2P48B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 2.3a resolution: se5b-tetra crystal form with five se-met sites (l4m, m34, m51, f68m, m83) in vhh scaffold.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
QVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
molecule keywords Ribonuclease pancreatic
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p48B00
1ORSB 5T5NF 1BIHA 4LLYA 5JXAL 3MJ8B 32C2A 4I0PB 5C08B 1C7SA 2X1PA 4FQHB 1N26A 5LQBL 4UINH 4LIQE 3HC3L 1UWGL 4GXUM 3CPLB 4LCCB 3O4OC 3RVVD 1MCBA 2Q8BL 3MLXL 5EOQH 3P4OA 5IB4B 1RVFL 1B6DA 2YEZA 3PWPD 5IVZB 3FONB 4PRPB 3D25A 4HBQA 3PWVB 4I4WA 1D7FA 2JJWA 3O3DB 1S3KH 5GZOD 1HH9A 2NY0C 1QVOA 3LIZH 5EOCH 4KK9D 4KVNH 1U3YA 3IAPA 3OG6B 4MHHG 3EYFB 3QEUA 4ZTPL 4E5XA 1S9YB 3GJFA 3H9SD 5E4EB 1MNUH 4LRNH 2QQQA 4PJEB 4WI4A 2VL5B 3FB6A 5I1DA 3OR7B 3AROA 4LAJH 3WIFA 4G9DB 3FQUA 3PDOA 1ZHLB 4C56A 1BGXH 3TNNB 5J89A 3E0GA 3MNZA 3D85B 1HHGA 1IGTB 4Z7UB 1U8QA 4BFBD 4P99A 1YMMB 1MIEL 5SWZA 1FNGB 1V3LA 1LDSA 5IJVB 5JW5B 4N8CL 4P5MB 3B9DA 4B0MM 3TH2T 3ZLQC 2ZUSA 3PQYB 4RMRA 3SDYL 4EXPX 5E9DB 4PUBL 5IQ7L 1A3RL 3CC5A 3FHQA 1NDGA 4WEUD 4OD2B 3V7MA 5D7JB 4OB5H 1EX0A 1MRFH 4KGJA 3X11A 1MHHB 4JB9H 3T4YB 1J0HA 3GUTB 3WJJA 3P77A 4Z95H 5L6YL 1OTUD 3VD4A 2V5RA 2IPUK 3F62A 5C09D 1KCLA 4QYOA 3U30B 4LIQL 5DRXA 3IFPB 1NGXB 4YGVA 3FTGA 1CD8A 2WUBH 4RWYL 1F6FB 1CS6A 2CH8A 3GIZH 2YS4A 3NABL 1YEIH 2D0FA 1I4FA 2N7AA 3H8NA 4HWBA 4M48H 1NCWL 2RQ8A 2I24N 3IRZA 1C5DB 1S9VA 1MCRA 3BPNB 1F90L 1R3IH 5KG9A 2IPKB 3AREB 1WBZA 1M7XA 1DCLA 4OV6F 3D85D 1IAIH 5HVWA 8FABB 4H26A 4Q9QH 1TLKA 1DUYB 4UUJA 4NSKB 4HUXA 4WTWA 5D9SB 2GK0A 4LCWB 3W0WD 5FHBH 3IJYA 1FO0A 4IOSD 3ARGA 4LF3A 1KB5H 1AQDA 2PYED 3CSGA 1D5BA 2DMCA 4FXGB 2QQKH 5CHNA 4CL7A 1R5IA 3S37H 2EKJA 4PLKC 1HHIA 5E8OB 1VSCA 4N90E 1N2RA 3VFOB 5B3JE 4PV8A 2JELL 1U8MA 3OKLB 2BCKB 1NLBH 2NY5L 4OLYL 4POUB 2VDPL 5M94B 4X6FA 1A4JA 5K33A 4DUVA 4FQQB 4W70A 2V6HA 2GAZB 5D6CA 5MENB 1JBJA 1BVKA 5FK9B 3C5SB 4P0DA 2AP2A 2CIKA 5FKAA 5J1SC 4OZHB 2MKWA 3L9RB 4JFDD 3V95A 3EO9L 3G6JF 4P3DA 4MNGB 1MCOH 3BDXA 1HKFA 1CDBA 4KQ4H 2QTEA 3QEHB 3UTQB 4FQCL 1B0WA 2Y5TA 1NKRA 4XXDA 5J11C 3TEUA 4RRPA 2WWMC 35C8H 3S7GA 5CGYC 5D7IF 1CFSB 1EGJH 3RGVD 4Y5YB 3JV5A 1VFAB 4HWZA 3FT4A 5KSAB 2I07A 3IKKA 1EJOH 1DSFL 1I85C 4X7FC 5HHPA 5ISZA 4NQSA 1LEKA 3BUYB 3GSWB 3QUZD 3S8WA 4W6YB 2ZNXA 1FG2A 1LK2B 5KSBB 4NIKB 2DF3A 2P8LA 4ZQKA 1RK0A 2R0WH 4MVBC 1RZKC 4QTHB 1F11A 2HVKB 2GT9A 5EZLB 1SJHA 1XFPA 3RA7L 4PJHA 4AENA 1G9MC 2VLRA 1P2CB 4TQEL 4NFBA 2Y36H 1Z5LA 4K23L 1A7RL 1Q9OB 1TQBB 3RWDA 5T5NG 5D2NA 3RL1B 1ROWA 1F4XH 5EO1A 2CO7B 3IDIA 2X44D 4JQIH 2GITB 3T77A 5HXMA 3S98A 2I60L 3QRFM 4H0GA 2YPVH 1QP1A 1X4YA 5DO2D 3BPCA 5J1AA 4GQ9H 4PJHF 5H8DA 4HC1H 4CMHC 3WHE0 2C3HA 5TGBA 3P4MB 4Y5XB 1BQHA 2AJXH 2AERT 3QULA 5MP6L 4U1SA 4PJFB 3EYFA 1MOEA 3QEUB 4E5XB 3Q6FA 4LK4A 3FQTA 3RZCB 4U2YA 5D96C 1TXKA 3VH8G 1HH6A 3G5ZA 2V2TA 1FIGL 5JNYA 1H8NA 1QFOA 1SY6A 4NKDB 3H3PL 5D1XA 1MH5A 1KB9K 2HMIC 5C71A 2EKSA 2AEPL 4JFYB 3G6JE 1AD9B 4TOYL 3D25B 4JGMA 2BSRA 2AEQL 5SX4H 1X3DA 3RKDD 1NCNA 5JR1L 5B21A 4PJ7E 3MQIA 4X6BB 4ZPTA 1EEYA 4J3XA 2DM4A 1JCKA 4JFEA 5KOMC 4KK9C 5JPMB 3KPQA 2P8PA 2ORBL 3SJVE 4IDJH 3T0ED 4K23H 2Q1EA 2YPLB 3ALWA 3VXMA 3BP4A 3E3QC 1E4XL 1TJHH 2OTWB 1F4YH 5CP3H 4KH2A 4WGVB 3TZVC 5FIEA 4PPTA 4ZFZA 4YHYC 3R4DA 5IIEB 1PX3A 4JDZB 3UBXA 1RUQH 4D0BB 2EDHA 3KLDA 4L3EB 4NHUB 3UTTE 3HAEB 1XGQA 5HYSG 4M1GH 3QULB 5B4MC 1T0MB 5CJOL 3OGCA 1Q9WB 4YWGL 2VZTA 5LGKA 1SM3L 4G7YH 3VXTB 3ZDYF 1G7JA 1J10A 1MNUL 4LRNL 2YUZA 4JM4L 3WL9B 2R0ZH 1EBPA 3WIHL 4GMTL 4WUUA 3IDGA 4F7MB 4Z7WF 2BY0A 3MRKB 3Q5YA 3DX9A 3MUGB 2EE3A 3MV8B 4QHNA 2EDTA 1MCOL 3AC0A 4WHTA 5JA9A 5JXEA 4UI2A 1KJ2L 4NN5C 5TE7H 4A2LA 1DBMH 4D9QD 3P4NA 1G0YR 1KJ2B 1A9BB 2W0FA 2JKXA 2VNCA 2YD5A 4CMMB 5C3TA 5E0QA 3VWKC 5I74B 4F8TA 2X9YA 4PJDB 4FFVD 2W0LA 3LV3B 5GRJH 5FUCC 1RFDH 2H8PA 5AZ2H 5DD1L 1XF4B 4BQ9A 4ONHB 4WCYH 3OKEB 1J8HA 1FYTB 2QKIA 3QUZC 4KROD 4MSWA 4DWHA 4DFIA 3WIIH 2MQ0A 3NIDE 5F6IC 3HS0B 1JNLL 2F15A 3O8XC 3MLRL 4LQ1A 1CFTB 1MFBL 4LU5H 4Z77A 1CFVH 3PWUB 1KUMA 3PXJA 3NGBC 3D2UA 4JPIA 2WWMD 4WTXA 4JM2B 5F7DA 4PJ8C 4MWFB 3NACL 1S7TB 5HGAB 4OZGA 2EDRA 1IAOB 4JO3H 2VLLA 4JVPA 4L4TA 1L7IH 3D0VA 2P42B 3BZ4A 2NX5A 1A6AA 3BSZL 3R8QA 1E4KC 1FQ9C 1KC5H 4FFZH 3VXNA 2Z8SA 2R0KH 1QFHA 1G7PA 3AS1A 1JL8A 4ELME 1NCWH 3TJEL 1XGPB 3IKCB 3JV4B 4JFXA 4TRPH 5EWIH 3ROOB 4N0RA 2KPNA 2OZ4A 1NGYB 4M4RA 1E4WL 1IGJB 1UB5A 1NLDH 4HX1A 4L1DA 4W4OC 1FAIL 3S34H 5LAXB 3I02B 2R69H 4RFNC 4JFED 1TNNA 3CMGA 3T1FA 4FXGA 1EAPA 2CLZA 4PB9L 2VDML 4KQ4L 3VXMD 4YDVB 4IOFD 1NCAH 1JPST 4R3SB 3IJHB 2BSRB 3BAEH 3THMH 3UTQA 3KPTA 5L8JB 4XNUH 4RCAA 2HFEA 3FO1B 1A7OH 2R8SL 3HR5A 4JZOB 1IM9B 1FYTE 2EXYD 3G5ZB 2V2TB 3T8XB 4YJZL 3SY0B 4Q6IB 1T1WB 4NRZB 3D1MC 5C0JB 3H9HA 1DQDH 4P2RD 4Z8FH 1IMHC 5GS2D 5DUBB 3P30H 1SMAA 2JK5A 5EU3A 4XCCL 5DK2B 1ND0A 4ZNCD 4UTAL 5J1AB 1DBJH 4Y19A 1QSFD 4BQBA 1LP9F 1MAKA 3U7YH 4LASL 4IIQC 5K9KA 3PNWB 3QDGB 5HVHB 4NQVB 2WK2A 1P7QA 5FOJA 2VYRE 2YK1H 1W0YT 4Y4HD 5IMLA 