2P4HX

Crystal structure of vestitone reductase from alfalfa (medicago sativa l.)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
310
Chain Sequence
b'KGRVCVTGGTGFLGSWIIKSLLENGYSVNTTIRADRDVSFLTNLPGASEKLHFFNADLSNPDSFAAAIEGCVGIFHTASPIEIVTKRTVDGALGILKACVNSKTVKRFIYTSSGSAVSFNGKDKDVLDESDWSDVDLLRSVKPFGWNYAVSKTLAEKAVLEFGEQNGIDVVTLILPFIVGRFVCPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDELKEIKGARLPDLNTKKLVDAGFDFKYTIEDMFDDAIQCCKEKGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.).
pubmed doi rcsb
molecule keywords Vestitone reductase
source organism Medicago sativa
molecule tags Plant protein
total genus 108
structure length 310
sequence length 322
ec nomenclature ec 1.1.1.348: (3R)-2'-hydroxyisoflavanone reductase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2p4hX00
4MOWA 2PZLA 3PGXA 3RCBA 1GFSA 1C3VA 4WUVA 1XQ6A 1JA9A 3LC1O 3MOIA 5JC8A 4G65A 1AN9A 3ZHYA 2CDBA 4E30A 1YL7A 2NQTA 3KB6A 2CF6A 1HDXA 2HK7A 3DOOA 1B3RA 4NFSA 1XSEA 2IZ1A 3KETA 5DP1A 3WXBA 2DPGA 4OH1A 3GGPA 1DFGA 1SOVA 2DFVA 3KV3O 1TEHA 1Z45A 2X5OA 3JD3A 4R01A 3SX2A 1YBVA 3FR7A 4EGFA 4MKXA 4XB2A 1Y8QB 3IJPA 4PLTA 1QSGA 3S55A 4PZDA 3JQDA 4YRBA 3E1KA 1WP4A 1E7SA 4N7RA 1WZIA 2W90A 2O3QA 4TVOA 2YUTA 1E7WA 4R68A 3STHA 3AUUA 4HY3A 4GVXA 2OZPA 1WZEA 2NM0A 2PZMA 2CVZA 4XQCA 4TZTA 1NHWA 1T1SA 2JL1A 3ZWBA 4DREA 2VRCA 3PTZA 1ZEJA 1B2LA 4JJGA 2H63A 4QX6A 3PWZA 1KVTA 2YDYA 3Q9NA 3RROA 4CV1A 1JAYA 3A06A 2OBYA 2PKQO 3WWZA 4DPLA 1QV7A 4PLYA 4MIYA 2W98A 1EUDA 2FMUA 4ALKA 3RWBA 4Q3DA 4ZRMA 3CMCO 2C54A 3RC7A 1VM6A 3GG9A 4Q3AA 3M1LA 4BQPA 2PWZA 4KUGA 2QIOA 1Q1NA 4D43A 2GLXA 2Q45A 4AJKA 4B4WA 1U9JA 3GR6A 3AU8A 3VZPA 1U7TA 4R69A 3I9LA 4NIMA 1IYZA 1MB4A 3IUPA 4YAIA 2WM3A 4UULA 3EW7A 3QIVA 1T24A 3H65A 1MX3A 4M1QA 4O59O 3K2EA 5JS6A 3LK7A 3ONDA 4QUKA 1J5PA 1VJ0A 3OJ0A 4E0BA 1NQTA 4J16A 4MVJP 3HG7A 4XCVA 4ALJA 1K6IA 1Z82A 1HL3A 2P68A 1IPEA 4IUYA 4RZHA 3D3EA 3H4VA 2Y0DA 2I6TA 2DBRA 3I52A 3I5MA 1W8DA 4OM8A 5EQDA 4FJ2A 2OHXA 2FPIA 3FF4A 3P2OA 1P0CA 3BTOA 3H9UA 3OIGA 2NLOA 4WJZA 3WGYA 2Y1EA 4JBGA 4R54A 3BMCA 1H2BA 1CRWG 2Q46A 4HFRA 3WR5A 1V0JA 1XWFA 4YJFA 3G1UA 3TFOA 2CD9A 3JQCA 2WE7A 3VZSA 4CL3A 5C7LO 4GLOA 3LLVA 1LA2A 2I66A 4FGSA 1U4SA 5BNFA 5CDYA 3KVOA 3V8BA 3EK2A 3UKOA 3H9EO 1WLYA 1YOVB 4R3WA 4ND3A 3WFIA 4CMJA 5JAIA 2GDZA 4DLAA 2YHIA 1DIBA 3NJ8A 5TJHA 2BHLA 4CMAA 3JQ8B 3L6EA 4Q3EA 5L4LA 4WEOA 2VCYA 4RVSA 3AI1A 1DC3A 1Y6JA 2AEMA 4OJNA 4DLLA 1PGJA 4YT8A 1NX6A 4DWVA 2YFQA 4HX5A 4EJMA 1ULUA 1YO6A 3PRJA 2BI7A 4TRJA 3WMXA 5ITVA 1X14A 2C59A 2ZTVA 4CUZA 5KJEA 3ZHZA 1DHRA 5JXWA 5GY7A 3JQ7B 1E3LA 5EERA 3TL3A 2NWQA 4JJFA 4NPCA 5DCUA 4BGIA 4BMNA 2PR2A 4R41A 2GN6A 1NASA 3X2FA 4J49A 5ES3A 2CF5A 3QWAA 3E6AA 4HP8A 4M54A 2AQKA 1NBOA 4GLLA 4DC1A 5L40A 3DL2A 4UEOA 5BNIA 4C4OA 2HMUA 4YA6A 3RQSA 3ENNA 3JQBA 3I9MA 1I2BA 4E6PA 3OA2A 3E03A 4YJGB 3VKVA 4XR9A 2VTDA 3GPIA 3EVNA 2EIHA 5G4KB 3NJ4A 3NGXA 4IDDA 4J3FA 3VOSA 1NPYA 1W0CA 4QO7A 5EN4A 2WWRA 2ZJ1A 1HKUA 1H9BA 2ZYGA 4IGFA 1SB9A 1ZK3A 3WTBA 4QFDA 2HRZA 4JNKA 1ADGA 1KETA 1DJNA 4DRYA 5TT1A 2NACA 1PJLA 3E5MA 1P44A 4CMCA 1ZFNA 3GAZA 2SCUA 4DLBA 3R3SA 1OFGA 3AFMA 4TRMA 4I5GA 1P3DA 3A4VA 3DR3A 1R0LA 3WMWA 4M49A 1ADFA 1DLIA 4W99A 4Y6PA 1JW9B 2EGHA 3ROMA 2VYVD 1NFQA 3H9QA 3I83A 2Y1FA 5IZCA 1ZK1A 1RM3A 3AUAA 3LLSA 4KTTE 1T2CA 2G76A 4B4OA 4W9NC 3ZWOA 3GNTA 3OHSX 4H15A 1GUYA 4MVJE 4CODB 2I5PO 3NRCA 3KXDA 1DSSG 4RF3A 2JCVA 1IL0A 3JQGB 3GDGA 1O6ZA 2Y68A 1UAGA 2BELA 4FJ0A 1PGOA 3COSA 2DVMA 5THKA 4CM9D 3BIOA 4U7WA 3H9GA 3KLPX 3ZWXA 4YJHB 1B3BA 4KUEA 3WGHA 1DFIA 1QRRA 3PYMA 5DOZA 4MIOA 5I7SA 2AXQA 2Q4BA 2ZTUA 3GVCA 3ITDA 4LVCA 4OQYA 3WG9A 2Z95A 4GVLA 3WGGA 4YPOA 3DOCA 4LMPA 1WDLA 1AXEA 3BMNB 3VTFA 4YTEA 1K6XA 5AXDA 2ZB7A 3Q2IA 3JD1A 4WCFB 1I3NA 1EE2A 3TSCA 5DBFA 5JAQA 4WE3A 2B5VA 3F4BA 4JQCA 3VPSA 3DBRA 2AEFA 3HDYA 3TNLA 5TJ9A 5C7IO 4DBVO 4BNXA 3QE3A 2Q1UA 2W4QA 2YYYA 3GZNB 3UN1A 4AVYA 3B1JA 1DIAA 5T5QA 3LSYA 4BMSA 4C7JA 1I30A 4BNZA 4D79A 1N7GA 3JCZA 1K0UA 1LSJA 