA 3MLUH 1D9KB 3O2DL 3U0PA 3GMLB 3QDAA 5EOCJ 1FAKT 5DT1H 1DQJA 1CQYA 4F7MB 1RULL 3T04D 4NHUA 5HGGS 5I6XB 4YFLF 1JIBA 3S36L 2ORBH 4WIQA 2HLAB 3KXFE 2H6PB 5I0DA 5I66A 2FGWH 3B2UD 4Y4HB 2MCG1 5I1DA 4YNYB 2C9AA 3L7EA 4NQCD 1KLGA 3VE0B 1B4JL 2A83B 3PWUB 4J7RA 1UWEL 5JOPE 1DE4A 2IJ0C 1JPGB 4JG0L 3WDJA 1UWXK 5E99H 4LAQH 2ARJQ 3TZVD 3GDBA 3BMVA 4TN9A 2NZ9D 3DX9B 4Z7UA 2A74B 4LOUD 4S1DD 2Q7YA 3IJSA 2GUOA 4RISL 1JWUA 1G0XA 1V3LA 5HDLA 1N64L 3VXSA 3O11A 3FQTB 4MD0B 25C8H 2YZ8A 1V7ML 5F6HI 3FL7A 2VNCA 5DHVA 3D39D 2LQRA 43CAA 5CBEA 4HZLB 1HHKB 1MHPL 1WZLA 3WN5C 4NCC1 2X4TB 4MJ5A 5CMAA 3KGRA 4OLYH 3CLEL 3RNQA 3U7AA 5HVHC 4LARL 1TQBB 3MLVH 5FYJD 5C0JB 4AJ0A 1I3RA 4RMUA 3VG9C 5CJQH 4F37F 4P0DA 3OF6A 4U6VH 4MAYC 3W5NA 4AEHL 4Z7NF 2CKBA 3OB0H 1J05B 3SE8H 3IDGB 2WAHA 3ULSB 3BYYA 4NC2B 1VB9A 4MDJB 5E6ZA 5CIPH 5FKPB 3ZL4L 1JBJA 3O8XD 5A16A 1D5XA 1GZPB 1TTFA 3BESR 2FLRT 5HDBE 1PLGL 1EZVY 1LEIB 3HZVB 2Y5TB 4Y88A 5J6HA 1BFSA 4JM2D 2VXSL 3BSZL 3D0VB 1VFUA 4F8TA 1JI2A 1MF2H 2NX5D 1JN6B 2KZ1B 3NAAL 2JJVA 1F6AA 1U93A 4L4TA 1MREL 3VWJC 3ABZA 3JVGC 3LN4B 3NH7H 3QUXA 4PRPA 3SO5A 2NY3D 1R5IB 2ICWA 5JNYB 2P4AB 1L0QA 2WP3T 5JOEA 2ARJA 1U8IA 4JQVA 1R3LA 3DYPA 3RVTC 2H2SD 4JKMA 4TSCH 3ZDYF 1JV5A 4WJ5B 3NTCH 1XR8B 4CVUA 3B2VL 1G7LA 5A2KH 3GZKA 2AQ1A 5I1AB 1L7IH 2QQKL 1CS6A 5FGRA 4Y4KA 4PP1C 4MD0A 4NBZB 5J8OA 2F19L 5ISZA 3WFEL 5E8PB 3QG7H 4K94H 4HCRA 2YEZB 5EU6D 4HWZB 1RD6A 4ZFOL 4PJ5D 4JPWL 4MJ4A 4WU7B 4HIXL 3WFEH 3WUWA 3R0NA 3BJLA 4I2XB 4OF8A 3IDIA 5T3ZL 3GSVA 3T08A 5HDBF 5FUOH 5EA0H 4DVBB 3QO0A 1YYLL 1ED3B 4QRPA 1AXSA 1PJ9A 4EN3A 1I7RB 5F7UA 5DJ2A 4JFQB 3O6ML 4QWWD 1Z5LB 1FFOA 4H1LH 3VFMA 1F11B 2DWEA 3TLRA 3SJVE 4DOHE 2D7TL 1WAAE 3B2UC 3ZTNL 3JWOH 1L9MA 3ARDC 3KYMB 2YUVA 3GRWH 5ENWB 5B8CB 4NQDA 3SDAD 5DSCB 1YN7A 5DJAA 5SV3A 4O5LH 1NAKH 4JDZB 1ZLSH 1RFDH 1MWAB 2HMID 4UT6H 1IC4H 1JGDA 5HYQB 4Y4HD 4XCYB 