2P45B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 1.1a resolution: se5b-ortho-1 crystal form with five se-met sites (l4m, m34, m51, f68m, m83) in vhh scaffold.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
QVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 28
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p45B00
4F7EB 1ZANL 1NBVL 4C56E 5DLMH 1A21A 1AD9A 1HKLL 3GB7B 1UEMA 4I9WE 4Z7QF 3O6KL 4WENB 2WBWB 4LRNL 3TWCH 1GC1L 4LEOB 2AEQH 4NC2B 1Y18B 3P0YH 2YD9A 4QHNA 4YIQB 1P1ZB 3VD9A 3GSRA 1T2XA 3DUSA 4FFZH 5ALCH 1IGYB 2HYMA 5BS0E 3GSNH 2EXYC 1HILB 3MXWH 1FQ9C 4TSBL 1OB1A 5ANME 1HHGB 5I17B 4UBDC 3KPOB 4K8RC 3S35L 3HPJA 1IARB 2BFVH 4G6MH 4U05A 3SCMD 2P5WE 5INDA 2C26A 4RGNC 4P5TB 3HNSL 4PJDE 1YEKH 1KJMA 4FQXA 1JK8A 4G80A 4ZXBC 3UBXA 4NO0B 4HMDA 4LCUB 4PJAA 4N8VA 1BQHB 2PO6D 4HBQA 3MJ9A 2VISB 3IVKA 3VMOA 3NIGF 4AM0B 5FM8A 2R0LL 1A3LH 4UAOB 4U7MA 3EYOB 1OGAD 1HHIB 2NW3A 1LE9A 3NFSL 2BSRB 1MNUH 3IDUA 4UT7H 4ZOCA 3VGAB 5C71A 5GS2D 5JQ6L 4JO3H 5KJRL 4EQ2A 4M7ZB 4YWGL 4HDIB 2E6JA 4Q6IB 1NLBL 1E28A 1MAJA 1EJOL 5L8LB 1KTKE 1AGEA 1N6QL 5E03A 1NMAL 4DFHA 4RMTA 1G7MB 4D0CB 4KZDL 4R3SB 1QZ1A 4X7TA 5F88B 1A7QH 2PYFA 1CGUA 2E7CA 2XT1B 4P49A 3D85B 2Z4QA 4JPVL 5C08A 3BDBA 3ARDB 4JM2B 3UTSB 1PG7X 5J8OA 4ONGL 1Z9MA 2VLKE 3VRIB 2VIRB 2IQ9H 1OW0A 2GUOA 3U1SL 4OM0H 4WU5A 3DBXB 1XIWC 2E7BA 4WW1A 2VLLA 1QRNA 3B9EA 4P23A 1N5YL 2XQYK 2GSGB 4H8WL 1B6UA 5DSCB 3ARFC 3IXTB 4BSVB 1IAMA 1D6VL 3RWCB 4M1CC 4NQSB 2VB5A 4A6YB 2ZP0T 3M07A 2HFFA 4UIKL 4C56B 3QDME 3QQ4B 1HE7A 4LF3B 4OFYA 4AENB 5DVOA 3DWTA 2PCPA 3JV6B 32C2A 5LWYL 1U3HC 1RZJL 3V4UL 4CVXB 1LO3H 1RZ7H 2VLRA 3SKJH 1AHWB 4WW2A 3IETB 3TYGL 2B5IC 5BS0B 2DLIA 2KQNA 1Q0YL 2XPGA 5ANMB 4L4TA 3TBVB 3DRTA 1BZ9B 1JGLL 4OF0A 3IDIB 4MSWA 1QR1A 2D31B 4PGDB 3X17A 3KYOA 4OZHE 3V0WL 1A9BA 3SKNB 2EDOA 4PJDB 4UTBH 1KNOA 2NY5C 1NANH 3CVHB 3ZDZF 1R3IH 1T5WA 1NC4B 1NL0H 2ICES 5CMAB 1QKZL 3ARBA 1BWWA 4BH8A 1SVZA 5HYSA 4V1DE 2L0DA 2Z91B 2ADIA 3QFJB 5CP3H 1WISA 3GO1L 2XWJB 1SJVA 4S1DD 3DRQB 4GW4B 3MFFB 3A67L 4LSVH 1YECH 2YC1B 4L4JA 4PJ8D 2ENSA 2CDEA 5FUOH 1CG9B 4HK0A 5K33A 1T0NB 1WZLA 4M6ML 3V2AR 2VDLL 1TCMA 5HHNB 1A3QA 5EU6E 4LIQL 2EIDA 4LQ1A 4KY1H 2DLTA 3WLBB 3CLFL 4JPIA 1D9KD 2Z8RA 1MFCL 4H8WC 5EO9A 3UJJH 2VLKB 4OB5H 1RULL 2GJ6D 5F3BB 4Y1AA 4DZ8B 4RFEB 4QOKD 1FFNA 3OZ9H 1J10A 3QUXD 4R96A 3HCVB 3QEQD 4E41E 4Z6AT 3IS0X 5CZXD 4NRZB 2YUZA 4I77L 1MWAH 4O2CB 3U82B 3MV11 2WBJD 3FAXA 2EDJA 4LDOB 3QDMB 5T1MB 3RVVD 1K2DB 2JCCE 4ZTOH 3EJZC 2DBLL 3P0VH 4XNMA 4UV4H 3HI5H 5E8NA 5IW1A 5LAXB 4KJQC 2DMKA 3N85L 2ZOKB 1CTOA 3ZLQC 1TZIA 5CD3B 5T3XH 4RAVA 4CW1A 3N1GC 3LN4B 3SO5A 3PWJB 3PDDA 1L0QA 4O2FA 2VITB 5JR1H 2FYYB 2H3NA 3REVB 1A4JB 2IWGA 2ID5A 3FKUS 4HKJB 5F9WC 1KN4H 2PXYC 5FF6B 2OP4L 5IB5B 4OZHB 2P8LA 1RQ5A 3RGHA 1TTGA 1T1WA 1MVFA 3PWVA 3UDWA 3MACH 1RMFL 1R3JA 5LQBH 2DQCL 5IBLC 1TCRA 3OJDA 1TVBB 1MCWM 4TOYL 4HJJH 5GISL 2EO9A 4JO1L 5E24E 4QRPB 3SKUD 4C54A 5DUBA 4V1DB 4WGWB 2K7PA 4Z7UA 2DMBA 5I1JH 4HIHA 5FXCH 3MA7B 3QDAA 3TO4D 5F7NC 1RU9L 4MNQD 5EOQL 4KK6C 1GGCH 5L2JB 2IALA 3H0TA 2VXVL 5BJTA 1L9MA 1J1OL 4M5YL 3PDOA 5C0EB 2FX9L 3BKYL 4ZPTB 2VAJA 3W39A 1DE4B 1ZMYA 2FLBT 4FOMA 4NT6A 4HWEL 4YXKH 1A6PA 3KPSA 4WI4A 2GKIA 1SJHB 4OZGA 3ULVF 1LEKB 3QULB 4JDTH 2H6PB 4LHUG 3MJ7B 3TH2T 5D1QB 3MFGB 5EU6B 5HHQB 2ATKB 4QWWD 3V5HB 3L3DB 4G9FD 3GNML 3GK8H 3LVEA 4JFFD 5A2LH 4NHUA 5J11C 2N4IA 2GHWB 1AXIB 5F9OL 3O45B 4U3HA 2FECI 2GTZA 3SDCB 2BVOB 3QPQD 3V6OA 4PJ7F 5JMOC 1TMCB 1KC5L 2DQUL 3QZWG 3WO3B 1JL8A 3FO1B 1EUUA 4JG0L 4LMQI 4E41B 5FYKL 4TUJB 3KWWA 5F1NA 4KROC 5GRYA 3W0WA 3ULUF 3HUJE 4ZUSA 4KDTA 4M4RA 5I71C 1D7FA 3CDGA 1DLHA 5JPMB 5ACMA 2VRAA 5CBAA 1H9VA 3TN0A 1F4WH 3L3HA 5C2UB 3EDJA 2BY2A 4NP4H 2PW2A 2WK2A 1WFNA 2JCCB 6FABL 2C3XA 1RPQA 3CD4A 3O9WD 3DUHA 4QRUB 3MRIA 1BVLB 2FJGB 5FYKD 1K5NA 4KMTH 3T0EA 3HPLB 3BT2L 4D0BB 4YLQT 1ZLVH 1BFOA 1U8HA 3LEYL 4HEME 2R2HB 1C16B 3HAEH 4G8FB 1ZLWK 5K9JL 1I8MB 1BOGB 3OJ2C 2LFGA 5DD5L 5C6TL 4JPWH 3MLWL 2KH2B 5C07D 5ILTH 2VLJD 1CDGA 3IYLW 1CD8A 4PJEA 4XAWH 4Y2DC 2HKFH 2IC2A 3LSOB 5DA4A 1ES0B 4KTDH 2X9YA 2R69H 4F7CB 2I26N 1JE6A 4WHDA 1F3JB 5TE7L 5IGXH 3STBA 1VFUA 3QXTA 2Q1EA 1G6RL 1BMGA 1PVHA 1MFEH 2PKDA 3U0TB 1YC8A 4NO5B 2CRZA 5J0BA 1RUAH 5CP7B 4GXVH 1S7WB 4TTGA 1UWXH 1IILE 4PLOB 2EDLA 4K3DH 4M1DL 3VXRB 5IB4B 3OKDB 2NY2C 3O8XD 4J23A 1KJ3L 2FBOJ 4HUUB 3SKOB 4HFUL 1NGYB 1VKXB 2W9LA 3WXWL 5EA0H 2LVEA 5FA4A 5KVFL 5FECB 4X0KA 2R0ZH 1KXVC 1IC7H 4HUWA 1EGJL 3FFCA 1EJ6A 2VNCA 2YPVL 1QFWI 2Y07L 3VD4A 5K93A 1QSFD 5JXAH 2WAHA 5C0CE 2QQLH 3DV4A 3P9MB 2A83B 3ZE0E 3VXUE 3BGAA 4ODWB 4U0RC 3HRZB 3RPIB 1GHFL 2VQUA 4JREB 5HXMA 1NC2A 3CCHB 3UAJD 2HVKA 3HUJB 1BAFH 4M7LT 1U8LB 1WITA 1YYMH 2IJ0C 2BNRD 1JZ3A 2OZ4H 2YRLA 3QG7H 1N64H 4KKLC 3MPCA 5TE4H 2EZ0D 3CDYA 4I2XA 3KPRA 5T1LA 3VXQB 4GG6B 1YZZA 4YXHL 4J12A 4KJPD 1YEDB 3PP4H 2FECL 3IDXL 3FQRA 4OD1H 2X4RB 1CLZH 2CK2A 4W4OA 3MTRA 4L4VA 4KZEL 4R2GC 1M7DA 4OSUH 1GPOL 1RY7B 2R23A 5FKPB 4RBPH 1QSVA 4NKIH 2CKBA 1UXWA 1YEFH 3T3MF 1ZGLB 3QEGL 1YN6A 5GGUB 1PGRB 