4IMRA 1F06A 2YFHA 4OIMA 4E5KA 4CLOA 1YJQA 5A9SA 3CEAA 3WGZA 4J4TA 4B3HA 5AOVA 1PQWA 1GY8A 4P4NA 4IS2A 4CM8B 2FHSA 4IINA 1XIVA 2PLAA 5KVCA 4UEJA 4D3SA 4QEDA 3TF5A 4PRLA 4PIVA 3UCEA 4DL9A 3HQ4O 3BXXA 1B16A 1YE3A 3P2YA 1WW8A 1ADBA 1UZLA 2BFOA 4N5NA 3TQHA 1P31A 2OORA 1G0NA 3ZV5A 3FTNA 4BO5A 4XDYA 2FY8A 1EK6A 4MKRA 2JFHA 3ON5A 5ICSA 5DF1A 3JQBC 5EESA 3HN7A 3PYLA 1PGPA 3ULKA 3WOHA 1A4IA 3WQSB 4CM4A 5ITWA 5I8ZA 4B8ZA 1VSUA 4S1VA 3CPSA 1Q0QA 2FPPA 4R1TA 1LEHA 4CLRB 3QV1A 4ND4A 1SZJG 2OGUA 1LI4A 2VYNA 2VQ3A 4MVJA 1NR1A 3I9JA 3HFGA 2V6BA 3LZ6A 4FFLA 4ZQFA 2GN4A 1ENZA 4BNKA 1C0PA 1Y5MA 3I4CA 3GDOA 1BXKA 3MOGA 3QVOA 5IAAA 5C3MA 3EUWA 3SC4A 1X0XA 4NBTA 4UAGA 5U1PA 2DU8A 1JTVA 1FF9A 4X54A 3JQ9A 5JO0A 1Y5RA 1HZZA 3H6KA 4RPKA 4J2HA 3FD8A 5IDXA 1UDBA 4OO3A 1WNTA 3LT4A 5TNXA 1TT5A 2VZ0A 3R0IA 4OKNA 3PZRA 4J1SA 3RKUA 5B4TA 4E2ZA 5EJ2A 1DAPA 5F1OA 3C3XA 1P1KA 2X22A 1HLDA 4LRTB 4RDIA 3GG2A 5TF4A 4GKBA 1JKFA 3OBBA 3EVTA 2F00A 3CH6A 3D1LA 1QYCA 3JTMA 1R16A 1KOLA 4GAEA 3RFTA 1KC3A 4YT2A 5FWNA 1P9LA 5F3RA 1UXHA 3VPFA 4QT0A 1BW9B 4BNMA 4L73A 1QLHA 1J0XO 1XQ1A 1D8AA 2CNBA 2HO5A 2DM6A 4DBZA 4J90A 3F5QA 3W4KA 2PGLA 3SBOA 1UUFA 3L4SO 3FBGA 3UCFA 2WD8A 2NUAA 5A1TA 4P4GA 3UAGA 4N18A 4IJUA 1FDSA 1JKJA 3OIFA 5U9CA 5LCXA 1ZIDA 1PZEA 3KLMX 5I9NA 2P9CA 4L76A 1T2DA 1C1XB 4DYDA 2Q2WA 4J1TA 4XYLA 4IZHA 3GFGA 4F3YA 1BDBA 2AG5A 2OUIA 4IMPA 3TZ6A 3U09A 1Y9AA 5JCXA 1R4MA 2CUKA 4J91A 4MVJM 2DBVO 1GYRA 4AJ2A 1C0KA 3ZN2A 1U3VA 4L4SA 4ESOA 3K31A 4FFRA 5U4QA 2JKVA 3V1UA 5TS3A 3DBHB 4R9SA 5IG2A 2H1SA 5G0TA 3D5TA 3I9KA 1EEHA 3AOEA 1YQXA 3EZLA 4CQMA 4E32A 1H6DA 3ZZNA 4TROA 2P91A 2IYPA 4B7UA 4BNNA 3JYLA 4CMBA 2DPHA 4OOEA 4AJLA 2IDZA 4EEXA 5MGBA 4QO8A 5T67A 5HRUA 2C2XA 2QQ5A 5L95A 3ZGYA 4EUFA 5K6AC 1U4OA 1PZFA 1WDMA 2EXXA 3VHRA 1EVJA 1PEDA 1F12A 5A05A 1VSVA 2ZATA 3DBLB 2OOSA 2ZJ0A 1AXGA 5IF3A 3P5SA 3ITKA 3BA1A 4KQXA 4RPGA 4AJOA 3GGGA 4CV2A 1DIHA 1FXSA 3U62A 3RUIA 2HQ1A 3O38A 5AYVA 1YL5A 3LYLA 3G17A 3DWFA 2IRWA 4DUPA 3LT1A 3NTOA 3S2IA 4ZQHA 4WLNA 3F6YA 1LRLA 1Y8RA 1HE3A 3JQ9C 1T2AA 1DB3A 4J4BA 2Q2VA 4GH5A 3W8FA 4DC0A 5TIIA 5B1YA 2R6JA 1ZSYA 5FYDA 4W6ZA 1Q0HA 1L7DA 2PZKA 4J2OA 1YKFA 1HDYA 3UOGA 4PCVA 3UH1A 1NVMB 1P74A 2B36A 3GT0A 2Y93A 1L7EA 4OHUA 3AY7A 1YBMA 1U3WA 3DONA 3BYZA 3F1KA 4ITUA 3ZWWA 4J7UA 3BHIA 2A35A 2YV1A 3LC7O 5F21A 4JP2A 4BO0A 3FTPA 4R5MA 5H82A 3G1TA 2UYYA 1EFLA 2XPCA 3KEQA 3RFXA 1EBFA 2VT2A 2IE0A 3DDNA 4RF5A 1O95A 3I9OA 4AJ1A 1YL6A 1UAYA 4BO3A 5ER9A 2J3HA 3RJ9A 5DBGA 4WGGA 3B1FA 3AI3A 5HTOA 1NM5A 4ZQEA 5L7TA 2PFGA 3ETGA 3H2SA 3HB4X 3IMFA 4UVIA 1ENOA 5I7EA 2B83A 3CINA 1O0SA 1UH5A 3GUCA 1DBVO 3GVIA 2I76A 4FQ8A 4QSMA 1GQYA 1ISIA 1LDNA 1SO8A 3PQDA 3GMSA 4Z9XA 4TSKA 3BMCB 5L53A 3HB5X 1LC0A 4KZPA 2PD6A 3OH8A 5KJCA 3WTCA 1IY8A 4XGNA 4R5HA 4YJFB 5EIOA 4JLWA 1WMAA 5AXBA 3W6UA 3KBOA 5AQ1A 2POQX 4FPXA 3I9NA 3UGKA 2JD1A 5MDHA 3D0OA 3TZQA 1UR5A 3N58A 4QFCA 4J43A 1ISJA 4K9DA 3NT2A 5CP8A 3OJOA 1IHYA 4ALIA 4RPHA 3W1VA 3K30A 2BH9A 2D4AA 2QRJA 4CR7A 4E5NA 2J8ZA 4ZJUA 1I5RA 2YHIB 1LDGA 5CEJA 2BGKA 3AOEC 3WQQA 3JQFA 1H2HA 2B37A 4MIEA 4RVUA 3KYBA 2D5AA 4URFA 1ZW1A 2GD1O 1NHGA 2C29D 5IN5A 3DHYA 2X0JA 2J6IA 1ZXLA 1L1FA 5JC1A 3BTSA 1E5LA 3Q3CA 5IN4A 1XU9A 3H3FA 4BNFA 4PG6A 1PZHA 3IKTA 1VJ1A 1Q2XA 3FRJA 5TRTA 4LW8A 4CMKA 2VNSA 2AE1A 1E6EA 1YDWA 2PD3A 1KY5A 2X23A 1VC2A 2QYTA 3GRKA 3ZWYA 3DZJA 1QR6A 3W4JA 1RJWA 4A10A 3G3EA 3IP1A 3IIEA 2O3JA 3Q2KA 4F45A 4GWKA 5GZ3A 2ZCVA 4I5EA 4O63O 9LDTA 4WNCA 2I9PA 5GZ1A 1HE4A 3G0OA 4AJHA 4J4HA 1K2WA 3MWDB 4JGBA 2RAFA 5A4DA 3BAZA 3DBVO 5DCWA 4FD3A 4CJXA 5JDIA 1OOEA 1LX6A 4XIYA 2RH4A 3FBTA 5EPOA 5ER6A 4W7IA 4AG3A 4ALLA 2PKRA 1R12A 1KS9A 2DBZA 3OEYA 2QRLA 1HDCA 3OQ1A 3NUGA 2D59A 1OC2A 3M2TA 1LU9A 5COQA 2LDBA 5KCZA 2O23A 3F4LA 4CM5A 4W82A 3OM9A 3OJFA 1GZ4A 2GZ1A 2V6FA 4YAJA 4ZRNA 3T4XA 2J5QA 4JBIA 4L9RA 3U9LA 1DFHA 1DLJA 5G0VA 5A5FA 1W6UA 4OXKA 4Y8VA 1J49A 1VJTA 3IL2A 1EFKA 4FOSA 1E3JA 3AY3A 3ZDFA 4DIBA 1EBUA 4IDAA 4XGKA 1IZ9A 3AOGA 2EP7A 3AUSA 1E7MA 3O4RA 3B70A 