4Q7DA 2P5ED 1BQHG 4OLUL 1MUJB 2DS4A 3TT3H 3CLEL 4Y4KA 1VHPA 3CC5B 4DZ8B 3S36L 4CVXA 4HKZB 1J8HD 4XP4L 3RTQD 5KG9B 1RUPH 4QHNB 1ZGLB 3TBVB 5I8EB 5D70L 2AGJL 4LFHG 4R7DB 3HAEH 3KJ4C 1MCDA 2ZOKA 3L95A 4M6NH 2WBWB 2YMXL 4L8DB 1BQHB 2ADIB 1J12A 3GNML 4MLIA 2DTMH 3HTLX 4MNGA 1Z9SA 3TNNA 3MXVL 5E7BA 1YQ2A 1YC8A 2QQNL 1KFAH 3G9AB 4J3TA 1JP5A 4JDZA 3MFFA 4PGJA 2NY5C 1OWWA 4LLUA 4K7PY 1ZGLM 3QWOB 4FFYH 3TIEA 5JTWA 3NIFE 5B3JF 3MBEC 5JHDD 4ZAKB 4LHUG 4FXLA 2HTLC 3MV7B 4HS8L 4JCMA 5JOFB 2XOTA 5B8CA 1QFWI 4MLSA 1KIQA 4NNXA 4D9RE 2P8PB 2A77H 4GG6A 2ADFH 5ESQB 3D5OF 3VXME 4PJCE 1YY8B 1HCFX 4LVOB 4P59L 3DIFA 4YLQT 3NMEA 3ARGB 4DN3L 4ELMF 4OCYH 4KQ3H 4ODUA 2NXYC 2CDGA 3C5ZD 4RNRB 2HA1A 2R2BB 3B3IB 5BVPH 1SJEA 2A73B 4PJ7A 2Q86B 3HMXH 5KAQF 4S2SB 3QG7H 3PV7A 1WZ1H 3K2MC 1CD0A 4A6YL 3GRWA 1M7DB 1FV1A 3S4SG 3KPRA 4HT1H 4OCWH 2XZCH 1MVUA 3DMMC 1RQ5A 4XP6L 4M6ML 3VFSB 3S34L 1NUGA 3L3DA 4Y16C 3QP3A 4Q9RH 2Y23A 1AHWC 3FOLB 4NWUL 5CLTA 1B0RB 2IFGA 1MIEH 2IAND 3LHPL 5FKPA 5B38A 3A6CL 3PP4H 4FMKA 4MS8C 2CKBH 2R1YA 2EIBA 4MCYB 1UCTA 5ID1A 4OCXL 2JELH 3MBEA 5E1AA 3M07A 1F3JA 5E00A 1AKJB 4Z5RB 1MF2L 2ICWB 5IFHL 1YN6B 2WBKA 2OK0H 2EH7H 2Z93B 4Y1AE 3SKOB 3GSNL 1R5IB 2VAAB 1KB5L 4OD2A 5TE6L 1NCBL 4NQXA 4WI7A 5CEZH 2H3NA 1EZVY 1KCUL 3GSUA 4ZUSA 4FRWA 1HSBA 3MJ8A 4XVUD 4BQ8A 3ZKMD 3QQ4A 4AIZB 4NUJA 5SWZD 1KIRB 1IAII 3C5ZB 2J12B 5ID1B 4PJCB 2B5IC 5ESQA 4XI5D 3T65B 3KLSA 3ZT5A 5GRUH 5D1ZB 3WBDA 4KAQL 4U1KA 3VXQA 2I07B 3MNZB 3PWNA 5GIRB 3UDWC 12E8H 2BXYA 1PEWA 4X7SL 5EOTB 3FOLA 2YPVL 2A83A 3CVHA 2E5EA 3V4VL 3K4DA 1I3RA 5GGVY 2FX9L 5I1LA 5KSUB 4JLRA 7FABL 1HOCA 4CJ0A 4OIIL 4WVRA 5C0IA 4QYOB 4HZAA 5T3ZH 3WEXA 3RZWA 3GM8A 3I6LD 3BPLB 1RZGB 4PYHA 5I19L 2FX8L 5JW3H 5D1ZA 1R24B 2ZUQB 4QY8A 5DJAA 1AKJD 1RJCA 4QRPE 5CZKA 1KEML 4PJ7F 4M7LH 2WBJB 3PWVA 4KKNA 2MSPA 4PJ9D 5I1CL 1XF4A 1ZHBA 1P7KA 5DQJB 2Z31A 3QUKA 3TBVA 1BFSA 3QUXD 5GS1C 1GPOH 5D7IB 2IQ9H 4OQTL 1QVOB 5ADPH 1WF5A 3WE6A 2RHEA 5GGRA 2Z92B 3DV6A 5DFTA 1RHFA 3CPLA 4X4ME 3O3BB 4JRXB 4OCLC 3LN9A 3GMRB 4M00A 2BVEA 3C8HA 1J0ZA 3OHXA 3X14B 5HHMB 4ALAL 1I1RA 1MQKH 3F7QA 3FFCB 3TT1L 3CXHJ 4LQFH 1XF3A 1BMGA 1P7QB 5HGHA 3JTTB 4LCCA 4OFKA 5DJDA 3C60D 2XQYK 1IGIH 3VRLE 1BEYH 3FQUB 3K2UH 4Y19B 1KN2H 5TDPA 1LWRA 1DQLH 2PCPB 4I5BA 1U3HC 4L1HA 2H2SD 1X5KA 3SCMD 1E4WH 4XP1L 5JLZA 5IFAH 4ORZC 2X4UB 1QSEB 3RY6C 3KWWA 4NN6C 3DSNA 4AH2A 2QADC 3H3KA 1F42A 4G8IB 2D0HA 2A77L 5SX4I 1EERB 5BXFB 4PGDB 1G9ML 1HSAB 1I7RB 4Y2DC 3MRDA 3Q3GB 3VRJB 4WHCA 1CFQA 2VAJA 1A2YA 2PXYB 5DRXB 5F7KC 4TSCH 4PYGA 4F37K 1LD9A 3LRSA 4R7NB 4ZTOH 1F4YL 3RX7A 3K80A 1JPFA 4HUUA 4JFDB 4F7TB 4X4ZA 2R23A 1CQKA 3VXSE 4BSJA 4YEEA 1CDYA 3GKZA 1AXSB 5K9KB 3FO2B 1DJSA 5FOBB 5DMYA 5AEAA 4HFUL 3D9AL 3MLWL 2PYFA 3ALPA 4ZUUB 1K3ZA 3S35H 1ZS8A 1P9MC 2BVPB 4HUVA 1P69B 2Y9RT 5ISZD 4XC3L 4RDQG 3MRLB 3NZHL 3BZFA 1C1EH 2G60L 4OCMC 5K9JH 1BP3B 1FO0H 4G9FB 1YA5A 4PJIB 2E7MA 2CGRL 1WTGT 3EDEA 5HHME 3IXAB 3IDMB 5L7XH 3HNSH 4H20H 5GS0L 5DZNA 4WDIA 5CIPH 5LJYH 5D93B 3HR5B 1YMHB 3QDGD 2P5WE 4M1DL 2Q3AA 5DJ2B 3MJ7A 2OL3L 4QRRB 1G6RA 1QSED 1HIMH 4HT1L 4OCWL 2LAAA 1S9YA 3GJFB 4HIJA 3T0DA 4GW5A 4NZTL 3DXAD 4LKXA 5DRZA 1DR9A 3T77B 2EC9U 2AV1B 1MRFL 4W81A 4DKEL 4OGXH 2C5DC 3L5WB 5JW4N 3W5NA 1XH3A 3C6LB 3FCTA 2PXYD 3QRGL 2L0DA 3KR3L 1U8PA 1QEWA 3QDJA 4WEMB 2YD2A 2YA2A 1QPXA 4FQJH 1MVFA 2Z35B 5DEGA 2WWKT 4H1LG 2DYPB 1BZ7A 3HC0A 3D69B 3VXSB 1PGRB 4EI6A 4MMXC 2YRZA 2A6JB 4NQCB 4IS6B 4DZBA 4UZGA 3G08A 4I48B 3O9WD 3V2AR 5ISZB 2M2DA 1TJIL 4L4VB 2AK4D 4WU7B 2W65A 2Y6SD 1WVZA 1U8PB 2GTZB 3IRPX 4MCZA 1RJYB 1YC7A 4IMKA 4NWTH 1A6UL 1PY9A 5DLML 4MDJB 5DMGD 3PL6D 3S88L 1JPTH 3W5MA 1MPAH 5DZOA 1UZ6F 3HRZA 3GNMH 3U4BL 2IAMC 4XTRC 3QNYB 5C0EB 5TFSL 4JZOA 3VXRD 4Y5VC 4HJJL 1I8LA 5B39G 1G7HA 5E5MA 5I71B 1SQ2N 3DXAB 4F37F 3MTRA 2BC4B 5DJ6A 2B4CH 4L3CB 3MREB 5EU7E 5FGBC 4JZJB 5C8JB 1YECH 2R56H 3CXDL 1M1SA 2DQGL 4LVHB 3WUWA 3P4NB 1GXEA 3LB6D 4OCRL 4PJGB 1E28B 5L8LB 4F7CA 4ONGH 5T3ZD 4RZCB 3T0VA 5HI5C 3T4AB 1KIUA 5J3HC 1Q94B 1XT5A 1OARL 5TDOA 3UO1H 3DUUB 3HE7C 5EZJB 1AQDB 1MFEL 2IG2L 1LNUA 5TE6H 1CXEA 2OJZL 5E2TL 3IAGC 4G7VL 5FCUL 4XCCH 5H37G 1A64A 1WUNT 1A7QH 2EKSB 3MV9E 4WWKC 1GZPA 1TVBA 1C08B 1LDPL 4ELKB 2UWEE 3AREA 1ORQB 5EZOL 2EXWD 5GXBB 1KGCE 1WAAA 5T33H 2CKNA 4LCUB 2BDNL 2RJMA 4CVZB 2X70B 4YDIL 4M48L 1DBKH 3DROA 5IQ9B 1EO8L 1K6QH 2W9LA 1IKNA 5D1QC 4XNQB 4X6CB 2V17L 3TC9A 5I15L 1DBML 4MX7A 2PCPA 4S0TD 3TPUB 3BGFC 4KROB 5HBBA 1X5YA 5ELIA 5EO9B 3DI2B 5DD3L 2WIIB 4H5SB 2NY2B 3E6FA 3MLUH 5HHNB 2HKFL 4BJLA 3UP1A 4WU5B 3K46A 3RIFK 3MO1A 1IGCH 4XRCA 1J8HE 4UDUA 5K9OA 4UIMA 2LU4A 4NNPH 4LSTL 1AO7E 5I1IH 3S96A 1XAUA 4PRBA 3T0WA 4OCYL 1CLZL 1I8KA 5DZLA 1JI1A 3H9ZA 1II4E 3WE6B 4KVNL 1A22B 2Z92A 3UAJC 2IAMA 1RK0B 1NLBL 4R0LA 5JORB 4MAYD 2O93L 4HCRH 1JN6B 1LDPH 3EJYD 4K7FA 4HS6B 4U1SB 4H8WH 1UB6B 3S37X 1OAYL 2RCSL 1RU9H 1U91A 3TH3T 1FL5A 1J1OL 5HHVL 1AY1L 1KNOB 1S7SA 1U6AL 2CXKA 1P9MA 1GC1C 4U1NA 3PL6A 3MLXH 2Q8BH 5EO0A 4C56B 1JWSB 2EXYC 5CGMA 5FHBL 4Q9BA 2X2YA 3DX7A 3FJTA 1A2YB 2C3VB 4KMQA 2FX9H 1JK8B 1Q0XL 