4NO0D 3N9GH 3S97C 4BZ2L 3O2WL 1FH5H 3C08H 4X6EB 4JFPA 3MRQA 3DSNA 4Q58C 4YBLC 4P5KB 3BHBA 1E4XH 2A73B 5FYJU 3CLEL 5DMGD 3QWOA 1CGTA 1I9RL 1NKOA 1ZK9A 4NQCA 3VWKB 2B2XH 1JZ7A 1F11A 1F58L 1R24B 5ENWA 5IMOB 1KCUL 3EOTL 5TFSL 1JZ2A 3LH2L 4PJAE 4BYHA 4LAQL 1RFDL 3AM8A 3DJ9A 2R0KH 5GS0L 4G42A 4PRDB 1DBKH 1DQJA 3PXJA 2UWEA 3HE7A 5C09A 4ODTH 3WIHL 1MCWW 5JHDA 1EBPA 3ARDD 2RHEA 3HMWL 4JM2D 3UTSD 5SV3A 4PRBB 3DUUA 1EDQA 1IEAA 1N0LA 4A6YL 1C5BL 3ESUF 1JPFA 2FIKB 3DMMD 1CFTA 4NRYB 5DFWH 5B38A 4EI5C 1I8LC 1SVCP 4ZUVA 5DD3L 3FO0H 1H3TA 4D0DB 5AEAA 5GS0D 2R9HC 1JMXA 2QHRH 4M48L 1W72L 1XF5A 3VFUA 2VLMD 2A6DA 4ZFOB 4R8WH 2C1OB 1IC4L 5C08E 2VDOL 5DDHB 4YO0A 4YXLH 1UJ3A 2XFXB 3H9HA 3PXHA 4P5TC 3VXUB 4C56D 2PTTB 3QDJA 3VCLB 4P99A 3QNXA 4NUGL 4UOJA 3EBAA 1P7KB 2IAMA 4I9WD 1QR4A 5I1KH 2V5YA 4FQHB 1OP3H 4WFFD 3BISA 3EKCA 4XBGA 4UAOC 2BDNH 5E2VL 1QRNE 5EORH 4UQ3A 3WNPA 1F13A 1T2QL 5IBUG 1XF1A 1YQVH 2Q87A 1DUYB 3L7EA 5F1OB 4KRPC 5GIRA 3CVHL 3MUGA 3LPGA 3A6CH 3O11A 4IHOB 1J8KA 1QFWL 4MJ6A 5HDQL 2HFGL 1JWSB 3VE0B 4OCXH 5DMYA 4JFOA 5C8JA 5I1IH 3WCYA 1HYRC 2APVA 3KXFA 4FFVD 4M3JA 3VXMD 1AD9B 1CQKA 4HPYH 4OKVA 3KR3L 4M5ZH 4Z7VF 1IC5H 4FZ8H 1FG2A 4QHNB 2VLRE 3D0LA 3QHFL 3GSRB 1S78D 3DUSB 1J5OL 5I9QB 2DQTL 3EYQD 4LSQL 3UTQA 1MCPH 3MOBL 1GRWA 1OB1B 4L4TE 5IUSA 3G5XA 4R0LC 3HPJB 5KS9A 3EYSH 3QFJD 2GJJA 4HQQH 4WI2A 5INDB 4M62L 2FH6A 4TNWK 2OJEA 4ODVH 5ELIA 4XPBH 5L2KE 1JTTA 4JB9L 3O3DA 4FQXB 5HHXL 1JK8B 4BQ9A 1KYOJ 2V2WB 4G80B 4JVUA 5B3NA 3I6LE 5IK3A 1CXLA 3UBXB 1AXTH 4PJAB 3IU3A 1FO0A 4N8VB 3IVKB 4TVPH 5HYEA 4M6NH 5IQ7L 2NW3B 4K8RH 2VDPL 1LE9B 1C08A 4X5LA 2LAGB 2H9GA 1E28B 1IMHC 2NXZB 1YPZF 1F90L 4JHAL 5I15L 4KVNH 1KJVA 2VLKD 1AGEB 3VI4E 5EZOL 3SE8L 2A77H 3WHE0 3W11D 1NCWH 5BMFL 2CRIA 1QSZA 4X7TB 3UTPE 5FUZL 2IFFL 4WO4A 4F57H 3OXRA 3MJGX 2MPAL 5GXBB 1IKFL 5FGBA 2Z4QB 3D48R 5C08B 3K1DA 1HHJA 4XBEL 2WIIA 3VXTA 3G6AA 5JA8B 1RURL 4KDWA 3QDMD 4U1IA 2GUOB 4WU5B 2NLJA 4WW1B 2VLLB 3Q5TA 1C7TA 1QRNB 4OF5A 4P23B 3MLSH 4JZOA 4K71C 4GG8A 1LO5A 1HZHH 1MY7A 1XZ0A 1A1MA 2EKSA 3H42L 3LKNA 2EDKA 1CLOH 2J5LC 5I74B 2HFFB 2DQHL 3KS0J 2J4WL 2IBZY 2A1WH 2VZVA 3RI5F 5DC4B 2PCPB 32C2B 3NCEB 3B8YA 2VLRB 5DO2D 2VZ3A 3JZ7A 4WW2B 1FC1A 4NNPH 4DGIL 1H5BC 4JFEE 1PJ9A 4G6KL 5E2TL 4PRNA 4QRPD 3MBEA 1RZGA 5CEZD 1N26A 2XPGB 4V1DD 4L4TB 2NY7L 4DTGL 3DRTB 1IFHL 4GAJH 4MSWB 3WHXA 3WLWC 1QR1B 5GS3A 3IKCA 4XC3H 3EIFA 3KYOB 4WU7A 1T04A 5BVPH 3MGTA 1OPGL 1A9BB 2EIBA 5CCKL 2RBLA 5LGHH 1KNOB 2ZG3A 3UEZA 1T5WB 3RDTA 3ARBB 4W68A 3MC0A 4BH8B 2D03L 4U1KA 3U7YH 5HYSB 2O5ZH 3QBTB 1RZKL 3FQUA 1XR8A 4P48A 2ADIB 1A6UH 3IDNA 5D1QD 5EU6D 4XWOD 4F15B 2NY1C 3VGHA 1YEIL 5EFIA 2AK4A 2NY5H 3V6BR 1MEXH 4UNUA 3SGDI 5GGTL 3KPSE 1HWGB 4O2EA 3E2HB 4QRQA 2CDEB 3EDKA 4HK0B 4OZGE 3SGJC 2FGWH 1KB5L 2EIEA 3GUTA 4X6CF 4E41D 2DJ4A 3WV0A 4RMQA 2R29L 3BKMH 3DSFH 5EIVA 1CXIA 4JPIB 5DVKA 4HT1H 2HJFA 1XGTA 1NMCB 2YWZA 4K7PL 5EO9B 4CU7A 2OR9L 3SDXF 4LVOB 2ZG2A 2P46B 3ZTNH 4PGCA 1M7IA 3V6OE 3VG9C 3VXPA 1UKTA 5I1LA 3KHQA 4Y1AB 4XBPA 1FFNB 5DGRA 3C2SA 3S7GA 4B5EA 5DRWA 4R96B 4I5BA 1DVFA 2CUIA 5DHVB 1NUGA 5IR1A 4TNVF 1NLDL 4RQQA 2DM2A 1BJ1H 3W0WE 1EVUA 1U8NA 1ZAGA 3CDFA 3D9AL 4TSAH 1NDMA 1C1EL 1BOYA 4MA8H 5HDLA 2PR4L 3CK0H 2B39A 3H9ZA 1T03H 1TQBC 4P9HC 5DUPH 1MJUL 4LLDA 4XNMB 1HOCA 2WP3O 5E8NB 5IW1B 3IFNL 3LHPH 2QTEA 1FAIH 3F6LA 4JFEB 4MLSA 3T0EE 2X4OA 4RWHA 4DKFH 4PGBA 3OG6B 5T1DH 1GVIA 1YMHA 2APTA 3DHMA 4NBYB 1GIGH 3KLSA 1FDLL 4RAVB 4CW1B 4MHHG 5DQJA 4ZFGH 4O2FB 4G5ZH 1A7OL 2H3NB 3SDCC 3W5MA 3IDYB 3PWLA 4X7DC 3OGOE 3D5OF 2VAAA 1K6QH 3ZE2E 2P8LB 1T1WB 3PWVB 3RVTD 1RZKC 2VDRL 5B8CA 1MQKL 1R3JB 4MXWH 5EU5A 1TCRB 3OJDB 3GM0A 1EMTH 4OFPA 1M7XA 3VXRD 2EO1A 4Z7NE 2BNQA 4XPGH 2Z8VC 3LN9A 3MV8A 3DVNA 4ODSH 5DUBB 5HGAA 4HBCH 4HS8L 3NFNA 1AFVL 4HIHB 3ZYIA 3NPSB 4XPAL 5DC0A 1DTUA 2HTLD 1V5JA 1P9MA 3QIBC 4JN1H 4O9HL 5HTSA 4YQXL 2IALB 3H0TB 5BJTB 4B7LA 2VH5H 3FB8A 3QP3A 3PDOB 3LIZL 4AEHL 3AREC 4X9FA 3W39B 4NT6B 5IT2L 1MJ7H 3GSVA 3KPSB 4G7VH 4R9HA 5EUKA 3OG4B 5C6PB 4OQTA 3PGCA 4OZGB 1L7TH 1P69B 4IRJC 3QI9C 2O5XH 1VHPA 3FTGA 3BN3B 4NRXA 4XMLH 1N7ML 1P84J 3EO9L 1RZFH 3UBXI 1J86A 3FFCE 3PWNA 4NHUB 1IEBA 5I75B 2GTZB 5CJQH 4S1SH 3U4BH 2P48B 4PJ5A 5GZNC 1E4JA 3F8UB 5D6DC 3OV6A 4L9LA 5CWSA 5FCUH 4HCRH 3NH7H 5F44A 3AVEA 3KWWB 1BFTA 5F1NB 3W0WB 3QH3A 3O4LA 4XP5H 1FJ1A 4ZUSB 4BZ1L 5DZOA 3CDGB 4WFHE 1QFWM 3GKZA 3JTSA 4NGHL 3ILQC 1CFQA 1DLHB 1DR9A 1JNLL 3JBG7 5FHAH 5CBAB 3TN0B 5T5NG 3HNVH 3L3HB 5C3LD 3THMH 4JKPL 3P9WB 3V52H 2PW2B 4YFLI 2H8PA 1ZOXA 3HNTL 3NIFF 4I2XE 2ZUYA 4CU6A 3KPRE 3GSOA 3IRZA 5DVLA 2CXGA 3MRIB 5CZVL 1FFPA 1K5NB 3T0EB 4PLNC 4L4VE 4JPKH 1BFOB 1U8HB 2E6QA 3BQUB 2XTJC 3VWKD 2VKXA 3KVQA 2BHZA 1FYHB 5EC2A 2CGRH 2YD4A 7FABH 4PJEB 2AEIT 4OCWH 5HHVH 4S0SD 2X1XR 3MLXL 3L5IA 1CQYA 4R4FH 4D8PA 4NJAH 1C7SA 2WWKO 4JREC 5FUCE 3FMGL 4ZFOL 1OT1A 5EIIA 1PG7L 1YY9D 4NQCE 3AB0B 2F8VA 3C09B 4IEFB 4PB9H 3BH8A 2R56L 1R3KA 1TJHH 2B7DT 4YZFF 5ALBH 2CR3A 3VGFA 2DKUA 3F7PC 1WV7T 4H88H 2J3SA 1KIQA 4F3FA 1FSKC 4XNUL 4RISH 3WSQH 1RZ8A 2M2DA 2UWEE 3LKPA 