5TF1H 1KB9K 3Q6GH 2NY0C 3V4VH 4JRXB 4M1GL 3D85A 3CVIH 2NY6C 3AU1A 2EEDA 1OPGL 1BD2A 3BQUC 4OLWH 5FUCE 1FCCA 1GGTA 5AAWA 5DUPL 4KAQH 5LVEA 3QRFM 3SKMA 3F58L 1YEKH 4P3DA 5I8CA 3LEXA 3HPLB 4MA1C 3ISWA 4L4VA 2EZ0D 4JZNB 2DQGL 2O61A 2HJLB 4Q9RL 3CLFH 5IHUL 1KPVA 1ZT7B 1N8ZB 3MNWA 4GRWF 3V6OC 4OJFL 2NYYC 1ULVA 2QQLH 4GMTL 1BZQK 5I1JH 4QRSA 4HWNA 2X4SB 2HVJA 2EDJA 2OR7A 2VLRA 3RY5A 3ULUC 3LRHA 3VFUB 2B4CC 2P5EA 1E4JA 4MAYD 1OGAE 5ISZB 3BUYA 1RZGB 3BE1H 2EZ0C 2ZP0T 3VWKD 3LPWA 3P0GB 3L3DA 5C9JB 4ZUSA 1F4YH 1XGQA 3RGVC 2E6QA 3LEYL 2B5IC 4PJEF 2X70A 1T1XB 4UIKH 4TRPH 1Q9OB 1X7QA 1UXSB 4J6RL 5EWIL 5EUOB 1C8PA 3UTPE 2RGSA 3IAQA 1P4LA 3W39A 5DMKB 4KVNL 3KPRD 1MFAH 2X4OA 1ZT7A 1E28A 4O2FA 4X6DA 5D2NB 1IGCL 4QY8A 3VI4F 4Y19D 1E6JL 1IGTB 5LJYH 4M9PA 1JNNL 4M6AA 2Q8AH 5D1QC 4J4PC 3VRIB 4J3OC 1EJ6A 1UACL 1A0QL 4H1LG 2OTWB 2DLTA 3D69B 5F3BB 5EFIA 1OAXH 2ZCLL 3B6SA 3SOBH 2Z31B 1XF4B 3QWRA 4U3CA 1U0QA 2VLRE 5LQBH 4H0GA 1A1NB 3QB7C 1U58B 1RZKC 5J13C 5J1AA 4IOIB 2WBJD 3S9DB 1I4FA 5I16B 5GIRB 4POUB 1T21A 3P4MA 4JQVC 4QEGA 1UM6H 5HHNA 5EIVA 5CSZA 3EHBC 1QRND 43C9A 1LEKB 3L3HB 4FA8A 3OHXB 4NRYB 1NCWL 1KJ2H 2NY5L 3BPLB 1U3HB 2JKXA 4XPHH 5FKPA 3QEGL 1NGYA 2I60L 3PWJA 4JDTL 1N5YH 1GGIL 4OD3L 4NQVB 4WUUD 5B39B 2LU7A 5GRYA 4ZO7A 2EDYA 3MV8D 4BJLA 2NY0B 3T8XA 3WNNA 4YDJB 4PV9A 1WSST 3R06A 3HC4L 1CLOH 4DW2L 3RWFA 5F6IC 1PQZA 5C9KA 4FQXA 1INDH 1RK1A 5JPMA 1OP3H 1IT9H 1CF8L 3VD5A 4AT6A 4MX7A 1I9RL 2MNUA 4IMKC 4XP6H 3GJEA 1T22A 3DXAA 5DYOB 8FABB 1FAIH 4ZOAA 4RBPH 4YFLI 4EKXA 5JLZB 4WEMB 4OZFG 3OSKA 4LSPH 5HBBA 5D7JD 4W81A 3D39E 3EDFA 1MIML 4DFIA 3IJYA 3TT3H 4XWOD 3D69A 5F3BA 3VXNB 1DQTA 1OP3K 2X44D 1F5WA 2P46B 4P5TB 2D31B 2DI7A 3MRPB 5E4EB 3FHQA 3CC5B 2XN9B 4N0UB 4FABL 3QO0B 1HEZA 2BOCB 3RGVB 1KYOJ 2B5IB 3TO4C 2VLLA 2DDQH 1JUFB 1EO8H 4KKBD 3DURA 1TZGL 1XF3A 5I71B 1LP9A 1CDJA 4NHUB 2R2BB 4C55A 3VD4A 1XF2A 