1J0YA 3TF7C 3KJ6L 4Q0XH 4FQXB 1P4BL 1AP2B 1FCCA 4R26L 4XT1C 4NO5B 1RFDL 4X7CC 4Z7QF 1F11B 4N8VG 1IQWH 3PGDB 3GO1L 5FK9A 1U8NB 3LKQA 3L6FA 1KJ3H 1WWAX 4MD4A 4XVTL 4NZJA 1KEGH 3GIZL 4JRWA 2ICCA 1ZT7A 2F19L 4IRSB 4W68A 3V6BR 4Q9RL 4AM0B 2VJXA 4HFWA 4OKVB 1CICB 4UILL 2G2RB 4Q2ZA 2R2HB 3BXNA 3CFKA 2L4OA 2GW5A 1LE5A 3ZDZE 1MPAL 2J6EH 3KJ6H 4Q0XL 4LOUD 1VFAA 1BX2B 1YYML 3BJLA 3ESVF 4OZIE 2ESVA 1HH6B 4JEGB 1E27B 3L3IA 4TUKL 3RY4A 3IDJB 4MD5B 4Z5RA 5SV4A 2HTKC 4BZ2H 3RNKA 3C5JB 3JWOH 1A3RH 3DYPA 1ULVA 1JPSH 1RULL 2X9WA 4RGMC 4IRJB 4DGYH 1J86A 1RUQL 5I8KL 3NAAH 4JFFE 3B9KA 5GRYA 4LDEB 4NP4H 1HXMB 4P2OD 1IEAA 4QHUB 4L8BB 4M62L 1UJ3B 1DVFB 3SOBH 5C9JB 3BQUD 3SDXF 3I9GH 1KJMA 4HIEB 1I7TA 2ESVE 2CLRA 3VG9B 4R90L 5BO1H 4P2YA 3ULUE 3ARDB 4GBXB 3SEPA 2X4NB 5CMAA 1EAPB 3PDGA 3MNWB 1RK1B 3UYPA 4X6DA 4Y2DA 5IR1B 4HJ0C 1H5BC 5H37H 2YXFA 3UPAA 2O5YL 3O81A 5EUOB 3W9EB 4PJCA 5BW7A 2YMXH 1EEZA 1T83C 3RIAF 4NDMA 3O2DH 3U0WL 4D9QE 1FNEB 5DA4A 5CJXA 2AXHA 4WUKH 4HUWA 3BIKA 3TFKC 1WWWX 4APQC 1AI1L 2G75A 2GHWB 5DEFB 4S10A 3TBSB 1I4FB 5A2IH 5IT2H 1C1EL 3NFSH 1OSPL 3KYOB 3DGGA 3KPPA 3OJDB 4TVPE 1P4IH 5J8OA 5IG7A 4YNYA 3B8YA 5F7DB 4G6FD 4NRYA 4PB0H 1T66C 2EXWC 5EIIA 1R3LB 2AABL 43CAB 1FFRA 3RVUC 5IEHA 1FSKC 4ODBD 3GJFK 2K3TA 1X5LA 3FAXA 1QQDA 3K0WA 4PJXE 4Z7VB 3U1SH 4P9MH 4WFEE 1OARH 3G5VB 4L8DA 2EH8L 2XFXB 2ZPKH 2UYLB 4TULH 3RWCB 4KKCC 4Z8FL 5EBMB 2LFGA 1X5FA 2BVTA 1RUPL 5J3HD 3O2WL 4JFOB 3RJDA 1HHIB 5E8OA 2FO1A 1GGBL 3SDAC 5GISH 4R8WH 4CUCA 3TN0B 1B4RA 5J7CC 3NZ8B 2YZ1A 3RVTD 2IBBA 2FD6L 1KCVH 3UTSA 5JDJA 4UIMB 2BHYA 4K7PH 4HUXB 2H1PH 3QDGA 3DX9B 4FABH 5JQ6L 4WUUB 1C5CL 1UKTA 5CKAA 4KKLD 3QR2A 3P9MA 3N9GL 1T7ZA 5I16B 1MLCB 2IPKA 4Y4FA 1M7IA 4O2CA 4BKLB 1KCSH 4LNRB 2DQTL 1WJ3A 3L7FB 2EDBA 4PP1D 3LMJH 5DHYA 4JHAL 2XXCB 4MA1B 1MJ7L 3ARBA 3VFWB 3CLFH 3M17B 1DN2A 1LP9E 1L9NA 4JFPA 4LCUA 4PY8J 3TYFB 1K2DA 4LLWB 1WIUA 4HXBH 3VFNA 5DT1L 3K74B 4M93B 1ZVYA 2WINB 1T5XA 1KC5L 3O9WC 5FA4B 2DLFL 2JB6B 4L8CB 3IU4H 2BP3A 3IXTA 4BQ6A 3QQ3A 5GRZA 4XBEH 4EN3B 1JGDB 2YWYA 4XWOC 3W11C 1J87A 1JWMB 1A1MB 4OD3H 4UV4H 2Q6WA 43C9A 4NO2B 1WLHA 3KHQA 3OPZH 2ORBH 4XNMB 1LO2H 1S7VB 1S7QA 1M71B 1TZGH 1K3IA 5IBLD 3DUSB 3G5XA 4J3OC 1ZAGA 2VLJB 5E9DA 4R2GD 2ENSA 2OZ4H 5LAXA 3MXVH 5AG9A 1ZVSB 2FJGB 3M1BA 5CAYB 3OKKA 1AGDA 1NDMA 1GH7A 4OM1H 4S1SL 2D7QA 4MYWB 4MXQC 2FB4H 1KB9J 3TJHC 3SDAD 2IANA 4APQA 4JFXB 3CFCH 1IAMA 4OD1L 5BRZE 2AJYH 4M03A 4XNXH 4JQVA 1DQJB 3RWFB 2LU7A 3OXRB 1ZA6A 5CZXD 2A38A 2R39A 1VFUA 4QRQB 3STZA 5GGTA 5KANI 5KS9B 1BD2E 2OP4H 5IW1A 4LCWE 1MCPH 1U8IB 1M05B 3BT2H 3JXAA 3NACH 2BHZA 4RMSA 1IGFL 5E03A 2X1QA 3JV6B 3BZEB 1YEJL 2E6PA 3IT8D 2GITA 2J88L 4BK4A 3K1DA 1I1AD 2BVQB 1IM3B 3N1MC 3RGVA 2W65B 1RIVH 3UTZB 1KLUA 1P1ZA 2M1KA 1TCRA 2VABB 1HH9B 2XTJB 5DMKB 3GJEB 3MCLL 4PBWD 1G84A 2VLRB 4NFDA 4U2ZA 1YEFL 3CX5K 2ADJA 4H1LB 1OAXH 1CZ8H 3QO1A 4RAUB 4RX4D 3G5YA 2AXJA 1AR1D 3I9GL 3RQ3A 3TO4B 5I9QC 1GOFA 3LV3A 4I3GA 2I25N 4JKKA 5AUMB 4YHKH 1HYRC 5EFIB 2X5PA 4PRIA 3U9UA 2KBGA 5I8KH 1LE9A 5F70A 3STBA 4JCLA 3UTZA 5ADOH 1NMCC 4XPAH 5JPNB 1MI5A 3FT4B 4N1EA 3OKDA 4QHKJ 2QADD 1T7WA 1XR9B 3DX8B 1FNSL 3MCLH 4GOSA 3ULUC 1R0AH 4ORGA 4CN6A 5JO5B 4PRPD 3DHJA 1X5IA 3E2HC 3SKUD 4MHHI 2F53D 4CGTA 3L5XL 4XGZB 4X6CF 3ZYJA 4LSDA 5DD5H 1ETZB 5FM8A 1G7HB 2AEPH 3EYVA 2FIKB 4DN3H 1ZLUK 5F9DC 2EE9A 4FZ8H 5C7XH 5T1LD 1HKLH 4IHOA 1BZQK 3BHBA 3X17A 3B9EA 3MV7D 3NFNB 3ZDYE 3IJSA 1F3DH 3P11L 1V7ML 4MXWL 3BZFB 4AMKL 4OFIA 1DDHB 1IGYA 3V5KA 3C09C 3CCHB 4HWBH 4WRLA 5A2FA 4R4ND 4JY4B 4XC3H 4KVCH 3KNBB 4Q97A 3KXFA 1UA6L 2EO9A 3G6DL 3C60A 4S1SH 1YEGL 1S9XB 2I60H 4HIXH 4UOW0 1S7VA 1QZ1A 4ZOBA 3QCVL 4ZSOE 1EEYB 2V2XB 1G9NH 1RUKL 4KTEL 2R23B 5DD6B 3GBLA 4LLAA 1KCUH 3FQWB 5EBLB 4B53A 5T3XH 4P4KD 3WN5C 4EN3A 1YMME 4TQEH 4NO0A 4MA8H 4JO2L 5C07B 1BD2D 4P5TB 1UJTA 1ZOXA 4GFTB 2K9UA 5FUCE 3SKNB 3RZCC 4LVEA 5F3BB 1FDLH 1UKSA 5E9DE 3Q6FB 2QSCH 4Y4HA 1S7RB 3SDDB 5CSZA 2F54D 1NCCH 5AZ2L 4E0RA 3ARWA 1AGEB 5ENWA 5JUEL 2DYPD 4PP2A 4XVSL 5J6GA 1A0QL 4LBEA 5FYKD 2R2EA 3QFJA 4YR6A 4H25A 5D8JL 3DETD 1I1AA 4YAQB 3HUJF 3FB5A 4YHPA 5DXWA 3ZDZF 5A2JH 3L5JA 2A6IA 5I66A 1JZ7A 4MA8L 2D9QB 4H1LH 3WS6A 3BQUC 3MRRA 3U4BH 4ZFGL 5J12C 1Q9OA 5DJZA 1T6VN 4OM0H 4OZFG 4PRIB 1KN4H 3BMWA 2OR7A 1PG7H 4I18B 5BVPL 2VZUA 3R06B 3FMGH 4KQ3L 1EEQA 2R0WL 4BUHA 2VZ1A 3PABB 1OD7A 4DQOH 4YHOH 2EIZB 2J7LA 4PV9B 2EYRB 2QJDA 1J5OL 2ADJB 1KT2A 2MKLC 4M6AA 4LLQB 1FGNH 1IBGH 4QY8B 5H94B 4Z7WA 3BGMB 4L8SC 2BSTA 2J8HA 3BEWB 3KLHD 3VXUD 2DLIA 3QQ3B 1HEZB 1QRKA 1FORH 3LS5L 1AH1A 5C0CD 2H32B 3QIBD 1Z0NA 1YZZA 5L2KE 1P4LA 2HWZL 4FQCH 4I3SL 3S4SB 3EO0B 3EDDA 4PJFA 2JCCE 4BFGA 4GRMB 4L3AA 3SE8H 3SQOL 3JWDC 1BFOA 1AFVL 1BVKB 1W0VB 2YD7A 2PYEA 2ZUUA 4LSQH 5JDSA 1NEZG 4X80H 3QIUC 5HD8C 2LQRA 4U6YB 5C0BD 1I8LC 2ZUTA 1Q9KB 3BSZH 1DVFD 1U8MB 3OKLA 4QNPE 4K9EC 1MCCA 1FGVH 3VFOA 5FYLH 4HKJB 4OTXL 1N4XH 4NC1C 5KSAD 4PJIF 3O2DL 5CBAB 2A6KB 3X14A 5F7EL 2XZAL 5HI5D 3O41A 4MA3B 4AT6B 4RMQA 2NY7H 3TO4A 1H3XA 4JG0L 5D2NC 1OQOA 1BD2A 2GQHA 4F58H 2P49B 4WFGE 1T2QH 2Z35A 3OKOA 