2P45B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 1.1a resolution: se5b-ortho-1 crystal form with five se-met sites (l4m, m34, m51, f68m, m83) in vhh scaffold.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
QVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 28
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p45B00
2FX7L 3D6GA 2OTWB 5B39G 2YZ8A 3EO0A 1YECL 1XGPB 1OAUH 4HIIA 2GUOB 3VXUA 2AI0H 1PG7W 3BXNA 1H3UA 3K1DA 2QHRH 2E8ZA 1P4BH 4FXGA 4QTHB 4D0BA 3VXNB 3LH2H 3D1MC 5TDPA 3TWCL 2VO5A 2B1AH 4HUVA 3T65A 1KB5A 3R0MA 3WHXB 2DQTH 1HHGB 3MGTB 5I71C 1NGWB 2F15A 5D1ZB 3DO3A 4PRPB 5IJKC 2EC9U 4MLSA 4HKXB 4AG4L 5DHVA 3MUGB 1W72H 2X89D 3QIWB 1F6LL 1DBJL 1GAFH 4M61A 5DTFB 4ZD3H 4UDUA 1QHOA 1JGUH 4Z7UB 2E27H 4OZ4A 3HMWH 3HPJA 2QHLA 3PWUA 1LO4L 5LBSL 1D9KB 3RP1A 2VH5H 3QIUB 2PXYA 3QEHB 2QADD 4OZGB 3RUGE 3L3GA 3P9LA 1VGKA 4OKDA 3CMOH 1KFAL 4LLMB 4ODHL 1QUNA 2ZUTA 2DIBA 3A6BL 1FNSH 3W0WD 1RMFL 4DVBA 5HXMA 5C0FB 3P4OB 5BZDA 2NQCA 1G9ML 1CD0A 1S5HB 5C07B 4HK3J 3RVXC 4H5SA 1RUML 1AIFB 4MD0A 3W39B 5J12B 1YEEL 4M93B 3UYPA 4YPJA 4TVPH 3V0WL 4ZOBA 4LARH 3ABZA 1Q1JL 5C08E 4JFHD 2GT9B 1JBJA 4UILH 4M8QA 4ODTL 2D03L 3AB0C 3GSNA 4X5XB 2BOBA 4QXUL 4YPGA 1C1EH 3T08A 4WHTA 1LP9F 3DYPA 3T2NH 4BQCA 4NM4H 3GMOB 4LLWB 5B8CA 2CMRH 5FYKL 4RIRB 1NC4D 1NUNB 2DL9A 3MLVH 4L5FH 4CBPA 2AK4D 5E2WL 5IHUL 2VDNH 3EW3B 5ESAB 1YEDB 5EOQL 4NNPH 3V4UL 4MWFA 1M7IA 2FX9L 1ORSA 2GFBA 4JVWA 4NRYA 1NANI 3RIFK 4LEXH 1IRAY 4HQQH 4J4PA 3KPSE 3SDCA 1BFVL 4G6JH 4P57B 1UM4H 1KIPA 2DRUA 3PWJB 2OSLB 2NTSP 4WO4B 3DX6B 1UT9A 5AAWA 4U1MA 5HYJE 1M7DB 1INDH 5AD0A 1GGBL 3SO3B 3ARWA 4BA8A 3TIEA 2JIXA 2KL6A 4UNUA 4GUPA 5IQ7H 3SBWA 5FM8A 1RZKL 1AGFA 4CVXA 5F9OH 1FNHA 3VRIA 4ZQKB 1INQA 4Z7VA 1YN6B 3OAYK 1TMCB 3OKKA 3DLQR 1C5BH 5J1SC 1CIUA 4HGMA 1QR1A 4OCLC 4XVUC 4PB0H 4XHJC 4I3GA 1JGEB 2CO6B 2H2SC 1IGIH 4Y2DB 4PJEB 3WFCH 1LEIA 2X4TA 3RIFF 5I8OL 4GRLB 3RAJL 4BUHA 2B5IB 3CPLA 3CZFB 2EDEA 1NGZB 5CKGA 2Z35A 1GPOL 3FB7B 3T0AA 5DXWA 4HMEA 1N6QH 3VFMA 5KN5A 1L7IH 3FB8A 2GY7B 5E6ID 2UY6A 5FUZL 4MNQE 4OTXH 1LEKB 4JB9H 1GZQB 5BO1H 3K8LA 3MJ9L 4MD4A 3QBTB 1BD2A 3GBML 2NY4D 3CXHJ 4XNMB 1S7VB 2E5EA 2YHGA 4IOIB 4APQB 4IHOA 1B2WL 4POUB 1S3KH 2ITDA 2EDBA 3RWIA 1NFDF 3VGEA 5TE7L 3HN3A 5IV2B 3IDIB 5I66B 5IMLB 1W0WA 4P2QA 1XZ0B 3RJQB 3CC5B 5HHNA 5JOPD 1AY1L 4KC3B 5EZOH 2EDRA 5D7LA 3QPXL 4X6DE 1QPPA 5E8EB 1RK1A 5TDOA 1J1PL 3NGBB 4XP9H 4K3DH 3U46A 5INCB 4EEEA 4O2CA 3RTQD 4HWEH 1T1YB 4OZHE 1WZMA 1HXMB 1SEQL 3LMJH 2VWEE 5DDHB 4KU1A 2ADIA 4XI5D 5EUKB 3S37H 1QBBA 3JTTB 5C0BD 4NNXB 5B21A 1CICB 1HXYB 2O26U 5IESL 4NHCH 5C09A 4R6UA 1L9MA 4C59B 4ONHB 3FO0H 1QR4A 5E95B 5FM5M 3UTTE 3K4ZA 1NPUA 2BDNL 4NC2B 2WIMA 3G5ZA 4PGDB 2GCYA 5C2UB 5D2LF 5DD3L 4U1NB 3WIHL 5FF6B 5IJKA 4YHLL 5DQDH 3IF1A 3T4YA 1SVCP 2ERJB 4ONGH 4HJJH 1RIHH 1NLBL 1ZT1B 1U8QB 1JYNA 4AEHL 1A3RH 4RFEB 1A4KA 4XPBL 1A14L 1IM9D 1ORQA 5FA3A 2HFFA 4DN3L 3QFJA 2HTLC 5C6WH 4AL8L 4G9DA 3RZCC 2J4WL 5D6DC 1GGIH 3ZT5A 5FEBA 4GRWE 3TVMD 1LEGB 1OLZA 2PO6D 5KS9A 4P5TC 3HC0A 4NQED 4E0RB 2PTTA 4K94C 3D2UA 1MLCB 1S7QB 3MMEB 2IQ9H 4Z7OF 3RVTD 4N8CL 3Q6FA 3DX8A 1UA6L 3EJZC 2MSPA 2V2WB 4J2XA 3QXDA 2VLKE 1WCBA 2OR9L 4LHUA 3NCCB 3IKKA 4HD9A 4ZDHA 4G8GD 2FSEA 2AW2A 4U0QB 1DQLL 1K8IA 5EZIH 3DI3B 1EEZA 3VD3A 3ARGD 2Z9TA 3SGKC 3PUCA 3ZHKA 2YXMA 1ZSDA 4XMPL 2VLLB 5F44A 1KBGL 4YX2H 3PDOB 4FQHA 3VJ6B 1QFHA 2B1HL 3T09A 5T3ZL 3D69A 5EOTB 4MAYD 1AC0A 4WTZG 5CILL 4KY1L 1K3ZA 1EVUA 4J3VA 1XIWB 1R6VA 2VDMH 3RZWA 2CK0H 5EZJA 2HT4C 4OF8A 1QLEL 3TBTB 3C08L 5DHYA 3L6FB 3BMWA 1DN0B 4JDZA 4G7VH 3V5KA 4L3AA 4XVSL 5ENWB 3RFZC 4P23C 5E8DL 5T1LB 1BZ9A 5ITFB 3HMXH 3O45B 4DJMA 4BUGA 1JZ3A 4G8EB 3FTGA 5I1GL 1FC1A 4LCWD 2VZ3A 4QHNA 3C87A 1MJ8H 3VXTB 1TQCC 4NQVA 1MRCH 3S98A 43C9B 1C5DA 3HZMB 4NKOB 3FQWB 2NXZB 4NSKB 3F7YB 3MNWA 3IDYC 3RBSA 3MR9B 4WW2F 2NNAA 5ICYA 5JLZA 5L7XH 5DC0A 3W9DA 3G9VA 4JFFA 4WEBH 2XN9B 4FFZL 4ORZC 4P9MH 1QQDB 1J1OL 3HNSH 2Y36L 3VXRE 2IMMA 3OKOB 4JDVA 4XNUH 4KI5C 3QDGB 4DN4L 5J1AB 3O8XC 3RGVB 4TTGA 2X9WA 1JGLL 5JHLH 1S7WB 1W0YT 4URTB 2N7BA 2A0LD 4JFXB 2CIKB 4UQ2B 3QNXB 3S34H 5I1KL 5SWSE 2NY7L 5FOBB 3EFFA 2HKHH 4HZAA 1SEBB 5T1MB 1MNUL 1S9WB 3ARRA 1CU4L 3OB0H 4UB0L 2P5WE 3TA3C 2QV2A 3BKYL 3H9SA 4OFVA 4L8CB 4WTWA 5CZVH 4LLVA 3WXWH 5J6GB 3Q3GA 3BZDA 4NN5B 1O7VA 1IEHA 1JI2A 2BNRB 4TVSa 2KZWA 4OZGF 5DQ9B 2ZUUA 1OWRM 3VE0A 3BPNB 4LCCB 5DFVD 2ZOKA 5F88B 4ALAL 1Z6JT 3GMMA 1T0NB 4DW2L 4BZ1H 1T0MB 1MI5D 4LVHC 2W0PA 2ICWA 4FQJH 2BC4A 4R97B 5INDA 2WANA 1BLNA 3MLYL 3FFCA 4DGVL 1YYLL 1JNHB 3X11B 5DURD 3KYKH 1EV2E 2OL3A 4JPVL 2R23A 3WYRA 1NLDH 5K9KB 5HVHB 3EDEA 2XPGB 1FNAA 5E9DA 2XY1A 3SDDD 1U2HA 1B6UA 3GSOA 3P73A 4HH9B 3RIAK 3RWCB 4OLYH 3SJVB 3VFRB 4B41A 3CXHK 4JPWH 4X5WA 3QUYC 5DO2D 5EULV 3GMQB 4N8VG 5CSGA 3U7WH 1LO0L 4OV5B 1PDKA 4KTYA 3MSPA 1S78D 3KPNB 3LRHA 5EO1B 1RUQL 2UZXB 1JGVL 1P5VA 3D39B 1K2DB 2DI8A 1O7SA 3ZDZF 2GY5A 3ZSTA 2H9GA 2EDJA 3TZVC 5MHSD 3SQOL 3RZCA 5D6DA 1CF8L 1L0YA 2Q87A 2WW8A 2A2QT 2XTJB 1Q94B 2F8OA 3P3YA 3VXQB 1M05B 3PGDB 4HIXL 4R8WH 1BZ7A 