4U1MA 5C09E 4NFCA 5JHDE 3BN9C 2V17L 1B0RA 2CUHA 2FSEA 2XZCL 1X5AA 1I8IA 3UYRL 1QTYT 4P4KA 4YDLC 2VDQH 1J0KA 4P5MA 3VXUD 3UTZA 4Q9RL 1G9NH 2DQGH 4PY8J 1ZLSH 2AABH 5FA4B 1IAII 3EHBC 4K3EL 4X0KB 1A7RH 4HUWB 1H3UA 3FFCB 3VGBA 3X12A 1F45A 5GRXG 4NCC2 4OCRL 3JVGA 1R5WA 3RL1A 1WK0A 5KTEH 1DBAH 5F70A 4IJ3B 1A14L 1LQSR 4ZFZA 2JB5H 4OCSL 5IROA 3QDJE 1U41A 1NC2B 1RZIA 2HVKB 2C1PA 4M02A 2Z35A 4Z7WE 4O4YL 3JWOL 3DVGA 4OGXL 2Q86A 4F58H 3LS5L 1RAMA 2V6HA 4I2XB 1YEEH 4GRWH 3KPRB 4OLXL 5T1LB 3GSWA 3MJ9L 5EOCJ 3RVUC 3A0OA 3FQRB 3KXFE 1JNNH 1I75A 4PS4H 2BVQA 4L4VB 1M7DB 2A9MH 1KPUA 1OP5K 2R23B 4ZUUA 3IFOA 2UVEA 5D71H 2CKBB 1UXWB 5F71A 1DQLH 2Y36L 4FQXD 2VTFA 1YN6B 4TVSa 4YPGA 1NAKH 2E7LC 4XP1H 2XZAL 5K9KA 1KLGA 3VMNA 4JFPB 4ZO6A 2BY0A 3MRQB 3I2CH 3TBTA 4GBXA 3BHBB 4X6FA 3NMEA 3EO0A 5KS9E 4Q9QH 1BQSA 1G1YA 1TETL 1TPXB 1U3JA 5C7XL 1C12A 4NQCB 2NY4C 1PSKH 5FKAA 5JIIA 1F11B 2NXZD 1DBML 1IGTA 5ENWB 1FL3A 2YEZA 4P3CH 1NUFA 1QBLH 1YNKL 4HAFA 2NZ9C 2A38A 4PRIA 1MJ8H 1DEEA 4G42B 1DQJB 2UWEB 4Z7QE 3HE7B 4ZUTA 5C09B 3TIEA 3KLHC 5C08D 5JHDB 4XTRC 4Y5VA 5SWQA 4P2OD 1FHGA 4EVNA 3DUUB 1IEAB 1XMWA 5TE6L 1JPFB 4Z95H 1A7PL 3AY4C 1CFTB 5I9QC 5B38B 2G5RA 4ZUVB 5DJ8A 4I18C 2RGSA 4OZFG 4FQ2H 5E70A 4LU5H 3O6FA 1QRND 4P23D 5IBTL 1XF5B 5CP3A 1DP0A 4XXDA 3RWJA 4IMKA 5F7WC 3VFUB 2A6DB 4M4PA 4P59H 4B0MM 3WD5H 2R15A 4N8CH 4PJFF 1TTUA 4YO0B 1UJ3B 3INUL 2B4CH 4PD4J 3H9HB 2VSCA 4LNRA 3QDJB 3PP3K 3JWOC 4LPTA 3QNXB 5E2UH 3WFEH 4OFYD 3WIFA 2ZOLA 2IAMB 4DVRH 3TA3A 3O6LH 1MQ8A 4B7IA 3BPNC 3RWEA 4XXCC 3MBXH 5AYUL 1CWVA 4X6DA 4YEFA 3MLYL 4XBGB 2VLRD 4UQ3B 4Z7WB 2Y72A 2NY0B 3L7EB 1IAIL 4JFQA 5GIRB 1TDQA 3MROA 3MUGB 4U3CA 3L3OA 1LDPL 4WUKH 1PLGL 3O11B 5KSAA 4MJ6B 2OR7A 4L4TD 4LEXL 43C9A 4JFOB 5C8JB 5CD5C 4PJCF 3KXFB 4GMSL 4RGMB 1W0YT 3HLAA 4OKVB 5E0QA 5EU7E 1UZ6F 2Y06H 5HI4D 4I0PC 2EDRA 5GGSY 1WIPA 3GMQA 5SX4I 4KK8D 1FG2B 3HE6C 3D0LB 3DVIA 4MA1C 2DQIL 2OJZH 2YXFA 1MI5A 4OT1H 2N56A 3I6LD 5DURB 2HKHH 1MWAA 3UTQB 3ARBD 2HRPL 5IJKA 3TT1L 3TEUA 4LPXA 1IGMH 3GHEH 3SOBH 3QDGA 1ACZA 3G5XB 3PL6A 3BPCA 4G8IA 1PZ5A 1YEJH 2F58L 5KS9B 3L95A 5KVGL 2GK0A 3SE4C 1F4AA 3NA9H 4Q0XH 5F1SA 3G6DL 2OJEB 1QBML 3Q1SH 3UC0H 1H3PL 4FXLA 3O3DB 5BO1L 4WFEE 2FLRT 4LRIA 5IK3B 4PJXA 2P4AB 3MJ6A 3IU3B 1FO0B 4M7LL 3QUZC 3UTPD 3B9KC 3DYMA 1G0DA 3IB4A 1RV6X 4X80L 1SMOA 4YEEA 5I74C 5IHUL 1C08B 4GQ9H 3AMLA 4YHKL 3KJ6H 3UROR 2K1MA 2QQNH 2YA2A 2LVCA 5KN5A 2XG5A 2H9GB 2Q7NA 3LKQA 2AK4E 4WW2C 2F5AL 2J7LA 3DROA 1KJVB 3MYJA 1VEOA 3ZKXB 3EJYC 4MAUL 4EOWH 1CGYA 4Y1AD 3SPVA 4WO4B 5JHLL 3OXRB 1EVTC 3U0PA 1ZGLM 4J4PD 1KCLA 3RZCC 4YFEA 5E4EB 1HHJB 2E8ZA 5T33H 2WIIB 3IDJA 1XR9A 3G6AB 4HZLA 3VXTB 4DCQA 5KVMC 1PW3A 3ZDZE 3T0WA 2IF7A 4U1IB 1VACA 2NLJB 1RUPL 2XKNB 4UUJA 2AJSL 3KYKH 3EYUL 4PG2C 2ZUQB 3QNZA 2EXWD 4JZOB 5DI8A 1LO5B 4M7KH 1KTLA 4MS8D 3DLQR 1XZ0B 1A1MB 2EKSB 5F7DB 4F15C 3LKNB 4OF6A 4KKCD 4I8DA 3QRFM 2XZQL 1X5JA 2W59A 5GRVL 3LEXA 2JJSA 1WAAA 4WY7L 2ZNXA 3MYZA 1ZHLA 4FNLH 2MQCA 1SBBA 4ERSL 2OL3H 4ALAL 2VDMH 1ZHBA 5I0ZA 3MREA 1JUFA 1Q1JH 1I1AA 4PRNB 5CZKA 1TNNA 2E27H 3MBEB 1RZGB 4JDVA 5GSRA 1NMCC 3WHXB 4LSUH 1FPTL 3IKCB 4BM7A 4WU7B 1T04B 3MGTB 4YC2C 2IBZX 4KC3B 1R5IA 5DZLA 3RPKA 2X1WL 2EYTA 3RDTB 2VZTA 3HAEA 3CXDH 2I60H 4RDQF 4U6YB 3MV8E 4U1KB 2CLZA 3ARGA 3QO0A 3RA7H 1MIML 2VERN 3BRDA 1OAYL 1WWCA 3FQUB 1XR8B 4MMZC 2Y7QA 2G9HA 2FHFA 3IDNB 5GRUL 3U0WL 3MO1A 4M7JH 43CAA 4DKEL 4UT9H 5CEXA 5EFIB 2AK4B 1IQWH 5DJXA 4PY8I 5IG7A 5KVEL 4AH2A 4KJYA 1U42A 4ZMAT 5CGTA 4O2EB 4X98A 2VUOA 4QRQB 4UT6L 5GGQH 2JLLA 1DL7L 5GRZA 3GUTB 4KI5F 3NCBB 3ARQA 2B1HL 2AERT 2VXUL 5EU3A 1ZT1A 5I1GL 4MNGA 2I5YL 2BMKA 3H8NA 4L5FH 1U8MA 2B1AH 2Q7YA 1DSFH 2HJFB 4GRLC 1XGTB 3V4PL 4GW5A 1CIDA 5D1XA 3KGRA 4PJ5E 4PGCB 1M7IB 4RFNB 3VXPB 1RIVL 3WIIH 2IMNA 4L9DA 4XBPB 1U58A 5A3ID 5JIPA 2HG5A 5GGVY 5DRWB 2QSCL 4XCFL 4I5BB 1KTRL 4EXPX 1DVFB 1R0AH 5IR1B 3BPLB 4RQQB 3T0ED 4Y4HA 3IKKA 3O4LE 3V4VH 4I3RH 1U8NB 4J6RH 2MCPL 5FK9A 3GMMA 4H0IA 3U79A 1NDMB 3S3JA 3VRJA 4YDKH 1ZLUK 3WFDL 1PBYA 2AV7A 4RA3A 5EG6C 4LLDB 5F96L 3IRPX 4JZJA 1HOCB 4ZPVA 3U4EA 3ULVE 2NY3C 1KCRL 4XMPH 4X6CA 2NX5D 2X4OB 1AGBA 2XV6B 1U6AL 5IFAL 4PGBB 1RI8A 1YEHL 1VERA 1YMHB 1ADQH 5DQJB 4TQEL 3EZ8A 4LVHC 4K3JH 2CPCA 4N5ED 1X9QA 3PWLB 4P9HH 5JW4M 2VAAB 1EHLL 4KI1A 1CL7H 2EDDA 1A02N 1X4XA 4G6JH 5B8CB 2CMRL 4UTAL 5EU5B 3U9PL 5D72H 2KBGA 4X9BA 4CVZA 1KN2H 2BNQB 2WP3T 1RK0A 3MV8B 5I1EH 3DVNB 5HGAB 4JRYA 5JQHC 5E6ID 3MRRA 3NFNB 3TN0C 3S36X 3B8SA 5DRZA 1WEJH 4PBXA 1IE5A 2P7TA 5CIPH 1JNHA 2PW1A 3MRNA 2G60H 2FJFA 3FB8B 3FFCD 3NTCH 1IZKA 1J11A 1MCJA 1ZEAH 3GSVB 4XPHH 4W6YB 3ZTJG 4YUEH 1CDYA 3BQUC 5EUKB 1SBSH 3PGCB 3K74B 3C5ZA 3K1KC 5BZDA 3WFCL 2EDYA 1NC2D 3HC4L 3FTGB 1OL0A 1P4LA 4NRXB 4WFHD 3WNMA 3PWNB 1IEBB 2CKBL 1CK0H 3O81A 4PRHA 4PJ5B 2EDHA 3RBSA 4AL8L 4LSDA 3KPRD 1GZPB 4C4KO 4DN3L 4L9LB 1JFQH 3X3FL 2Q8AL 4EN3C 5CWSB 1PY9A 1IAIM 1HIML 3QH3B 1DQML 3O4LB 1BQUA 4L4VD 4AMKH 1FJ1B 3RWDA 3QZWA 5JDSA 4DFIA 3JTSB 5HBBA 1CFQB 5D7JB 5I18H 1EXUA 5GGRY 2B8OT 1KB9J 2H8PB 1CU4L 4KPHL 3GSOB 1EIBA 5ECJE 2FATH 