4Z7UF 1ACYH 5DEGB 2OK0L 4L9DA 2PTVA 1MCQA 4U1MA 1L6XA 1P4IL 3GJEA 5CEZE 5EN2B 1AJ7L 5B38B 3OKNB 2EIEA 3MRDB 2EICA 4U6VH 1C5DA 3TYGL 2IAMD 4U0RB 3WFHB 5MHSE 1KTLB 5FYLD 1QA9B 3VFWA 2E7HA 4HWZB 4P23B 4PG9A 3WUZA 3OG4B 1BAFL 3IVKB 2DB8A 1HQRA 4UT9L 1CCZA 3RY5A 3I3DA 1QD0A 4NRYB 4PJEE 5JOPE 3L3DB 2CSPA 5F88B 1FLRL 1A9EB 3E6HA 4OLUH 4LKCA 1K4CA 4G8GD 1FL6B 4XP6H 3TBSA 4ZFOA 1DL7H 2VR9A 1KCRH 3FQXA 5SWSE 4LARL 1N8ZB 4JB9L 3ULVD 5C0DB 3RBGA 4ELMA 4MQSB 4OF6A 3RUGB 1KN2L 4BUGA 4N1CA 4R96B 2Z8RA 5A43C 4LPWA 1U3ZA 3EIFA 4LHJB 3HNTL 2F54E 3SDYH 4FABL 5JQ6H 3V6ZB 1HI6B 4ZO9A 4J4PA 2PO6B 4YHKL 1A1NB 3NAAL 4IMKC 4O4YL 3TN0D 4PG2A 1LVEA 2VQTA 4NZRL 5C0GA 4Z7UA 4XNUL 2H32A 3BAEL 3THML 3MACH 5C0IB 4OSUL 2NTFA 3IDXL 3FB6B 5I1DB 5T5FL 3P0YH 3HZYA 3CZFB 3U2SB 4HKXA 1QSEE 1I9IH 3FN3A 5H94A 1DFBH 1N7ML 1UXSB 3U1SL 3CVHB 5TQ0L 3BRDA 4D8PB 5I8EA 4HV8A 1YN7B 3I6GA 3SPVA 4X6CE 5FO9A 1MLCA 3QUYA 4G3YL 1ZANL 3ARYA 4E9LA 5IB5B 1MFDH 3BKCL 3RY6A 1YECL 2AJXL 4NC2B 3GBNL 1FZOA 4FNLH 4MDIA 4MD0A 2IMNA 2CDGB 4GKZA 3LEXA 2HH0H 4NYLA 2MHAA 3OJ2C 1XGYL 5I1IL 1RJZB 3G9VA 5B22A 5DGQA 3O6MH 3DV6B 3RL2A 4HWUA 2YD6A 3X3FH 1QLFB 1ZGLP 5CZXC 3MV8E 3NFPA 5BV7B 3EDJA 1YN7A 3I6GB 5DK2A 3HC4H 4PJ8D 1GHFH 1GIGL 1UVQB 3QG6A 5E1AB 2D7OA 5HDQL 3C8KA 4KTDH 3I75B 4XVJL 5I8CA 1JNHA 3P0YL 4D9RD 5LVEA 2YXMA 2P24B 1T1WA 4NRZA 3TBWA 3EBAA 5AWNH 5IJKC 1WCBB 4FTVA 5D7KD 4LLMA 3LKNA 1WV7T 1YNKL 4RX4A 3RVXD 3CH1B 3PUCA 3TBYB 4OUOA 1S78D 1N59A 2ZZUT 4YNYB 5CEXA 1I3RB 4R3SA 3SO3C 5L2JA 2EE2A 4Z7UE 3MUY1 4HEPG 5CGYD 3RGVC 2UZYB 2YZ8A 1REIA 4MA3A 3VWKD 1ITCA 4CVWA 3MOBH 4HS6A 1A14H 4KV5F 5DVNA 3WXWL 1I1FA 3PG2A 2AJUL 4LHUA 3UPRB 3GRWL 3ZTJH 3P40A 1HHKB 2I27N 3OBAA 5GGRY 4AM0A 4AEEA 4PLNC 4ZG1A 4KMTL 1KIRA 3Q2CA 4PRPA 2OSLB 1FNLA 4P48A 1TPXC 1WWBX 4L3CA 4JN2B 2P45B 5CZVL 1XGPA 1KELL 3IKCA 3JBG7 4ELMB 3GB7A 4KZDL 3KS0J 3MO1B 4HS3B 1AP2A 2QR0A 1YY9C 3WJJC 2VDPH 3D0VB 3LKOA 5KVMC 2C1PB 4JJ5A 1PVHA 3F7YA 3FT3A 1I3GL 4PP2B 1DUZB 4C54A 2BNRB 1EPFA 5EU6D 4L4JA 3L3HA 1PAMA 3HCVB 2DL9A 3H9HB 4LLVA 3KPLA 3HPLB 2FSEA 3EYOB 2A9NL 3RWJA 2AW2A 1WIPA 2NY1B 3U0TA 4QTIH 4WV1C 4CJ1A 3MLWH 1GZPB 5B38G 5EH1A 1OCWL 4X9BA 4UDTA 1DQMH 5D1ZC 2ZUWA 4YK4C 2Y5EA 5D5MB 3FT2B 4PJ9A 1IARB 4QXGL 4H88H 4PJDA 5FV1L 1YQVH 2GJ6D 2J5LC 1NGWB 2NY4B 2R4SL 3QIBB 4LHQB 1PZ5B 1U3HD 3C60B 1P5VA 3V5HB 2A73A 2Z91B 3NA9H 4WHTB 3ZYZA 5I17A 5AZEL 1ZT1A 4HFWB 4JDVA 3OAZH 3RI5F 4G6AC 5E94A 1DBBL 5IB1A 1KJ2H 5FHAL 3GMOB 4O51B 4E41B 5IGXL 3MREA 5IOPB 5IB2A 4P2QA 1GGCL 2AK1H 1NFDB 4HMEA 2XPGB 4CU6A 3BEVA 1N7MH 3CGTA 4G6KL 1L7TL 3OTTA 2LABA 3SDXB 1VFOA 5I76A 5KVDL 3MOQA 2IBGA 5DMIH 2XTLA 5DRNB 2P5WB 4X4YB 2HWZH 1S7RA 3IU3B 3S4SA 1KTKE 5DD0H 2P7TB 5ID0B 3VJ6B 2B20A 4HG4J 2WWKO 1H15B 4BSWB 3BP6B 5FDWA 4MJIA 2A74B 2A1WL 3VXOA 3ARZA 5LWYH 3IFOA 1WC7A 4LP5A 2Y07H 2FJGA 3M1BB 3MUJA 2Y07L 3I3EA 1JF6A 4N68A 4NQDB 1DBAH 2YPLA 3TVMC 4C58B 3BH8B 4JM2D 4K94H 5ETUA 4LHUD 4YDJB 4NZUH 1S78C 1H0DA 2CKBA 2CDFA 3ECBB 4DN4H 5TDOB 1AXSA 2CLZB 3VFRB 1UYWL 4OFVA 3O0RH 4N8PA 2NY4D 1BFVH 5LGJB 1FC2D 2DQTH 4WI5A 5ILTH 4CMHB 1U8KA 1RIVL 4I18A 3KG5A 3O3AA 4L9LA 5E8DL 3ARBC 4R4FH 5CEYA 1DE4A 3KYAA 3JTSA 2CRIA 5L0QC 3O6LL 2BMKA 1NC2B 5IGXH 4UBDD 2E3VA 3MV7E 3MRRB 4XCYA 3TYFA 4FP8H 4MNHA 3NIGF 2HJFB 3KPNB 1T7YA 4XVTH 4Q74A 1ERNA 4JFEE 3JVGC 1ETZA 3IS1X 1I9JH 2VERN 1Q1JL 4E41E 1PKQA 1UXWA 4ODWA 1W2KT 4C83B 1UM6H 5MI0C 5JMRA 4IJ3B 1H5BA 2R9HD 4GW4B 3OR6B 1NJ9A 4JHWL 4GW1B 5GS3A 4IIQA 3Q48A 4YZFE 1DQML 5F1IA 2MCPL 1IKFL 4CVZA 1RUMH 5TPWH 2LTQC 4F7PA 1OAQL 3SY0A 4XCYB 3BFOA 3TIDB 3REVB 4UU9A 4TUJA 4OFYA 3VWJB 4X98A 1B2WH 5GJTH 4AEHH 3OKMB 3QCUH 1FRGH 1KBGL 4APQD 1CLOL 3WFBH 4LVNC 4NQCD 3MX0A 1S9KC 3P30L 5E2WL 5C6TH 1L0QA 2P8LB 1S7QB 2BOBB 3FO2A 4PGEA 2D7NA 4XH2A 4OF5A 1A1MA 2R56L 3BH8A 4LSUL 5ETUB 4YBLB 4OI8A 4JY4A 4IEFB 4AMKH 1KSRA 4WENB 2YPLE 4U1JB 3VFVA 2XKSA 3NCMA 3PXHA 4PLOB 1YPZE 5FYJL 4L8CA 1NBQA 1G9EA 4JZNB 3IDGB 3NFNA 1CFQB 1HKLL 2QSVA 2X1OA 2VMFA 4X9GA 3CDCA 1W72L 3KPMB 4LCIH 3M17A 2ICEA 2X4QB 5AG8A 1G7IA 1DN0A 3GSNB 5IW1B 3QWQB 4J6RL 1TTGA 1T83A 3IDNA 4UIKH 2D3VA 4ZUWB 1HILA 2YA1A 2I9LB 4AZ8A 1A7PH 3CMOL 4PRHB 4LEOB 1OOAA 4ORGB 2EDOA 1RIHL 4BZYA 1FL3A 1Y6MR 1J18A 4YDIH 3VFMB 5HI4C 1KJVB 3MRLA 1UT9A 2Q8AL 5JHDA 4AIZA 1N2RB 4EDXB 3QI9C 4KI5D 5FDYA 5CIPA 4LSRH 3GSXA 2JJVA 5JHLH 1ZLWK 3MLPA 4BSVA 3OKYA 3VH8A 2VRAA 2FGWH 3TN0A 1N0LA 1Y18A 5HYJE 4Y1AD 4ZPTB 2WQRA 3EYUH 3IJYB 4KDTC 3UZVB 3ESUF 4IDJL 3AB0C 1BBJA 1VFBA 3CDGB 4MJ4A 4PJ9B 2HP4A 1JIBA 3QFDB 3TNMB 4F7TA 3RIFF 2CR3A 4JFYA 2Y06L 3MRBA 2WBJA 5JOPD 1MCSA 5INCA 1JHLL 3OAYK 5I71C 5E8PA 5JXAH 4QCIB 3D18A 1HXMA 3WFDH 1UH3A 3RAJL 5HTSA 3BE1H 1QACA 1GSMA 1JNHB 3WLBB 3WDHA 4Y5YA 5DJCA 2IALB 4O02L 5C92A 5E8EB 2OP4L 3BO8A 3JUZA 4OZFH 3MMEB 1JGUL 4K2UL 1QRND 3C2SA 1U8IA 4WUKL 5E6ZA 1NGXA 4YGVB 1G9MH 4PJFF 4P3DB 1YUHB 1J1XL 4NQED 3BPOB 1NUNB 2G60H 3QEQD 4KMLB 4Z18A 4MAYC 1MHHA 4EOWH 3ILQC 4MZ2A 5D7JD 3ARVA 2HJLB 3CIQA 5DJ0B 3S88H 2YHGA 1DEDA 4G8GE 1I7ZB 4R2GB 3QUYB 1I8MB 1D5IH 1IT9H 1U8NA 4KY1H 1Y6KR 2VDRL 3H42H 