3MRCB 1T7ZA 3RZCC 4HK3J 2EYSB 5A40E 3IF1B 3HNVH 5E1HB 4LSQL 1AD9B 4HFWB 3QNYB 5ITFB 1T66D 4DN4H 3THML 1I9IH 2VYRE 2HKHL 4D3CH 4UU9B 4X5WA 1UM4L 4XB8A 3UC0H 5GS2H 2YC1A 3LHPH 4O2CB 4HLJA 3MV8A 1U36A 3PWLB 5IVXB 4YO0B 1R3IL 4KU1A 1BFVL 2DJSA 3OR7B 3QXWA 1WQVT 3UROR 4LHUB 1D5IH 4PGDA 3QISA 1E4KA 3MXWH 1WIPA 4HWEH 1JJUA 1L6XA 4X6FB 3SN6N 1QNZL 2VISB 3ARDA 1NGQL 5ELIA 1U3JA 3OXRB 1YEGL 4Y5YB 4HS8L 4HJJH 1A6ZA 2KUTA 3D25B 3RWFB 5CCKL 5MEOB 3L5WA 4JKWA 4RZCB 3MJ7A 2EDRA 5SV4A 3A6CH 3ZDZE 3SGEI 3N1FC 4N5ED 4LOUC 4S1DC 3C9NB 4F33B 4GRWH 2R0KH 4KKAD 4JB9H 2EO1A 3KNBA 4MD4A 1XGQB 3VXQA 3MNZA 3VFGL 2W0KA 4ZXBD 4Y19A 4QXTA 5KZCB 4P4KC 3VDBA 4P23B 2P42B 1EEQA 4NKIH 3ULSA 3KPRA 1H3UA 1QLFB 2FX8H 1OP5K 5I8EA 2DQHH 3SE9H 2IPTL 2ATPB 4PY8I 4PJHB 2WWKO 3ARGC 5IEKB 3WUWG 2HG5B 4I13B 1MI5B 5IMOB 4PJCB 3TA3B 4BQBA 3FONB 4RFOH 3B9DA 2NTFA 1PBYA 3GO1L 2O61B 3DARA 4JO3L 3FZUC 3WE6A 3OJDA 3EOBB 5K9KA 4FMFA 4J1UA 1LK2B 4WGVB 1SJHA 1F3JA 2VDPH 4QY8B 1KTDB 5HYIA 5C0IB 5CJ5A 3WFHB 4XCNB 3K8KA 3TNNB 6FABH 3MXVH 2EECA 2NNAA 5C70A 1LO5B 5A2IH 1I9JL 2Y07H 1HSBA 2CIIB 1BMGA 4NGHH 2AJ3B 3KPNA 3X12A 1YN6A 4HIJA 1HKFA 5GXBB 4TPRH 4MQ7A 5EDXA 1CGSL 1TJHH 4H8WH 3X13A 2FDBP 5ESVB 5KTEL 5E7BA 1BD2D 4HW6A 4LK4A 4KKLD 3G08B 4KROB 3E8UL 3RU8L 5BMFL 3D85D 2HVKA 1A7PL 3PL6D 3D39B 4P57B 3SGDH 4OTXL 2VUOA 3BWAB 4ZG1A 3MO1A 1R5WA 4XNMB 1PLGH 2VTFA 3SGJA 3VXUE 3BE1L 3CFKA 1BFOB 4LSRH 3LKOB 2IC2A 4QXUL 3V5KB 2KQNA 2D03L 3VFRB 4KK9D 3MACL 3IDIB 2IAND 4HXAH 1A3LL 2JB5H 4MD4B 3FJTA 3RDTA 1QKZH 2HT3D 1BD2B 1FFPA 4GG8A 4Z7NE 5SWZA 1FZOB 5IM7A 4ALAL 5EIIA 5CWSA 4ZUWB 5TE6H 5IR1A 5I75C 1CI5A 1CT8B 5HHMD 1RZFH 1OCWL 3C8KB 3LSOB 4LARH 2VL5A 2XZCL 2Y5EA 3HMXA 1F3RB 2FWOA 4HCRL 2V9QA 3LD8B 5FOJA 4ESKA 5TDNA 5SWQB 5HI3C 4K7PL 3CVIL 1UT9A 3T2QA 2D31A 1HINL 2A77H 3D2UD 4GBXC 1QSEE 2GJJA 4NO3B 3ZDXE 5B38A 5IFHL 3V6ZB 3D2UA 5FYKL 1D9KC 