3GRWH 4HG4J 3TJEH 1M6OA 1FFPB 5GJTH 3H3BC 5CS7A 2CR6A 2EE3A 4NQCD 2X7LA 1OAXL 4OCYH 3N06B 4DVBA 3T1FB 1NPUA 3LQAL 3I50L 5EC2B 1FGVH 2GYSA 4LLWA 2ZKHH 3GBNL 3O8XC 4DZBB 4D8PB 4H25A 4U3XA 1PEWA 1DLFL 2ARWA 2VJXA 3G6JF 4D9RD 2YWYA 3T2NH 3HE7D 5EIIB 5JHDD 1LP9A 3BH8B 2VZUA 1R3KB 3GSNB 4N0UE 4M03A 3MOQA 1JPST 3WFZA 4PRIE 5BOZG 1PG7W 1KIQB 4F3FB 5CSGA 4IS6A 5J06A 1RZ8B 5DRNA 3LKPB 4U1MB 2DLHA 3U9UA 4LASL 1B0RB 1G9ML 2FSEB 2HT3C 1N2RA 1I8IB 2WWKT 5CILH 2L7JA 4P4KB 4P5MB 4WIQA 4YHNA 3UTZB 1QRKA 3QDJD 4FQIL 3JXAA 3NGBC 1MSPA 5GJSL 1JTOA 1FE8L 1KEML 3X12B 4RA0C 5AWNL 4ODUB 1F4XH 2QSVA 1QO3A 5KANG 2NY0D 4YHZH 4M9PA 1R5WB 1NCCH 1WBZA 3RL1B 5FUCC 4RCAA 3RRQA 2NYYC 4UU9A 4ZFZB 4IBLT 4ZXBA 3MV01 4Y4KD 3L3KA 1RZIB 3VFWA 5E2JA 2IADA 3OMZA 1AQDA 1LO0H 4KTYA 4NOFA 2C1PB 2Z35B 4X6DE 4D3CH 3NACH 1C5CH 1CE6A 1MCOL 4XI5D 2X05A 4ZYKA 1K3ZA 3BGFC 2JJTC 5ADPL 3DVGB 4BKLA 1OVZA 2Q86B 1QBBA 3AS3A 5DURD 1HDMA 5FM5O 1YJDC 2RB8A 1FO0L 3GSWB 3RGVD 4LLMA 2IFGA 4EUPH 3ZE1E 1S8DA 4NWUL 3FZUD 4OI9A 2BVQB 3OTTA 1KPUB 4WDIA 2X4SA 3O0RL 3IFOB 4HUMB 4ZUUB 3O3AA 1F00I 2WZPD 4GO6B 4XPTL 1NGPH 4JO2H 3ZDYE 3ARSA 4XP6L 5F1KC 3U48A 1MI5E 7CGTA 4YPGB 2XN9A 5K9KB 4OI7A 1VGEH 1KLGB 1GXEA 5CSBA 3QDGE 3TBTB 4GBXB 4X6FB 4LLVA 3EO0B 2VE6A 1XIWA 2IAMC 1C12B 3GKWH 3QQ9D 1D6EA 4HLZG 1GGUA 1RUKL 5FKAB 1AO7D 3GSXA 1BVZA 4K55A 1GGBH 4E42A 1IGTB 3ARFA 4J3TA 3Q0HA 5GGSA 1FL3B 4FHBD 2YEZB 5EBMA 3RWGA 1IGCL 3H3PH 1XGPA 4PJXE 1Q72H 4X8JA 4PRIB 5T3XE 1INEL 5IMLA 1NFKA 1KLFA 1DEEB 4U4BA 1NGZA 4LK4A 4XMKH 3SGEI 4LOUC 4WO4D 3UJIL 4PGJA 1SEQL 4NZRL 4UB0L 1VPOH 1U3HA 2HLAA 4ZUTB 3TIEB 3LCYA 2D7MA 1PY4A 1YMMA 4Y5VB 2BC4A 1MIEH 5SWQB 1KYOK 3MRDB 4EVNB 5SWZE 1MLBA 1V3KA 4V2CB 4HX1A 3OKNA 5INCA 3KPNA 4NKMA 4U1GB 3WYRA 4KK5C 5DJ8B 5JUEL 5F8RC 3P4MA 3O6FB 3LZFH 4OCLC 3UO1L 1EEZA 3K7UA 1QFPA 4XXDB 3RWJB 4DGYL 3SQOL 1E6OH 5HGDA 3OB0K 1X5FA 1NFDA 5I30H 5TGBA 1LO2L 4WWID 4IRZL 3WIFB 2ZOLB 4IM8A 3TA3B 2EDEA 1BVKA 1MFAH 1YNLH 3RWEB 4HWBH 5D96B 2J8UF 4X6DB 1ZVHA 1UM4H 2XA8H 5DWUH 5E6ZA 3FRPG 5E99H 1DCLA 3LQZA 4JFQB 3MROB 1W0WA 3L3OB 2IPUK 5E00A 4XP4L 5DD1L 2IG2L 5KSAB 3MBED 1UM6H 3JWDH 1FLRL 1YPZE 43C9B 1JGEA 3I9GL 3O4OC 3MLUH 1WAAE 3HLAB 4KKAD 5FGSA 2AK1L 5DRXA 5DEZA 1EZVY 1ZANH 3GMQB 1HKLH 4WFED 3K2MC 3O6KH 1MI5B 4KHXH 5C0NC 1GC1H 2CK0L 1MWAB 1Y0LA 4M93C 3ILPA 2PTUA 3QDGB 3PL6B 3BPCB 4G8IB 4MLIA 1B2WL 1PZ5B 3L95B 2ICEA 2GK0B 2ADFL 2BSTA 3S96A 4IOIA 1T89C 3CAFA 2YD2A 3S35H 2AK4D 4DUWA 1MFBH 2W9DH 2ZUVA 1U3YA 4Y16A 4R90L 4PJXB 35C8H 4HIJA 5ESAA 3UZVB 4K9EC 3MV9A 4ENED 4NZTL 1EHXA 3QIUC 3D1MC 5EU7C 5KN5B 5GRJH 1CD1A 1P2CA 4OD2A 4TTDD 1AI1L 3NFSH 3TIDA 3LKQB 2CD0A 4JQIL 1I1RA 1OTSD 3DROB 5MP6H 4R97C 5BV7C 3FN0L 4QEGA 3MYJB 5EIQA 4OAWA 2NR6C 1NLBH 3WFBL 4LFHD 2N1KA 3TFKC 5IEHA 4QNPF 1OTUC 3MA9L 1NGQH 1X3DA 3SPVB 2GITA 3J7HA 4PJHF 3NABL 5TF1L 1DVFD 4N0CC 3U0PB 5C9JB 2D4DA 5BXFA 4KZDH 4MNGE 4TULH 3C60C 4M3KB 1ZT4A 4TSCL 3IDJB 4HZLB 1XR9B 4QHUA 4DCQB 2DTML 1NCNA 2ITCA 1XGQA 1NSNH 3QPXL 4POZD 3TVMC 1EEYA 3I85A 3GI8L 1VACB 3MMEA 1NBZA 3RDTC 1FV1A 4MDJA 1T5XA 3K2UL 4UUJB 4OFVA 3K80A 4ONGH 3VDCA 4JY6A 4EQ3A 3QNZB 4NUJA 3PNWA 5I8EA 5DI8B 3U1SH 5I2IA 5KW9L 1KTLB 1BX2A 3SO3B 1N5YH 4DKDC 4XH2A 4ZD3L 5GRVK 1RJCA 2A74A 3LEXB 2WBKA 1FNLA 3CC5A 2AV1A 1D6VH 5IFHL 1UWEL 4PTUA 5SWSA 3BPOB 1X5YA 5F7EH 1WC7A 5DD0L 4CKVX 1ZHLB 5I1CL 3N1MC 5KSBF 3S98A 5HVGB 3PIQA 1ZHBB 4X6CE 1JGDA 3IFPA 3MLZL 4K2UL 4KUZH 4PPTA 3ZDXF 4YDIL 3MREB 1JUFB 1I1AB 1SJEA 3V4UH 3QXAA 2BNQD 4JHWH 3WHE1 3T0DA 3MV8D 4JDVB 1KLUA 5GSRB 4OQTL 1INDL 4HLZH 3X11A 1Q0YH 3HMXH 5D7SL 2YKLL 1WZ1H 3RKDC 4KV5E 4P0DA 4G6AC 1R5IB 4MB4A 1Q94A 1CN4A 3BPLC 3KYMA 2EYTB 4PR5A 3HAEB 1OAQL 1EBAA 3S37X 2CLZB 3ARGB 3QO0B 3H7BA 4JRYE 1AY1L 2HMID 4LSPH 2Y7QB 2G9HB 5GHWL 3LKSA 4YHLH 3O2VH 1XGYH 3MO1B 43CAB 5HI5C 4OGAD 5CEXB 2UVFA 5DFVC 1YEGL 5DJXB 1I9IH 5IG7B 3WJLA 4L8BA 4KJYB 1BGXH 2EDNA 4PJ5D 3F58L 4YHMH 4X98B 3VFPA 3NZHH 3GMRA 3A67H 5DJ6A 3FO9A 2ICCA 5F7HA 3TBSA 1A1OA 1WZKA 4OGYH 4MQSB 4TUOA 5EU3B 1IKNC 1ZT1B 3BVNA 4P57A 4MNGB 3O4LD 1RIUH 2BMKB 3C6SA 1U8MB 2Q7YB 2ZZUT 1KXQE 3RHWK 1X5XA 4RWYH 4GW5B 1OWRM 2Q8BL 3GBLA 4GMTH 5D1XB 4PRHE 3BGMA 1CBVL 3IDMA 4FMKA 5D7KE 3VXNA 4WTWA 1MFCH 1S5HA 1U58B 4AEIH 1NGXA 5DLML 3T0AA 4PJGF 2VQTA 1P84K 4Y4HB 5D1ZC 1P9MC 3TWCL 2QQKH 3IU4L 1Z9OA 2DS4A 1ZS8A 3DXAA 4MQXD 4FFZL 4LHQB 3GMMB 5FK9B 1FIEA 4HV8A 4NPYA 5ALCL 4BFGA 4U7SA 4N0FA 3VRJB 4I77H 1MRCH 2AV7B 3F12A 2KZ1B 2FD6H 3LDBC 4HH8A 4JZJB 4ZPVB 1JI2A 3U4EB 1J7VR 1BREA 1RVFH 3QCUH 4LSSH 4X6CB 2DBLH 1AGBB 4KKBC 3V0VB 4L8CB 1NH6A 5I8CA 1WTLA 4O02L 1YEKL 2BX5A 4Y8DC 3N85H 5GGRA 4C57C 1A3LL 3RWFA 2H32H 2EEAA 1QLEL 1MNUL 4JO3L 1AH1A 3WNLA 4CVZB 5AZ2H 5ETUA 3M8OL 1RK0B 1RMFH 2DQCH 2W0LA 4NNXA 4JRYB 5D7JC 3MRRB 4WNQA 2I25N 5EBWA 4TOYH 5DRZB 3ELAT 3BJ91 2EDBA 2P7TB 4JFDA 4NQVA 1JWUA 1JNHB 1KT2A 2PW1B 3MRNB 3NIFE 5DEFA 5GZOC 1A7QL 2FJFB 3ULVC 5EOQH 2ADJA 2XRAH 2PN5A 3S34L 1AGCA 2EDFA 3BP5A 1J1OH 5FYKU 3RBGA 4JRXD 4XZUA 3C5ZB 1U92A 5BZDB 3QDHA 3BEVA 1LDSA 4UNTA 4OM0L 4TVPE 1HXMA 1P4LB 3B4NA 