1FH5H 4TNWF 5J56B 4FOMA 5CJQL 5SWZE 1EHLH 2XFXA 1JWMA 3GGWA 3MV9A 2VLKE 3O8XA 3LRGA 2EYSB 3SKMA 2QL1A 1T4KB 4AG4L 3DSFL 3ZKNC 4F33B 3K4AA 1INEH 2VUYA 4M5YH 2ZUVA 1EO5A 4R0LC 4NHCH 3KYMB 4PJAF 3VWKA 1C5BH 2NCMA 1I7UA 3V0WL 5ALBH 4HAGA 1MCEA 3NH7H 4HXAL 5EOTA 1BOGA 1B0GA 3L9RA 4X5WA 3RNKB 2AEQH 4DEPB 1GJIA 1IGIL 3L3OB 4RFOH 3N06B 4J3SA 4EDWH 4XPAL 5K9QI 2O61A 2V5TA 1TTFA 3QNZB 4HKZA 4UOW1 3RRQA 2HN7A 2HT3C 2J4WL 4Y4FB 3VI3F 1BX2A 1FN4B 4PRNB 5D7KE 3TT1H 1H3PL 1A4JB 1MFAL 4JANB 5ICYB 1KIPA 4GKZB 2ATKA 2HH0L 3CDGA 4K3DL 2YEZB 3T0EC 3FQNB 3X13B 2R4SH 2DQFA 4P3CL 1T2XA 1RHHB 2O5XL 5IM7B 5E24E 4Y8AA 1WCQA 4G8GB 32C2B 4I0PA 5C08A 1BM3L 3WO3B 3CFJB 5DHVA 5TH2B 2ERJB 1UH4A 3CU1A 3ZHLA 1H3WM 3PF2A 5F88A 3F5WB 5C6TL 4KTDL 3VRIB 4UUJB 4WWKA 5I75C 3AU1B 3ZSTA 1T1ZB 1MRDL 2IFFL 1JGEA 2PF6A 5F7EH 1VEMA 1IGFH 1HYSC 4Z7VA 3CZFA 1U6AH 4UNTA 3LEYL 4MXVE 4ZTOL 5GJSH 5KS9E 4ONGL 2DQCH 4OLVH 4U1MB 1ZHKA 3B9KD 4G9DA 3PGFH 3MRQA 2XWBB 1OP5H 3VDCA 1BQLL 3QXVA 3MC0A 2F58H 1Q38A 5IG7B 5IHUH 2FO4B 3QDJD 1NANI 1OGTB 1T80A 3DGGB 7CGTA 3TO2B 4I3RH 3FTGB 3DECA 2ZOKB 3O11B 1QLEL 1PDKA 3E3QE 2CJUH 4PJGF 5I30H 2A6KA 1EJOL 4HS3A 1TVHB 2EDLA 3CDYA 5T1DL 3VFPB 4JO4H 1K8IA 5C86A 3NCYP 4FHBD 2OSLA 5DQDL 3ABZA 5CUSH 3KPRD 4U1GC 2CK2A 1BQSA 4OLEA 1MREL 2H26A 3RUGA 4EIGB 4GSDH 3ZYOA 2AQ2A 3TZVD 4NWTL 2Z4QA 3HNVL 3C2AL 1TZHA 4UAOB 2H2SC 1UWEL 3E6FB 1WBYA 4R4BB 5FA3B 3GI8L 5IJVA 2GUOB 1NCDL 5L88L 3ULUD 2FJHA 3O4LA 1QBMH 4KUZL 3D0LB 2ZUXA 1X4XA 3PWPE 2AK4E 1HHHA 3LS4H 1T3FB 2X4SA 2KZWA 3MRQB 4NNYB 1GZQA 2FLBT 4OJFH 5HY9A 1NJ9B 2VL5A 1CQYA 3B9KB 3NCYS 2YSSB 1CGTA 1G9NC 1GGUA 1JGEB 3KPSE 1OAXL 2VH5L 3H9SB 1T66D 5BS0D 4HIHB 5E2UH 3HZKA 4MJ6A 3PABA 1EHXA 4L4TE 3MA7B 4FTVD 4HPOH 4OLXH 1LO3H 4NM4L 3DUUA 2W60A 2APVA 4PRAA 2JJTA 4P9HC 1NGQL 4TSBL 5SWSB 2Q3ZA 5D70H 1XZ0A 4HHAA 4ODUB 5I18L 1SVCP 4ZSOB 5GPRA 3W2DL 2NX5D 1FJ1B 4GO6B 3W2DH 2VIRB 4NQDD 4Y5YC 4IDLA 4B5EA 4FXKA 3MRPA 1JYVA 1CL7I 3BW9A 3U0WH 4XPFL 5GSVA 3QQ9C 3OX8A 5D6DA 4PJ5D 1DZBA 1X5XA 4N5EC 3CVIL 4QOKB 2CPCA 4GRMA 4PREA 2OTUA 2WBJC 3W0WE 5DUBA 1WWCA 4P46A 5ERWA 3IDYC 3RWGB 3QCVH 2DQHL 1P5UA 1QTYT 2NY3D 3ORJA 5L2KD 3MOAH 4LSSL 4EN3D 3A67H 1LGVA 2K7PA 9CGTA 3TN0C 4G8EA 4JAMA 1CU4L 1JI2A 1WSST 1IEHA 1OLLA 3BEWA 1UQSA 3PWJA 4M1CC 4QRPA 2R1XA 2QSTA 4X0KB 1KNOA 1S7SB 4KRPC 3HE6B 5GSVB 2B1HL 1A7BA 4I48A 4WNQB 4KJWC 3L7EB 4IBLT 1DLFH 3MRGA 4U1IA 4WGWB 2A0LD 5FM5M 4ESKA 2HTKD 2Q8AH 1AC6A 4DW2H 1N5YL 1GC1H 5ITBL 5LKNA 3FB8B 1PBYA 2ZWLT 3X3GL 4CNIA 3T2NH 1EGJA 2K7QA 5E4IA 5D4QA 5F3HA 3WO4C 3KLAA 1JF1B 3OWEA 3GKWH 1N6QH 5JNYB 1WIOA 3LN5B 4GQPH 1AO7A 5F21B 5IBUB 3GMPB 4KUCD 3GRWH 3PWLA 4CW1A 1RAMA 5EPMB 3WFZA 4IMLA 3HI6L 1DLHA 2GJ6B 2F19H 1I1AB 3OR6A 4H20L 2ZCKH 2R2EB 1VKXA 1U93B 4YR6B 2ZSWA 4HGKC 4MX7B 1BPVA 1S7TA 2IALA 5C0CE 3T0EE 2DJSA 2E7CA 4JDTH 3VXOB 4XP9H 2NY3B 5L2KB 4L29A 5IHZA 5LCVL 5HGHB 4OZIB 3EKCA 3KYNB 5IMMA 3BIBX 5EA0H 4Z0XB 2XWJB 4NT6A 4JKPH 3QCUL 3BVNB 3BUTA 4YDLC 3TWCL 5HPOA 1JPGA 4XCNA 3RNQA 4AJ0A 5DFWH 1FG9C 1QSZA 1NLDL 1UFUA 3KLAB 4NJ9L 4Q9QL 4HH9B 4KKBD 2EDDA 2CK0L 4X5XA 1ZSDB 4K71C 1E28A 2DQGH 3VDAA 3T2PA 3BP5A 3GO1H 3L5HA 3RPKA 4OF8A 1I1FB 3QUMH 1G6RL 5DC4B 2VXQL 3SGEI 4X80L 1A6WL 1OF2A 1Q1JH 4GXVL 4ODSL 4X7DC 3BHBB 3HA0A 4XP1H 4HCRA 2Y5TB 3DXAA 2HLAA 4Z78A 1H3PH 4HIHA 3U7YL 3H9YA 4U31A 4CDHA 3WNPA 2VWEC 4HPYH 4JPWH 4M8QA 3UROR 5A16A 2J6EA 5HVFB 4WO4C 3ZKND 4WDIB 5C9KA 4FFWC 1DFBL 4QRRE 4LQFL 2JIXD 4ERSH 1NMAH 5IB2B 4QRPD 4HC1A 4HJ0D 1U8LB 2AJZB 4M8VA 5I1JL 1K4DA 2B1AL 3NCFB 4ODTL 1AGBB 3MLYL 5ADOL 3QQ4B 4L4VA 2DAVA 1MELA 2FDBP 2GSGB 4XCFL 1A7NL 3MUHL 1MRCL 2GUOA 2YN5A 1LE9B 4XCFH 3A6CH 3VGAC 1NCDH 3OHXB 3CSPA 4M62H 1J0JA 1S8DB 4UTBL 1SY6H 3ZKQD 4PRIE 1IFHL 5E5RB 2Z93A 1AO7B 2ARJQ 2GY7B 2X4RA 2H2PD 5CJQH 4NKOA 1A6VH 4YEFA 1NBYB 4XB8A 3I84A 1MAML 5FA4A 3MRIA 4O5LH 5GJTL 4AEHL 4GMTH 4RAVB 7FABH 5HGDA 3FB8A 1B4JL 2E27H 2HTLD 1PQZB 3WEXB 2CD0A 4X8JA 2BSSB 2Y7QB 2HRPH 3WV0A 3WYRA 4N9GA 2ZSWB 4EUPG 3SJVA 4RFNB 1CDHA 3MCG1 2VN4A 4QRRA 3GZKA 4GRWH 5IK3B 1U92B 3KPRB 3WNOA 1XCTB 1GZQB 2PW2B 1FVDA 1DQJA 3RWFA 3EJZC 1VFMA 3LRHA 2GJZA 5DJDB 4LCYB 3GB7B 4XNYH 4V2CB 1E6OH 5GGTH 1FFPA 4CN4A 1QO3A 3MXWH 5AYUH 3W9DB 3O6LH 1UWGH 1MRDH 1VADB 5CBEB 4NRXA 4V2BA 4CN1A 1ADQH 4WV1A 3S35L 1T2QL 2KQNA 3QJFA 1ZS8B 3BW9B 5IFHH 2Y06H 2IQAA 2C4FT 3GIVB 2VXTH 1M71A 4N1HB 1ZHBB 3CFDB 1BM3H 4HQQH 3RVWD 1F6LL 4B41A 2IH1A 4YE4L 1F90H 1RZIA 3P9WB 3LKRB 1N3NA 1JGDA 4NCC1 2HLFC 3ZE2E 3BJ91 2BRQA 2D7TH 2AJ3A 1QLRB 2XN9B 1R3LA 1GAFH 2HFFB 5I2IB 5D2NE 2C26A 3ULVF 4LLWA 5FUZL 5DT1H 2ITCA 4QXTA 4NBYB 3WHXB 4PRDB 4EUPH 5E8EA 1CLZH 4X5WB 2YK1L 4ZOEA 2FEEL 2XWTB 5DURD 3I6KB 4U1LA 1RZJC 1OAKH 1OM3H 3CFEB 2PETA 5KS9F 4GRLC 3OKNA 2VH5H 4X9HA 2WV3A 1UM4L 4NKQB 2LU3A 3C08L 1EHAA 1U41A 2IGFH 5ISZE 3FQNA 2H1PL 5A2KH 5HYQB 1SHMA 2VDLH 1ZHNA 1Z6JT 2CXGA 4HKBA 1SEQH 1HQ4B 2YD8A 1ONQB 3D39A 3GMMA 3GSXB 5J9PA 3A6BH 5D7IA 5HHXL 3S97C 4ODTH 2GK0B 1ND0B 4FQXC 2APXA 3FFDB 2OI9B 5DYOA 2XTJE 3EOBA 3MBEB 5ALCL 3TO4D 5JW5A 1NGZB 4KJYA 4HLZG 4H1LA 1HK6A 