3IAHA 3DQPA 3GZ4A 4RVGA 4CUKA 4D41A 3IKVA 4E13A 5L45A 4PLFA 1Z7BA 4D3FA 3C85A 2O7SA 3K96A 4DGSA 2CMDA 4CMEA 1A7AA 1B15A 2X58A 5JO9A 4A73A 5DDIP 1ONOA 4Z0TA 2GF2A 3V2GA 5KNLA 3V1YA 4OL9A 4OXYA 4BUCA 4BOYA 4FR5A 2NU9A 1E7RA 2CDAA 5B37A 4FB5A 3E9MA 4DPMA 2D2IA 5DNAA 1BG6A 4GX0A 2Q1SA 5DT9A 4NI5A 3D7LA 1R0SA 3ONEA 2EV9A 1YXMA 3DZHA 3FCOA 4XD2A 1PS8A 3RU7A 4II2A 2YDXA 3FN4A 4JX8A 3F46A 1QORA 1VLLA 3OJLA 2EGGA 2WD7B 3PFWO 4YWJA 3INTA 5I8WA 1DIGA 4IJVA 5J23A 2DUUA 5JFOA 1N92A 2DAPA 1JWAB 2P4QA 3I1JA 4PLPA 2QHXA 4AJIA 2ET6A 1K6JA 4EZBA 1F14A 2JAHA 5JDCA 1Q0LA 2R00A 1LDEA 1H0KA 3GNSA 2NU7A 2CVQA 1JAXA 3DFZA 4AJJA 2O3UA 1O89A 1EVZA 1M6WA 2YQ4A 1EUZA 3DBRB 2OP0A 1ZEMA 3GAFA 4GWGA 3PYXA 4RDHA 3EGOA 3SLGA 1GD1O 3UW3A 3RFVA 2HJSA 3W8EA 3ZWCA 4H7PA 2O50A 3HN2A 4I9NA 1LXCA 4Q9NA 1OBFO 3KO8A 3NDJA 4B3JA 1YQGA 3MJSA 1TI7A 4Y98A 4CLOB 1LLCA 4ZVVA 5A9SB 5DOVA 2B0JA 1Y1PA 4F46A 4TKMA 3KYDA 1PWXA 1P0FA 1TVEA 4WNIA 4YVFA 1X0VA 2FZEA 2Q2QA 4JROA 4XQEA 2JAPA 2X5JO 3U4IA 1KC1A 4FC7A 2ZYAA 4D7AA 3GMDA 3DEYX 4KTVE 4XYMA 5LDGA 4HFJA 3UICA 5C7OO 5HM8A 1U2DA 4BL5A 1AGNA 4F6LA 1E7QA 2V65A 3ASUA 3UFXA 3ZU4A 3ETDA 5JDIC 3FPCA 1GQ2A 2ZTLA 4I5FA 1M76A 4NK4A 1HYEA 7ADHA 4CM4B 1A27A 8LDHA 4CQLA 3RUDA 1PJCA 1R6DA 2FOIA 1ZMTA 3BMOA 4BNIA 4YCAA 1HT0A 4RGBA 4DYVA 1DC6A 4TZKA 2RHRA 3MTJA 2C7VA 2I65A 2YV2A 4HADA 5G2OA 2YHUA 4KOAA 2WE8A 3LQFA 5KVQA 1CDOA 4L74A 2QRKA 4AJ4A 1RM4A 1LQUA 5H81A 3WGTA 4EBFA 5KKCA 3PLRA 2AMFA 3EYWA 4KWHA 3DZBA 3ANLA 5BSHA 1HE2A 4H16A 3DB2A 1E3WA 4ZD6A 1KEPA 1VL6A 2QW8A 1TT5B 3QHAA 2J3KA 1VPDA 2FWMX 1PR9A 4KMSA 1M66A 1QV6A 1RM5A 4A03A 1SOWA 1ISGA 3FNHA 4QECA 1GTMA 4I9UA 2J5RA 3MJTA 2VHZA 5F1PA 1XG5A 4DVJA 3TL2A 4FFOA 4BNJA 1U5AA 1LLQA 2IEDA 2TMDA 3PJGA 4FC6A 3MJVA 1FDUA 1YJ8A 1JN0A 3QJ5A 1WAMA 4IDFA 3Q11A 5A9TA 3PHJA 2Y67A 4LCJA 4RPLA 2AHRA 3JV7A 4BO7A 3H7AA 2VRBA 5AXCA 4YAGA 3H8VA 1FK8A 5GZ6A 4UUNA 1D3AA 4BKQA 1WVGA 1MXFA 3DFUA 4IQ0A 4KWIA 3JD0A 5HA5A 4WEQA 3D3WA 3N7UA 5BSEA 3MWEB 5DN9A 3FR8A 4K28A 3QQPA 3E18A 5JDCC 1HLPA 2IXBA 4NBVA 2R00C 3U4HA 5JCJD 5ENVA 4MVJI 4G81A 1QP8A 7MDHA 4J9UE 1I36A 3VTZA 2VNAA 4I08A 3QWFA 3GEDA 3GOHA 3O9ZA 4CR8A 4BO9A 2WJPA 4G5HA 4DXHA 1PL6A 4J0EA 3GHHA 3FWNA 4FS3A 4EJ6A 4DQVA 2EHDA 1R4MB 5CAEA 3TRIA 3WBFA 1FDVA 1KEVA 4J9VA 1X7DA 4W7HA 2A9FA 1NQAO 3RASA 3GRPA 2H5LA 2ILTA 5IDQA 3H5RA 5KWEA 1PU2A 3TPCA 2PY6A 4BO6A 1B7GO 2VWPA 1YVEI 4BNGA 4FSHA 1MGOA 1GUZA 4PFJA 1DAOA 3L9XA 4BB6A 5A06A 5B12A 3U3XA 1SAYA 2VWHA 4GI2A 1IE3A 4IJKA 4M55A 1Z7EA 3GNQA 1MFZA 3PDUA 1DPGA 4CQMB 3N74A 2PGJA 5BQFA 4N54A 1PJ2A 3TJRA 3PQEA 1KY4A 3PVZA 1FDTA 1GU7A 5IXSA 4R4JA 4E33A 4IZIA 4J7XA 4LVUA 1IUKA 1OAAA 3NAQA 3HADA 2FR8A 3S2EA 3RBVA 3R1IA 2VT3A 1N1GA 3GK3A 1U8FO 4RORA 3L4BA 3JQAB 2QZZA 3BZUA 4IQGA 2IZ0A 4EW6A 3NYWA 1P1RA 2XOXA 3CMMA 4LSWA 4YAEA 1UJMA 3DO5A 3WJ7A 5G0SA 1MUUA 1OZAA 1R0KA 5AVOA 1AHIA 3H5NA 1V35A 4NBWA 2RIRA 2Z1NA 4K1LA 4RQTA 4U6SA 3GVHA 5BR7A 3ORFA 4HV4A 4WLFA 5A04A 4D42A 3INGA 1G6KA 1PR3A 4K6CA 2FSSA 5CPBA 2C5EA 3TN7A 5I7FA 4R1NA 2NADA 1Y8RB 2VHWA 4H3VA 1XHLA 4Z6KA 3AW9A 4TRRA 3NT4A 1T4DA 4IY1A 3OEWA 3S2GA 4K26A 1R37A 2VUUA 3HSKA 5EINA 4YQYA 1XDWA 4NMHA 4Q3NA 2BF7A 4RCVA 4D44A 5A9RA 5CDSA 4CM9A 2HUNA 1PWZA 2VOEA 1BMDA 3VDRA 3ZWPA 5KJ6A 2ZKLA 1ISMA 4E5MA 2Y66A 3CUKA 4OMUA 4MPDA 4BNUA 1LC3A 5CEEA 3FPLA 3WYEA 3GN1A 1XA0A 4R3NA 2HLPA 3PIIA 1A7KA 3FSRA 1LNQA 1DRUA 4IXTA 4E5YA 4D0SA 1SPXA 2Y0EA 4BNWA 1HRDA 2FR0A 3RUHA 2Q1WA 2DUWA 4DMMA 1GYQA 2BGLA 1LQTA 2GGSA 1JVBA 3MJCA 5IZCC 1CQIA 3ETEA 3WGIA 3CXRA 1N9GA 3PP8A 3CKYA 3F9IA 4FOOA 1EDOA 5EL0A 4LN1A 2FPGA 3TWOA 1IHXA 4ND2A 1CEQA 1HETA 1I33A 4LGVA 1DIRA 4CMGA 1BRMA 1XCBA 1S7CA 1SMKA 1HYGA 3ROPA 3EAGA 3GA0A 3RUEA 5KIAA 3SVTA 3ANNA 1IULA 1YDEA 1U3UA 1MC5A 3FWZA 1KEWA 2H9IA 1F0YA 3JQAD 1GDHA 4L4XA 3JSAA 4BO2A 2TMGA 3OQBA 1I32A 3S1LA 1W73A 4ZQGA 1E1LA 4KUHA 1MG0A 3GF4A 1P1FA 1IOLA 2FZWA 1U3TA 3QVWA 3WNQA 2B4TO 4A5OA 2YW9A 2XXBA 1ZCJA 3GH3A 3WGOA 4TQGA 1DHTA 2E4AA 4A7PA 4D3DA 2GASA 3AJRA 