2VC2L 4M8QA 4WHYH 1AIFA 3Q6FA 1UC6A 4HIXL 4NN6C 4PRHB 4RGNE 3ULUC 4OLZH 5C0AA 1H15A 3EGSA 1Y6NR 4YZFE 1DQTA 3O41A 1MY5A 1BWMA 4L3CA 4P46C 4FMFA 2PUQT 1EO8H 1KC5H 2JJVA 4OI8A 3DX9A 1LO3L 3CX5J 3RWDB 3IGAA 3QZWB 5JDSB 1RZ7L 3TJHC 3SKJL 3UJTL 4JJHA 1EXUB 4MVBC 1ACYL 4NHCH 4YIQA 4CRPA 1XGUA 4P4KC 4WEMB 4EI5A 1I8LA 1M6OB 4J3UA 5L0QB 3MODL 2J88L 4C4KT 2ERJC 3DX6A 1TENA 4KMQA 2X7LB 4UTBL 3FB5A 3DARA 5D2NC 4DVBB 1R3IL 4CN4A 4TNWF 4PJBA 3BP7A 3LEYH 4MA7H 2XN9E 4LLWB 3VJ6A 5HD8C 5K9JH 4PRID 5DD5H 2HT4D 1JMZA 1A9EA 3MLWH 1UEYA 4H25B 3DO7A 3TF7C 2YA0A 5E8EA 5DJYA 1N59A 3C8DA 4KRMB 5FHBL 1LP9B 3N1FC 3VDBA 1W0VA 1NCDH 1I1YA 3MLRH 2QSQA 4LCIH 5F6HJ 4LSVL 2XI9A 3RY6C 1J1XL 3OXSA 3WKNA 4PBVC 3DETC 5FUOL 3O6FD 2VN7A 3WDHA 4IS6B 3D2UA 4RGOH 3QYCA 5DRNB 1I1FA 4D0CA 5LG1A 3AROA 3U9UB 1YMME 2OM5A 1CCZA 1N2RB 1M71A 3PF2A 2DM7A 1WICA 4YHNB 3UJJL 2DD8H 5CJOL 5E1AA 4OB5L 2XICA 1MPAL 4XT1C 3TA3D 3PUCA 4E0RA 4YBQC 1KJ3H 4LGRB 4R0LA 3OZ9L 1A4KA 2DTSA 1UT9A 3B2VL 1A3RH 4G8EA 2HLFD 2YOCA 3T4YA 1QO3B 4GBXC 3G6JA 1WBZB 2V2TA 4RGNB 1JGVL 1EGJH 4UU9B 1MWAL 1T1XA 1UADC 3U4AA 3V7MA 2Y07H 2YMXH 3LB6C 4ZXBB 3SDYH 2DKMA 3RP1A 3L3KB 4OLWH 2XXMB 1QNZH 4XVJH 3VFWB 4ZTOL 5F7KC 2IADB 1EAJA 1AQDB 1U2HA 2QL1A 4DK6A 4FQQA 1CE6B 3HI5L 4ZYKB 1QA9A 5MHSE 2YPLA 1DFBH 1MI5D 4QRRA 4PD4K 4BKLB 3MRJA 1HH9A 1HDMB 3FRUA 3MCLH 3O3UN 5DVMA 5T3XL 4DKAA 4LLMB 5DFTA 3QDGD 5JR1L 1S8DB 3PL6D 1Z3GL 2Y4SA 1BM3H 1KN4L 2BHYA 4WDIB 4XCYA 2X4SB 3K4DA 3O3AB 3MACL 5HI3D 5LQBL 2X10A 2XWTA 1IM9D 1UB5A 1AGDA 2Z8WC 2NXYC 5DGQA 4IMKC 2P5WA 2APFA 4HJJL 4QXUL 4LPUA 2XN9B 1YJDH 5FYLD 4OLUH 2A6IA 1A5FH 1ZVSA 4QLRA 5I1JL 2P47B 4XHJC 4ORGA 5IQ9A 4LLVB 2VE6B 1XIWB 4X4YA 3O2WH 1GGCL 2Z31C 1JYXA 2OL3A 1D6EB 3GSXB 4E42B 1HYSC 3CLEH 3ARFB 3FHQA 5GGSB 1NCBL 1S5IH 4YXKL 5EBMB 3RWGB 1B9ZA 1XGPB 3U30C 4JG1L 4X8JB 1UKQA 3V8OA 3MV9E 5IMLB 4BQBA 4DOHE 5KSAC 1NFIA 1NGZB 4U6VH 1EUTA 1KCUH 1SY6H 1MRFH 2BVUA 1F2XK 5TFSH 3D39A 1U3HB 2HLAB 4LAQH 4PJIF 4QRTA 5KZCB 3GJEA 1OGTA 2EEDA 1YMMB 2BC4B 1FVCA 4KTEL 2B5IB 3MUY1 1H5BA 1L6XA 1MLBB 4HX1B 4XP9L 3EYVA 2DAVA 3OKNB 4KFZC 3WIHH 5INCB 9CGTA 3KPNB 1D5BA 4NKMB 3HMWH 2W0KA 4DWHA 2R4RL 2JE8A 3OKOA 4A6YH 5IJKC 3P4MB 4NQXA 1EEZB 4XC1L 1DANT 5DD3H 3BRGC 5ICYA 1R5VA 5HGDB 4O5LL 4OZFA 4J2XA 1W72H 2H45A 2X6MA 2DDQL 5TGBB 4LRIC 1UYWH 1F3RB 1E4XI 1BVKB 3BYYA 3ES6A 1W8OA 1BBJA 3E6HA 5HDBF 2HTKD 3LQZB 4Y19A 1W0WB 5E00B 1OAKH 3CIQA 2ORBH 3DURA 4P2RA 4JKKA 3HN3A 4HJ0D 3S36L 5IESH 1WCQA 4JPWL 5DEGB 1JGEB 5ILTL 5IBUB 3ZL4H 4LSTL 5F7YC 3IFLH 4XAWL 3FN9A 4N9OB 5SWSE 3EFDH 2HKFL 4OCMC 3SGJA 5DRXB 2BCKA 5L6YL 4XVTH 4KTDL 8CGTA 1IAOA 3HFMH 2R69L 1WCBA 3KR3H 3ZHLA 1Y0LB 4XB7A 1YN7A 3R4DA 5FB8B 5IGXL 3ILPB 2WW8A 5ADOH 3BUTA 3ARGD 5DXWA 3U7AA 3IJYA 3HR6A 3ZZ1A 2J8OA 4LSQH 1IQDA 5JXEA 3P4NA 5IVZA 1PKOA 2ICEB 3MOBH 4ORZC 5HJ3A 1RUAL 1RUML 2EE2A 2BSTB 4GXVL 3AMKA 4IOIB 4Q9BA 1KIRA 1X4YA 4K3DL 1X4ZA 4Y16B 3TCXA 5C0GA 4PV9A 4HIJB 5ESAB 3MV9B 2ZJSH 4DOHB 4Y4FC 3UX9B 1FRGL 3D3VA 5I1AA 4KHTH 5EA0L 2JJSC 1F97A 2R0ZL 4QY8A 2VXTH 3B2UD 2OSLA 1IC7L 1HSBA 1CD1B 1MCEA 5IQ7H 1P2CB 4OD2B 5T1KA 1E4KC 3RX5A 4EDWL 3E8UH 2BVYA 1JHKL 4OAWB 5D1XD 1I1AC 2DIBA 2IBGA 2QQLL 5IVOA 4HF5H 5IEHB 2J12B 1QSED 2GITB 5F9WB 1U36A 5CIPA 5EUOF 1YA5A 4Y4HD 5F9DC 5BXFB 1YYML 5FUZH 2IFFH 1ZT4B 4I0KA 3MLTA 4QHUB 3ZYJA 3PDGA 1IKFH 3ALPA 2ITCB 1XGQB 5BV7H 2ARJA 1EEYB 3NIDF 4XBEH 3MMEB 1NBZB 4LQFL 1FV1B 5MENA 4MDJB 3TT3H 1T5XB 1RURH 4PP1C 3PP4L 2AXJA 1NBYA 1CVSC 3IJSA 1U8IA 4JY6B 1TZHA 4OD1L 3QIBA 5DMKA 2DQJL 4NUJB 3PNWB 5I8EB 1JZ5A 4HGMA 1CLZL 5I2IB 4OLVL 5FM4A 3VFOA 3LAFA 3HR5A 3BESR 3AREA 4NKIL 4S1QH 5C70A 4XH2B 3T0VA 2BERA 1YEFL 2C9AA 3DXAE 4JKLA 4YHPA 3VG0L 2A74B 1LNUA 3C6LC 1DDHA 3QIWC 2FX7H 1E0OB 2AV1B 3CC5B 1C16A 4PTUB 5SWSB 1WC7B 1NDGA 1RHHA 3C08L 3WMSA 5CEZH 2DQHH 3CFEA 4IRJA 2ZUXA 3QI9A 5C0JA 4OZIF 2OCFD 3G9VA 1IVLA 3PIQB 1E4XL 4KI5E 1JGDB 3IFPB 1HN1A 4MCYA 2MHAA 1SJEB 2BVTA 3QXAB 5J11B 1NQBA 2B2XL 4L29A 5AZEH 3S5LA 3AU1A 1KLUB 2V5RA 4QHLA 3RAJH 3T04D 3F5WA 5E2TH 2C3VB 5D6DA 4HEPG 4GRWE 5K59F 2D0HA 3GRWA 4APQC 1BF2A 2NY7H 3UTTA 3VFNA 4DTGH 3GDBA 4UV7H 1IFHH 2R0KL 4DN4L 5JIHA 1QFUH 1NMBH 1ND0A 4RRPA 1VESA 1Q94B 4ODTL 1G0XA 3KYMB 1IBGL 4PR5B 1S7UA 3OBAA 5CCKH 1C5DA 2DM3A 3NVQA 3H7BB 4P2YA 4NO3A 2CRMA 4WRLA 3TH3T 3LKSB 4NM8L 2D03H 2P43B 3FO0L 4JFDE 4LAJH 2PNDA 2YUXA 3BWUC 4ZAKC 4RMRA 5A3IC 1DN2A 4PLKD 5LXGL 4RFOH 4L8BB 5LGJB 4XX1E 3ARTA 4PRHD 4WJ5A 4HGWA 3VFPB 5D7KD 1CZ8L 3GMRB 5DJ6B 3FO9B 4HAGA 1S7SA 5DT1H 3TBSB 1A1OB 1TZGH 5I1KL 4TUOB 1TJGL 4M43L 3BVNB 4P57B 3AXLA 1N0XH 1HQ4A 3BO8A 3V7AE 3VGEA 1KB5H 2BDNL 1VGKA 3C6SB 1YQVL 4KQ3H 1C8PA 2Q3AA 2R29H 3ARXA 3KPPA 5D5MF 5IV2A 2APXA 3BGMB 3A6CL 3I3DA 3IDMB 5C0AE 3VXNB 3ZHKA 3HZMA 1S5HB 1KPVA 1MF2H 4OCXL 2OR9H 5I1IL 1NGXB 3MZTA 4HPYL 5DJCA 1J05A 2YD3A 3UCRA 1IC5L 4MDIA 1V3JA 3BDYH 1ZS8B 3S9DB 3DXAB 4ZUWA 4YFDB 4HV8B 4NPYB 4QYOA 4N0FB 1U8KA 2NY2B 5MEQA 2DB8A 1MCPL 1NAMA 3F12B 5AAWA 3JV0A 4K7PX 1Z0NA 3C5ZC 1ZLUH 3EYSL 2VXQH 4HQQL 2QADC 3FT2A 2D9QB 1JRHI 4ODVL 3R0MA 2C3GA 4XPBL 