5IBTL 5KJRH 2FX8H 3G5VA 4D0DA 4UQ3B 1MLBB 2QV2A 4NZTH 1HE7A 2J88H 2O5ZL 4F15B 2FJFB 5KOVC 5FM4A 1C8PA 4UMGA 4YIQA 3RPIA 5GRVL 5FGRA 3OR7A 3GSNA 4QRUB 4I2XB 5GGQH 3ARBD 4E42B 2XKNA 4UQ2B 4U6XA 5JXEC 2FCBA 5D8JH 4NKMA 2CJUL 1AGCB 3OXSA 5I30L 1R5WB 5FYKH 2EDYA 3QDMA 4I3RL 3U30C 1QA9A 5FKAB 5ACMA 4XP5H 1ZA3B 5EU4B 3BOVA 2GEEA 2FECI 2E9BA 3HR6A 1AI1H 4OLXL 15C8L 1OTSD 3B83A 3MV9B 1ZSDA 5T1MB 3X11B 4OZ4B 5IBLC 1IKNC 5D1QA 3SGEH 2ZPKL 4KPHH 3OKKB 5EORL 2YR3A 3DUHA 1SEBA 1QYGL 3B4NA 3V5DB 2GK2A 2ARWA 5EUOA 2O5YH 5J9PB 1OT1A 1HSBB 2VQ1A 2CR6A 4ENEC 4LPTA 4P23C 4X6DE 3PWPA 3U7WH 3IDXH 1J1OH 2BOCB 1RU9L 1KLFA 2HT4C 3PL6C 4LKCB 4M43H 1P6FA 3P73B 4ZPVA 1HHGB 1IGTA 1K4DB 2DLFH 4MWFA 1QBML 4KUZH 4WFHE 5AAMA 1I1YB 4ETQB 4ZUVA 1MQ8A 2C7UB 4HF5H 4JFHE 5C0NC 1JWSA 4GKNB 4XCEA 4I0PD 5C08D 1WZMA 1YYLH 3RUGE 3T3PF 1JUFB 5C0RH 5FKPB 2H9GA 4QLRA 3V6FB 5GS0C 1NH6A 5LBSH 1UACH 4U33A 2VXSH 35C8L 2B5IB 1D5ZA 2E9IA 3RWHB 1IC7H 5C0FB 4K3EH 1FZMA 1OPGH 5ANME 5DHVB 4P9HH 4BH8B 4GAYA 3IS0X 3MV9D 1V5JA 4K9EL 1I1CA 1F00I 2AXGA 3SGKA 5J11B 4UILH 5JHDB 4C56E 2OJEA 3LY6A 3DPBA 3DI3B 3Q0HA 4JANA 5GISL 3T08A 2GTWB 1CXFA 1QHPA 2AJVH 3VH8B 2YBRB 5SWQB 2WIIA 4H5SA 3LKQB 3S9DB 3PHQA 4MD4B 2F5BL 3QIWB 1FLTX 4QRPB 1IQWL 4MJ2A 2YPLD 1CFBA 1JPSL 1RULH 3VMPA 4XMLH 5I1AB 2YWZA 2UYLA 1AJ7H 2W59A 3CUPB 3TIEB 4LU5L 1GYAA 4KTEH 3X3FL 4KK6D 3IETA 3RHWK 3EYQC 4I0PC 4OSUH 2F53A 1AIFB 1BBDH 3D3VD 5DUML 3V6OA 3EGSB 4KVCL 1VDGA 2G9HB 4K8RL 1I85A 4P3CH 1V3KA 2OXGA 1FL5B 5KAQG 4ZS6C 1T89C 4GAFB 2HJKB 5EC2B 1U42A 4JZNA 1OF2B 4TSCL 3PWLB 1AE6L 1DTUA 4XZUB 3CSYB 3GIVA 3T3ME 5I18H 4P4RB 4M61B 5I17B 3RX8A 4LPYA 4HEME 4N5UA 4DZ8A 4D0CB 3RDTC 1AD9A 3AMKA 3UC0L 3MRCB 5TE4L 2IH3B 4AEIH 1SYSA 3VXPB 4YFLI 3CAFA 5LG1A 5INDA 5GGUA 4YFLF 3DVFA 3V0WH 3GHBL 1BEYL 2FZ3B 2DWDB 2XRAL 1B9ZA 4P4KA 5F93C 4LRIC 2Z31D 4NZRH 1S9WB 1N5YH 3GSOA 4Y8DC 1UZ6E 4ODWB 5LBSL 5F8QC 4IIQB 2DWEA 4KWUA 1TZIB 5IMKA 4YZFF 2IC2A 1A8JH 5C07D 1RURH 5T33L 4X9IA 2MPAL 1IAKA 3BH9A 4PJ5B 5MERB 5BOZG 4AK1A 3NIDF 1F2QA 4GJTB 4AQ1B 1DQQA 4RMWA 2IBZX 3AMLA 1C12A 5J13B 2J6EL 2V7HB 3WS3B 1BECA 5D93C 5F7WC 3BWAA 3OAZK 3VGHA 1JNNL 3MXWL 3MLUL 1JGVH 1BVLA 1JRHH 4XXCA 5K59F 5C0BE 4YXLH 1INQA 1EH9A 3REWB 3N85H 4DUXA 4YFEA 2GFBA 4PD4K 1XGYH 1CDJA 1JGUH 2XNAB 3VI3E 2CKBB 4Z0BH 1UWXH 3S36H 3EFDH 1MHEA 3FOMA 4Y4HC 1AGCA 1BWWA 3MA7A 5HJ3B 3CFCL 4S0SD 2B4CL 3GMLA 4J7RA 4Y4KD 1CR9H 3FQTB 3RZCA 3PWJB 4QRUA 1D5ZB 3VGFA 3BE1L 1ITBB 1SBSL 1CYGA 3C9NA 3ARDD 4GBXD 3O3EA 3IETB 5CKGA 4YK4B 4LLMB 4F7PB 5C0EA 2NY7L 2XPGA 2P7TA 4RBPK 5ID0A 5IHZB 5C3LD 1EEUA 2IG2H 3LKPA 1RJLA 3VD5A 3DTXB 1ZLWH 3UBXI 1A6VL 3ARGC 3JV6A 1E6OL 2ESVD 5E94B 2EDNA 3HMWH 3CNKA 2FGZA 5CP7A 2RGSA 2X9XA 3MJ9L 3P9LA 1OD9A 4ZXBB 1LO0H 4DOHE 1CR9L 1KTRL 2YA0A 1GVIA 2VIRA 4CAGA 5DHXB 1NBZB 3QEQE 4JDTL 1LILA 3O6KL 1MEXL 5E8NA 3UTSB 4EQ2A 3SQOH 1D5XB 2FR4B 3DBXA 3WNLA 1SYSB 4PJFE 2ZCHL 1NL0H 4FFWD 2R4RL 3UTTA 4QNPF 4P9HL 1ZVSA 4KMTH 5GHWH 2KUTA 4I3SH 1T1YA 2IMMA 1UM4H 3ARSA 3C6LA 3FCTB 2CMRH 3D2UD 5HVGB 3PP3K 4UTAH 4HPYL 4JPWL 5DWUH 5IB3B 1A6ZB 3G04A 2NXZC 5IUSA 3H9SA 5DLMH 1VCAA 2QSQA 3WL9A 3DRTB 5T1DH 3QNXA 3MLVL 3WIHA 1ADQA 2PUQT 3F7YB 2R1XB 4X0KA 1F6AA 5SX5K 2AK1L 4RGNB 5JIPA 1MEXH 3RPIB 1A0QH 1GC1L 3HCVA 4DGIL 4N0FA 4M9PA 3QUML 5IQ9A 2HJFA 3OV6A 5IHUL 1GOGA 3GMPA 3VJ6A 4X5LA 2UUDH 5GS1A 2WUCL 3ZE0F 5DQ9A 3AU1A 4NJ9H 3PDDA 5J06A 1A1OA 4UB0L 1YEEH 3O3AB 4WUUD 2Z4QB 4OFPA 2FYYA 4BZ2L 4M7ZB 3BP4B 3QXDB 3VMOA 4FG6D 3HB3C 3UO1L 2CLVB 1D9KA 2FNBA 1RJZA 3ZKXC 2I9TB 5F1NA 2NLJA 3Q6GL 5FAAA 1JZ8A 2JIXB 3SGDH 4WNQA 1HHKA 2X42A 4TOYH 2CUMA 3MR9B 4JFDE 1BQUA 3TJEH 4Y5XC 1RK1A 5T1KD 4M6NL 4XP5L 4WHYH 2R1WA 5GRUL 2VO5A 4JZJA 3ZTNL 1JWUA 2PTTB 4MQ7A 2NXZD 4OF0A 3BN9C 3BQUB 3MMEA 3R0MA 3RWHA 1R3HB 2UY6A 3MYZA 4XWGH 3BX7C 4R97C 2YKLL 3TBYA 3KYKH 1BOGB 3MV8D 1LO5A 1F58H 3PHOB 4OCSH 1Z0MA 4I18C 4EIZC 4TTDC 1QSFA 1AQKL 2PO6D 3BPCB 4I5BB 1T22B 5D1QD 1O5DT 1MCKA 3O6FD 1Q9LA 4QRSB 5FECA 1PEZA 4LGSB 5JO5A 3H0TB 5E2UL 2UZXB 5JOEA 1N5AB 3EOBB 1UM5L 3D0LA 2HG5A 4Y1AB 4M5YL 5FGCB 2DKMA 4HWBL 4K94L 4RMTA 1FORL 3LS5H 3V6OC 2D03L 4TNVF 4HKBB 4LPUA 1MCJA 4M1CD 4IS6A 1DQDL 5SV3A 5IM7A 1F8TL 2ZCKL 2ED9A 4NP4L 1SJHB 3BN3B 5FYJE 4I9WE 1I8IA 4TUOA 1RI8A 3LDBC 1A4KB 1SEBB 1TDQA 1KTDA 3DNKA 4B7IA 3N1FC 1E4XI 3HZKB 5CBEA 1Z3GH 5IB5A 1NUDA 1T03H 5SWZB 2X1XR 5T1KB 5A3IC 3L5XH 1DEEA 3DMMA 4PRHE 5EB9A 1TVHA 2BRRL 5D5ME 4F57H 4HUKB 2E6JA 1YEDB 4Y4KC 4DAGL 5D2LA 4XHJD 3WNNA 2XKNB 1I9EA 1OGTA 2ICWJ 3BESR 4N0UE 5KN5B 4FZEL 4PTTB 2NPLX 4NN5B 1A14L 3IAQA 3HLAB 2W0PA 3MA9L 2XN9A 1DVFA 2FD6H 3PWNB 1Y0LB 1LHZA 1BAFH 4WUUE 3GUTA 3UTOA 5I74C 5FB8B 4O02H 3IYLW 3TBWB 3OL2A 1G6RH 2X10A 3DVGA 5B8CC 1RZIB 5K9JL 3ULUH 3AY4A 1EUTA 5C2UB 1CGXA 5L9DH 4UT7L 3HUJB 5D7JA 2V7NB 3DVNA 1LO3L 5HSFA 4S1DD 5DA0B 4XCNB 4YHYB 3QFDA 3TNMA 5FF6A 1H3UA 3PV6B 4TYUA 1A7QL 3NN8B 3BVNA 4WFHD 1HQ4A 3O41B 4KU1A 3EFFA 2RAMA 3VW3L 3D39E 5ICXA 4XPBL 4O9HL 5ESVB 2BXZA 4JRYE 1FO0B 2BSED 4O2EB 1A9EA 3QPXH 5HI3D 4PBXA 3NCJH 4RISL 4NSKA 1MAJA 5I73B 4MNQB 5KTEH 5D71L 