3KOUA 3DZFA 1U2GA 3P7MA 2EKQA 1H6AA 4OYRA 1PS9A 3WLFA 4CM1A 3U4DA 2DFDA 3SC6A 4BB5A 2NSDA 3JD2A 5IZ4A 3L0DA 4IDCA 4Z0PA 3VPXA 1CF2O 4R9RA 3AFNA 3VKUA 1PQPA 1VI2A 5KJFA 5L7WA 4JP3A 3GFBA 1YRLA 4RQUA 1BVRA 1A72A 2GR9A 4PRKA 3B6ZA 1I8TA 3F3SA 5DP2A 5B4UA 5DCYA 3WWYA 3GQVA 4CL8A 1G1AA 2P5YA 1RPNA 3WBBA 1A9YA 4UVHA 4OQZA 1Y9EA 2BD0A 2X4GA 3WSWA 1IB6A 3NTQA 1E1MA 2CDCA 4L0QA 4NFYA 2EW2A 1E92A 4NU6A 4IDEA 3BMNA 2NVUA 1R66A 4PN3A 3P19A 4DMLA 2ZQYA 2PV7A 4RLHA 1ZK0A 1GPDG 3OECA 4XYGA 3MTGA 4MVJG 9LDBA 1HXHA 1M75A 5FI5A 4N5LA 1YONA 1ZSNA 1GQQA 4EEZA 3W4IA 4HXYA 3UXYA 1ONPA 3VC7A 3KSDO 4OOFA 2Y05A 3DMYA 3PJEA 3QP9A 4TMFA 4IM7A 3C1OA 4D45A 2B69A 3OF2A 4DQXA 2VHYA 2C5AA 4YR9A 5ENDA 4ND1A 2F1KA 4IQ8A 4UREA 4BKRA 2IEBA 2PNFA 1DDOA 4MJLA 1LDBA 3PHLA 3JQEA 2CSUA 2X86A 1GV0A 2D5CA 3WNVA 3RAJA 2Y1CA 4OXNA 1B14A 4DIOA 5G4LA 1AE1A 3QRWA 4CM7A 3A1NA 3VH4A 3PJFA 1ORRA 1LJ8A 3D64A 4RPJA 4XR4A 5THQA 4GMGA 1YB4A 1LDYA 3WJAA 5C37A 3PFFA 4GSLA 3NV9A 1C14A 1HDOA 1TB4A 1KVRA 3PQFA 3OICA 1GZ3A 2E49A 2C07A 4B79A 1MC4A 5T8KA 4RVDA 2HRBA 1UXGA 4Y6SA 1FJHA 4EJ0A 4ROSA 1WDKA 1S6YA 4W4TA 5I9LA 2NVWA 1B8PA 2JJYA 1C1DA 1SEPA 1LRKA 4Q39A 2UV8A 8ADHA 3ZV4A 3ZU2A 4JN6B 3DZGA 3LF1A 4GQAA 2GCGA 3LU1A 1WPQA 1GADO 3F5SA 4WECA 1Q7GA 2VUTA 4F6CA 4JK3A 4R1SA 4XRRA 2P9EA 1T4BA 1UXJA 1N2SA 3L07A 1I2ZA 2ZYDA 2IXAA 4BS9A 1DOHA 3HWRA 4RO0A 3VVCA 1NVTA 3UHAA 5JLAA 1GYPA 4E4YA 1AUPA 4ZU3A 2VTEA 4IS3A 3E8XA 3JYQA 3I3OA 4JJIA 2J3JA 4FCCA 4ZN6A 1QG6A 4L75A 3OJEA 2DT5A 1HF3A 4PZEA 3K6JA 4EYEA 3NGLA 1KVQA 4BO8A 4E31A 2GZ2A 3DHEA 3NT5A 1X1EA 1PS0A 3KYCA 1ZBQA 3EDMA 3L77A 4GX1A 4HFMA 4WLVA 4OAQA 5I7VA 5L51A 3OSUA 4K6FA 4UUPA 3RVDA 3PPIA 4NJMA 2HK8A 4Y67A 2D8AA 2EP5A 2PA3A 3KSUA 3KYDB 4CMIA 2Z5LA 3H2ZA 4N5MA 2W2KA 4AL4A 3JYOA 3HDQA 3OETA 1SB8A 1MA0A 3JYNA 1KVSA 1QYXA 1NWHA 4RF2A 4YT5A 3QVTA 3WIDA 3ZNQA 1ZVMA 2VRCD 3E9NA 2Z1MA 3W6ZA 5COBA 1CJCA 2HMWA 1UP4A 5L4NA 3RKRA 2JCXA 1GL3A 3WB9A 2ZIZA 4GMFA 5G0WA 4XB1A 2W2LA 5A3JA 1CETA 3HHPA 1YWGO 4C7KA 2DTEA 2EWMA 2LDXA 1C1XA 3NEPX 4OSOA 4BHTA 1ZH8A 3UUWA 1A9ZA 1E6UA 1YH3A 4YRAA 1V3UA 1CWUA 3BMOB 2AW5A 2X9VA 5EQFA 1NYTA 4O5OA 4GX2A 4P4LA 1O5IA 4XDZA 2D1YA 2I99A 1B0AA 3G79A 4KDEA 1UZMA 3ICPA 4Y9DA 4AJEA 2GRAA 4WOKA 5CDGA 2GN9A 3PHHA 5L7YA 5COAA 5TX7A 4L8VA 1E6WA 4L4RA 3Q1LA 2PTGA 4IPTA 4PG8A 4BKUA 1O9BA 2B5WA 4A26A 1TT7A 4XKJA 1UDCA 1BDMA 2C20A 3WFJA 1VL8A 1E3WB 1I01A 1E0DA 1LBEA 4CLHA 3IUSA 2NTNA 1TLTA 4IDGA 3LDHA 3SJ7A 4D46A 3CSDA 5CG2A 2QX7A 4XWYA 3H9JA 3BTVA 3DZKA 4JXKA 3AUTA 1MP0A 3PLNA 5T8KC 1HYHA 1ZXBA 2VZ9A 3NDRA 5KJ1A 1PTJA 5JSFA 3DBLA 3ZW9A 1F8FA 4WPGA 3M6IA 4Z9FA 3WS7A 1DEHA 1Y81A 4R1UA 4GL4A 1PZGA 5L3ZA 4BV8A 4EITA 4J6FA 3M2PA 1E3IA 3LT2A 1LSSA 2BFPA 1BXGA 3C7AA 1EMDA 1FMCA 4NHEA 2DBQA 3PHIA 4PLZA 3ADPA 4XQ9A 1PGQA 2DKNA 3GPDG 3VH3A 1XEAA 2P5UA 1OI7A 3D5QA 4O6VA 2XF8A 2EJWA 4NQZA 3TZHA 1E1KA 3D3WB 3M1AA 3AM5A 3ICCA 3WSVA 2X0RA 3O8QA 3WDSA 4FIZA 1ZJYA 2ZK7A 3TZCA 4FDAA 4FW8A 1Z75A 1Y7TA 4PLWA 4PZCA 2NNLD 3C1TA 3MJEA 5F5LA 3WYBA 5TQVA 5DBIA 5L4SA 1ZKMA 4YT4A 2HJRA 4XRGA 5BSFA 4ZGWA 3DC2A 1X1TA 4RL6A 1GPJA 4A2CA 4IIVA 4HNHA 1ZSVA 2YQ5A 4BNVA 1P1HA 3AM4A 3ENKA 3H3JA 4ID9A 3ZNOA 3JD4A 2WYUA 1DC4A 2CFCA 3Q0EA 5TGDA 2W8ZA 1YB5A 2FP4A 5A02A 2RH8A 3KRTA 4FJ1A 4MP3A 1V8BA 1WWKA 3KTDA 4EUEA 5K0ZA 5A5EA 2E37A 4MINA 1P33A 3RC2A 5BSGA 3JQFC 4PGFA 1YS4A 4XX0A 5CPFA 3ZWVA 1UXIA 4FGWA 4O0LA 5KVSA 4KQWA 3GC6A 5ILOA 3KZVA 2HMSA 4W9NA 3ST7A 3QA9A 2HU2A 1CIVA 3DXFA 1BTOA 3ZI0A 3PK0A 3ZWMA 4B4VA 1UZNA 2UDPA 1RWBA 2Y1OA 1RM0A 2NVBA 4TWRA 2IODA 4I8XA 3UVEA 1Q7CA 3DAFA 4FFPA 3WQRA 3C1AA 3BMQA 4MP8A 3ROQA 4WOJA 4M89A 1OMOA 3NTRA 4JBHA 2HKIA 1LDMA 3FNFA 2X0IA 5JMWA 3EC7A 4KDFA 1M6HA 3ZCXA 1NQ5A 3ZWNA 4BIIA 2A4KA 2O3TA 2I3AA 3A14A 2OFPA 4OGWA 3HE3A 2A94A 3Q9UA 3V2UA 3EY4A 2E82A 1XLTA 4CM3A 1X7HA 4IIUA 2NTVA 4OSPA 3F47A 3V5NA 4MKZA 2Y99A 2WDZA 3DAPA 3HDJA 4KP7A 2PH3A 4NH4A 4CV3A 1ID1A 4ZICA 3G49A 1H94A 2AQ8A 2I3GA 2EERA 4B8WA 1HDZA 1U5CA 3HFSA 2AEJA 5G0UA 2JFGA 3VAZA 