1Q0XL 4GAYA 4P5TA 1FORH 2HFEA 3HI5H 2X4SB 1JL8A 3NIDF 2WUBL 4GAJL 2DQCH 3U30B 3OGOE 3RIAF 2QR0A 2YEZB 1TJIH 1U8LB 3GMLA 5DR5L 5A2IH 5DJ2A 2I07A 4QGTA 2CDEB 1IC5L 4DUXA 2R69L 4PRPD 1C12A 3V7AE 3GO1H 5JR1H 4OAWB 2BSSB 3TV3H 5A40E 3QIWD 1SY6L 3DYOA 3BZEB 2DQDH 1OD9A 3BHBB 3RHWK 3WNMA 2D7NA 3SGKA 4EN3C 5BVPH 1UXSB 2MNUA 1D9KD 3L3JB 3TYFA 4AQ1B 1MLBA 4PJEF 3RWDA 5MENB 1Z0NA 1QKZL 6FABL 3NFPA 3K8MA 3UJJH 1RAMA 2J8UF 3L7EA 4O5LH 2KPNA 2NXYB 5C07D 3VFGH 4JJ5B 5DGRA 1JZ5A 1H3XA 5ADPH 3SE9H 4H0HB 1U58A 1A7RH 2W1NA 3GIZL 1U3YA 1ZWIA 4KRMB 4MXQC 1EJ6A 5I1CH 3BH8A 3VFOA 4FRWA 2B4CC 4GW4A 1SHMA 4P23A 1FG2B 3A6OA 4JRYB 5F7EL 1KCRL 4JN2A 3KJ4C 4AT6B 1BPVA 3NCYP 3ARFC 1IGCH 4QHMA 2Q7YA 3RHWF 4U6YA 2QQNH 3QEGH 3C8KB 3WNLA 3NFNB 3X14B 4CU6A 1FNFA 1JP5A 2ENYA 2VL4A 4KTDL 2VISA 3S5LG 3MLZL 2DLHA 3T1FB 3G5YB 2C4XA 3O4LE 1NMBL 1DVFB 3P77A 4OI9A 4OLXH 1A9EB 5IBTH 3IDMA 1UVQB 2BY1A 4HS6A 2IH3B 1RD6A 3RWJB 1LQSR 3RWHB 4Z0XA 3BT2H 3RVUC 3EFDL 4YFLF 2BNUB 4IRJC 1KJ2L 1BFSA 4QF1B 4Z7QE 2FJGB 3HE7D 4F15B 3O8XA 3U0TB 2Q1EA 3HPLB 4EOWH 5SWZE 2ED7A 1UC6A 2DQGH 1SBSH 4QHKI 5EDXA 4GG6B 4WO4D 4ZOCA 2D3VA 4OF0A 1IC7H 4U1KB 1ZT7A 4O2FA 2K7QA 5I16B 1BJMA 3F7RA 2X4QB 5T33H 4JKLA 1B0GB 3QDHA 4YIQB 2ZG2A 4KHXH 5T1DH 1K8DA 3F65A 1DFBH 2PNDA 4Y8AA 3TA3A 5T3XE 3D18B 1E4KC 2PETA 3SKJL 4CNIB 1J18A 2GTZA 4I2XA 3GMNA 3ISWA 3WIFA 5SX4I 4I3RH 3U4AA 2VXUH 2FZ3B 2ITCA 4Y2DD 1Q9KB 5C0NC 5LJYH 3U7YL 3FB6A 2LTQC 1IAIL 4GRLD 1IBGH 1BJ1J 4Y1AB 1FE8H 4LU5L 5DJDB 1MHCA 3EO9L 3O2DL 2R29H 5I1AB 3SKNA 3TIDB 1CN4A 1A7QL 3KXFE 3RWEA 3QDJE 1OTTD 3CFEA 2OI9C 3IETB 3JUZA 2R2BB 3IXTA 1ND0B 4HPYH 5D9SA 4G5ZL 4ODXB 3MO1B 5IVXB 1H5BB 1IAMA 4EQ2A 3JTSB 2HRPH 4OCWL 3VA6A 6CGTA 1LE9B 1YPZE 4JKPL 4M6AA 4OF6A 3ILQD 3O6KL 1VGEL 5FUOH 3QUYA 1PYWA 3MRRB 2EDHA 4CADA 1BBDH 1X5FA 2VAJA 3G08A 1II4E 1K85A 3FRPG 1IZJA 1U8MA 3O6FC 4W4OC 4NZJA 5DEFB 1UZ6F 4G43A 3UXFA 3QNYB 1IARB 3O9WB 3E6HA 4X4XB 2UWEF 4YHZL 2CGRH 3MRFA 1OAQL 3ARDB 3RBGA 1NJ9B 2XKNB 4UIKL 1PKQB 4N1HB 4ODSL 1T03H 2WAHA 5MI0B 2LQRA 3TZVA 2XQYK 4YH6A 1QSVA 1YEIH 2L0DA 2R1YA 1VENA 2XRAH 3RWFB 2HH0H 3WHE1 2WWMD 3Q6GL 2Y9RT 2IPUG 4R4ND 3H7BA 5EUOB 1CICD 4OJFH 2EKSA 2R56H 4BKLA 3CVIH 1HZHL 2H6PA 4PRAB 2BJMH 5DRWB 2AEQH 3BN9C 3BJLA 4PJ7E 3U6RB 3MRQB 3TO4B 3QPQD 1EGJA 3FQUA 3QQ4A 4IRSB 3VXMA 5F3BA 5GSRA 1V8HA 4EKXA 4IMKC 1IC4H 3QWOA 4HUUA 3JWOC 3AS0A 3E0GA 1I4FB 5F21B 2BVQA 5IB5B 1N0XL 4MQTB 3PWPE 5FECA 1N2RB 4EN3A 2A1WH 3RL2A 1B3JA 1B4RA 4EZMA 1RZ8A 1QSEE 1HHIA 2PYFB 4PGJA 5CEZH 4M6MH 3QRGH 4HPOH 4ORGA 4EDWH 2ICWI 3LPFA 4YDIL 3SDXA 4NQSB 4X4YA 1TQBC 4HJGA 4GKZA 2CLZA 3RNQA 5HHQA 3HNVH 1UKTA 5GJSL 4NUGL 5EN2B 3CFIC 5ANME 3BIAX 3L5JA 1BIHA 3FO9B 5HD8C 4R4FH 4RGMB 4NZUH 2BY3A 4FFWC 5DGQA 3L7FB 4QYOB 4NHUB 1JRHH 3WXVL 1MWAA 3P9MB 3EIFA 2VXSH 3IRPX 1F58H 3BYTA 4B53A 3V0VA 2PW2A 2VR9A 2AJVL 4U1IB 3ARFA 3IAQA 4Y4FD 3JSSA 2C1OA 5ESVA 1A21A 1U8NB 3IKCB 5GSVA 1I8MA 1JTTA 1EAPA 4X98A 3LCYA 4Q6IB 1FRGH 2VABB 2J6EL 2CDFA 3JV5A 3KVQA 1BEYH 1F6AB 1I1AC 1MFAL 5FUCE 3VI4F 4HIEA 1MJUH 3EZJB 3IGAB 4TSAH 4EVNA 3S97C 2PR4L 3SDYL 5IB1B 4P9HC 4M6NL 3CK0L 1JV5B 3GSUA 3T77A 3SCMB 5GHWL 3FN0L 1XIWD 5JA9A 2R4SH 3DSNA 1U6AL 2DYPB 1KOAA 4YHML 4FN0A 4PREA 4JPKH 3CFJA 5E08L 4FQ1H 4FMFA 1LWRA 3RVWD 2W9DH 3OSKA 1B4JH 1FVEA 2F54E 5L2KA 1QSFB 2EYTA 3BGMA 4GRWB 5H35B 1CYGA 3X13A 2NZ9D 3VFNB 2D31A 5DHXB 5IGXH 5T1LD 5IVNA 4GBXC 4O4YL 1HKLH 5I18H 2AERT 3TJEH 3ZKXC 1CZ8H 4I5BA 3V6FA 2HN7B 4F33B 4RZCA 2VITA 4HUMB 2XG4A 3VG9C 1K5NB 3MCKA 2X44D 1FGNH 4YDVB 2ESVE 4K8RL 3JWNC 3V7MA 3WKNA 4C56E 1DCLA 3DWTA 4ONFH 3BUYA 1E4KA 1LO5A 1ZGLA 2P7TA 5IMMB 2W60B 3F7VA 4ZPTB 1HSBB 3UJTL 1OGAE 1JPSH 3T1WA 2XN9D 5FHBL 3EYSL 2I27N 3BE1L 4WWKC 1CDBA 1DEDA 1AR2A 2QKIA 4MDJA 3RGVD 1F11A 1CGWA 1DANU 5DJ6B 2BY2A 1KPVB 3CVHL 2Q8BH 4HIHB 5EU6A 4RCAA 3C2AL 3U4BH 2V7HA 4HCRA 1C7TA 3SGEI 4JANA 4DKFL 1MIEL 1MHHB 5E5MA 1G7HA 4UT6H 5F7WC 4B7LA 4LRNL 4ZAKB 1EEQA 4NC1C 5ID1A 1NCBL 5LQBH 2RIKA 1RVFH 2N1KA 1CR9L 3ULUC 1H3PL 3VFPB 5HSFA 3O3EB 1EGJL 5BOZG 5C0IB 1HIML 3KYAA 2EH7H 5SWSA 3EYUL 4BZYA 3CH1B 3O6FA 4JY4A 4W4OA 2GJ6E 4OGXH 5HVFB 1PGRB 1MREH 2NY3C 2PYEA 4RMQA 3TT1H 1ADQH 4EI5B 2BNRD 3MRJB 5EA0L 1X5GA 1KLUA 4ETQB 5IJVB 1C08B 1V7NH 1F3DH 4KRPB 4L8DB 1GIGL 1ZHKA 2OXGA 3QXTA 3LKPB 1JJUA 5JOFA 2X4PB 2LVCA 4KK6C 1FZMB 2Z31B 1PSKH 1P4IH 1ZA6B 3NA9L 4N90D 3WS3B 4N0CD 3MRNA 1CFQB 3ZE0F 1CGXA 3KPOB 5B39A 3UEZA 2EO1A 2VLJB 3GNMH 1KC5L 4U6HB 1B9ZA 1AKJB 3R1GH 4HZLA 3IAGC 4PY8I 3SJVD 3WUZA 4FP8H 4IMKA 2A6JB 5DI8A 2X4OB 5JDSA 1Q72L 2ZUWA 2A73A 1ZEAL 3WFBH 5IB2B 4XP4H 1YYMH 4M62L 3MRHB 1QA9A 1AD0A 2NR6D 4I1NB 4N9GB 3U36A 3CSYB 3RWGB 4CW1B 4HIJA 4U31A 5IBLC 3MLUH 3CUPB 2DM4A 3D39D 4X7EC 3OL2A 1GSMA 3LRSA 3WKMH 1IFHL 1I7ZA 1KIRB 5BRZA 5FB8A 3MACH 1ACZA 2XTJD 2FHFA 5F70A 2QBWA 1FFOA 2MTPA 3D0VA 3BQUC 1FJ1A 5D72L 4KZEL 1KPRB 3P9WB 1XF4B 3LKNA 4PRDB 4H25B 3ESUF 1CD1B 2Y7QA 4M43H 5ERWB 3FMGL 4X6FB 2Z92A 1AFVL 2NY1C 2YBRA 1S7TA 4K71B 4FG6D 4OZIE 3TBVB 3B8SA 5F1KC 4IS6B 4LPCA 1U92A 3I84A 1HI6B 4HWNA 3SE3C 1TITA 4FZEH 4JRXE 