1IC4L 5BMFH 4ELKB 4RGOL 4XP9L 5C09B 2ADGA 3UZVB 3OX8B 4H5SA 3WLWC 1YNLL 2YSSA 3GRWL 2ADFL 4ACPA 4UDTA 1GGBL 2CXGA 4WI3A 2HT2D 4AEIL 4EQ2A 1CDUA 4Y4HC 4MWFA 5F1SA 1SYSB 5CEZE 4Z7VE 3GI9L 3H3BC 1SY6L 4IRJC 3MRCA 1RIHL 5GS0H 2JK5B 4OFKA 3OPZH 4MNGE 1BZ7A 4B7LA 5FO8B 4FMKA 4HULB 2ORBL 1AGEA 5DMIL 4G7YH 3PNWA 3CVHL 4ELMA 2IANA 2V2TA 2I9LA 1U91A 2BOCA 4Z7OE 4HCRH 1F3DJ 1TZIA 4MSWA 3DV6A 1MUJA 1N6QH 2AJUL 4NRYA 4XPTL 4NRZB 2NQCA 1JCKA 2V2XA 4EEEA 5B4MC 5EO0A 4JRYB 3W82A 1FN4A 4NYLA 4DGYL 2KL6A 1N2RB 3K80A 1FDLL 4ZPTA 1CFNB 2QQLL 4ISVA 5GS0D 4BZ1H 4MJ6A 1E27B 1TMCB 2HRPH 3MCLL 3PHQA 3RDTB 1NEZG 2DQEH 1DVFB 2R23A 3WJLC 2NMSA 3DVIA 3QJFA 4P9MH 1YNTA 2I26N 4AT6B 4PBXA 2A74A 3DSFH 3NH7L 5IMKA 1IC7L 2KKQA 4ONFL 5JUEH 4NC1E 4FQXB 2XA8H 1HHJB 1L0YA 2J8UB 4NHCH 3STLA 1I1RA 1UXWB 4PJDA 4DKDC 4ZO9A 1QRKA 1MRCH 1DN0A 4K55A 2R2BA 5ESQA 2Q87A 3T1WA 3GSRB 1OAUH 2NY6D 2NY7L 1ES0B 1XH3B 4WO4D 5IJKA 3L1OH 1ZVHA 3L5HA 3BKJH 2ADGB 4KI5F 3DURB 5I1KL 1NGYB 3PWJB 2NXYC 4RQQA 1HXYA 1RIUH 2DWDB 2R1WA 3ZO0A 3V6ZA 3ZTNH 1I3RB 3O3UN 4KRPD 5CIPA 3VD7A 4KFZC 2VLKA 4G8FA 3ZL4H 3RAJL 1IZKA 3U0PB 3V5DB 1T3FA 2HAZA 4I3RL 4YAQA 3T0VA 1J0ZA 4ZUTA 4LCCA 5F7EL 3RWHB 2ZPKL 3WEXB 3QUMA 2J8HA 1P1ZB 4QWWC 5I30L 1EHXA 4NNPH 1D6VH 2J8OA 2W65A 4OCXL 4ODVL 2YUZA 1XZ0B 3KS0J 3RIAK 4QOKD 4WHYG 4NQEA 2JK5A 2YHGA 2NY2C 4FQIH 1INQB 4PJIB 3VGGA 5KSBB 1Z6JT 5DUMH 3O3AB 2AJSH 3CSPA 1YEJH 4JHWL 1T0NA 5DJZA 4ODXA 1GRWA 3IU3A 2XWTB 5IMOA 5D96B 2R29L 2YRZA 5HGHB 5EC1A 5CJ8A 3H8NA 5JPMB 1S7XA 1RSFA 5K9QG 2FBJH 1JYWA 3E0GA 4J23A 5HGDB 4BKLA 3QEQE 3I6GA 3M17B 3CZJA 3U4EA 3X3GH 3RVXD 1DR9A 4DZBB 1WBXB 4CW1A 5B8CC 1LD9A 3KYKL 4NN6B 1XGPA 2EDXA 4TSCL 1PY4A 1HILA 5D6DC 2P5EB 3RWCB 2IH1A 5F9WC 1T2QL 3EYVB 3G5XB 1J0HA 3DRTA 1CBVH 1RUQL 2Q76B 32C2A 1MAKA 3GBNH 3QFDB 5D71L 2VDKH 2DQCL 1QR1A 5FGCE 4YC2B 4L3ED 1U8JA 4NPYB 5T1KA 4PS4L 4W6XB 1F42A 