3HFML 3LRSB 4R7NA 3BPOC 2R1YB 5DJ8B 3LQZA 3C6LC 3TT3L 4MAYB 2Q76A 5DTFA 1QSFB 3CXHK 3JWOC 3TPUA 4D8PA 2JJSC 5FYKL 1B0RA 3P11H 1MFDL 1QOKA 2OQJA 2C3GA 2V2WA 4O2FA 3WHXA 3VFSA 4JR9H 4DKFH 4G80A 2RIKA 4Z9KB 5BRZB 5MEQA 2VC2H 4YIQB 1TQCB 2EEAA 3DLQR 2MHAB 3NH7L 2X05A 4JE4B 5ILTL 1QFWM 3CFKB 3R0NA 3T4YA 3LKSA 3STLA 1QHOA 4M7LT 3V4UH 1Q8MA 4XBEL 2ATKB 4RNRA 5EDXA 2IADA 2DQJH 3W82A 4XHQA 4YPJA 1FE8H 4C55A 5ESVA 4PRNA 1HINH 3V7AG 3V6ZA 5TF1H 4PJXB 5B4MD 2FX7L 1QBBA 4DCQB 5GQBA 3PGDA 4PJGA 1UQSB 4P46C 3LQAC 3MV7A 2J3SA 4Q9CA 1BZ9A 3AVEA 1RZFH 4IM8A 4PRBB 3U4EA 1U8JA 4KDVA 2VLRE 3LKPB 5DJZB 1N6VA 1NCAL 4FQXA 1MREH 1NCUA 4YBQC 4ZXBD 3HC4L 4YXKL 1N5AA 2Z9TA 4CVUA 1Y0LA 43CAA 1FAIH 1UKQA 1U92A 1RMFL 1NANH 3WFCL 1F6AB 1VPOL 2JCCF 3T0EB 3HZMB 2BVUA 2E8YA 1HIML 4U1HA 3KPPB 3TJHD 2ZSVB 1MCWW 1JFQH 3UYOD 1J11A 4JREB 2ZKHL 3ULVH 4GKSB 1N64L 2NY0B 3D18B 3O2WH 1RV6X 3QJHB 4B50A 5GGQL 2DBJA 1NSNH 1C08A 2DQIL 3MRIB 4LGPB 4LSVH 4JRYD 3PP3H 3GSRA 4ZDHA 4PRHD 5EOQL 2V7HA 1HHJB 2QADB 1Y6NR 4RGND 2O5ZH 2OYPA 1Q0YL 1D6VL 2XZZA 5ESAB 5IEKA 4PJ8A 5F96H 4QHKI 5E6IA 3QEGL 4RMVA 3FQXB 5CD3B 3TZVA 1X7QB 3KYNA 1N0XL 1KACB 4NPYB 5H35B 3LQMA 3VXUE 3PV6A 5JW4M 3HPLA 3K7UA 1FZKA 3QUZA 4NJAL 4L29B 2D7MA 5KSVB 3QQNA 4G8EB 2W9DL 4QOKE 4UV4L 4HZLA 4ZNEE 2OLDA 4K3DH 1Q9LB 4YGAB 4S1RL 4Y16D 1QR1A 3SE3A 4GRWB 1RY7B 2AXFA 4AYFA 1YJDC 4XAKE 1HXYA 4NM8H 5CD5C 2PNDA 5F72S 3U7AA 2ED7A 4U1GB 2D7PA 4RIRA 3AY4C 1SMOA 2ZJSH 5D1XC 1KCKA 5CWSA 3S35X 3RP1A 4ONFL 4AY0A 3FQWA 3IJHA 5HJ3A 5HYFA 4A6YH 3GKWL 4LASH 1N6QL 5D1ZD 4P2OC 1T89A 3MNVB 5B39A 1FFOB 4J6RH 1CGSL 4ZTPH 5CJOH 3ES6A 4EI5C 3VGEA 1KYOJ 5K59E 2R69L 4DKAA 3AAZA 1C5CH 4KK5D 1J0KA 1PZ5A 1Q9KA 2ADFL 2EDWA 2CDFB 1S3KL 4YBQD 1EXUB 5GRVK 1SYVA 5C8JA 4NO2A 3MBXH 4U3CA 5DRWA 5BMFH 5L2JB 2WIMA 3AREC 1HHJA 2IQ9L 2W9DH 4PJAA 3OAUL 4KDWA 3WKMH 1T0MA 3AS0A 4ZAKA 4ZXBA 1LO0L 2NYYC 3O2DA 4WI8A 3TO4C 1T20B 5F7LB 1WZKA 4OZIA 4CU7A 1EK3A 2P24A 1PX4A 4C4KO 1LO4L 1U8LA 2AEIT 2DQUH 2J5LB 3QIBC 1T3FA 1TITA 2X4SB 3DARA 5F8RC 3WFBL 4EEEA 1YEHH 4PGCA 1FZKB 2YRLA 5T3XL 3FL7A 1AXIB 3T0EA 3U79A 4WU7A 1TJGL 4M5ZH 3DGCR 1M7IB 2GJ6A 1JJUA 5GGTL 3LIZL 4QHMB 3ZDXE 4KJPC 4GRLD 3L95B 1UB6A 3LD8C 4PJAB 1P7QD 5FGBA 4OZIF 1NCTA 3TPKA 2CUHA 3K1KC 1JTOA 4JRYA 2C1OB 5BV7H 5GGVL 1FVCB 3ARFC 3GMQB 3EFDL 4ZDHB 3MYJB 1I8KB 4P2QD 5F3HB 1YEIL 1FNFA 5EC1B 3D48R 1R3KB 5IWLA 5GGRB 2O61B 5DD6A 4FN0A 3MV8A 3QHZH 1FFOA 2X41A 3G5YB 4JO2H 3FKUS 1WITA 3NOIA 2A6IB 2F8OA 1KPVA 2QLVB 1IC7L 2YUWA 1NQBA 4LKXB 1ES0B 4LPCA 3P4MA 4Y5XA 4Z7NF 1I9IL 1OTUC 2B0SL 2G9HA 4KI5F 2XI9A 3U36B 2XN9E 3MV11 1SJVA 2VLKD 4BFIB 5EBWA 3SBWC 3HAEA 3S3SA 3U6RB 4MJIB 2BJMH 3WSQH 5C0GB 1XGRA 4IHOB 2CKBL 4S1DC 3IGAB 1WEJL 3RZCD 2E7LC 2OXHA 4PJIE 3KWWB 4JVWA 1CD1A 4M43L 2VL4A 2GJJA 2B2XL 3ZE0E 1E4XH 5GSRA 4ONOA 3KHOA 4MNQD 2DOCA 4G9FD 4OM0L 4U1KB 3F7VB 3MRPB 4PJXA 3KPQB 1MCWM 3VFRA 5TDNA 2G5BB 1HN1A 1G7LA 5D1QB 5DQDH 2XIDA 3MLTA 3RWIA 1QRNB 4OGXL 1XZ0B 4HHAB 1JTPA 3QG7L 4FQ2H 4IJ3C 5GGUB 3BIAX 4CRPA 1VACB 2BNRE 1BVLB 3NTCL 4XNMA 3UC0H 4WW2B 3IJSB 1NGYA 1LQSR 4D0CA 1ZLUH 3B8SA 1LEGB 2DJUA 3NPZB 4G6JL 5EBMA 3QUYD 5BZWB 1I7UB 3UYRH 3HMWL 1KTLA 1T5XB 1JMXA 4XMPL 4C59B 5CCKH 3EJYC 4XGZA 1IZJA 4OZGB 5TDPB 1QFWL 4M7KH 4KGLA 4PGCB 5IOPA 5DUMH 5I8CB 1R3JB 3OQ3B 3L7FA 3OB8A 1WAAF 3CFBB 1OAQH 4F58L 3JTTA 2FJHB 5HHOB 2ARJB 1MF2H 2GYSA 3O4LB 3RWDB 2LVEA 5HHMD 5M7QA 4O00A 5F89A 3BD4A 3UTPD 4X8XA 4DN4L 1OSPH 2Q7NA 5KZCB 4L4VD 4PREB 2A6JA 1IC4L 3O3BA 4JRXA 5EUOE 4OTXH 3UYRL 4KJPD 2RFXB 3GMLB 5DMGC 2R2BA 2IANB 1I9RL 1XMWA 3TP4A 2F8VA 2CRMA 1OGAB 3GSRB 4MMZC 1BOYA 8FABA 2NW3A 4BH7A 2Q20A 5DF0A 2NY6D 1CLYL 3J8F7 1B6UA 2E9WA 5D6DC 4X6DB 4Y2DB 3SE8L 2FBJL 4NN7B 3O2VH 5DVKA 1XF5B 3HI1A 4RQQB 4XZUA 1ED3B 4F57L 2W60B 2W92A 2ICES 3I6KA 4IRSC 3FRPA 4KZEL 1G7IB 4TSAL 3K2UL 1CICC 4U6XB 4WWKD 3QA3A 1V8HA 2NTFB 2XA3A 3OPZL 3KPOA 4M1GL 1VGKB 2AJ3B 5FYJD 1OTTD 2DTSA 4NFCA 1JMZA 2BVOA 3TGXA 1UACL 3DSFH 4EUPB 3CZJA 4OQ1A 4K7PL 4EKXA 4U1NB 2PYEE 3OJDA 5EIVA 2DICA 2W91A 4GT7A 2H32H 4MNQA 1U2HA 1AXTH 3F5WA 3U82B 4YHZL 2IPUG 5IKCA 2RFXA 2DQJL 4TUOB 5H35A 1UG9A 4ZO8A 3P9MB 5I16A 4JHAH 4OBRA 3V4UL 3LB6C 3DO3A 1JZ6A 4PLJC 4DVBB 4JFEB 1TZHB 4R96A 1AD0A 3W9DA 1LE5B 4MB3A 4JM2C 4PJ8B 1FIEA 2FBJH 4LCWA 4MB5A 3SGDI 2P5WD 1CLYH 5E00B 3PGCB 4XRCB 4JO4L 1X4ZA 1U8OB 1ZT7B 3L3KA 2Y4SA 5ITFA 4P4KC 5TDNB 1O7SA 3V4VH 5BRZA 4QRSA 3NIGE 5FECB 1DANU 4QHUA 3F12A 2SEBA 1AE6H 1NC4D 3RKPA 4ODSH 5MEOA 3VGBA 5L7XL 1TENA 4TSBH 1I7TB 4S1QH 4A2MA 1EVTC 2V2WB 3GBNH 3QDMB 4JPVL 2XWTA 4PP1C 5F1KC 4ZFFB 4QXGH 3NTCH 4G9FE 4L8BA 2X70A 3VWKB 3ARFA 3RDTA 3NBNA 1L7IL 3RIAK 4U7SA 5EN2A 1NC2A 4Y2OA 4LP4A 5IEHB 4GKNA 2VTFA 4FP8L 5INCB 5EBWB 1W72A 1U8OA 5E2VL 3KPOB 3PIQB 1BJ1H 3LEXB 3P0VH 4JFZL 4JKPL 5DMJB 3OF6D 5LGJA 1BLNB 2GJ6E 1T7XA 1NMCB 4BQCA 5IBTH 1DANT 5LGHL 3NGBB 2EDKA 1WZLA 2EYRA 2BOBA 4PB0L 1EVUA 4KK8C 4YHIA 3HAEG 3VU2A 3EFFB 2YOCA 3NVQA 3ARXA 2GKIA 3FO0L 5J0BA 4K3HA 1AGBA 5F7FA 3K3QA 4G8GA 5DQJA 4HXBL 1KJVA 1AHWA 1MSPA 2YUVA 3HMXA 1MUJA 2YN3A 4O4YH 1FZJA 