4A2MA 5F1NB 2H2PD 3TH2T 1AR1D 3C6LC 2YKLH 2DD8L 4S2SA 1QRKA 1FO0H 4I13B 1RU9H 4Z76A 2VRAA 4XCFH 1DE4A 4ELME 3PQYE 1I1AA 2JF1A 5I1LB 5KSAB 3PXHA 3GIVB 2X1QA 5I75C 4XX1G 3LIZL 4NJAH 1RZIA 1BWWA 5A16B 3FFDB 1QG3A 4OT1H 1NMAL 2NXYD 3QIBC 3RKDC 5BZWB 5D1XC 5M95B 3MV8E 3P4NB 4PV8A 4EI6B 4HBCL 2ADGB 1QRNE 4XB8A 5FYJH 2DJUA 3QI9B 1DEEB 4KJPD 1NCWL 4A2LA 1CFBA 1UKSA 5C7XL 1V7ML 4JRYD 5E99H 4PJIE 1H3VA 4GBXA 1EVTC 1IAIM 5JW4R 4D3CL 4M5ZL 4NKMB 4G6MH 1H0DB 1I7UA 1D6VH 4IEFB 1MFCL 1A1NA 2X1XR 4LAQH 5I9QC 1KT2A 2GK0A 5E0QA 2BHUA 4DZ8A 4F7PA 5JQ6H 4WJ5A 5IFAL 4GS7C 1U36A 3GRWL 1BOYA 3U7AA 2A6IA 3LN4A 2FX8L 5E24E 1GGUA 4NOFA 3S7GA 3IJYB 2F5AH 1A02N 1QO3A 4HKBB 2VXQH 4WWKA 4LLQA 1OGTA 4LNVA 3AS3A 1GOGA 3I6GA 5ITBL 1NGYB 1EXUA 2IMNA 5FUCC 5KVGL 4WU7A 4IRZL 4KPHL 2OJZL 4Y89A 4Q9RH 2IQAA 4PJCF 5HDBF 1IGML 1MRFH 3ARVA 1A6ZA 1RZ7H 3M45A 3MRIA 4NN6B 3GSRB 5SX5H 2EC9T 4BQ6A 2Q76A 4MXWH 3B43A 4NWTH 3ZE2F 5F6IB 3PV7A 4AYFA 1V5JA 4UAOC 3LD8C 3FQXB 1MFEH 1FSKC 4OFPA 5CCKL 4NKDA 4XRCB 5SWZA 2IAMB 4JFDE 3TBYA 1LVEA 2L7UA 3W5MA 1T3FA 1WC7A 2OK0L 4O51A 4M48H 4RQQA 4WI3A 4JVUA 2FL5A 3QUML 2EEDA 4YUEL 3LB6D 4G7YH 3HCVA 1RUPH 2H26B 4KQ4L 5DZOA 2VXTL 2DBLL 3GBNH 4ODWA 4EBQL 4J8RA 2OJEB 4NIKB 1I1CA 4LEOA 3FT3A 4Y1AD 1S7RA 5D93C 4HULB 2IAND 2GJJA 3UBXG 4DQOL 1G0XA 4KHTL 3RY4A 1JWUA 4JGJA 1G84A 1CE1L 1NAKH 3BXNB 1MFBL 4X99A 2IGFL 1LGVA 3FOMB 3MLSH 5F8RC 5D5MA 4PP2B 2A9ML 1SM3H 4Y4HD 1UYWH 3DO7A 2HJLA 5TDPB 3D3VA 4HUVB 3T65B 5DEGA 4MCZA 2VERN 2DDQL 4XPTL 3D87B 3QDJA 4QXWA 1Q8MA 3O6MH 3VXPB 2CKBB 4QTIL 4BH7A 5IG7A 4AJ0A 4FNLH 4WFHD 4UDUB 3O9WD 5I17A 4Z95H 4OZ4B 3HPJB 2DTMH 5I8KH 3PWUB 4S1RH 1V05A 2PXYB 5J13B 4FXLA 4JHZA 2VZOA 3DROB 3L3GB 3NIGE 2GITA 1R3HA 2FGWL 2NY6B 4OUUB 1AP2A 2P5EA 3LEVH 4DVBB 3VFTA 4WI9A 4BQBA 5DF0A 1NFKA 3QISA 1A6VH 4HJ0D 5IEHB 3UC0L 4Y5YC 1ZA3B 1FC2D 4LP4A 3BP4A 3BQUA 1SMOA 1AGEA 4WNQA 4MD0B 5GGVH 3GHBH 3GMPA 4Z18A 2CR6A 5KVDL 4Q9CA 1CLCA 2XKSA 2QQLL 4GAFB 3CXDL 4FQ2L 5GS1B 5B3JF 1FNLA 2QEJA 2CRZA 2PKDA 1JTPA 2PW1B 4FTVE 4M8QB 1OPGL 3MLXL 3U79A 3GSNB 1Q9LA 4NJ9H 2BOBB 4YPGB 4X4ZA 3OAUL 2CUIA 4WHTB 3C6LA 5F1IA 4OB5H 4QGYA 5B8CB 1D5BA 5LWYH 4WDIA 3ULVE 4PJ7A 3V95A 3H9HA 5CWSB 3BD5A 1OP3H 4K23L 2W65B 4NM8L 4XC1H 1CT8A 5DFTA 1ORSB 5DUBA 2YRZA 2OXHA 4NRYB 3WE6A 3LZFL 4MNGE 4PJGA 3QIBA 1N7MH 5D1XA 3L5IA 4WTZA 3SDCB 5IK3B 2FJFA 3HE6D 1KIPB 5GZOC 3TJHC 3AU1B 1DBAH 3D85A 4RMRA 4FHBD 1FVDA 4U1MB 3WNPA 3N9GL 4OQTH 2H32H 3OKDA 4GQ9L 1TDQA 3TIEB 2JIXB 3MBEC 1AQKH 3HS0A 1AGFB 5ISZA 1ZS8A 5CEXB 4CVXB 4JO1H 4Z7VB 3VRIB 1INQB 3OKKB 1N64H 4N9OB 4MQXD 5E94A 4F9LC 3KJ6L 1QR1B 4WI5A 1R3JA 3QCUH 3I9GH 4HXAH 2AJXH 1J88A 3QCTL 1OY3B 4HGWB 4PS4H 3STLA 1Z3GL 2CKBL 4KROC 1LEIB 2X4TB 3S3SA 3A0OA 3SCMD 2VLRD 4BZ2L 2G5BA 4ZPVA 1W72A 2Z35B 4C54A 2DYPD 1S8DB 5T3XL 2KQMA 1C7SA 4GW1B 4LSRL 3U9PH 3QDME 3PGFH 4KKBC 4MCYA 4DGIH 4HLZG 4M6OH 2YPLA 3SDAC 2BOCA 2AGJH 2NW3A 3IJHA 4YK4C 4IHOB 3A67H 1IGTB 2FX7H 1UG9A 1KJVA 2ITDB 5FV1L 1GH7A 4X9GA 1OTSD 4Z8FL 1HH6B 4WW1B 1YECH 2R9HC 4P2QB 3JXAA 4S1SL 1MQ8A 5HHNB 2AV1A 1LP9A 4MD5B 5D7LB 3MBXL 1KF9B 3TWCH 1RK1B 2A38A 3MV9E 3HKFA 3N85L 2EYSA 4MVBD 4O2CB 4JQXC 4P3DA 1F4WL 1LK2A 3HUJA 5DD5L 1ZVSA 1T0PB 3KPMA 4AG4H 4F7CB 4S10A 5FDWA 4MJIA 1DBJH 2ZCHL 2OTPA 3V2AR 4LQFL 5HHPA 4XCNA 2WLZA 5BS0A 1LO4H 5LBSH 5C09B 1XCTA 4PJBE 4AIZA 1KFAH 4ODHH 1F4HA 5CGYD 3A6BH 3DARA 3E2HC 1MY7A 5JXAL 2VDRL 3G5ZB 1RMFH 4CAGA 2XWTA 4ZAKD 5I71B 5ELIA 3IVKA 2GCYB 1Q0YL 1EJOL 2YD3A 1MPAL 4Z7WF 3JZ7A 4WFFE 1G9MH 5DSCA 2HFGL 3ESVF 3S3PA 1ULVA 1F3JB 3EOAB 1OARL 1RUMH 3IF1B 3T4YB 3VXSA 5JMOC 3OKYA 3MV7B 2APXA 2EDOA 1JPGA 4X4ME 1BQUA 1YEEH 1D5XA 4EI5D 1A4KB 4YHNA 5GRUL 3V0WH 4N8VA 1FVCA 3NA4A 4O02L 4WW2C 1IL1B 1Q1JH 1ORQB 3FRUB 5HTSA 3UAJC 3OJDA 4NT6A 2HFFB 4G42A 4GH7B 3QFJB 4FA8A 4PRNB 1AGDA 3BDYL 3GJFH 4ODTH 4WI8A 3CDCA 4M5YL 4F3FA 4G9DB 1HEZA 1UEYA 2CLVA 3QXAA 4QXUH 1A6UL 2EO9A 4I4WA 3NH7L 4LLYA 4Y5YA 2WP3O 3FZUD 5KS9B 2Z31D 3HC0B 5FYKH 2PTTB 5HHXL 4YE4L 2PTUA 4HSQA 1ZGLP 1QLRB 2EZ0C 1LE5A 5IHUH 3HC4H 1ZHNB 1AKJD 5I2IA 2NYYD 4BK5A 3QXDB 5HGDB 4PJHE 3V4UH 2FX9H 4CU7A 1TVDA 5CJOL 4LNRB 2AVGA 3G5XB 4HUXA 2FSEB 3RY6C 3PHOA 3VFVB 3AB0B 5ILTL 1BFVH 1EEZB 3UMTA 5E8PB 2C7UA 5BMFL 2X6MA 4R0LB 5FDYA 5C86A 4KMLB 1F97A 5EU7C 1GGBH 1MY5A 4RBPK 5EZLA 3LDBC 3LKRA 1RZKH 4PTTB 1BJ8A 5KTEH 2M26A 3MFFA 2NTFA 2FB4L 5EZJB 1ZLWH 1AO7D 3F12B 4YHIA 5DHYB 5BVJA 1A7OL 4M7JL 4F2MB 3V6ZA 4JDZB 4P2RE 5E8OA 4PJFE 2EXYC 5I8OH 4HXBL 3Q2CA 1BZ9B 4QRRD 3RAJH 5FFLA 4KGJA 3FTGB 2V6HA 1GPOH 1FL3B 4JGMA 4K7PX 1WF5A 3MBEA 1R5WA 2MHAA 2Y4SA 3DPBA 4P5KA 4QHNB 1MFDL 4PJDF 1X6LA 4JJHA 4PRHE 4NQVB 1G7JA 4Q9BA 2YRLA 3E3QC 1F00I 4XWOC 4F9LA 3MJ9H 5C3TA 3GBMH 4KK9C 1A1OA 5H94A 4D0CA 3P0VL 5KSAD 2NNAB 5ICYB 5DMKB 4PUBL 1B2WH 3NACL 3LS5L 3KPRA 4OBSA 3S5LA 5JOEA 5GRWA 3VFUA 3O3BA 5CEZE 5TE7H 5TGBA 5A2LH 3EUUA 2R2HB 2RHEA 4EXKA 1AY1H 3QJFB 4HF5L 4S0TD 3QPXH 4G6FB 1BVKB 1F8TL 5FM4A 3QI9D 4NGHH 1J1PH 1XF5A 3MLTB 3EFFB 4WUKL 5GS0D 3SDAA 2E9BA 4L5FL 1J8HA 1NCCL 2F74A 4NUJA 1SEQH 5F71A 3FHAA 3ZHDA 