1CZ8H 1T04B 3QFJA 5EUKB 1X5JA 5AWNH 1H3GA 4L29A 2XKNA 2ZUXA 4ODWA 1D5MA 3DTXB 4XRCB 4NIKB 4X7TB 2R0WH 2BNRB 4LDEB 1J8HD 1WBYA 4JO4H 4Z77A 1BM3H 1TJGL 3HTLX 4ZAKA 3ILQC 1S8DB 2DD8H 4FQXC 2YEZA 2CDEB 3OV6A 3AU1B 3CU7A 5DRWA 3NCJH 3TCLA 4LRIC 3FFCA 1K4DA 5KS9A 5C0AA 5J11B 5INCB 1KJ2L 5E56A 1KSRA 2ICES 3CFDA 2EDOA 5T1KB 3EO9L 2XQBH 3V6FA 1TZHA 3BEVB 1A22B 4LIQL 1A6WL 5ICXB 5KSAD 3SQOL 5C7XL 1OARH 5JHLH 2FRGP 5LCVL 2APVA 3WS3B 1JZ4A 5C9JA 2VRAA 4W70A 3G6JF 3K4ZA 5JNYA 1C5BL 3X13B 3MRJB 4NKOA 4R4NC 4XVUC 1MFCH 4H20L 4OM0H 5KVFH 4OQTL 1IAKA 1NKRA 3L5XL 2RIKA 3SCMC 4PGBB 1ZV5A 2IANE 1QFUH 2WQ8A 4KK5D 4P2RD 4KVNH 4PJGF 4IHOA 4MNGA 2FR4B 2Z93B 3R8QA 2DBLH 5JA9A 2XA3A 1BGXL 1BFTA 3O2VH 4EJ1C 1GHFH 2VAAA 2DLFL 3PP4H 1DUZB 3AMKA 4ZODA 3DSNA 4KJQC 5DO2C 3DGGB 4UI2A 5ICYA 1P1ZA 2ESVE 1VCAA 4ZPTB 4GO6B 3S36H 2YD3A 4JDZA 1T03H 5C0EB 1QZ1A 1U8IB 3RWDB 1EERB 1DSFH 5J13B 3KG5A 1FHGA 3RL2B 4YPJA 4TNVK 3QCUL 4LP5A 4PJGE 1TTGA 4HZLA 4Y4FD 4AG4H 1SBSL 4YHMH 4P5MB 4U49A 1SEBB 1MI5E 2BNRD 3QCUH 1GGIH 4OD3H 7CGTA 1LE5A 4KKNA 2EE2A 4H88L 1XGYH 5JW5B 1A4KB 1MCDA 1CDGA 1GGUA 2Q7YB 3TO2B 2R4RH 1L4IA 5EZLB 3T4YA 4M1GH 3RTQD 5L2KB 4LEOA 4OD1L 5GJTL 1CU4H 4M6MH 1BF8A 4GRMA 1ZVYA 2CDGA 3VFVB 1CE6A 4GBXD 2DYPD 1A1NA 1T0PB 1WISA 4BH8A 4EDWH 2X4QA 3UYRH 3V8CA 1I8MA 4WHTA 1IC1A 1KLGB 3RGVD 3VXNA 1A7BA 2BFVH 5E1AA 1R5VB 4LASL 1NGQH 1MLBA 2P8LB 4I4WB 4ZFOB 5E5UB 5EO0B 4ODTL 1Z9LA 4G3YH 2QQNL 3QHFL 4I18A 2HJKB 4I3SH 3Q5OA 1TLKA 1G9MH 4XNYL 3FT2A 1CFVH 5L9DL 4ORZC 1A5FH 2VL4A 4IRSD 4WNQB 5ID0B 3HE7A 5EOCL 1OB1A 3U7YL 1X4ZA 2B0SH 1RZKL 4JFEB 4OZIA 4UV7L 1TVHB 2FSEA 3IGAA 2R0ZH 4YBLB 2FIRT 2X70B 3MRGA 4P2RB 3LRSA 4N0RA 3UC0L 5CEXB 4WUUE 1I8MB 1OAYL 2ZUTA 2ZNXA 1AQDA 4G8EA 3BGFC 4DVRH 5LCVH 3WS3A 1FZMB 4FP8L 4G9FA 1EFXB 3CX5J 5HHVH 1KJMA 3FO2B 4PRHB 4APQA 3N06B 4HD9A 3U1SH 3SDAA 1OAZL 2WBWB 2OI9C 2PTVA 4O4YH 4KQ4L