1FG2B 4K3JH 1RIHH 4Y16A 4UU9B 4OZ4A 3IGAA 3WUWG 4JKLA 5IVNA 1U8QB 3SDAB 1N8ZA 1T21A 2GJZB 4GRLB 3BP7A 3ELAT 1J0IA 2XICA 2GIYA 1JZ5A 1XIWA 4CADB 5EIIB 3KS0H 3QA3B 3SO5A 1ZE3C 1IAOA 3BEVB 4EI5A 4P2QB 4OB5L 1L7TH 4PJBE 1HWHB 3HE7B 5FYJH 5JIIA 12E8L 4OZGF 1K5NA 1K9TA 5BV7C 4R8WL 2VLME 4X5XB 4P5TA 4GS7B 4PFEA 4G3YH 1H8OA 1EMTL 3K81A 2UZIL 5DC0A 4XPHH 5E4EC 3HG1D 1UH2A 2VZSA 3MRNA 2F9BT 4Q6IC 5TF0A 5HYJA 5DVMA 2R29H 4MQTB 4M93C 1C16A 4K8RH 4F15C 3MRFB 4H88L 4CMMA 1YMMD 5GGSB 1D9KB 4OI7A 3S36X 4JGJA 4I2XE 4HLJA 5EA0L 4KPHL 2G2RA 4MXQD 4OV5B 3RGVB 2XY1A 1AO7D 4PY8I 2P44B 3WS3A 5A40E 1S7WA 5I1GH 5K93A 4DVRH 2Z8WC 1KB5B 3FQRB 2I9LA 4LEXH 5HHVH 3BT2L 3IU3A 5J12B 1CDIA 3CD4A 3ISWA 3NPSC 1XEDA 4KI5E 4LVOC 5KBNC 1LEIB 1N64H 3DV4B 5GS0D 3FRPG 2ICWI 3T2OA 3GBMH 2ICEB 2X4QA 5IVXE 1CBVH 5FYKU 4GQ9L 2BY1A 3DRTA 2DWEB 3IDMA 4O51A 4UINL 1AR1C 1FV1B 3G04B 3QXUA 1NEZA 2BK8A 3DO7A 1VESA 2WMPA 2BSTB 3B43A 1ZT1B 3PL6B 3WFEL 3DMMB 3GDBA 4HUVB 1U2CA 3RWEA 4UQ3A 4NHCL 2X09A 3U9UB 5IMOB 3MLTB 1BF8A 3VXSA 2I9TA 1UZ8B 4P59H 1Q94A 1BIIB 3PP4L 4JFFA 2VE6B 3B9KC 3G6JA 2V17H 4W6XB 1G0DA 3LEVH 4LSRL 1A9BA 1A1OB 4NBXB 4NRXB 4WW1B 1ZHNB 2X7LB 2C4FU 5FDWB 2D0GA 4JRYB 4BSWA 5K9OB 1O0VA 4WY7H 5EZOH 4OGAD 4QHLB 1IM3A 4F3FB 3EOAB 1YEKH 5ERWB 3I75A 2QQNH 2BNRA 5A3ID 4NNPL 1H3TA 3PDOB 3B2UC 1T0PB 2R0LL 5C0CA 5TGBB 1AQKH 3RBSA 1VKXB 3D3VA 3CVHH 4D2NA 3QZWA 2JJTC 1WGOA 4U1LB 2XZAH 3HRZB 4M9OA 1CE6A 5T3XE 4R6UA 3QT2A 1F4WL 1J1PL 4JN1L 2OTPA 2CDEB 5D2NB 5HD8D 3ZT7A 1CXHA 3OJVC 4Y16B 3L1OH 4PJIA 5EC1A 1E4KA 2YPKB 4PGBB 3MRCA 1ZWIB 1NBYA 4HGWA 1MCIA 2JJSA 4L3ED 3I50L 1QRNA 4ZQKB 5JPMA 4QF1A 1ZKAA 2OL3B 4HK3J 3AM8A 2DTML 2P4AB 4P2RE 1MY7A 4PJCF 5JZ7C 1B2WL 3VXTA 4RRPG 4Y19D 3WUWB 4X99A 3CH1A 2PR4L 4EXKA 4CKVX 3GHEL 2VITA 5FYLL 3Q3GA 3VRJA 4I0KA 5GS1B 2WUCH 5JHLL 1G6RB 1KXQE 4NQEE 1BREA 4MAUL 3E8UL 4RSVA 5FA3A 3C5ZC 4M8QB 4HD9A 1V05A 4S1QL 3ILQD 2VDQH 5L0QB 3VI4E 4JJHA 1AFVH 5I8OL 5F9WC 4HUWB 1W8NA 5DRWB 1NFKA 1EO7A 3H6JA 5HDOA 1IGML 5EZJA 5CD3A 4AIOA 1I1YA 1NDMB 4ETQA 3OKDB 1HZHL 5HDBE 2NY1D 4LSPL 3QWRD 5IVXF 4RFEA 5CP3A 1INQB 1OM3L 1AD0B 5KJRL 1XIWC 2IH3A 1DE4B 1MQKL 1KV3A 2XKUA 3BWAB 3V52L 4BH8A 5I1EH 3BRFA 4HLZH 3SKOA 3QIUD 1WAAE 1SY6L 5E8NB 2I5YH 3MRNB 3SE4A 1DBKL 1EZVX 3O6KH 1DBAL 3HUJA 5D7LB 2F58L 2FIKA 1DLFL 3QFJD 4G6ML 1NBVH 5D71H 2CUIA 3WD5L 4IRSD 1F8TH 4FQ1H 2YSSA 2IWGA 2Q76B 2A1WH 5J13C 5E2WH 4J12A 1CFSA 4P57A 4AIXA 3HI5L 2GCYB 4KY1L 3O4OB 5A1AA 2RB8A 3SKJH 3KPRE 4JJ5B 4DKFL 4PY7A 1MHCB 5HI4D 3CUPA 1XF3B 1NAMH 1T04A 2QHRL 3VXRE 3QHTC 5J1TC 3TZVB 3BWUC 2P46B 2X6MA 3HI1B 4HBCL 4M7JH 5IESL 4EOWL 4QEGA 3S5LA 4KRNA 5CCKL 3PJSA 1UM6L 4RAUA 1N4XL 4PJBF 4PS4H 3BKCH 2NX5E 3GMOA 1ZANH 2HT2D 1NC4A 3AAZB 2FEDC 4FMFA 4JO3L 1MFAH 1K8IB 4M6OL 1W0VA 3KVQA 3UTTD 3DUSA 3G5XB 4LHUB 4P4RA 4NUGH 2K1MA 5DUPH 1RVFH 2HT2C 1JFQL 5B39B 2PXYC 3QIUB 4ZNEA 5SX5H 4ZUTB 5HPMA 2VXUL 3MRKA 3QPQC 4GLRI 2FB4L 3RWCA 4NM4H 1WT5C 3RAJH 3DJ9A 4XNZB 5MHSD 2BERA 2HYMA 3GK8L 4JFDA 2X4PA 2XTJC 1S5HB 4G42B 2BX5A 3VD7A 3H0TA 1R3JA 4H26B 1MJUL 3SCMB 1E6JH 4FTVE 5GS2H 5HHQA 3OXRA 1Z3GL 2Y72A 5C09A 1NGPH 1Z2KA 4XPTL 3VCLA 1KGCD 1U95B 5I9QB 1AY1H 1NFDE 1OB1A 3H9SE 5D7SL 3F6IA 4IRJA 2EC9T 1ACZA 3L3HB 1MIMH 3MBXL 4G6JH 4HIIA 2VZOA 3IU4L 3NA4A 1OW0C 4QOKA 3QDMD 5FGSA 2DIAA 5MEOB 4WHDA 1QLFA 1VGEH 1FHGA 4W4NA 3F12B 3R06A 2YD3A 3T65A 2HRPL 3ZO0A 4YBHA 5FOBA 4Y89A 1TVDA 2BY2A 2DQFB 3LMJL 4X6BA 4LF3B 3SDDD 3MGTA 2BRRH 4OAWA 4O2EA 4UDUB 3KDMA 3P4OB 1SM3H 5IB4A 2HG5B 3P3YA 2VDMH 4ODVL 4K3EL 4NQDE 4PRAB 2VXVL 1F2XK 1NDGB 4PBVC 3VFGL 4G80B 5MEQB 3QJHA 1W72H 4TVSa 3QNZA 5KZCD 2D31B 2V5YA 2VQUA 1IL1B 1WFUA 1FPTH 2NZ9C 1AKJA 4X6CA 1B0GB 4UT9H 4GXUN 3VE0B 1CE1H 3RKDC 1CFNB 4PS4L 5DK3A 3V4PH 5DQ9B 3WFHA 4LEXL 1T1XB 3VD9A 1EBAA 5C09E 4LSUH 3VCLB 2HMID 3U6RA 3LQZB 4HBCH 4M7JL 2NY4C 4JKWA 4OLVL 4K7PX 3C60C 3C5JA 5IK3A 5F6IB 3BGMA 2ID5A 5D1XD 2F8XC 1N3NB 3WXVL 3R1GH 4O9HH 2BOCA 1RZ8A 3CH8A 4JPKL 3FFCA 4WWKB 3WXVH 4BK5A 4HH8A 4PV9A 2NR6D 5CJ5A 1MFCH 5DYOB 5E9DD 4POYA 2FHFA 4OUUA 2AABH 4R0LB 5JORA 4GG6B 3QSKB 3OAYH 4A6YA 5I6XC 3PHQB 1YEGH 3CCHA 3EOYG 3MLSH 3QUXC 3EYSH 3IF1A 3SDCB 4K94C 4G6MH 4PGBA 5F7UA 1F45A 3DVNB 1RHHA 1FL3B 3KAAA 4J3VA 1U3HA 4KZDH 3MFFB 5TJWK 1MCHA 4M02A 5ICYA 1Q72H 1MJ7H 1S8DA 4XC1L 1FPTL 2E27L 2NYYD 4I1NB 3WFCH 1IE5A 5DK0B 4LCCC 1KXTB 4GMSH 1HOCB 4RA3A 4DUWA 2P5EB 2VDKL 4M6MH 5FGCE 3LH2H 1J88A 1KG0A 1JGVL 1GGTA 5C0BB 1G7QB 1TCMA 3ET9F 4X9FA 5I1HH 4ZFFA 5F1OB 4PJHE 1LO5B 4GAJH 1OVZA 4JFHD 1UJ3A 4QXWA 3CX2A 1NL0L 5EU6B 4RGOH 1JUFA 1ZGLA 4UNVA 4QXUH 4ONFH 1S7UA 4Z7OF 2IEPA 3MRJA 4XI5C 2ZNWA 3PGCA 4AG4H 3W0WB 5ANMB 4PV8B 5IVZA 3CLFL 4FA8A 4OLZL 5IR1A 4S1RH 2V2XA 3Q5OA 5HHOE 5AAWA 4NC1E 3GHEH 2NLJB 2CIIB 4XBPA 4ERSL 5FCSH 2X4NA 1D5BB 1PSKH 2JF1A 4G7VH 5E95B 5JHDE 5I1KH 5DMKA 3SE9H 4EDXA 4LSPH 2VISA 4JVUA 3QRGH 5E1HB 4HWEL 3JVGA 1RZKL 3MUGA 4XTRD 1ZTXH 1WZ1L 3ILPB 4URTB 1JRHI 1BJ8A 1FN4A 3DRQA 3DVGB 1IEAB 1D6EB 1KIQB 1GGCH 1KLGA 4HJGA 4NCDA 2JCCA 1F58L 1LEIA 5DUPL 5BV7L 2BNQD 5C0AD 3U83A 4ZFOB 1NCCL 4L9LC