5F96L 4ZOEA 1TTUA 4PJ9C 3EHBC 5CSBA 4UUJA 1J11A 2AJ3B 5IESH 3AXLA 3CFBB 5HGAB 4V1DD 3Q3GB 2JE8A 4DGYL 3HAEH 1UJTA 2VLME 3ZKSD 1HHHA 1L6XA 5DD3H 5EBGA 3WIHH 1IM3A 3VE0B 3FQNA 1Y6NR 2XXMB 2ZOKB 4YHLH 3GMMB 4JQXA 1HQ4A 5K9QI 2ICWB 4Z77A 5ID0B 3MRMA 2BC4B 1NLBH 4FQCL 5HPMA 5INDB 1BLNB 3QWQB 5I73C 2FO4B 3FFCB 2YPKB 4AENA 1X7QA 4AEHH 1Z9OA 3ZYIA 1CXEA 1PX3A 5F9OL 4DKEL 4XPBH 1A14H 5D2NE 5D7JD 2OL3B 1AXTL 2R23B 5IW1B 3OB8A 4KDVA 1CDJA 5E9DB 4AL8H 3WHE0 3TC9A 3GSOB 2J4WH 3P73B 2IBGA 3DRQB 1VKXA 1A3QA 4AEEA 1HQRB 4X5WB 1OHQA 2ZUVA 1DL7L 4PJXA 2BVUA 2YPVL 4M9OA 3H3BC 4PJIB 3QAZB 3TCLB 4N8CH 1LO3L 5DZLA 3OKMB 1UA6H 1U3ZA 2LU3A 3FRPA 3HMXA 5CJ8A 4WUUA 2OR9H 4JB9L 4WW2A 3AREB 3CFDB 1M1SA 3E6FB 3MODH 2H9GB 3KLHC 1DQLH 3RZCB 3CX5J 2ZSWA 4PP1D 3NPSC 5CAYB 1BZ7B 1QBML 2C1PA 4GAYB 3VXUD 2HFEB 1BF8A 2R8SL 4XMPH 4EUPB 2X05A 1KBGH 4L8SB 5KSUB 2B1HH 3GMLB 5T3ZH 5EZOL 4ZXBC 3M07A 5DJ2B 2I07B 5CILH 4KY1H 3JVGC 3WLBA 5L2JA 3FOLA 3H8NA 1C12B 1QLEH 3FAWA 3RY6A 3C08H 1Q9OA 3WNOA 5BW7C 1OCWL 4P3CL 4XH2A 2VZTA 7FABL 4JG1L 2W0FA 5E8DH 2EE3A 2PXYD 4XP1L 2VL5A 3TYFB 5T1KA 1D5MB 1MLBB 5I1GH 3RWDB 5D7KE 2Y23A 2XNAA 2Q8AL 5KSBF 4L4TE 2I60L 3L7EB 5CJBA 3ARPA 1I75A 2UUDK 3MV01 4YDLB 5KSVB 2GYSA 2LV4A 3OF6A 3BIKA 1U58B 4N0YL 1ZWIB 2B0SL 2F58L 1J9CT 3VFOB 4FFZH 4GW4B 4P23B 1J1OH 4JN2B 1FIGL 2YMXL 3ARYA 2GJZA 4DN4H 4X6CB 2Q7YB 4U6YB 3FL7A 3PP3H 3DHJA 1JGLH 1JHTB 1TQCB 2EDNA 3T8XA 4ZMAT 2K3TA 3IJSA 2RCSL 2FEDD 5I1KH 3B2VL 3L1OL 2NY7H 4OF5A 4ODVL 5DVKA 3VWKC 3IDYB 3MTRA 3P77B 3IDMB 4NRXA 4HS6B 1CU4H 4UB0H 4CKVX 1NC2A 4LP5A 4Z0XB 3BKYH 2Q20A 2ZUXA 2XV6B 1N4XL 2YWZA 3KHOA 4X8JB 4YZFF 5D7IF 4M1GL 1MQKH 4HAGA 4J4PD 2GI7A 4LCUA 4Z7NE 3SDCD 3WJJC 4LPVA 1MAKA 3PHQA 4IOSD 4UV4L 4YFEA 1ZT7B 1ZOXA 4OM0L 5IP4A 3HR5A 4ALAH 3NFSL 2JIXD 1TZHB 2DI7A 1YEGL 4U7KA 4DW2H 1HN1A 4CVZA 1T22B 3ZO0A 3B9AA 4R7DA 5BQ7A 3MLYH 4PJ9A 2DQJL 4CDHA 4DGVH 1YYLH 3K4AA 2GTZB 5EIIA 4I2XB 5F3HA 3GMNB 3DRTA 2N56A 4JPVH 1WSST 4BJLA 5DFWH 3GFUA 3W0WE 2DLFL 2ITCB 3CLFL 2I5YL 1U91A 4HG4K 3V4PL 1IKNC 3T0VA 4J3WA 4XNZB 1WFOA 1P84K 1JNNL 1MHCB 4MSWB 1EHLL 3RA7L 3MROB 1LO0H 4LVHB 2J8UA 1UZ8A 4OLZL 3CFEB 1RUQH 1JGVH 4JM2A 4JFHE 2VXVL 3L5WA 1BD2D 4I9WD 4LKXA 3IXTB 2IADB 3KPTA 4JO2L 3QT2A 3SQOH 1CF8H 4XCCL 3OXRB 2LAGB 4HIXH 2H41A 1CTNA 1Q0XH 3QUYB 4P2QD 1PYWB 4CADB 2BHYA 3HNSL 1U8IA 1U8MB 3NBNA 2AK4E 4GAJH 3TBSA 5D7LD 1RZFL 3P30L 1E28A 3LY6A 3E6HB 5DR5H 1P2CA 1W0VA 1ONQA 3MRFB 3GBLA 5HYFA 1IC5H 4WGVB 4POZD 4O9HL 1SY6H 2DLIA 2R1YB 4O58L 5JIHA 4Q58C 2HJFA 3QQ3A 1OP5K 1T2XA 2UZIL 3H7BB 3K4DA 3MV9A 2EKSB 5C09D 4BKLB 1BREA 3S4SB 5JW5A 2ZCKL 2H6PB 3C9NA 4M02A 1QKZH 6FABH 4ZXBA 4M7KL 3FQUB 3QQ4B 3JVGA 4Q7DA 3VXMB 4BH8A 5F3BB 2ED8A 5GGUA 1Y6KR 4P0DA 1X5IA 2GSGA 3QWOB 4HUUB 1FYTA 2FRGP 1A6WL 4OCXL 4PJBA 3GIZH 4P46A 5BW7A 3GMRA 1WZKA 2M1KA 4EN3B 1WIUA 3QHTC 3FAXA 3RL2B 3CAFA 5F7EH 5ICZA 1KCRH 1L7TL 1HHIB 3QEQB 1MJ7L 2FBJL 2P1YA 3ARBC 3QFJD 4ORGB 3SDXB 5DK0A 2HRLA 3BX7C 4HDIB 4AY0A 4X4YB 4NQCA 4HJGB 4L3EA 4FFVC 2CLZB 4X4MA 3RNQB 1AQDA 5HHQB 4JM4L 3OG6B 4KTDH 1EHAA 2VN4A 3RVXD 3MLZH 1NEZA 3K7UA 3D2UD 3CX5K 1NMBH 3ZDXE 4R9HA 5IR1B 1I9IL 3ULVL 4HK3N 4PJ8C 1MWAB 3H7LA 2RGSA 1U2CA 4LPYA 1MIML 5HYQA 4N0UA 1IGJA 2PW2B 3EFDH 3P2TA 4LHUD 4LRIC 3KJ4B 1KJ2H 5IMOB 2VE6B 5F7UA 3ARFB 1VSCA 2C1OB 5ESVB 1UWGL 1S7XA 2P8PA 5DS8A 4ELKB 1MFNA 4X98B 3W2DL 1WBYA 5DJXA 5EBLA 2EIDA 4HIEB 4PJHA 3VWKA 3CSGA 4ZFOB 5FGRA 2UWEA 2OP4L 4OIIH 4EVNB 1HDMA 1K6QL 4Y19A 1P9MC 1PZ5A 2JELL 3GSUB 1H8OA 5DRXB 4U1SB 3T77B 5C0BE 2OM5A 1GZPA 4IRJB 2W9LA 3SKJH 4WCYL 3EOBA 4IBLT 5E4IA 3CFJB 4ISVB 5I74B 3DGGA 3WJJA 5KVEL 1I9JL 3ES6A 1FVEB 4TUKL 5L2KB 3OKNA 1D5ZB 3U7YH 3BGMB 2R39A 2EEAA 3X13B 5B22A 1IAIH 4K3EL 2D31B 1ZV5A 2ZZUT 2CQVA 4LU5H 4LIQE 3EO9H 3O2DH 4G9FA 2MQCA 4I5BB 4KXZH 3V6FB 4RZCB 1KELL 2VITB 4H20L 3MCKB 2D7QA 4J12A 2JJSC 1X5LA 1NCNA 3GJEA 4P2RA 2RAMA 3SKUD 1ZGLB 1FN4A 1K3IA 1R3KA 2BFVL 1MUJA 4PJFA 1Z0MA 4PJAF 4XVUD 4G5ZH 4XHJD 1SJEA 2LU4A 4MX7A 1QEWA 2H2SD 5AYUL 4BSWA 1FAIL 3SN6N 4JFFD 1IKNA 4OCWH 2LTQB 4JKPH 3Q5YA 3FB5A 4NQEE 3O6KH 5GRZA 1VGEH 15C8L 2ADFL 1FGVL 2QKIB 4K7PL 4MDJB 1J0YA 2NCMA 5CMAB 5IIEA 5F7YC 1F11B 3BGFB 3V52L 5EU6B 2R0ZL 4YHZH 3ZE1F 4JANB 2VDQL 3BDBA 1OAQH 4G8GE 5E5MB 1HWHB 1KTKE 1G7HB 4R3SB 5K9JL 4UIKH 2IH1A 2J88L 4L1DA 4ODSH 1SVZA 3LV3A 2ARJA 4YQXL 2R2EA 3LN9A 1JYXA 1JF1A 2P8MB 3H9SD 1U41A 3Q6GH 1FV1A 1NEUA 5F1OB 1JZ7A 2BNQE 3O6FB 5FXCH 1F3RB 1HZHH 4NP4H 3BZ4A 4QWWC 5AUMB 3IDXL 3SKMB 4KRNA 1L0QA 2C4FT 4WV1B 2VSCA 4DVRL 2Z8SA 3UTPD 1T7YA 1ZHKB 4LOUC 5C6PB 2BX5A 5JOFB 4YBQC 1MCOL 2ZNXA 1N0XH 4ZFOL 5J3HC 2EEBA 3FFCD 4OI8A 4U1JB 3RUGF 2NY0B 2Q6WA 4ZSOE 3VCLA 5B39B 1FFNA 1QVOA 1GL4B 3B9EA 4LCWE 5F9JA 5E9DD 2FR4A 4I3RL 4HZLB 4YDIH 4MB4A 2YD7A 1JFQL 5GJSH 5DI8B 3H3PL 3DURA 5JDSB 4NUGH 2WBKA 1A9BB 3HI1B 1FE8L 2FHCA 2ZJSL 1QA9B 3MYJA 1I3GL 2DWDA 3U36B 1H3GA 3WXVH 3C8HA 1EIBA 1IE5A 3RVVC 3F7QA 2AJVH 3ARBA 2F53A 3TNNA 4LHJB 1I7ZB 2HTLD 4HS3A 3CDGA 4NZRL 2EIZA 3X3GL 3VGDA 4MDIA 4UU9A 5BRZB 5FB8B 3RZCD 1CDYA 3EKCA 2FO1A 4Z7OE 2P8LB 