4WK6A 3U0BA 1Z73A 3HJAA 3O26A 2B4RO 3I4FA 5L9AA 1PJSA 3FNEA 3C7DB 2OL4A 3KSZO 4XZ3A 4RJTA 2RHCA 1E3EA 3SXPA 5HS6A 2B35A 2E48A 2P9GA 4NG5A 4DA9A 1JKIA 4WLOA 1A5ZA 1Z74A 5FFFA 2JHGA 2ZB8A 1DRWA 1MG5A 5TT0A 3WGQA 2BKAA 1U28A 3CTMA 4LSMA 4M86A 1GEGA 4YJDA 4Z3DA 3E9QA 3Q6IA 4FN4A 1ADCA 1R4NA 4U0KA 1H6CA 3WLEA 5CDTA 1ONNA 4J7CA 5JYDA 1KEUA 1NVGA 2GO1A 3PWSA 2G5CA 4BNYA 1DJQA 1OC4A 3DAGA 4GGPA 4BKOA 1P1JA 5HWSA 3IJRA 3OA0A 3S8MA 1ZNQO 5DULA 4CMEC 1ARZA 1I3MA 2XXJA 1X13A 2RCYA 4XEHA 4YRDA 1V3TA 2OP1A 1N9GB 4NR0A 4IDBA 3C8MA 1D7OA 4S3MA 1N1EA 5KOIA 2PZJA 4PVDA 1PL7A 4QQRA 2VWQA 1LRJA 1J6UA 1EE9A 3VPHA 2HAEA 4WASA 1QYWA 2NU8A 4CLXA 3C7CB 1Y8QA 3GGOA 4BVAA 1GEEA 6LDHA 1KBZA 4GX5A 4HFNA 1YGYA 3MEQA 5HS4A 2HK9A 3V1TC 4Q3CA 3OFSA 4NU5A 3UCXA 1XR3A 2G1UA 3K2BA 1ZMOA 2X0NA 1HWYA 3PHGA 4O1MA 1NAHA 4CV0A 2X7HA 4ZHSA 5JAZA 4GKVA 2GSDA 2PGDA 2JD0A 2X8LA 4PLHA 4PLGA 1XGKA 1QXSA 4IJWA 3K8ZA 2P4HX 3I23A 2RBEA 1O8CA 6ADHA 3HDHA 2G17A 4ND5A 5JY6A 2HCTA 3PXXA 5H83A 1I2CA 1PL8A 1CERA 1NTOA 3SEFA 1H9AA 3OIDA 3RBZA 1A71A 1EVIA 2YV3A 3GUYA 1BHSA 1P45A 3RUFA 1G0OA 2BFAA 2WEKA 3TDKA 3KUXA 4FFMA 1SC6A 3K92A 3ASVA 3PEFA 3WYCA 2AG8A 1B26A 5ICMA 1I3KA 4CR6A 1LSUA 2ZB4A 2GPTA 3QY9A 2VYND 3D4OA 3FNGA 4JCOA 4MVJD 1EZ4A 1XU7A 4BKPA 3PIDA 2H6EA 4B4UA 1WXDA 4LISA 2VHVA 3TOZA 1AHHA 1YB1A 4E21A 1F8GA 2WD7A 2O3RA 4E2YA 2X5KO 1I24A 2VN8A 3RUAA 4NJOA 2O4UX 2V7PA 3ZNNA 1ZK4A 3DHNA 3ZHBA 2BI8A 3ZV3A 2HDHA 4UUOA 3QWBA 2NVUB 4NK5A 2BMAA 2C0CA 3RSHA 4M87A 4RF4A 4PG5A 3T4EA 1NAIA 2Q99A 3QWIA 4P8RA 4U8GA 1HSOA 4HNGA 2Y0CA 3X2EA 4EUHA 2V6GA 1NR7A 1UP6A 4NBRA 4DQUA 3U4CA 4XGIA 2AA3A 1N8KA 1K5HA 4HUJA 3TOXA 3A28A 3L9WA 1B8UA 3T7CA 3DZIA 5B4VA 3IS3A 4LK3A 3H5AA 4BQRA 4Z9YA 3QLJA 2QYSA 3HUDA 1U1IA 3QVSA 2X6TA 4R51A 2DQ4A 1YOVA 4P22A 1P77A 1BSVA 3U49A 1I10A 1D4FA 1GCOA 1KIFA 1O94A 3ZWAA 1PJQA 2C7GA 1U8XX 3RU9A 2VYVA 5JAMA 3A9WA 4CPDA 5LC1A 2PH5A 3OMLA 4U5QA 2O2SA 3JQ8A 4PVCA 3RC9A 1A4UA 2BFMA 5F5NA 2WYVA 1NNUA 3GDFA 1NPTO 1B8VA 5JCJA 5BT9A 5BNTA 3RIHA 1N7HA 2ZQZA 3MCVA 2UUPA 3VVBA 4MVJH 1BXZA 2PK3A 2UAGA 1H6BA 1HTBA 3B1KA 1DC5A 4WCDA 3RUCA 1LUAA 5EMHA 1PJTA 4D0RA 5K6AA 4BNLA 1RYEA 3FHLA 1LSOA 3JQ7A 4UUMA 3ZW8A 1V6AA 5IJZA 2FSVA 3U5TA 1ZJZA 4XIJA 5HBRA 1C1DB 4YEDA 3I6IA 5K9ZA 2QG4A 4RVHA 1V9LA 1Q7BA 3PWKA 3E48A 4OKIA 4BNTA 2C82A 1ULSA 3MJ4A 4G2NA 4QTZA 3AY6A 4NBUA 4R16A 3GEGA 1EVYA 3NDIA 4PG7A 2DTXA 4E12A 2EF1A 3AWDA 2VOJA 2O7QA 5JE8A 2YZ7A 2DLDA 3PJDA 2WSBA 4FFNA 2NU6A 1E5QA 3E82A 1NFFA 2EG9A 4A27A 2WMDA 1JVSA 4CQMD 4ILKA 2FRDA 2UVDA 2E6UX 2A92A 2Q50A 4YJGA 4HKTA 3ABIA 1PGNA 4AJPA 4XA8A 1LLUA 5ILGA 1HSZA 4RLSA 3S2FA 1D1TA 5G4KA 2JD2A 1ISHA 1KVUA 2Y1DA 2VHXA 3KM0A 3PI7A 3ONFA 4PLVA 1PIWA 4ONEA 1VKNA 3GEMA 3CZRA 3EHEA 1GV1A 1PJ4A 4ALMA 1XYGA 2VWGA 1E1NA 4RVFA 4II3A 5GMOA 4BNHA 5JNLA 2NTJA 1HEUA 2CY0A 3IQDB 5FEUA 5IDYA 2FR1A 3DTYA 1MXHA 5C5IA 2AQHA 1ZO8A 3KYCB 4LCEA 4XJTA 2YJZA 3DOJA 1HDRA 1NPDA 1H93A 3RI3A 4DPKA 1FDWA 4NJMB 2DTDA 5TLSA 3BTUA 3ZH2A 4YYZA 4E5PA 4CMIB 3E5RA 1PJ3A 4INAA 2W2KB 1F17A 1CQJA 1QYVA 2GNAA 4UVDA 1M2WA 1JU9A 1NP3A 2Q4EA 4EI2A 1EUCA 3HZZA 4RV9A 1GCUA 3VH2A 4J1NA 4TKLA 1ZUD1 1EK5A 4XYEA 4YQZA 4CMHA 4LMRA 3FI9A 3JQGA 4BO1A 4YAKA 1UDAA 2IZZA 4I1IA 1BWSA 1GR0A 4ALNA 1WMBA 4TVBA 3L4BC 2P2SA 5TSDA 4AJNA 1ZK2A 4GSKA 4QXMA 3HNPA 3ADOA 4YJHA 4Y6RA 5KVVA 1Z6ZA 1YQDA 1T2EA 3CZMA 3ZV6A 1MLDA 3K9QO 1BGVA 3GLQA 2C2YA 2GYYA 1QMGA 3OQ6A 1KYQA 2JCYA 2J5KA 3GY0A 4NFHA 4B7CA 4B7XA 3IP3A 4CLEA 1HE5A 5LDHA 1JDJA 4B3IA 3AI2A 2V6MA 4PLCA 2VZ8A 1P1IA 2BRUA 2YY7A 2EKLA 4NNJA 4UEKA 3NX4A 4UVEA 4WCFA 2XAAA 4XJSA 3SJUA 5F1KA 2ZCUA 4IBOA 1K89A 3EZYA 2HSDA 2NV6A 4AICA 4BGUA 2Q3EA 3VDQA 5CG1A 1NQOA 4YBZA 1X7GA 1I3LA 2D0IA 1I0ZA 1NWCA 2EJVA 2WYWA 3LF2A 5JPIA 3LT0A 3GZNA 4HBGA 2CZCA 3TFQA 1RYDA 3C24A 3CIFA 2AE2A 2B4QA 4YXFA 2PD4A 1T1RA 5FI3A 2EEZA 2OBNA 1N5DA 3KHUA 3R6DA 3JQAA 2G0TA 2D3TA 2Q49A 3T7EA 4CM8A 2O48X 3DMTA 3INRA 2O4CA 1LTHR 3OP4A 3SLKA 2QZ9A 1MV8A 4Z3KA 4LRSB 1X15A 3ANMA 4U6QA 4DIFA 