1LVEA 5I8CB 3P11L 1KB9K 5HYJD 4PJBE 2LTQC 4GRWB 2YSSA 1AXTL 5GGRB 5LVEA 4HG4K 4PV8A 3ZKMC 4EUPA 1XH3A 3NBNA 3RWFB 4K8RL 3GMLA 3CFIC 5FAAA 2C4FT 2GW5A 1P7HL 5ETUB 5JZ7C 5I6XC 3VFSA 1JIBA 3HZYA 3TV3H 4NNXB 1HHHA 5CINL 3VW3H 5EPMA 4KVNL 4WNQB 4DAGH 2EXYD 1WUNT 5EBWB 2A77L 1EEUA 4ZO7A 1NCWL 4JFDB 4NQVB 1JWUB 5DHYA 1KT2B 5GRWA 4UBDD 4K8RD 1DBBL 1MCIA 5CJXC 1AFVH 3HG1A 4F57L 4XPAH 2ADJB 1AJ7L 1G7IA 5L0QC 3O2DH 4YQXH 2AGJH 1AGCB 4RGND 1SEBA 3BP5B 4L1HA 1U2CA 2DLGA 4X7SH 5JW4Q 1MLCA 4XZUB 4ZXBD 1EFQA 1U92B 1NGWA 2E7LA 5C0CA 3BEVB 1HXMB 4YBLB 1HQRA 2PTTA 4M8QB 1AIFB 3MLSL 2AXGA 4HKXB 3Q6FB 1OAZL 3F7QA 1HZHL 3G5YA 3G6JE 5CGYC 1BZQK 4X9GA 5C0AB 4PJDF 1H15B 1I9EA 3EGSB 1CLOL 4LLYA 1RUQH 3T4AA 1MHEA 4MGXA 3O41B 2WUBH 4L3CB 3L3JA 4HMEA 4HS6A 2AJ3A 4MD0A 4OLYL 3DX9B 3IGAB 3W2DH 5DYOA 4NNPL 1FNSH 2DM4A 2YPLE 3BD4A 4QRRE 2B20A 3ULUH 4BZ1H 4X8XA 4TUKH 1XCTA 2XN9D 4RIRA 1XGUB 1A22B 4L8SC 2AJZA 3AY4A 5H37H 3E0GA 4EI5B 3W5NA 1J8HA 4I18A 5J1AA 3KNBA 4HWBA 1XIWD 3DX6B 2AEPL 5K9QG 4XC3L 5E8DH 2YRZA 2WWMC 4XAKE 3FB5B 5LGHL 1H3XA 4BUGA 1UCTA 4ODHL 3ARFD 3FHAA 4PJBB 4U1LA 3BP7B 2IPTH 4M1CD 1U91A 3VJ6B 3OPZH 2O5ZL 5TF0A 2V2WA 1A9EB 3U7WH 4AZ8A 1K4DA 4P3DA 1A6UL 4G3YH 4CL7A 3DO7B 3RTQC 3MRBA 1G7JA 4XXCA 1U3HD 5E8EB 2L7UA 5DJYB 1N59B 4TRPH 5KZCD 3RVXC 2XA3A 1YMMD 1PX3A 3QNYA 4NQEA 1W0VB 2NY5L 4KRPB 1I1YB 2F8OA 1MEXL 3DO3A 3OKEA 3H9YA 1JRHL 4OJFH 2NTFA 3O3BA 5D9SA 2VN4A 1PG7H 5F89A 4Z18A 3OXSB 2R56H 3VD3A 2FGWL 1SMAA 3D39E 1B6DA 3D2UB 4OBSA 4I0PA 3WEXA 1OOAA 1I1FB 3BKML 3HE6A 3DSFL 2AJXH 5E7BA 4XWGH 1M71B 5FO9A 1GZQA 5E1AB 1NCTA 3ZTNL 5KAQF 4U33A 4E0RB 1JZ8A 4R0LB 1A4KB 4Q9RH 3S88H 1BIIA 3SBWC 4G8EB 4CN6A 5BW7C 3T4YB 3SE4A 5MHSD 3SKMA 4L3EA 3G6JB 5IF0A 2V2TB 4OZHF 1B4RA 3WO4C 1T1XB 4MX7A 4QHMA 4OCRH 4NKQB 2HWZL 4MA8L 1T20A 3CK0L 1Z6JT 3QUZA 1T03L 1A14H 3B9KA 3L5HA 3VFTA 4FQQB 2MCG1 1CGSL 5C6WH 2RAMA 1QA9B 4AIOA 2UV3A 4Y19E 2YPLB 4QRRB 3CGTA 3S37L 3MRJB 1HH9B 2NNAA 3FRUB 1GIGL 4P2RE 2X1OA 4OQ1A 3TO2A 4ZFGL 4O4YH 2X4UA 3DTXA 3LS5H 2NY6C 4XCYB 4JQXC 1I7ZA 1BD2A 4MXWL 2XWTB 1UB5B 3RZCA 1A6WH 3HAEG 1AGDB 2P5WB 4WI7A 3WXVH 2EE6A 4FTVE 1INQA 1GGIH 1MFDL 3D69A 2BXYA 5L2KA 4ODSL 3MV9D 3QT2A 2A6IB 4HBCL 4P4RA 1ZVSB 2VKWA 5JTWA 5IQ9B 3K8MA 4ORGB 1JHTA 4AQOA 3JV5A 2V5TA 3EJZD 2AKRA 2Y6SC 4JN1L 2H1PL 4X4YB 4AYFA 3ZKSD 2EDTA 5L7XH 4XVSH 2VH5L 2J8UE 2OL3B 4PG2A 3GFUA 4K71B 4KJQD 2OTUA 1A7NH 3LKRA 5LJYH 3FONA 4WWKC 1MJ7L 4PUBH 1XAUA 4G7VL 2J5LB 2IGFL 1OARH 2VZ1A 2PYEE 5ESVA 1VCAA 1NFIB 3D3VE 3HMXA 2JCCF 1DBJH 3D39B 3I75A 3P3YA 2O5XL 3H2WA 2PXYD 3ZO0A 2BJML 4QRTB 4XMLL 4GT7A 2YUWA 3GJEB 1OGTB 3NCFB 1RZFL 2CO6B 1FVCB 1UJTA 4U1JA 5IBLD 1H5BB 3EYVB 1Z9LA 1FGNH 5CJQL 4S1SL 3U4BL 1D5BB 2WQRA 4MHHI 5EC1A 3OKOB 5TE6H 5A2FA 4NQXB 2QSTA 3IDGA 4KK6D 4KKNA 3PGDA 4NN7C 4EEEA 3NH7L 3ZMRA 3EOAA 4XP5L 3VI3F 5GGVL 1CFVH 4H1LG 5ICYB 1R5VB 2FB4H 5KOVC 4JVWA 4OZFB 4QT5A 3Q5OA 5DHVA 3HNVL 1BBDH 3NZ8B 3NOIA 4Y16C 4MXVF 5BZWA 3ES6B 5SWSD 1D9KA 3OB0H 5MENE 1BBJB 3E6HB 5IW6A 1HSAA 1IM3A 1HHKA 4OV6F 2A0LC 2GJ6A 2NY1B 4Y19B 3RUGA 1ZLVK 3W9DA 1IT9L 4JPKL 4QOKA 2VR9A 5AYUH 4IRSB 3DURB 3MLYH 4ACPA 3I02A 4P2RB 1JYVA 4NC1C 4K07A 4GS7C 4JFEA 1IAIH 1I3GL 1UA6H 1EX0A 3FRPA 4RAHA 1LDPH 3K4AA 3L7FA 1RD6A 4FZEH 7FABL 2WBJA 5HHVL 3PHOA 4J3VA 4GKZA 1G1CA 5HHOE 2BCKB 2C3HA 4R4FL 3ARVA 4QNPE 1CDHA 3DVFA 1IAOB 2EH7H 4KROD 1A6TA 4PJHE 2KZWA 1WCBB 1I85C 5EU4A 3FL7A 4FP8H 4FTVB 3CH8A 1YN7B 3EDDA 3UTOA 3GBMH 4LLAA 5I8OL 4GRLA 1TJHL 5ALBL 3IJYB 3VG9B 1IQDB 2K3TA 3P4NB 5IVZB 5HYQA 4AJ0A 2HRPH 1X44A 5HJ3B 2APBA 4H88L 3UTTE 4YHOL 1K85A 3WE6A 3ETBF 2YBRA 1KIRB 1P6FA 3CVIH 3ZT5A 1T83C 2E9WA 3VXSE 3G6DH 5C0GB 4PV9B 1QBMH 1ZHNA 2CH8A 5BO1H 1DEDA 1BPVA 1G9NL 3D3VB 5I1AB 4MJ5A 2D0FA 2AABL 1TQBB 4Y2DD 4GG6F 1CR9H 3RQ3A 4QY8B 2H32A 2OSLB 1HSBB 3KPQA 4PLJC 4X80H 3TO4A 5T1KB 5KSBE 3LPFA 1LK3H 2XTJE 4BSJA 2LAAA 3GM8A 1DBAL 1FNGA 3BDXA 1CFSA 4ZOBA 4UIMA 5ISZA 2JB5L 3QG6A 3MXVL 2G5BA 4FFWC 5CIPB 2NW2A 1IGFH 4UMGA 1TIUA 4S10A 5IB2A 3MLTB 4CVWA 3Q5YA 3DXAD 4FQJL 4LBEA 2ARJB 4JFFA 4F58L 3QO1A 2NY2D 1YEEL 3SE9L 5MENB 4JFHD 1NBYB 1WWWX 3IJSB 1U8IB 1TZHB 5I73C 3QIBB 2E7MA 1JNNL 5D70L 5DMKB 1JWMA 4PS4L 2A9ML 4JHBA 2AJSH 2G75A 4QTIH 3VFOB 3HR5B 1HCVA 3AREB 5LBSH 3MLVH 3EYUH 5D71L 3O6MH 1ZA6A 2H26A 4YHPB 1DQLL 3ARRA 4R7NA 1FBIH 5L9DL 4ELMA 3BQUA 1JPSH 4G8GA 3WJLC 1LNUB 1NAKL 1DDHB 1LO4L 4PTTA 5J1TC 4JN2A 1NDGB 1RHHB 3OJVC 4W6XB 3CFEB 4IRJB 3S3PA 3QI9B 5C0JB 1MAML 1CF8H 5A43C 5CFHA 4WY7H 5EUOA 4K94H 4Q9QL 4MCYB 2MHAB 4Z76A 5CEYA 5TPWL 4L29B 4ERSH 1PSKL 3S5LB 4ALAH 3AU1B 4KKLD 4QHLB 2ITDA 3CSYA 2EYSA 2R8SH 4NOBA 2MKWA 3F5WB 3GIVA 3SDAC 4JFDD 4TN9A 2V5SA 3W9EA 3UTTB 1MHCA 3VFNB 4EN3A 1G9NC 4F2MA 1ND0B 4R2GD 4OTXL 5DUMH 3VFMA 3VXSB 4R4BA 1VB9A 2Y9RT 1WFOA 1S7UB 1T7VA 1C5DB 3NCMA 4BZYA 3GHBH 4NO3B 2E9BA 3VFGH 4EJ1C 2FBJL 4IDJH 3L5XL 3ARYA 1GAFH 4H0HB 4N0YL 5T5FH 5BOPA 1MIMH 4FQ2L 4LU5L 2XWBA 1OAYH 5DZNA 4NBZB 4HH9A 3HG1E 1F2QA 2UZIL 2AQ2A 5GRUH 1MHPL 1D3CA 4XNQA 4KI5C 4MAYC 1FC2D 2XTJB 4JY4A 4JAMA 3WD5L 1F4YH 4WJ5B 4HGWB 