1TQBB 1J87A 4YGAB 1FFOB 3D0VB 4N8PA 2J6EH 4Z9KB 4P5TD 2CIIA 1FJ1B 3ECBB 3IFOA 1MFAH 2NX5A 3QXVA 5DMIL 2PR4H 3SDYH 1KEML 4M6NH 4PJ8A 1BFTA 3CK0H 2Z92B 3EJZD 5GGTL 1S7TB 3FN0H 1FPTL 4LRIA 3IYLW 1U92B 3DX9A 5D2NB 1U6AH 1T7ZA 3QFDA 1DBML 4YHMH 5E08H 5DQJA 4JCMA 1YEIL 4LSDA 4Z76B 1FZOB 1G7LA 1DE4B 4QHUB 2E9IA 5TF1L 1ZANL 5T5FL 4O4YH 1H3WM 1MI5E 4HS8L 1P9MA 4YFLI 1AXSA 1RZIB 5IB3B 3LEYL 2CLRA 4K8RH 2HT4D 1UM5L 2FIKA 1I8KA 1G6VK 3X12A 1ADQA 1HINL 1FDLL 3VFSA 3UJTH 4X7CC 2WBWB 4OV6F 2BCKB 3K46A 5FHBH 4P23D 3EYSH 1ETZA 1LO2L 3ZKXB 4MJ4A 1HCFX 4U0RB 2HAZA 4NBXB 3QRGL 4UV7H 2DQFA 2I25N 1I7UB 3VG9B 2JJSA 3CVHH 1NBVL 3C2AH 1XGUA 2JCCE 4B5EA 1A1NB 4KUCF 4OLVL 5FGBC 2MOVA 2GK0B 1MIEH 2MCPL 4DKDC 2AABL 2BVYA 3M1BA 4WJ5B 5MHSE 4YFDB 4LRNH 5JTWA 4L8BA 3O2VH 2FECI 3LN4B 5FYLL 4D0DA 1NCBH 5DJ8A 4CGTA 2YUWA 5HY9A 1CR9H 1BM3L 2EDQA 1H3PH 4WWKB 5JDJA 4LLQB 1TNMA 3I6GB 4LF3B 1HIMH 4KI5D 1EXUB 3EYUH 3O8XD 1CFVL 4E41A 3FO1A 4X6DF 4WU7B 2IQAB 4HMDA 1T7XA 1V3MA 3MRIB 5EA0H 2XFXA 4PRPE 3UPCA 2Q76B 1TZGL 4JO3L 4OZHF 2CH8A 5E8NA 2WV3A 1MJUL 1GIGH 1WZLA 4YDJA 1PQZA 1UWEL 4NCC1 4XVTL 3TA3D 4CJ1A 5CHNB 4Z7UE 3F6LA 1UWXK 1WC7B 3NA9H 4AK1A 4OZGE 4OGZA 1I7TB 2CR3A 2JTDA 3ZYZA 3HCVB 1KC5H 2NY3B 1NUDA 2MJWA 2ZG3A 5HVGB 2HKFL 5E70A 4DAGL 1IJ9A 4LSSH 5C07E 3K80A 4GRMA 1LHZA 3FT3B 5TH2A 1CIDA 3EOYG 3NPZB 2EYRA 4BSVA 1HKLL 1Q72H 1HILA 1ZEAH 4TSCL 4GRWH 1CGSL 4M62H 1FO0A 3G6JA 5IMKB 2NZIA 5TFSL 1BX2A 2DKUA 3G6DL 1XGYL 5ACLA 3VGAC 4X99B 3C60C 1AHWC 2QJDA 2AJZB 4RGNC 5D5MB 1YEHL 4JR9L 2YS4A 2HJLB 3WJLC 3ZKMC 3KS0H 3D3VB 5ICXA 5CP7A 1J05A 4QO1A 4MCZB 5DEGB 3QH3A 3TFKC 2VDLL 2QL1A 3UTSA 3QUYD 4S1DC 3BPOC 2OS7A 5DK3A 5D72H 4KZEH 5IG7B 1W2KT 1ZLVK 4XNYL 3Q48A 3AVEA 5I17B 4H88L 4M8VA 1AFVH 3B9VA 4P2OC 4PGCA 1UH3A 1JPST 3EYOA 3T0BA 2GITB 2XA8L 1R3HB 2HT3C 1U0QA 3UTZA 5DEZA 3TZVD 2P5EB 1GYAA 3VFTB 1IAOA 2JJWA 5C0AA 5EO9A 3W0WB 1MCHA 1YUHA 4PIRF 2DD8H 4Q6YA 2I24N 1B88A 5ACMA 3PABB 1ZLVH 1CQKA 3BP4B 1KGCD 3BQUB 1AGEB 3I85A 4KV5E 3SE8L 4W6WB 2EH7L 4QNPE 4AZ8A 4DWHA 3LIZH 2NY1B 1A2YA 3VXMD 3CLEH 3ZKNC 1VERA 2NY5L 3DMMC 1NMAH 2YA1A 1KCVL 1ZLUK 1Q9LB 4KKCC 2VZUA 2ZKHL 1NGXA 4HBCH 2UVFA 1NBYB 3C6LB 4PJEE 5F1IB 5GS2D 4M7LT 4AM0A 3QZWG 4LPWA 5D70L 1D5BB 4EN3D 2HA1A 4XNXL 1U8HB 2WK2A 1P4IL 1V7MH 3H9HB 1JNJA 4D3CH 4M5ZH 5DUML 5LCVL 1NANH 1F02I 5I75B 2AK4B 5M7QA 2BXZA 3V4VH 3IRZA 5D4QA 5MEOA 1ZLUH 5DUBB 3WE6B 3FCTA 1MFCH 4PJGB 3QIBB 5TE6L 4Y5XC 4UMGA 5D1XB 1P7KA 5IFAH 3GRWH 3N1FC 4MXQD 4TPRH 3D85B 1JGDA 2FX8H 2WINA 5E5UB 2FWOA 1EK3A 1RV6X 1FVDB 3BMVA 3OKDB 4Q2ZB 3HNTL 5KOMC 5ITBH 3ARFD 4MA7L 3L5HA 3HS0B 1A1MB 1MRDH 5KVGH 1ZS8B 5ISZB 4IRZH 2OJZH 1IGMH 3AUVA 3TPUA 5H8DA 4LAJH 5F6HI 5F7NC 5E94B 3OJVC 5I9QB 5CJXA 5FGBA 3SPVB 1PW3A 1BZQK 5CFHA 2ATPA 1NH6A 1OM3L 3BP7A 4U7SA 3ORJA 4GS7B 3UZEA 3GSVA 4F7EA 3LQZA 5SV3A 3W5NA 3JV6B 2OQJA 5CCKH 1G9MC 3WN5C 4GKNA 1YEFL 3RVUD 3MLRL 4MYWB 2G5BB 4IRJD 4ZPVB 1W72B 5AWNL 4TOYL 2OK0H 3MGAA 1KEGL 1J12A 4MJ5A 3QUMH 4DKAA 3T04D 1DUZA 4YUEH 3BEVB 4DOHB 5F72S 5C9KA 4KQ4H 1T7VA 2MMXA 2VXTH 4MCYB 2DBLH 5L2KD 4WIQA 5J7CC 4EBQH 1VESA 2YPLB 4WY7L 5HGGS 2E7CA 5CEYA 3IJHB 4LLAA 4ACPA 1KLGB 4FQXC 5HHOA 1VPOL 4UAOB 1YNKH 3LD8B 1FSKB 4XP6L 1JCKA 1U9KA 3O41A 4DQOH 2XIDA 3O2WL 4PG9A 4MXVF 3MRGA 1CE1H 5KJRL 1W8NA 1MFBH 2IGFH 2AV1B 1LP9B 2A9MH 2X7LB 5FCUL 1SQ2N 5GXBB 3BPLB 1YMMA 1A3LL 2Y6SC 3E8UH 5C0ND 3OR7A 1IQDA 4XPTH 5J6HA 5F9DC 3MRPA 1ZVSB 3VH8G 3KPMB 4QTIH 5FDWB 4MJIB 4CMMA 3RU8L 4OZFH 1PY9A 5EU6D 5HHPB 1MOEA 1J7VR 5C0BB 1XCTB 3C60A 1AHWA 1C8PA 4AIZB 3BP5B 2FGWH 3ROOA 3T3PE 4HWZA 1A7PL 3WJLA 1RZKC 2GK2A 3LEXB 1FLTX 4J3UA 4M7ZB 2XWTB 3HFML 3IVKB 3RL1A 1I1YB 2D9CA 2QSTA 4AEIL 4MQ7B 3UC0H 4TSBL 5DSCB 2R2CA 4K3GA 1CFNA 3S3JA 4AQOA 5D1ZC 2A6DB 5SWSD 1EAJA 2DMCA 2R0KL 3O6FD 4ZODA 4MJ6A 1KJ3L 5H37H 1WIPA 4XZUA 4Z0BL 5KVDH 4WHYH 4MHHI 3GHEL 2PYED 4EIZC 2QQLH 3CXDH 1MRFL 4FQ2H 4MA1C 2HLAA 3MLWL 4OQTA 1QP1A 1FVCB 2H32A 4P2OA 1BQHG 2ZUSA 1RIUL 3OJDB 2JLLA 1IM9B 1EH9A 1OPGH 1AGDB 3QIUC 3RX8A 5JORA 1T1XA 2BNQA 1N5YL 2CLVB 3QXAB 1NCAL 4M4PA 2IFFL 3OAUH 3ZMRA 3THML 3DX7A 3NMEA 4Y5YB 4LSVL 4JLRA 4QLRA 4NQEB 1T21B 4FQQB 4XMLL 1X4ZA 4PPTA 3T4AA 4KUZL 3M8OL 4JHAL 3VXOA 1LDPL 1F4XL 3BN9D 3O3DB 4K23H 4NM8H 5J12C 2NMSA 4UNVA 5DMGC 3DMMA 4V2CB 4HUXB 1T1ZA 3LZFH 3PHOB 4NNYB 1ITBB 1C5CH 1IAKA 1NFDB 4ZSOA 3W11C 3GB7B 1KB9K 4R4BA 1TETL 3VDBA 4OLWL 2C7UB 3T0EC 3C5ZC 2XN9E 3ARGB 1BAFL 2YWYA 5GRVL 1KUMA 2VZSA 1F2XK 4ENEC 3UPRA 3N9GH 1CXIA 4GQ9H 2HMIC 3QDGE 4JKWA 1IEAA 5EZLB 1RFDL 1GHFL 5BRZD 2A74A 2NTFB 4H0IA 3STZA 3KJ6H 4OFDA 4YHIB 4Y5XA 5BVJB 2ATKB 4BSJA 3A6CL 3V6ZB 5HD8D 1OT1A 2EDLA 3QCTH 4DCQA 5E8OB 4ZNEE 2JKXA 4FFWD 1KIUA 1KG0A 1Z3GH 2CKBH 1BVZA 5I8KL 4S1RL 2P4AB 4Z7QF 4R96B 4BZ2H 3AFLA 3I75A 5IQ9A 3BWAA 3MBEB 5E56A 5FHAL 2YD6A 5D2LB 1R5WB 2MHAB 3K3QA 5T3XH 4P5KB 5GGQL 3S6CA 4Z7WA 3SO3C 1VFBA 1U95A 2BNRE 2WLYA 1G7JB 1GGYA 1AGBB 4LSRH 3V6BR 1BFOB 3IXAA 1BQLL 4XCYA 1SYVB 2WMPA 1A1OB 4LASL 1I1AD 2A6KA 2VDKL 4H26A 4D0CB 3VMPA 1M6OA 3BSZL 1SYSB 5C0CA 3BW9A 3KPRB 5DJZB 4KROB 3VFUB 