1TA4A 2DC1A 1NXQA 1XELA 2FN7A 3I6QA 4MVJF 1VKOA 2Q1TA 2ZTMA 4J1QA 1W4ZA 1GUFA 4WLUA 3RJ5A 1BXGB 4E2XA 1HDGO 1LLDA 4PG4A 3RD5A 3WIEA 4MDHA 3QSGA 3UF0A 4E3ZA 3DTTA 4JIGA 1CYDA 1PSDA 1K3TA 1ISFA 1VRWA 3B20A 3EMKA 2AQIA 1C0IA 1EDZA 3O8QB 2OXIA 2GZ3A 2EKPA 1EQUA 4CLRA 1JWBB 3KEOA 5FF9A 3JYPA 2W2LD 3LVFO 4UVGA 4ZA2A 3VZQA 3L6OO 3ZNPA 1T2FA 1IZ0A 3F1LA 2HMVA 2X9NA 3R3JA 3NKLA 1KERA 1U7HA 5JW6A 1ENYA 4P38A 5KKAA 1V3VA 1R15A 2Y1GA 3AU9A 5JY1A 4TRNA 5KTKA 3LC2O 3AK4A 2HMTA 3WX0A 1J4AA 1E7YA 3RBXA 1TXGA 2OMEA 1PX0A 4MO2A 4YDRA 2WTBA 3QWHA 1D1SA 1ENPA 1T26A 3GVXA 4IGEA 4NDNE 4WKGA 4YACA 4U0JA 1IPFA 5T57A 2GUGA 4M8SA 2EW8A 3IOYA 5CHEA 1QLJA 5IXYA 4CM6A 3BHJA 3IC5A 2IYOA 2NQ8A 3V2HA 1SCUA 2R2GA 3ZU3A 5CEFA 1SBYA 5CFZA 3BHMA 4XQGA 3JQ6A 3TZKA 5JBIA 3VH1A 4BGVA 4I9HA 5TC4A 3PDJA 4FBGA 3GVPA 4CLDA 4GGOA 4NZ9A 1E77A 5CDUA 4EDFA 2UUOA 1DRVA 5ADHA 4J0FA 1JLLA 3BMQB 3VZRA 3QW2A 1BW9A 1C0LA 2CVOA 2X1HA 5IDWA 4RZIA 1DO8A 2X9GA 3K73O 3GN2A 4WLEA 3WICA 1UP7A 1HZJA 4I5DA 4Z0HO 5A3VA 2G82A 2I67A 3VPGA 3CE6A 1SNYA 1UXKA 2VUSA 3PGJA 3ZU5A 3GHYA 3IDSA 5T64A 1PJBA 5IFLA 3D4NA 1RKXA 4WCFC 4DTIA 4BO4A 1BVUA 2JFFA 2GERA 1DXYA 2BLLA 2J3IA 4Q3BA 4ZQBA 3D4PA 4BMVA 1GZ6A 5JYEA 1GAEO 3ROKA 2PKQP 2JHFA 4CQLB 1E3SA 3PZBA 4BV9A 4XYBA 1M67A 3MZ0A 4E2WA 2O2YA 2O3SA 3K5PA 5DZSA 3RC1A 3L6DA 1QKIA 1XKQA 3QVXA 4AFNA 4BGEA 1SEVA 1YBAA 4IXWA 1ML3A 3AM3A 2BGMA 1H5QA 1T25A 1QYDA 4HWKA 1NFRA 5JMPA 5I9MA 4CUJA 5AXAA 1EQ2A 1PQUA 1VL0A 2ZB3A 4A0SA 3W8DA 1ZZEA 4MP6A 5T6BA 1VE9A 2GN8A 1JQBA 3DMTC 2OO5A 5A03A 3ZHXA 3DBHA 1MFPA 4GBJA 3O03A 4GPD1 4YB8A 1R4NB
chains in the Genus database with same CATH superfamily
4MOWA 2PZLA 3MCTA 3PGXA 1G3UA 2FX5A 2JIDA 3KE8A 1C3VA 3PUWA 4RYLA 1KI1A 2WJWA 2CLDX 1IWOA 2JHPA 3UY4A 1JA9A 2ENWA 3PGMA 3P0IA 1G42A 4Q4HB 1C1YA 4B2LA 4EB8A 2NQTA 4B09A 4EHNA 3VBEA 2J30A 3O91A 3JATB 3KETA 1F9EA 3FJYA 2B2CA 4OP3A 5DE3A 3BIXA 3KYIB 2GTHA 3PPXA 4PBSA 2DPGA 1T9DA 4OH1A 4UM8B 2H1FA 1V41E 2NU8B 2R6R1 2DFVA 1Z45A 3O4IA 1CW2B 4OHVA 4UTPA 4DCUA 3I9FA 3D6NB 1Y8QB 1N34B 2D2VA 4PZDA 5L3VA 3FAKA 3E1KA 4Y1RB 4Z2YA 4ACAA 2O5CA 3C41J 1WZIA 3V3TA 3WP1B 4ESEA 1NF8A 1OFTA 3T7KA 1XHEA 3MAAC 4IICA 1TF2A 1NGSA 1P60A 4TV8F 1JSRA 4WZAE 4IWNA 3DMRA 4YIKA 4FCVA 2CVZA 1CCWA 1JG7A 2HX1A 3FVTA 4TZTA 2ZU6A 1NHWA 1T1SA 4XQCA 3QMWA 1CV2A 3ZOKA 3ZWBA 4AY6A 1SUWA 1ZEJA 2GJAA 1EXVA 3OPYI 1IATA 4JJGA 2H63A 4KKXB 4JHXA 5A6SB 3RROA 3U4QA 1F6WA 1HNWB 4DNOA 1C9NA 5HKBA 3RUPA 1QV7A 2LGJA 4Q9IA 3AEKB 1KWGA 4P80A 5LMNB 4NL4H 1RBQA 3LDGA 3MGCA 2OC4A 4OHXA 2WG1A 1GL6A 4A0FA 1EUDA 3C5CA 5EG5A 5H3CA 4ALKA 4EFKA 5CB4A 1IXZA 4RKRA 4N82A 2C54A 1DRKA 3TVDA 3GG9A 3M1LA 1JIKA 4HN9A 5G41A 3ZXIA 3RSQA 1KIMA 4JB0A 2QIOA 1Q1NA 2IEIA 3RVNA 3FFBA 4Z4IA 2Q45A 2WICA 1UPAA 2IUUA 4TTJA 1P7PA 1LPSA 2ZRLA 4NV3A 5AUNB 4YCMA 1BWPA 3A6PC 1IYZA 2Y0PA 3CRW1 5AW9A 1TVKA 1JHOA 2AG0A 1TCAA 3HBMA 1Z88A 4MYCA 3DC7A 4WOPA 3ONDA 3ZTWA 4E0BA 2O52A 2A1IA 4JT2A 4D0NA 4BFYA 5H4HA 4ALJA 1K6IA 1HL3A 2P68A 1IPEA 4IUYA 4RZHA 4YQFA 2WWGA 2YN4A 1F5SA 2GLUA 4IHJF 1JZSA 3D6UA 4XLLA 1RWXA 2Y0DA 3HVKA 4KQGA 2DBRA 1PLKA 2M98A 3MRTA 3EPLA 1ZI6A 2WF8A 2XVXA 3I5MA 4NMLA 4FJ2A 4OM8A 1L5RA 3FHCB 4XGQA 5EQDA 3D3QA 4EZIA 1DDIA 1Y3IA 3BTOA 4K6HA 4CF5A 4EX6A 2WJAA 4QGFA 4I1RA 3ZLTA 4LIPD 1DUIA 2VPYA 4ZO9A 3BMCA 1H2BA 1CRWG 5HKKA 3GJYA 4FBMA 3WR5A 2UZ1A 2PH7A 1XWFA 1Y8AA 5LLDA 1G5PA 1RU3A 3M6AA 4RTPA 4YJFA 3G1UA 4QOGA 4EGQA 1NU8A 2HADA 2ZR8A 4HZGA 1QJ4A 2ZYSA 3VZSA 1NZDA 2FOLA 4Q4JB 4O4JB 1FZQA 1RAFA 4NBKA 3SVZA 2UZ0A 1GG5A 2Q1YA 3KVOA 5EWJA 1Z8NA 3PQ6A 3EK2A 5HNKA 2IH2A 2H11A 3HLKA 4R3WA 4R2LA 4L22A 1Q92A 4ZOLA 5K2OA 2WA2A 2Z8XA 4M7WA 4QOFA 3W3AA 1PQ4A 2V7UA 1XZFA 4WAUA 4CMJA 3P52A 2PUAA 3O5AA 3ENQA 1FTNA 2PFKA 2YHIA 1U0BB 2Y77A 3ZE0B 5TJHA 1AH2A 3L6EA 1ZHOA 1TTQB 4WDRA 1ECFA 4Q3EA 3IE1A 3MTBA 4O4LF 3HYSA 4C05A 4RVSA 4MGIR 4KPFC 4EHJA 1Y6JA 2AEMA 3EZGA 1PGJA 4REOA 1KDRA 1KMQA 1IOVA 1NX6A 3AFIA 4HX2A 1Z38A 4DWVA 1G3RA 2V98A 4BMPB 5DBEX 1CZNA 4KR6A 2NPOA 4JWKA 