2B4CL 5C0AD 4H1LH 3S8WA 1Q9LA 5TQ2L 5E2UL 3WFEL 1E6JL 4FRWA 4F33A 1I7RA 1S7SB 4W6WB 2GTWA 4OIIL 1U8QB 3O8XA 1OP3K 2NQCA 3N1QC 5BQ7A 3O6LL 3A6BL 3AXLB 2ED9A 3MBXL 1HQ4B 3BO8B 4D9LH 1VGKB 2X89A 1FZMA 2B1HH 1G84A 3NCJL 3KPPB 5I1GH 4CDHA 5IV2B 5ID1A 4WUKL 3RY4A 3HZMB 1KPVB 3LRSA 4R6UA 3V4PH 4G7YH 4I4WA 1QSFA 3M17A 4EI5D 4PJAF 5HVHC 3QR2A 5DJCB 1J05B 1PDKA 3BIBX 2Y06L 1KCSH 1JP5A 4MDIB 2R9HD 1FSKB 4QO1A 1YC7A 4ZUWB 2OJZL 3M45A 4OT1L 3KAAA 4QYOB 2XTLA 4JKMA 1U8KB 2HKHL 5MEQB 1TNMA 2BNRA 2E3VA 1NAMB 4YDLB 4P5TD 1J0IA 3GEWB 3SOBL 2VXSH 3WFDH 2CDGA 1J8HE 3CX5K 1S9YA 3FT2B 5HDOA 3NA9L 5F96H 3Q1SL 1AQKL 3UC0L 2J6EH 2UZYB 4YFLF 3RZWA 5D93C 4KRPD 2GCYA 3P30H 1CVRA 2ZPKH 5D5MA 3CFCH 1U6AH 5IFAH 4Y89A 2YSSB 2X4QA 5HHME 4PV8B 1II4E 4FG6C 2QHLA 4EUPB 1XH3B 4BFIA 2OS7A 4TQEH 3LPWA 4M8VA 3STZA 3CU7A 3WUWB 3GMLB 1UXSA 1IGIL 3D2UD 3KJ6L 3QWRD 2RCSL 1ORQB 2OMBA 1UACH 3VFSB 3HZYB 1YYLL 1X7QA 4NQEE 2JJTA 3U9PH 1HHHB 5EPMB 4HKBB 3D85D 3LOWA 2F5BH 4EOWL 2B4CC 2WANA 5DHYB 1BFVH 2AVGA 2MNUA 4FABH 3HG1B 1Z2KA 3X3GH 1X5ZA 1G7IB 5FYJH 3U46A 1CGXA 1SEBB 3TGXA 5T33L 4OD3H 4BQ6A 1MLCB 1NGWB 5C0CB 2QQQA 3TNNA 1X6NA 4IOFC 4ZSOE 1HQRB 1SY6A 3DMMA 4LVNC 3WFCH 2AXGB 3QQNA 1WJ3A 4FQLH 3OJMB 1FORL 3HC4H 3BKJH 4L3EE 1EK3A 3G5YB 2DLFL 4M7KL 4QRRD 2NY4B 2XY1A 4PRPA 4LLYB 4Z7WA 2OMNA 4MQ7A 3T4AB 1B4JL 1R3HA 1MHEB 5BS0D 1J12A 4F37K 5JW5A 3L3JB 2DYPA 4HS6B 2AJ3B 5IEKA 4MD0B 5HYFA 5A2JH 3OQ3B 2FDBP 2W07A 2EICA 4XAKD 5DYOB 2OL3L 2VDML 1AR1C 1HIMH 3CMOH 1DQMH 1Q1JL 2P5WD 1LEIA 4J3WA 1W72A 1XCTB 4RIRB 2E27L 2OX5A 4JE4B 5B4MC 2AJZB 4N5UA 2YN5A 3VI4F 1J8HB 1NC4D 2AJVH 4I18B 5J1AB 3KNBB 4DW2H 1CU4H 4YX2L 5JLZA 4MJ4A 2ZCKH 5J13C 1FZJA 3SGKA 1BD2E 3VXMA 4DGVH 4ZO9A 3RVWC 2FEEI 1SQ2N 4U1LB 1RJYA 3IAQA 3CXDL 2I60L 1U91B 2X9WA 5HHMB 2BY1A 3NCYS 4BJLA 3RA7L 3ZSTA 2QJDA 5TQ0L 2HRLA 4GSDH 3R8QA 1K4DB 2HJKA 4P3DB 3I50H 3D39D 3MRBB 1G7JB 3BPNB 3VWJC 5EOCH 4M7JL 2WLZA 4UT9L 4MYWB 5ICXA 4NQEB 3QNYB 5KOMC 1IQWL 3OKEB 2NTFB 3O3BB 2OK0H 1BHGA 5D9SB 5F89B 3RWHA 4A2MA 1FVDA 8FABA 4BA8A 2CRYA 4RSVA 1FNFA 5GGQL 4OFDA 3WLWD 3DI2B 2PO6B 3WEXB 4I0PB 5H2BA 3S4SG 3FOMA 4HWNA 3HE6B 3K3QA 1BFSA 4UILH 4MA1B 4L5FL 3I3BA 2B1AL 1DSFL 5FO9B 1A8JH 1GZQB 1XF3A 3T2QA 4Z8FL 2MWCA 2EC9U 4LASH 1TITA 5E08H 3WIIL 2CIIA 3HS0A 1BIIB 4S1RH 3WNNA 5FA3A 3AAZA 3P73A 5FM5M 3SKMB 4L3EB 2NY1D 4Y19D 2XKNA 5IF0B 4B50A 1T89A 4I3RL 3V4VL 4Z0BL 3DGCR 4J6RL 2Q76A 4P2RD 3R06A 4MX7B 3ARPA 4QHMB 3TBYA 3ZYOA 4YDKL 1T20B 5F7DA 2GI7A 3FB6A 3QUZB 3B9KB 4Z7UF 3VFTB 5EH1A 3QIUA 2BHUA 2XKUA 4XMPL 4H0GA 1CIUA 1MAKA 2GJ6E 1MCCA 3RUGE 1IRAY 2NNAB 4QOKE 3PHSA 4ZS6C 1A6AA 1MCOH 3TPKA 1PYWA 1RIHL 3TO2B 1MELA 2IH1A 2X4UB 3DTXB 4K3JL 3LV3A 1P4BH 1VEMA 4NN5C 1FO0H 4P9HL 4OZGF 4F8TA 4FQCH 1I7ZB 1S9KC 1BD2B 4RX4A 1QUNA 1FP5A 3OSKA 5D72L 3RZCB 4NQDA 1BQLH 3C60A 1KN2L 3QUYC 1INQB 1MCQA 3D69B 5L2KB 4XPTH 1OTTC 5DK0A 5I1EL 4HUNB 1NEZG 4P4RB 3TVMA 3D3VD 1JHTB 2AKRB 4U6YA 25C8H 3DV6A 1KGCE 2OTUB 5HDBE 5T1KD 4UOW0 3LKRB 3FONB 4XPHL 1G7PA 2A9NH 4X4ZA 1E4WL 4IRSC 5ESVB 2Z0BA 2ZSWA 3LMJH 2FEEL 2R0WH 1D5IH 3ECBA 3SDCD 2C7UA 3I75B 2DL9A 1INEH 1P4IH 4GQPH 2Y23A 3FAWA 4U1JB 1NCAH 1T4KA 4YAQA 1CK0L 5EO1A 4RDQG 4JY5H 5EZIH 4Z7OE 5EC1B 3RHWF 5ISZE 5MEND 3VD5A 2B0SH 4IIQA 1JFQL 1JV5A 3IDGB 3V5DA 1FG9C 3QIBD 4KAQH 3PGDB 4PJEF 2YHGA 1CDJA 1LK2A 5JXEC 5J89A 3ZE2F 3EOAB 4YC2B 5TDNA 2YS4A 4AMKL 1XF4A 5JUEH 2R1WA 3ARED 2DBJA 4QT5B 3HA0A 5I18L 4DGYH 3SQOH 5AYQA 4JFFE 3ZYZA 4HK3N 4U6XA 5BZWB 4CADA 4YPJA 1D9KB 4IRJD 3TJEL 5IW6B 3QI9D 2CJUH 3ORJA 3QXUA 4JFZL 3RFZC 5AG8A 1HSAB 1IM3B 1HHKB 4IRZH 4KK9C 5GJTL 2GJ6B 2V7NA 1N4XL 3RUGB 3W9DB 4QOKB 1KB5A 3I02B 1KJ2H 3ZT7A 4OCYL 3UXFA 5T3ZH 5GZND 4XP4H 4ELME 1WQVT 1G7QA 4G8GE 3L7FB 2IG2H 2N7AA 1B0WA 1UVQA 2WBJB 2ZKHL 3PHOB 3QUKA 4GKZB 1WFUA 3UTTD 2H2PC 2WUCH 4KVCH 1IKNA 1A6TB 5EUOE 5EU4B 4E5XA 5BRZA 3ILQD 4GRLB 1O7SA 1I8KA 2CK0H 3QUMH 5HYQB 2R2EA 2AS5M 2X42A 3WE6B 2YBRB 1F3DH 1EEQA 3ABZA 4XX1G 1J9CT 5D1ZA 5F7FA 2DWEA 2XTJD 4K23H 1ZHNB 5CILL 2ZG1A 3OAUH 3UPCA 4MJ5B 4R90H 3KJ4C 2Y5TA 3V7AG 2FL5A 4BELD 2O5YL 2F9BT 2H32B 2NY3B 4NZTH 3VA6A 3KPQB 4HZAA 3TO4B 4KJWC 1F4XL 5EZLA 2W60A 5K9OA 2LV4A 1I1CA 1FNGB 1NUDA 1CFSB 4WUUA 4I0CC 3L6FA 4UIMB 5ISZB 3QG6B 4LVHB 1NAML 5EO0A 1V05A 3BZEA 2IQAA 3FN0H 2G5BB 3WFBH 2NW2B 1GZPA 1LO0L 3K0WA 3P2TA 3F7RA 3FQXA 5CUSL 4D3CL 5IB2B 4Y0GA 12E8H 4M61A 4A2LA 1O5DT 3VGGA 2WIMA 1EHAA 4X5XA 3O2DA 5IB1A 4LBEB 5J3HC 1L4IA 4JFFB 3BN9D 3QO1B 1KCVL 3GGWA 5D7JA 2DTMH 3N50A 1QYGH 4R4NC 1QSFE 1OF2A 1V7NH 3GI8H 4ESKA 1JWMB 3EHBD 3F6IA 1LMKA 2YA1A 3E6FA 1VFOA 3OKKA 4XVUC 3K2UH 1I9JH 2G75B 3Q6GH 2DQEH 1NGPL 4JO2L 1ZA6B 2H26B 5KW9H 2ED7A 1GOGA 2DOCA 4R7NB 4ELMB 4G8GB 2BNRE 5KBNC 1VGEL 2QLVB 4PTTB 4JN2B 1A6ZA 3EUUA 1LE5A 3VU2A 1WGOA 2X4PA 3T1FA 2CXKA 4ZS7H 2VSDA 5EUOB 4PJ7A 1UWEH 4WCYH 4Z76B 5DD0H 1J18A 5CEYB 4DZBA 4HC1H 3MSPA 1DUZA 5KANI 1KIPA 5IOPA 3MCG1 1GGBL 4NWTL 2ITDB 3CSYB 2EYSB 3MLZH 4KQ4H 4YDIH 3TCLA 2VDNH 4H20H 5D5ME 1TJIL 1S3KH 5DK3A 1OP9A 3H3PL 2P24A 3GIVB 1Q72L 1I7UA 3JUYA 4HUXA 3RVUD 3W9EB 1QD0A 