3O3BB 3WN5A 3B6SA 3KPLA 4LIQL 2X4UB 3I2CL 4N90E 4WFED 3IFLL 3DGCR 3VD7A 3UDWC 4TNWK 4NPYA 4IDJL 4S1SH 1S7SB 1WITA 1NFIA 3MBXH 1I1FA 5CP3H 4MLIA 3SJVE 1XF5B 4OLUH 3N85H 3QSKB 3BN3B 1YEJL 5TDNA 3PIQA 4U6VL 4X83A 5MEQB 3GJFA 5EH1A 3SDAB 4GBXD 1QNZL 1QTYT 1X5AA 4YK4B 1F4WH 1DQML 4HWUA 5DD5H 5FK9A 2F74B 3QYCA 4FQXA 4NUJB 3B2UC 2NY2C 3U9UA 1CE6A 4JO4L 4APQC 1ZTXL 4G6KL 2DWEB 4LQFH 4UUJB 3GI9L 3AXLB 3D39E 3UZVB 1Y0LA 4NFCA 4X0KA 1TPXB 4ERSH 4YR6A 1CCZA 1YY8B 4UNTA 5JXAH 2VDRH 1YPZF 3AS2A 2XTJE 1HHHB 1Q0YH 2AEPL 1QLFA 4HC1L 1EJOH 1VACB 1IM3B 1MPAH 3FQNB 5EC2A 2WWKO 4WWKD 3NGBC 4XB7A 5T5NG 3REVA 1OARH 4WU5B 1JIBA 3ZDYE 5DJCA 2V9TA 4Z77B 1X5ZA 4UDTB 3MRMB 1RULL 1PEZA 3V5DA 5HPMB 4GT7A 1N0LA 1H8NA 4J3XA 1X7QB 4AENB 5GRUH 1JN6A 3O3AA 3ILPA 4OIAA 4O02H 4X9FA 2E9JA 2FJHA 4K07A 1XGPA 5DURB 4OCMC 3BDYH 4M5YH 2AJXL 4OLEA 1X5XA 1VKXB 3VXNA 5J4MA 1A6UH 1FP5A 1RUAL 5SWZD 3NH7H 3ULUD 1HHGA 4PJXB 5HHXH 2LABA 4YE4H 4PJDA 5D1ZA 3OXSB 3BDXA 4LCYB 4NDMA 2FD6L 4RMUA 4D9LL 4PJ7F 3MUGA 5JW4Q 2NY3D 3QIWA 2AQ3A 1F6FB 2CRMA 5J06A 1PLGL 5DTFA 4WUUB 1JWSB 2BVTA 4OCRL 3QDAA 1WLHA 4WW2B 5CJOH 1D3CA 1OAYL 3QIUA 2K9UA 2ZSWB 5ILTH 4PJGF 3MJ9A 5BMFH 3ZSSA 4KK6D 5C0RL 2C1PB 5C0FA 4UQ3A 1J5OL 4JRYE 1UENA 5IHZB 5GGSY 2J5LC 4H8WL 3KYOA 1S5HA 1QFWI 2D7TL 2C3GA 3VD9A 4K3JL 3D3VD 4XMKL 2X41A 1W8OA 5I30L 5L2JB 2N7AA 2AAVA 2FB4H 5IVOA 3VI3F 3QDJD 2AQ1A 4QEGA 3RPIB 3BIBX 4NWUL 1A7OH 1TZIB 4M7JH 4EDXA 4TYUA 3FQTA 4NRZA 4Y0GA 4Y88A 2LFGA 4XH2B 3T0EA 3C5ZA 2W0FB 3KLAA 4HXBH 5IBLD 2VL5B 2M2DA 2ORBL 2YUZA 3BYYA 2XNAB 3LDBB 4NO2A 4X80L 4YC2C 2P5ED 4UIMA 1MFDH 3B8YA 2E7LC 1FNEA 2OZ4L 2IF7A 4GG6E 1WVZA 3PWLA 4K7FB 3BQUD 3BIKB 2WM0A 5EU4A 1BWMA 4MS8C 3P0VH 3HAEA 3LPGA 1HHKA 4PUBH 3RGHA 3NACH 3LS5H 3WIHA 2NY1D 3DUUA 4N5EC 4IOFC 4OZFG 1QPXA 3I3DA 3PWJA 4F80A 1CG9A 2GJZB 1T4KA 4HF5H 2APFA 4KVNL 2GQHA 4YLQT 1F8TH 3C6LD 5E00A 4Z78B 3IJSB 4XCEB 3V7AG 4Y1AE 4ZQKA 1YN6A 1NUGA 4WUKH 2YD4A 4RGOL 2NXZC 1NCCH 4NRXB 3BEWA 1JI1A 1NC2B 5A3IC 5F7LB 5F96H 5H37G 3HC4L 3V79C 4WHYG 3HUJF 3U1SL 3O6LL 2V5SA 5CINH 4CU8A 3UDWA 1G0DA 3QIBD 3RKDD 5F93C 3RDTC 1E4XI 2MFNA 5HHMB 5D1XD 4LCUB 2R0WL 3HE7B 4QXGL 1G6RL 4U4BA 3QHZL 1A5FL 4NO5A 3GSWA 3PHQB 5IVXE 4DGYH 3ZT7A 1TFHA 4W81A 4TULH 3D85D 5L88L 2CJUL 3HR5B 1GZQA 4PGBA 4WFHE 1S7VA 4R7DB 5F8QC 5ISZD 1X5HA 4FQCH 4APQA 3QQNA 3WLWC 2A9NL 3AROA 1X44A 3KPPA 5KTEL 4DKEH 2V9RA 4AH2B 5EIIB 2ED9A 4L9DA 5F3HB 5IV2A 1AXTH 3ZL4L 5I66A 1PKQE 2VNCA 1GJIA 3BO8A 3QNZA 1RJLA 3CC5A 1U91B 4P4KC 2D4FA 3DXAA 5K9OA 4JFEA 5E8EA 5EUOE 3ARSA 5KSBA 1DL7H 2YPVH 2W9EL 3BPNC 2P45B 3IS0X 2J8UB 1UZ8B 5I1IL 5ETUB 1T1YA 1LO3H 4EXPX 3HRPA 4S1QL 1R24A 3L5WB 5F7DA 5J9PB 3JTTA 1EHXA 2YPLD 1DLFH 3OZ9L 4HEME 3MNZA 5DMYA 1FL5A 1QD0A 1N8ZA 3QG7L 1ED3A 1IGYA 5L6YL 5HPOA 1G9NL 2IBZX 3DNKA 3DVNA 1QBMH 1U8IB 2R8SH 3LPWA 1FFPA 1ZHBA 1X4YA 5FF6A 1S5IL 3QULA 3TBSB 4U05A 3JV4A 4QOKA 1E28B 4JKMA 4TVPD 4X7TA 4ZS6C 1P2CB 4PJ5A 2KBGA 1ZT1A 4NGHL 3DVIA 5DVNA 2XTLA 4GLRI 3MRBB 4FXKB 1MCLA 4MJID 3L5XL 2J2ZA 3QQ3B 3NPSB 5D7IA 4WI7A 1OCWH 1S9KC 4P3CH 4BFEA 4NQDA 7FABH 4JG1H 5BS0D 4U1HB 1RY7B 5CUSL 5JW3L 3H0TA 4XP1H 4X6BA 5JW5B 3C9NB 2YA0A 4OFYA 2Q8AH 1MLCA 1QFUL 1MCFA 4L4JA 3WS6C 4PYHA 5MERB 4BH8B 5GGUB 2I60H 1EFXA 2GSGB 3AC0A 1FYTB 1JHKL 4OD2B 3VXSD 2Z8WC 1XF1A 2WP3T 4N0YH 3DV6A 2B0SH 2F58H 4OZIF 2Z93A 3ET9F 2VLRE 5ICZB 3OV6A 4P59L 1FIGH 5F9AC 2YMXH 1S9XA 3LQMA 5FO9A 1PY4A 5DK0B 2VZ1A 3DTXB 4NQCB 4L3EB 2E7LA 1MH5A 3KR3L 1AQDB 1N59A 4ELMF 5EOTA 1QSFE 2RCSH 1NEZB 3V6OC 3B2VH 3WNNA 3L1OH 5B3JE 4ODVH 3WFHA 4HFUL 2AJUL 3TBTA 2V5TA 3MRDB 3L6FA 4QKXB 3N0PB 3OHXB 5HYQB 1DN0A 1MCIA 4N0UB 1IGJB 2VUOA 2GKIA 1N4XH 3UTOA 5ENWA 4M1GH 1EX0A 3TH3T 3MODL 4Y4FB 2P8PB 5DS8B 2XQBL 2RR3A 1WBYB 4UV4H 3TYGL 2BMKA 3WEXA 5EBMB 5F97E 43C9A 4OM0H 3U0WL 2UWEB 1HDMB 3NFSH 1FZJA 4Y19B 4NSKA 1DBKH 1YEGH 3GUTA 1PZ5B 1I9EA 4ZO8A 5JPNA 1DVFC 4EUPH 3MR9A 4X7DC 1GZPB 2DQJH 4R7NA 3CU7A 3EOBB 3MQIA 5GRYA 3RDTA 1NCDH 2YSSA 3DGGB 3TNMA 5A43C 3AMKA 3QDGA 4F15C 1OB1B 4L4VA 2DLFH 3U82B 3ES6B 3CLFH 2I5YH 1XR8A 3OKNB 3TJHD 1BBJA 3V4PH 5GZOD 5GZNC 3I6KB 7CGTA 1JNNH 3QNXA 2IPUK 3VRJA 1YDPA 4G9FB 1EHLH 1SY6A 3RA7H 3MBED 1OWWA 2IWGA 4PJXF 4QRTA 4OLZH 3GJEB 1WAAE 4ZNEA 1XEDA 1R3KB 1MUJB 4YXLL 2VXVH 4F57L 3PNWB 5D7SL 4TUOA 2J3SA 4HUNB 1FZKB 4JO2H 1SJEB 2ARJQ 1QEWB 1YA5A 5HI3C 4BSWB 3OAZH 4P4KA 3KPRD 2DM7A 4KROD 4XCCH 3FB5B 4QRPA 3LQAL 4OGAC 3EYQC 4FZ8L 3OB0K 5IIEB 5DRNA 3SGEH 2VLJE 4B7IA 5F88A 4TNVK 1EEYA 2NW2A 3P30H 1RZFH 2LVEA 5JHDA 1EMTL 1N3NA 2ICEA 1D7FA 4KKBD 5K59E 5TQ0L 3INUL 2FECL 1JNHA 2IH1B 3SDAD 2F5BH 4O9HH 1J8HD 2ARJB 2C9AA 1V3KA 4ZFGL 4R90L 2R2EB 2AJSL 4O58H 5K9KA 2XPGA 2OX5A 1JF1B 2R4RL 4LK4A 1H5BC 1FV1B 4NYLA 2R9HD 2UZIH 3RWCA 2IPKB 5E1AA 3OPZH 1CFTA 4GMSL 5L8LB 2ZCKH 4PD4J 1MQKL 3BOVA 2DN7A 4M7KH 5LAXA 1P6AB 3BKCL 4P2YA 5A1AA 1KJ2A 1AO7E 3KPNA 5EO1A 3PJSA 4PYGA 4TNVF 2PF6A 4X9HA 1A6WH 3ARDC 4OCXH 4PRIA 3EAKA 4IMLA 3DSFL 4KJWC 4HX1B 5MI0C 2MKWA 3G5VA 3NN8A 4EIGB 5BV7B 3NIGF 3AAZA 3VCLB 5HYSB 1EA9C 3PGDA 3EYVB 2B20A 1FFNB 1UB6A 