1ULUA 5KINB 1YO6A 4JUAA 3CIOA 3L04A 3O7WA 5A0TA 1E2FA 2CJXA 1A04A 1ABEA 2WZDA 1AK2A 2ZTVA 2VLBA 4CUZA 5KJEA 3KP1A 1TMOA 2NYAA 3OT5A 3ZHZA 1JILA 3ZX5A 3RNLA 2QGFA 3LDFA 4WACA 4NPCA 1TU3A 3W8NA 1A82A 2PR2A 1FFAA 2YY5A 3DOEA 3W8RA 5EJ5A 5A4MS 3JASA 3VR5A 3R4CA 4K9OA 1KE1A 4OK3A 3TBHA 4TT3D 1OZHA 4NHOA 3BRWA 2V3CC 5B3LA 2KSQA 1STOA 1W49A 1D6NA 2CF5A 4N12A 4R1OA 2QVYX 3RIMA 4P3PA 1V47A 4R0VA 4D8VA 3TIVA 4WNAA 3OT1B 3ZVNA 4M54A 3LFHA 3LGAA 5EUMA 4GLLA 1SBTA 1L8AA 1YC5A 2ENUA 1FPQA 2NU6B 4YA6A 3FCXA 4C4OA 2ZSBA 1NURA 3RQSA 1R5BA 2D62A 3QFRA 4LVNA 1SQ5A 4HEQA 5BSWA 3HC7A 3LGXA 5KQLA 1PKXA 3OA2A 3DS8A 3M8KA 3NM4A 3E03A 4ND8A 3JAMA 2OCYC 1K7SN 1PV4A 3IP7A 3R0ZA 1C7QA 3R5KA 1VA4A 2C5BA 3EVNA 4C4TA 3F6PA 4HS4A 4PAOA 3TTWA 1NI4A 3ORYA 3C98A 2DZDA 3MG9A 3NGXA 4IDDA 4J3FA 4JHLA 1ZOOA 2M6LA 3CEJA 4B9AA 4YRMA 1XCOA 3CVVA 5EN4A 3UAWA 1R3UA 3K9LA 4G36A 4S2UA 1BFDA 1H9BA 1JXQA 1THTA 3GOQA 1A9XB 4KDCA 5CJ2A 3SQDA 4AKTA 4IIJB 3HJNA 3UK2A 2RJNA 2QRQA 4QFDA 1NNEA 3AHIA 4D0LB 3TOCA 3DD1A 1KETA 1L7VC 1DJNA 2P1DA 4DCJA 1EKXA 1GQSA 5IHXA 2A84A 5AI8A 3AIOA 4M9CA 5FI1B 2PS1A 3W06A 4AMUA 4DRYA 4Z4EA 2YJGA 3E5MA 3L7NA 4KPUA 1AUVA 3M4YA 3DSRA 4UHBA 1OPRA 1Z36A 1L6RA 4P9NA 2YN2A 4X1KB 4YP5A 5ESWA 1OFGA 1M34B 3UHPA 4B3TB 1SKAA 2I34A 3IPYA 2GXQA 3B1VA 4GU5A 5H5JA 4XD7D 3P4XA 4M49A 4Z9BA 4QM7A 2VSQA 2XUKA 3UJCA 1P8JA 1CQJB 3PI6A 1ZLXA 5HKLA 4OLBA 3UPDA 4N0QA 1NFQA 3H9QA 4X20A 5IZCA 3I5XA 3ONVA 1V5WA 2V8BA 5EGNA 2I33A 2JIZA 3OHSX 3CZ5A 4LHSA 5IP5A 5J2TF 4C04A 1TK9A 1WXEA 2BFBB 3P96A 3DWIA 1R6AA 4GXTA 1DSSG 4UU0A 3JQGB 1IL0A 4EM6A 1JEEA 3GDGA 4L4YA 1O6ZA 2Y68A 1IH8A 3EUEA 3HBAA 1CJKC 3COSA 4UHDA 2AZ4A 1U98A 3TTVA 4U7WA 2WJ4A 2BKEA 4C14A 1BKDR 4F3KA 1EUYA 3DDWA 5AVZA 5IKEA 4MB2A 3R7NA 2SKCA 1JHAA 1SN7A 1JVNA 3WGHA 1A8QA 3BX1A 5JS7A 4Z7OB 4IYRA 4FVTA 4LDJA 3NAGA 3WG9A 3DOCA 3V97A 4R1PA 1O57A 4PX5A 1PF7E 3G2HA 5FNVB 4EHLA 2XLBA 4Q9JA 3SGLA 1K6XA 1XXHA 3ZDYB 1OQAA 4HEJA 5HKOA 5LA6B 2PT7A 5EP4A 2FUEA 1BA3A 5L3RA 4KPYA 1YZFA 2X77A 5AJHA 5IULC 2Q2NA 2ZJ5A 4PX2A 1RJ9A 4JQCA 3LV8A 3DBRA 1WRBA 2HWKA 2X5XA 2RHDA 3HDYA 4FBLA 4KGXA 4TXLA 3RVRA 5AW0A 2F90A 1W1WA 4R2KA 4BNXA 4IIEA 1S96A 2P78A 3MUOA 1WSDA 1TAQA 1GZ5A 2MIIA 3GZNB 3PA6A 2G9NA 3V8QA 1GTVA 4HYEA 4AVYA 3PFKA 1DIAA 5CFPA 4YV7A 2D3WA 3TXAA 1IN6A 4GG1A 4NVRA 3TE6A 2ZYHA 3JCZA 3T5MA 4MH0R 4OIMA 2HRDA 2NO5A 3B6JA 3CZ4A 2REBA 1KHTA 5A9SA 4CLOA 1GM5A 1G2PA 1YCGA 4WV3A 4F2PA 7AT1A 3G8BA 4J4TA 1N2BA 4D8YA 1KBOA 4RTRA 3IEIA 2ZJ8A 2NV2B 3E2PA 1ONSA 4IDNA 4II7A 4MUMA 2ZM6B 4NPAA 1ZUNB 3ZJVA 3ANYB 2WBLC 4FYJA 1XIVA 2BLNA 2PLAA 2J0QA 4UNSA 1LPNA 1HBJA 1FLDA 3H2BA 1WB4A 4DL9A 1U9YA 3BXXA 3PGLA 1YQ9A 1JIUA 1GGVA 4HQ0A 4RTSA 2PUDA 5CA1F 1ADBA 1ZM2A 2CNLA 2YVQA 5I7UA 1OI3A 4N5NA 1P31A 2IIQA 1Y4ZA 2C9CA 2F55A 1B41A 3WHKA 2FY8A 2NXEA 4LOIA 4EDHA 1IZ8A 2JFHA 2RHMA 1GTJ1 2A9PA 1BX0A 4Z7JA 1A5AB 4G37A 3PJRA 2F8TA 4LQDA 4DNXA 3ULKA 3NH6A 3PQ8A 1A4IA 1Z4NA 2A9JA 4P35A 4U9HS 3CG0A 3KQMA 3OOSA 2OG2A 3OUUA 4S1VA 4Z4CA 1E0SA 2FKAA 2XUZA 1SCAA 2FPPA 3TQOA 4A2QA 1LEHA 3UMSA 3QV1A 3AB3A 5JQGA 4BBZA 3OURA 5E6SB 1Z4LA 4XFDA 2W8BB 2QL6A 3HWX1 5HYVA 1P80A 2VQ3A 3GLHB 4MVJA 3EPRA 3JTEA 2OY0A 2PYZA 3GRVA 3I9JA 4IIYA 4M99A 2RH5A 1P0PA 1G8GA 5K20A 1TJ5A 4QUBA 1ENZA 4DUZB 3I4CA 1IBKB 3GDOA 3QVOA 1WU7A 1FX0B 4FYKA 3EUWA 5CNJA 5C3MA 2WKWA 5FPKA 1VKZA 2FWIA 4HXFB 4ED9A 5JR3A 2QX8A 5U1PA 4AC9A 3OQOA 3N2LA 2C5FA 3JQ9A 4MYTA 3TLXA 1Y5RA 1Y3HA 4CTOA 3H6KA 3E3AA 1YCDA 2CE2X 3E1SA 1WM1A 2VBGA 2YX1A 3FD8A 2A4MA 5LZ4A 4M60A 3DYBA 1HKHA 4DSAA 1NUSA 3U7RA 1DINA 4GMHA 1TT5A 2GN0A 2VZ0A 1AD2A 3PZRA 3STTA 3UMCA 4UMFA 3RHFA 1Z2EA 2XB2A 1VKHA 2ACVA 4UNQA 5DISB 1PK9A 1UXOA 2G0AA 4D74A 2GK7A 4YUXA 3LBYA 1ULBA 2X22A 2BYTA 1AT1A 3KIPA 3WB0A 1CDEA 2D5LA 5CXSA 3GG2A 4NEHB 4X63A 4F9GA 3IUNA 5IPFA 1NI3A 1JUDA 1WXQA 3H2JA 4FGZA 2Q3LA 3GRAA 2WUWE 3CH6A 3D1LA 3IXQA 4MCAA 1KOLA 3K5IA 4IJ5A 2XNDD 3GI1A 3RFTA 5I9IA 4YMIA 5FLKA 3OE7D 1P9LA 2ZUDA 1FDOA 4XM0A 5EZYF 2P62A 3RAGA 2BMVA 3IHLA 2HA4A 