1MHCB 3GSNA 3TZVC 1MUJA 4EN3B 4OQTH 4P46A 1T66C 3HG1D 4F2MB 4UI2A 4YGVA 5DK2A 5D7SH 2YKLH 3VFMB 5JNYA 3HRPA 4R4BB 4N1CA 1B88A 3GSQA 1MIEL 1MCKA 1XGRA 5GS1C 3G5ZA 2JIXA 4LMQE 5C0CD 1FIGH 1GCFA 3QISA 1IJ9A 2FEDC 4N90E 3ZT6A 2ATPA 2XWBB 3LZFL 2WV3A 2BVPA 1V7MH 4HH9B 5D8JH 1CGWA 3CJJA 3MOAH 5GHWH 4XNQB 5F9JA 1A6VL 4JY4B 4JAMB 1E6OL 2C3WA 2NY4D 3EYFA 4UDTA 4ODUA 5D2NA 4Q97A 1UM5L 1Q9LB 5F7MC 1DQDL 3QQ3A 2NZ9D 1HI6A 4F33B 1CTNA 1I7RB 4M1GL 2GTWB 3O8XB 1MFAL 5BQ7B 4HWBL 3PWUB 3CDCA 1MRDH 2Z93A 1UM4L 2XA8L 5CLTA 5DWUL 1FZMB 3LS4H 3KLHD 2H2SC 4FXKA 4XTRD 5ID1B 4NFBA 5C0BA 4PRPE 1RJLA 2VLME 3LRSB 5CBEA 4I4WB 2Q8BH 4NZUH 4GKOA 1QSFB 3M17B 3RY6A 4XCCH 1J8HD 3MLUL 4PJ9C 1AC6A 3OKMA 3BUYA 1KEGH 3JWNC 5CHNA 3HB3C 2K9UA 4LPYA 4F9PC 4EXKA 3NA4A 2HT2C 4G9DA 4KHXL 2W38A 2XQYG 4WFFE 3IU4H 2BNRB 3OAYH 2OTPA 1IGJA 5HHMD 2P49B 1I3UA 5J6HA 5MEOA 3NGBB 2CDGB 4TPRH 1V3MA 3GJFH 5JW3H 15C8H 1PZUB 1S9YB 1TQCC 3GIZH 5I19H 5M7QA 4XGZA 1FVEA 2R1XA 4FS0A 4ODXA 4NQED 3VXME 1MFBL 2GCYB 2W9DL 5D5MB 4CMHB 1B90A 1H0DA 35C8L 1KELH 2X4QB 4O02H 4N0UA 4BFIB 5CD5D 3STZB 1R6VA 1UXSB 3ZKNC 4I0PD 3R0NA 5GRJL 3HC3H 1JF5A 3HE6D 3SE3C 1F4HA 4F7TB 1X7QB 3BGFB 4GAGH 1QLEH 3PHQA 4LKCA 3QFJE 1CT8A 1OD9A 5MP6L 4MXQC 3M8OH 1AP2A 3MRDA 4NKDA 1FZOA 5CJ5A 3SDDC 2NPLX 1ZT7A 1CICC 1NGQL 1UQSA 5C0RH 3CFDA 4WEBH 4K3HA 4L3ED 2F74A 4D2NA 3U46B 1QACA 4TULL 3QCVH 1NSNL 2YN3A 3S34H 4NIKB 4LCWA 3QUZD 4P2OA 1OM3L 4S2SA 3TNNB 3B9KD 3JWDC 1G7LA 4WHTA 1DZBA 3DMMB 2VOTA 2Z31A 3NIGE 3F7YA 3NCYP 2VC2H 4PRPB 3MUHL 3BAEH 4MQ7B 5HVWA 1U93A 1R3HB 4HIXH 4X5WA 1GC1C 2P42B 3EJYD 3QAZC 3SCMC 5JW5B 2DYPB 2F19H 4GOSA 5F7EL 5IEKB 1N5AA 5FCSH 1AD0A 1BD2D 2E8YA 1XEDA 3RZCD 4KUZL 1VSCA 3GI9L 2O26U 2PO6C 1N8ZA 3MQIA 4JHWL 1LEIB 4YHYC 1W72B 5L2KD 1OWWA 1U8PA 3UJTH 1I3VA 4KWUA 1ACYH 2ZCLH 3LRHA 3CFBA 1QEWA 3HMXL 5IMMA 3AC0A 1WZ1L 5JLZB 3HI6H 1V8HA 3C2AL 1FZJB 3VXMB 4KGJA 3MODH 2J88H 4NQDE 3ZHDA 4DQOH 1CYGA 1F8TL 3K46A 1RJYB 3FFDA 5E1HB 3CUPA 4RMVA 4C59B 3X14A 5ESQA 3T2PA 3Q3GA 2JJWA 4LSPL 2HJKB 5L88H 5JORA 5GSVA 4YHLL 3O2VL 4QRPE 1XGYL 1FYTA 1GOFA 5CEZE 5IWLC 1MREL 4KXZI 1ZSDA 5ICXB 1T7WA 4FFYH 1OAUH 5DC9B 1CXFA 5DHXB 1I9IL 3OKYA 5D6CA 4Z7VA 1BGXL 1X5IA 5FHBH 1U9KA 2FIRT 5EN2A 4ONFH 3BKCH 3RWHB 4YHML 1FVDB 2F53A 3FN3A 8FABB 5SWZA 4PGEA 2XZZA 3NZHL 3O4OB 1U8JA 4XPFH 3FB7A 4OGYL 5H2BB 1J1XH 2HH0L 2VDKH 4JO4L 1RIUL 3FOMB 2XACC 1FZKA 4O51A 2OI9C 2WNGA 5C9JA 1XF3B 4RWYL 4X7EC 2DJUA 4GMTL 4M93B 3G5VA 2FX8H 3UZEA 3R1GH 3DNKA 4K7FA 2FO4A 4OV5A 1HINL 5ERWA 2CIIB 4AEIL 3HS0B 4DEPC 5CJOH 3GSUA 3TPUA 4HLJA 1MPAH 3MLPA 5FA3B 3AAZB 3P73B 4YR6A 4LARH 2QQKL 4P9MH 5AAMA 2ZUUA 1AKJA 3B2VH 3C5SA 2Q76B 4LDLB 3R06B 4JFED 4J4PA 3KYAA 3TBYB 2KKQA 5TH2A 1JGVH 1RZJC 4Y88A 3FB6B 1MRCL 2GT9A 1MCNA 4Y4FA 2FD6L 1YPZA 3UYPA 3U36A 1JGUL 3QIUB 1RVFL 3QCUL 4LSSL 4OF7A 1QBAA 5D4QA 4UINH 3S5LG 2DKSA 1A6AB 1J0JA 5FO8A 1E4KA 2P5EA 4GRLD 2MQ3A 4R97B 1PYWB 4D9QE 5BV7B 5IJVA 2IH1B 1S7XA 3LV3B 5FYLH 2QR0A 4S1DC 2ADGA 3AS2A 2VMFA 2DIAA 4RRPG 1KGCD 1A7BA 2R1YA 1Z3GH 4NQDB 1BIHA 1F6AA 1Q9KA 3C8KA 1OQOA 4PJ8C 3C60B 3VI3E 5AZ2L 5BRZE 5DK0B 3VD7A 2BXZA 3TVMB 4PBWD 2CLVA 4PB0H 4QXUH 3KPSD 4AEFA 4MXVE 5E2WH 1D9KC 3LD8C 2NY3D 3DV6B 1K8IA 3VFRA 4KDVA 1Q9WA 2XRAL 4WEUD 1G7PB 1H3VA 3LEVH 5ISZD 3QUXC 2ZSWB 3VXRE 1NCBH 3C6LA 3CU1A 3QIWA 3ECBB 2C7UB 4OM1L 1JYNA 4JG1H 5CZXC 4HFWA 4KUCF 1AE6L 2WBJC 2RR3A 4X7CC 3MNWA 1T4KB 1G6VK 3RVVC 2R4SH 4YAQB 5EO1B 3W0WD 2JELL 3QXVA 3MV7A 4OLZL 4KTEH 4WUUE 1VA9A 5M94B 5KG9A 3T1WA 1Q8MA 1GOHA 4IIQB 4POUB 4XP9H 3TN0D 1WT5C 1JV5B 3V5DB 5C2BL 1OHQA 1LK2B 4APQA 2D2OA 1EO8L 2R4RH 5TDNB 4MWFA 3BFOA 1XF4B 4K3GA 1JYWA 2R1WB 4XC1H 1REIA 5DMIH 4NHCL 5ITBH 3BE1H 3QJHA 3BQUD 4G8GD 3VH8G 4O5LH 2R2CA 4U6XB 4CADB 4H1LA 5DF0A 4Y5XC 2DDQH 4X83A 1ZWIA 1SM3H 4ONHA 1J1PL 2V7NB 4GG6E 4ZAKA 1KB5B 3LKOA 1RK1A 1S7TA 3J8F7 3TO4C 2XQBH 4L8CA 2DWDA 1G7QB 2OZ4A 3H3KA 4EUPG 4MA7L 4FQ1H 3QRGH 1UVQB 3QUKB 3WUWG 3S36H 4EN3D 1L7IH 2MMXA 3SDXA 3BYTA 4LSTH 3UZQA 3F62A 4PJ7E 1JVKA 1B0GA 3BIAX 2UUDK 3B43A 4E5XB 5BRZB 4MNHA 5L6YH 4HXAH 4O58H 1NCDL 3QWQB 4CMMA 2NX5A 3MLRL 4LCIL 4CGTA 1I8KB 3ULUE 4QWWC 1A0QH 2BRRH 1ZHKA 4UZGA 4NJ9L 2R2EB 5ID0A 2DI9A 1G0YR 3PGFL 3HC0A 1J0YA 3QPQC 5D1ZB 4RGOL 2DWEB 1RUMH 2J6EA 3EZJB 4LDEB 1LHZA 5F3HA 4Z77A 2DD8L 3C5JA 4WVRA 2Y5TB 3LDBB 1WBYA 5MI0C 2FL5B 3LY6A 2YK1L 2YRPA 5E6IA 3WKMH 1FRGH 3FQWA 1A3RL 2X89D 2W9EH 5EZLB 2W60B 5LCVH 5K9OB 1ETZA 4WUUB 3O9WC 3L6FB 5D2NE 2YMXL 5EO0B 3BZEB 3HI1B 4ZO8A 2IQAB 3SDYL 5CJ8A 4EDWH 5E5UB 1UWGL 4OLWL 1JHKH 1CFNA 3NAAH 4MB5A 1QNZL 3QCTH 4HXBL 4XVJL 3IS1X 5T1LD 4JM4L 3FQXB 2X44D 2X1QA 4M61B 4XNZC 3B83A 3MNZA 4X5XB 4ZTPL 4LP5A 3WL9A 5IB1B 4R26H 1DFBL 4EZMA 1JHLH 2KL6A 4F7MA 1O0VA 2HT3D 3ESVF 1KENH 4P2QA 3MCLL 5C0BE 1EH9A 1ZTXL 3GGWB 1QFOA 5FOBB 3I6GA 2NMSA 1QP1A 1OF2B 4EBQH 2Y1VA 4LQFH 5DQ9A 1BM3L 3E6FB 3OKKB 5CJXA 1KSRA 4LHJB 3RX7A 4HIEA 1HXYA 1CD9B 2DQJH 3E3QC 3BMVA 4OLVH 2NYYD 5FGCE 1T1ZA 2BK8A 5KVDH 1YJDL 4OLUL 1A6ZB 1A5FL 3VG0H 1LE5B 4MCZA 2X4PB 4EKXA 1T3FA 1UZ8A 5ACZA 4PJ7B 2Q20A 4HGKC