1L7TH 2K1MA 1QVOB 1MJ7H 4ZUTB 2FBJH 3B9KC 3MXVL 2FR4B 3WS6A 3I3BA 4MA3B 4K8RC 4KKAC 3S35X 4JREB 4JM4H 3MX0A 3DURB 3TO4C 4IRSC 2X09A 4P2CG 3WFEL 3DVGB 1S7UA 5F89B 4TRPL 1I9IH 5GS3A 2DWDB 3ULVH 2BSSA 1MAJA 4F7TB 4PJAA 4MB5A 1MIMH 5EU5A 4WUUD 4OD1L 5JZ7C 2O5ZL 3O2DA 2XZCL 3UAJD 5JIIA 2F53B 5DVMA 3TNNB 4X6EB 2CUMA 5JA8B 4HS3B 3CDGB 2C3XA 2EIZB 1H8SA 3HG1A 4MDIB 4F37F 2YZ1A 1UWGH 5BXFA 5MENA 4BFIB 4KDTC 1OSZA 2BVEA 3LKSA 3ULVF 4J1UA 2OTUA 3W2DH 3T2PA 2CIIB 3V6OA 3IFOB 1QZ1A 2XA3A 2NX5B 1MHPL 2OP4H 2EZ0D 1K6QH 5JUEL 4H1LB 4I77L 2JELH 5EBWA 4RGMC 4V2BA 2VWEC 3HRZB 1PG7L 2EE9A 3DX9B 4V1DE 4WCYH 2GHWB 4HKJA 1FG2A 3NCFB 3QFDB 3SOBL 1UQSB 5DQJB 2XWBA 4UOW0 4UINL 3NZ8A 1I9JH 5KVEH 3MUZ1 4MMXC 5GJTL 4TUKH 1CDIA 1G7LB 1NCUA 1AJ7L 1WGOA 3X14A 2XZAL 3GI8L 4K3EH 4QY8A 3W9EB 1NQBA 2XT1B 5T1KD 1K4DA 2VMFA 3H42L 3QZWA 4JAMB 3T1FA 2MQ0A 1AXSB 1IQWL 1KELH 4H20H 1CL7L 1DVFA 5TE4L 3ZTJH 2CLRB 1P1ZB 3RWJA 1I8KB 2BFVH 3OF6D 3X12B 2ILLA 1FH5L 2FJGA 4OGYL 4JM2F 2WIIB 3RUGA 3LHPL 1GXEA 5AYUH 3BRDA 4PTUA 4ZO9A 3VFSB 1FAIH 1UB5A 4K3HA 2EXYD 3V8CA 2HVKB 5C0EA 15C8H 5GS2H 2ADFH 5BV7L 1FGVH 1CXKA 4K7PH 1CBVL 4HV8A 5CJ5A 3D9AL 2GTWB 1F2QA 4YIQA 3V52H 2R0ZH 1UFUA 4XWOD 2VDQH 2E6PA 4KK9D 3GKZA 3TBWA 1JMZA 5IEKA 3D18A 5K9JH 4CNIA 1ZKAA 2J88H 4NC0B 5C08A 4L8BB 3QUXC 4YQXH 4D0DB 1NC2D 5DJ8B 3RNKB 2FZ3A 1SBBA 5HY9B 2V7NA 3VXUE 1LNUA 1WBZA 5FO8B 1T20A 3AMLA 3T2QA 3DJ9A 4E41B 5HHMD 3FO1B 4Y1AA 5CIPH 3SQBA 4PRBA 1NDMA 4RAHA 4F9PC 3IDXH 1F3DJ 4DVRH 2VR5A 3BGAA 3LKOB 5DMJB 5E8NB 1TCRA 2R2BA 4YDJB 1TJHL 4OIIL 3OKLA 4YAQA 2Y06L 1MCOH 5IBUB 4PJ9D 3EHBD 2J6EA 1OLLA 1H5BA 4XNQA 5IVXA 3KPSA 3JTSA 3ROLB 4ZUSA 1E4WL 4PJBF 4Y16C 1LE9A 4KH2A 4GJTB 2J1KA 1B0RA 1VEOA 2V5MA 1IMHC 25C8L 5C3LD 5HYJA 5DEFA 4HFWA 4LSUL 3QNYA 4Y8DC 1JFQH 1NKRA 4GRMB 5TH2B 4B0MM 3H3PH 4BSVB 2EYRB 1P5UA 1HILB 3ARDA 3N1PC 2Y5TA 2ZJSH 2Q86A 2IANB 4KRPC 3ZTNL 1G7QA 1I3GH 3G6JB 1BX2B 3GK8H 3VH8A 4EUPG 4YBLC 1GGCL 2VR4A 3B9KA 1CTOA 2PTVA 4LDEB 4NZRH 4Y4HB 5CP7B 3X3GH 1J05B 3WD5L 4PY7B 3EBAA 3QH3B 4M7LL 5JNYA 4G8FA 4WVRA 5DRWA 3KYMB 3U6RA 3TO4A 4IRSA 1RURL 4OCYL 3S36X 4MNQA 4KK8C 4DK3A 4XT1C 5IW6A 5DMIH 5E6ZA 2WQRA 2P44B 1KEMH 4BFGA 4KGLA 4PJHF 5GGTH 5IM7A 5IB5A 4PGCB 1T66C 3EYOB 1FPTH 5SWQA 4G80A 1T04A 5GQBA 1N2RA 1CLYL 3L3IB 3UTZB 1KULA 2X42A 3KLHD 1DBMH 4G3YL 1IAOB 3CVHA 2G9HA 1B6DA 1CFSA 3VRLF 5C0AB 1BQHA 5EO9B 5C92A 1WJ3A 4KDTA 3NTCL 4NQSA 5ABDE 4ZTOL 4X6DA 2YR3A 3MV9D 4ODUA 5TF1H 4PJCB 1ZANH 5T5FH 5E4EB 3HZVA 1T5WA 5EN2A 5BJTA 4HS8H 1M7XA 4MGXA 1NAMB 4NP4L 3OGCA 1WEJL 4ZXBD 4QRUA 1A2YB 4Z7VE 3LEYH 4OZHA 1X5JA 2EDXA 1RHFA 1MEXL 3DUSB 3HZYA 1LK3H 1FYTD 1UM5H 4XWGL 3PV6A 4RRPG 2I9LA 2ZP0T 3C2SA 3U0PB 3MJ7A 3SGDI 1HINH 4PJFF 1FDLH 5E7BA 2IJ0C 3UTTA 4XAWL 4UZGA 4ONOA 4K9EL 1LO2H 2VABA 4XBEL 3WL9A 2G60L 3UYRL 2XOTA 3VMNA 4NQCD 4D94A 4L3ED 1NBVH 5IB1A 1I8IA 4IJ3B 3FCTB 1P7QA 5DJAA 1FCCA 4OLVH 4I9WE 2MCPH 2AABH 1P7KB 4HEPG 1DLHB 4LGSB 3WO3B 3T0DA 1AGCB 1JK8A 3HE6B 5FYLH 1JGDB 2WINB 3EDJA 3T0WA 5JPMA 2FWOB 3MNVA 2V5YA 4P2QE 5FO7A 1BM3H 2CK2A 32C2A 4I48B 1QSFA 3J7HA 2ZPKL 3O11B 1CFVH 1QBLL 5D7LE 3VDAA 3RY5A 4W70A 2VKXA 3MRCA 3TPUB 1JVKA 4F33A 4JFZL 1K5NA 2DKMA 2D0HA 2ATPB 1TZGH 3VWKD 3BP7B 4JO3H 3PWNA 1P4LA 2VLKA 4A6YB 1ZVYA 3GSVB 4Y19D 2W60A 4YGVA 4F7EB 4ZPTA 3QUXA 2OQJB 1MCWM 1UWEH 4L29A 4XVTH 4U6XB 5GGRY 5CJQL 1BF2A 4CN4A 5C09E 4LSQL 2VLRB 4N5UA 1FIEA 3L3DA 4MJ5B 4P5MB 1JZ8A 1ZHLB 4K7PY 4XBGA 1DUZB 1RZGA 3L9RA 1U93B 1U8OA 4GXUN 4F9PA 2HKFH 2IG2L 4DAGH 4NN6C 1FQ9C 1TIUA 4JZNA 5CEYB 4JDTH 3MV7E 4G9FD 5HHOB 4TSCH 4NQTA 1CGSH 5B4MC 5F6IC 1HYSC 4OCNC 4WTXA 1PAMA 3MRGB 5TFSH 4P2RD 1KENL 1NAML 2F8VA 3G6DH 1XGYH 4Y16A 5I8CA 3P4MB 2IAMC 3LVEA 3QFJE 2DBJA 4YHYB 3ALWA 1YEHH 4JR9H 4PB9L 3WIIL 3O3EA 1VA9A 1YMMB 2X1OA 3KAAA 3IU3A 43CAB 4I3SL 2G2RA 1IQDB 3LN5A 2VDLH 1KTDA 4GMTL 5J6HB 5KS9E 5K93A 3I50L 3MRPB 1DQQB 1C08A 4E5XA 4CMMB 4XNYH 4L8DA 4UV7L 4H88H 3ZTJG 3S4SG 3VGAB 5DRZA 3C60B 1AHWB 4HUWA 4RGNB 5CEZD 1FZMA 3VGHA 2XA8H 1ZA6A 5TF0A 4HWZB 3WUWB 1RZJL 3VXRA 3WO4C 2VLJA 3RL1B 8FABA 3O2VL 4U6HA 1A64A 3QO1A 4RWHA 2IEPA 1HH9A 3MREA 1F4YL 3EJYC 3BPOB 1CFNB 4PV9A 4MJ6B 3SE8H 5HI5C 1LMKA 3GRWA 4XZUB 3U4EA 2KZ1B 5IB2A 2HLAB 4P2OB 4YDKL 4LPTA 2NY5H 2P5WA 1KSRA 1MHEA 1KCVH 4PGEA 2ZKHH 3ZLQC 2NY6C 4HW6A 2W38A 4A6YL 5D70H 3IDJA 4XNXH 1YMHA 1DQTA 5DUMH 3VA2C 5LCVH 4R26L 1KPRA 3DETC 3JWDL 4OF3A 2XZZA 2CUHA 2V5RA 1O0VA 5EORL 1T1ZB 5GS1C 4LSSL 4Y2OA 3QUMA 2DB8A 1IC1A 5TE6H 3D48R 1IAKB 5DUPL 1Z9MA 1HI6A 5DD0L 4UT9L 3M17A 1QFWL 1MELA 3BH9A 1B90A 2OCFD 3MJ8A 3N06B 4YXKL 3UPRB 1KV3A 3HNTH 1IEAB 3ARBD 2F53D 5MP6L 5DC9B 1Z5LA 4MA7H 5I76A 4F8QA 2HG5A 5ACZB 3MA7A 3GIVA 2A74B 3S35L 4XAKD 1K9TA 4FFVD 5I1DA 1D6EA 3STZB 4HLZH 3CSBA 3AM8C 4Y5XB 4DEPC 1AO7B 3CX2A 3MJGX 2X70B 5D8JL 3T0XA 3R06B 1RJCA 2C4FU 1OT2A 2NX5D 1OM3H 3S88L 1YN7A 5I1JL 3QXUA 3P4NA 1CGYA 3CJJA 1MCWW 4PJ8D 1OSPL 3H9SE 3QEUA 3C5SA 1YEFH 1PVHA 2I9TA 5I6XC 1ZXQA 4LDLB 1PZUB 3MLRH 4QRRB 3MCG1 1QSZA 3I75B 5AWNH 4TOYH 1KEGH 1ZLSL 3BWAB 4Z7NF 1IGFL 2QSQA 3IU4H 9CGTA 3GSXA 3NCEB 3TT3L 4OZFA 4Z7WB 1VFBB 5FGCB 1Y18A 4W6XB 3VDCA 2ZG1A 4J7RA 3IXAB 1DUYA 3KLSA 3IFPA 1FFQA 5FM5O 4GG8A 4NO3A 2V2TB 2A6KB 1FAKT 5JO5A 1KXVC 4WY7H 5B3NA 4I0PC 4Q97A 1M6OB 1MCQA 1XR9A 1YEKL 4XPAH 5C0CB 3BW9B 1VPOH 1SJHA 4XP6H 3FFCE 3NIFF 3WN5B 3KPLB 2BK8A 5GGSA 3O2WH 5KJRH 3CLEL 4NPYB 2AXHA 5IB4B 1QFOA 4HKBA 3G6JF 5FCUH 5E9DE 1NFIB 1A3LH 4LFHG 5CZXC 1FNGB 1J0JA 2BXYA 4MNHA 1P69B 5TDNB 3PIQB 3CNKA 3GJFB 3GSRA 4DUVA 5FK9B 1KJMA 5GISL 4FQXB 2O93L 4LVNB 1IEBA 3CZJA 3V5HB 3B5GA 1E4XL 3RU8H 4J3SA 4WGWB 3V4VL 1WWCA 1M71B 4JFPA 5ADOL 1Y0LB 2IAMA 4X0KB 4RAUA 3CMGA 4V1DB 5KANI 1A7PH 4NZTH 5SX5K 1S9YA 4NBZB 2C26A 3HFMH 4ZFZB 5CKAA 1QLFB 2A83B 2H26A 4TPRL 4WHDA 1E6OL 1NGPL 4KMQA 4AEIH 4TSBH 4P4RA 5DJCB 2OJEA 4E41D 2R0KH 3MA9L 2E9WA 1XF3A 1KJ3H 5EOCL 4Z0BH 1MRDL 1OTUC 3GHEH 4GKSA 4U3XA 3O4LA 2VJXA 1JN6B 3O3AB 3MLWH 3ILPB 4DFHA 3CFCL 1VFUA 2FJHB 4Z6AT 1RIUH 5D7JB 1X5YA 2KH2B 1AD9B 2GIYA 3FOMA 5EO0B 1N5YH 5TQ2H 3B83A 3QQ9C 2CRIA 1J1XL 4FQIL 4PP2A 1NCAH 1ES0A 2IFFH 5IWLC 3THMH 4LSVH 1EBAA 2XZQL 4PJDB 3HC3L 4XMLH 4Z5RB 1MCDA 1NGQL 4NDMB 5GRVK 3CFKA 3VXPA 2CKBA 4KUZH 1UM6L 3M8OH 4JHAH 5H2BA 4D2NA 1LDPH 1NDGA 1F4XH 4POYA 1HSAA 4MA1B 4QWWD 1KTRL 1SJXA 2UVEA 5CZKA 3DROA 1B0WA 4LOUD 2MKLC 4OUUA 1TETH 1YNKL 4PLKC 4YBQD 5DT1L 4OLWH 3DIFA 5J3HD 4Y7MA 4RMTA 4UQ3B 3EO0B 1BAFH 4HIIB 3VXUB 5HGBA 5IEHA 3KYOB 3CIQA 1ZA3A 1ZT4A 4X6CE 2MCG1 1KYOJ 4FXGB 1RFDH 3SGJC 4D0BB 2Q7NA 5B38G 3N1GC 1GHFH 2QSCL 2RQ8A 2AEIT 1KB5B 3E8UL 4ZUVA 3UTSD 5GS1A 4RA0C 3QHFL 3KXFA 2OMBA 1J0ZA 3ZDXF 4EDXB 3A6CH 5DHVB 2PW1A 3FQTB 4NRZB 1JZ2A 2IALA 4XXDA 5CP3A 5FYJD 4AIOA 3AY4C 3T0EB 4M61B 1S9VA 5GS0L 3C5ZB 2FH6A 4JFQA 3KLAB 2BHZA 3RVVD 4R0LC 3KDMA 4KI5E 4W68A 2VQ1A 5HYEA 1YPZA 3P9LB 1VGKB 4NO2B 5FHAH 1HK6A 4UIMB 5GGQH 1F90L 5CWSA 4XP5L 1FNEB 5C0AD 2FYYA 1P7HL 4OCSL 5BZDB 3PWLB 1BQLH 5FOJA 2W65A 3AM8A 3Q5OA 3S36L 4LASH 4H5SB 5IFHL 2VDKH 5EU4B 1WBXA 3CGTA 1NSNL 3HAEB 4HWBL 3U2SA 4WEUD 3BSZH 1HHKB 4XPHH 2HT2C 4N0RA 4HK0A 3TN0C 3DUUB 4ZS7L 5IK3A 4LIQH 3I2CH 3IFLH 3AU1A 1XGTA 1CG9B 1OP3K 4I2XE 4IDJH 1T6WA 1T4KB 3VGBA 4RNRA 5E2VL 1TENA 1A8JH 2EECA 5E00B 4ZO7A 4CVWA 5CEXA 1I9RL 1YEJH 4U6VH 2EXWC 4I0PA 1QNZH 1RK0A 1DQMH 4BELD 3BEWB 2PN5A 2X5PA 5FAAA 1I3RA 4JO4H 2DI9A 1ZTXH 4HGWA 4G6KH 3GEWB 3GI9H 4MWFB 1M7IB 2GFBB 3S96A 3DBXA 2YD1A 3PWPA 1YJDL 3K2UH 4CJ0A 1C5CL 5AZ2L 2OLDA 3NABL 1ZVHA 4NO5B 3GSWB 1S8DA 1CWVA 2BSED 1QSEA 3OAYH 1GCFA 4AMKL 2AEPH 4GW1A 4HC1H 3KNBA 4LSPL 4PGBB 1JHLL 5AD0B 4MJ2A 3PHSA 2NY2B 4GUPB 1RULH 5IOPA 4DK6A 5ANMA 2C3WA 1IGTA 3KPPB 3W81A 4KKNA 3I02A 1HH6A 2AXFA 4WW1A 1R5VA 4KZDL 1KB5L 3BO8B 3QB7C 3QNZB 1FBIH 4CUCA 1RJLB 1GOFA 2DQIL 4NKIL 4MD5A 4XPFL 3DXAB 5K9OB 1RUAH 4JFEB 1TVHA 1KGCE 2R0LL 5KSBB 3QG6A 2CXKA 3CPLB 1OAZL 3BP6A 3F5WA 4H0GA 2FD6H 4F7CA 2WBJC 4D9LH 2DLTA 1KCUL 3VFMB 5KN5B 3FB8B 5ALBL 3VXME 1PLGH 1RHHA 4X7SL 3TF7C 1R24B 5F7DB 1QOKA 4OCRH 4I18C 4KFZC 4MD4B 1BD2B 1OAYH 5JXEC 4ZO6A 4TUJA 3MNZB 1KTLA 1FL5B 5IUSA 5HHOD 1N8ZB 1ED3B 4ZNCD 5IWLA 5JIKA 1IGYB 2HLFC 3DVNB 3RWIB 5C0RH 1J5OH 4KDWA 3K8KA 1W0WB 1FFPB 1ZHBB 3QEQE 4FQLL 4H8WH 3QULB 2F54A 1NMCC 3JV4B 2C3VA 1F3JA 2D7TH 4QOKB 1HKFA 3SDXE 3EOAA 1YMMD 4X7TB 1GC1L 3DI2B 2DICA 4K3JH 3MV7A 1VEMA 3QAZC 4XMKH 2GSIA 5I30H 4PJ5B 2YA2A 5TDOB 3GSNL 4OLUL 4CN6A 4U3HA 3U46B 4NWUH 2ESVA 1IL1A 1XH3A 3AREC 3FRUA 4C56A 5FA4A 4PRNA 2AKRA 5D7IB 5HJ3A 4NQDB 2ADIB 2ZUQC 4ZTPL 5F7HA 1QFWM 5CSZA 3H0TB 3C60D 4X6BB 2J5LB 5C8JA 1X6NA 1OGAA 4KMTL 4LQ1A 4RGND 3WCYA 2ORBH 3WFDL 4ERSL 1A22B 3ZKMD 4X80H 3SGJA 4L8SC 5GRJL 1QLRA 2LU7A 3C09C 3GGWA 2OZ4H 3TFKD 3VD4A 4LDOB 1EFXB 1ZHNA 3GJFK 1MCCA 4U49A 5J56B 1JZ6A 4S1DD 5HGDA 3JV0A 4LNRA 4NQXA 3G5XA 1KCSL 4MA8L 3QCVL 3VFVA 3HA0A 3AY4A 3DV6B 3DECA 4ETYA 4UT7L 3BFOA 2P42B 2Z93B 3T3ME 4P2OD 4C4KT 5E8PA 4R0LA 3TP4A 2D7OA 3PDDA 5KW9L 1S9XB 5FO9B 2HT3D 1CLOH 4X5LA 5FA3B 1I7RA 4YC2B 4ODBD 2BNQD 4KVNH 3DV4A 1MH5B 3PGCA 1K4CA 1N59B 2GJ6A 5L2KE 4QRQA 1EZVX 3NCBB 4PTTA 5K9QG 4KJQC 2R1XA 4QT5A 4U1LA 3WFHB 2YOCA 2YRPA 3F12A 4RGOH 4YDLC 3D2UB 2DIAA 4F2MA 4M1CC 1G7MA 3TN0A 1DZBA 3Q6FB 3DX8B 5J0BA 4WFGD 1G1CA 3U1SH 3O6LH 3ZKND 3DMMD 1WCBB 5FYJU 3B5TA 4XPGL 1A0QL 4LHUB 4L3CA 1KYOK 4ZDHB 1JUFA 4Q0XL 2EIEA 3Q0HA 4KKCD 2R0WH 4QXGH 5TJWK 1G6RH 1ZLWK 1FL3A 3QHZH 1A5FH 1C16A 3OKEA 1K8IB 1L6ZA 4D9QD 4JY6A 2BMKB 3WEXB 5L88H 1ZSDB 2CJUH 1I1RA 1VFOA 4LSTL 1FZJB 3GUTB 4FQHB 5JPNB 1NBQA 5EU6E 3D69B 5GGVY 2JCCF 5DMKA 2A9NH 2D0GA 2HVJA 4R7NB 3O0RL 2SEBA 1V3JA 3RDTB 2YSSB 3ZL4H 2YC1A 2R2HA 2ZSVA 3TNMB 4L4VB 3QJFA 1XR8B 1BBJB 3V5KB 2ZWLT 1BVKA 4E9LA 2PCPA 3OX8A 2XACC 3MLTA 3VRJB 1YDPB 5HDQL 2X1WL 3AS1A 2W9EH 1WICA 4CDGC 2B39A 2PYEE 3UJIL 5I1IH 4QRTB 5E2TL 3UTQA 4S1QH 1U8JA 2P24A 1C5DB 1MJJA 3VG0L 5FCSH 2VAAA 4NQUA 4TUOB 5LG1A 1UCBL 4TQEL 1ROWA 3OZ9H 2AJ3A 5KG9A 4OZIA 3WDHA 5DD1L 3CFBA 3WSQL 5HGAA 3MNWB 4P99A 5C2BL 4P4KB 3FO2A 5C0CD 5JLZB 3MUJA 3QG7H 4Z7UF 4FABL 3W9DB 5L6YH 1G9NH 1UACL 4JFFB 4QRPB 4JRXA 2E7HA 5L8JB 4GXVL 2HWZL 1Q9WA 3NCJL 4JDVB 4XNZC 1VFAA 5DRNB 1S5IH 3ULVC 2JB5L 3BI9X 4ELMA 1EEYB 2NW2B 3PQYA