4QT0A 4B46A 1BW9B 4BNMA 4L73A 1QGUA 2OFWA 5CB6A 3V48A 4GPBA 3RHZA 2QUZA 4YJKA 5LQRA 2GARA 2GXSA 4D57A 4DDMA 2BMDA 3H86A 3C3JA 3ED5A 1OFIA 1XWWA 1ND5A 1OXUA 4J90A 2X19A 4F1WA 2GBLA 3W4KA 1OWLA 2PGLA 4F2HA 4UHHA 3VNVA 5E38A 2XWQA 1W4AA 5EE9A 1O9HA 3I39X 2WD8A 2DUJA 2G36A 4LYAA 1YCHA 4HB0A 1PVDA 1O08A 2W6QA 4KL8S 4U5XA 5J58A 1FDSA 1JKJA 3OIFA 1SQSA 3PFGA 5EIXA 1ZIDA 2VYQA 5J4LA 2BOVA 4E46A 3CPEA 1OSNA 1DBSA 4DYDA 1O58A 2FWBA 4J1TA 4IZHA 3AC0A 4LSZA 4XSGA 3T4PA 1CY4A 1IEXA 1UJ2A 4OQMA 1WTAA 1FNCA 2VH2A 1BDBA 3ZJ5A 3T1YB 3A9CA 5TV2A 1KR5A 5K3BA 1D0SA 1TLFA 2FXVA 2OUIA 2OZLB 1Y34E 4IMPA 4DR5B 3TZ6A 5KKNB 2P75A 3E2MA 4BTVA 4EVRA 1K86A 4D96A 2L69A 1IM5A 4GLBA 5IT5A 5SZJA 5L3SB 3AVVA 1T5TA 1ZU5A 4MVJM 1DX6A 2CXHA 3EOAI 2DBVO 3G2NA 4CN8A 3L8HA 4INOA 9MHTA 2XMZA 1XCMA 5U4QA 4FFRA 2WHRA 1DJPA 1F2TA 1WJGA 2COKA 3A1EA 4MS3B 3DBHB 2BEUA 2GPSA 3PFHA 1RCTE 2IIVA 3I0MA 2NPFA 2C98A 1NNSA 1ZCFA 1P1CA 3KKPA 4XAQA 3UC9A 4UC0A 2ORYA 2O0HA 2PUJA 3O92A 2RD2A 3CKMA 2EZUA 2QNBA 3H6GA 3BB4A 2VPTA 1EPUA 2RK3A 2YXBA 2IYPA 1VE1A 3R24A 3JYLA 2GFIA 2GFHA 2X0EA 3ZDRA 2SBTA 3SVLA 5HRUA 4OA5A 2QQ5A 3JZFA 4UDOA 4EMUA 5L95A 1FY2A 4M3NA 1X3LA 1RRFA 1BN6A 3TRJA 1WDMA 1ZNYA 1EVJA 1U2SA 1G5QA 1F12A 5AK3A 5IEBA 3WYGA 5AW1A 4KEAA 2QTAA 1NF2A 1OLUB 2PCLA 4DLUA 4DRZA 3L8YA 1U6KA 3KKMA 5BN3A 1QE0A 4J29A 4MO9A 1AXGA 2H2AA 2FUCA 2HA0A 3ICOA 4IZ6A 4FONA 4KQXA 4RPGA 4UPDA 3FLEA 4AJOA 3GGGA 3U62A 3GLFA 4I1VA 4RULA 2B94A 4GPAA 5AYVA 2QENA 3LYLA 2O0JA 5HMMA 2I62A 1TM3E 3DGEC 4DUPA 4D81A 3ESXA 4TMVA 2QRVA 4OHYA 3CSUA 4AY4A 1WOYA 2CN1A 4FWIB 5DEOA 3K0KA 2FVXA 4V0RA 4ZQHA 4YCSA 3LRXA 3Q3JB 1YZLA 3GJQA 3VR6A 3I53A 3JQ9C 2B3DA 2GD0A 3L0PA 2Q2VA 1M2HA 3HCAA 3OEED 4DC0A 5BQ5A 5TIIA 3UH0A 1ZSYA 2CNWA 3E7FA 4W6ZA 1Q0HA 2PZKA 4L4ZA 4XWTA 3EAFA 3SP1A 4JJZA 4W5NA 1RVV1 5K6TA 1M1YA 2ACEA 2MSLA 1NVMB 1XD2A 1P74A 2B36A 2AH5A 2QSZA 2Y93A 2AI1A 4A1FA 1JQLB 3A0UA 4EPRA 1U3WA 1V48A 3A6GA 2BSXA 3HR7A 1ULAA 3KZCA 3BYZA 1KDYA 2B9EA 4ITUA 5J4VA 2OXTA 4IEIA 3BHIA 2A35A 2GN2A 5K8UA 4W8OA 3LXXA 2M32A 2IP4A 2AZMA 4DJFC 1Z2OX 3ILHA 3JS5A 4XX1A 1EFLA 5EYPB 2JLBA 2ZOSA 1GTSA 3VFDA 4DQDA 1L1EA 1K7YA 2WF7A 3DKIA 4IOKA 4XJXA 2VZLA 3CNQS 2POCA 3KQVA 4OQEA 5H1YA 2GF9A 4IGKA 1JSXA 3QXJA 6CHYA 5EC8A 1P6XA 1YL6A 4N0PA 5LLTA 5AJYA 4G6ZA 1P4JA 2EOAA 3A6DA 2ZTHA 2CT8A 1WBBA 3BN3A 3S0JA 3GLIE 2Q7DA 1M2VB 2OV3A 5L7TA 2GK3A 2OHVA 2PFGA 2GBLC 1XDGA 3ETGA 4XCXA 2PWAA 1NUQA 3K1AB 4HZIA 4PV7A 1KSGA 4UVIA 1HA3A 4DYHA 1J56A 1CIPA 2OZVA 4G23A 5AMXA 3CINA 4EY6A 1UH5A 4UUAA 1RBYA 2XD9A 1DBVO 1EXWA 3GUCA 4H18A 2XE6A 1GQYA 3KDSE 4JIMA 5CT5A 2PYIA 4MMZB 2I71A 3EEYA 3FPGA 3PQDA 2W2QA 2ZRNA 3GMSA 4J1TC 2FN4A 3P27A 5L53A 1XMSA 2CD7A 4M9ZA 2GZHA 1MQ9A 1LC0A 1NF9A 4FMCF 4KZPA 5F77A 2PD6A 4IH4A 3RREA 3LHIA 3WTCA 4AKSA 1IY8A 1T15A 2QYHA 4HVAA 2N1BA 4KX3A 2I6UA 1WMAA 1MF7A 3AGPA 4JC5A 4H0NA 3BEDA 4JLWA 3O4HA 1W1IA 5KCMA 1XMOB 4M9SA 3I9NA 2RFLA 1J33A 4QFCA 2CUZA 1ISJA 1J07A 2FU5C 1I13A 3II6X 2Z04A 3OJOA 3AETA 3NTVA 1A9XA 4ALIA 4RPHA 3DPSA 4OBXA 1A2QA 3W1VA 1T6YA 2R79A 4WZBA 2BH9A 4BVEA 3FTEA 2D4AA 4ZJZA 4CR7A 2QTHA 4ZOBA 1P18A 5F76A 5KWJA 4P33A 4KR3A 4ZVNA 4ZI7F 5AIAA 4OHRA 3SS8A 2X5NA 1RCUA 1KK3A 2QXYA 3DV0B 4YS6A 2Y6UA 4OFBA 2KWIA 3ZWDA 1H2XA 3SY8A 5FWXB 3ROXA 4E11A 5KYKA 1S89A 2FPXA 2W2PA 1BAPA 1PP4A 1KFBB 1RZ3A 2EDCA 5K4AA 3DEHA 4J0DA 5BR1A 2IOHA 2GYUA 3AI7A 3QIAA 1LVHA 4G86A 1ZXLA 1L1FA 5KTYA 2F48A 1JDBB 5KB3A 4A8TA 1W93A 2PFSA 1L1QA 1TUBB 1KOFA 1THMA 3DO8A 4KV7A 3ND6A 5FL7D 3H3FA 3DE7X 4AZ0B 1FVHA 1W88B 3IKTA 5ELMA 1Y1QA 4NOLA 2HLNA 2ZSAA 2VNSA 2AE1A 4TS3A 4PWYA 4AY2A 2Q8PA 3UHJA 1YDWA 5EUCA 3ZHRA 4R3UC 5LM3A 4QOIA 2O5RA 2X23A 3ELBA 3T3EA 1LK7A 1VC2A 1LCIA 2TECE 4I4IA 4NNPA 2QYTA 5LNK1 5A5VA 3ZWYA 4MV9A 2PVCA 2QPTA 3LFUA 3VHQA 3G3EA 2UZ4A 1N3BA 2ID8A 3IIEA 1FLVA 1ZOLA 3K0EA 3Q2KA 3ZHVA 3IR7A 2Q5OA 2Z3VA 2D5BA 3LRTA 2OBMA 1T0UA 3IUBA 3UXMA 5IKOA 5BRJA 4OXXA 9LDTA 5A4JA 2XA1A 2E0IA 4U7PB 1VHJA 2GOYA 4EBBA 3Q2OA 3BAZA 1LV8A 2Y9MB 2ONYA 4L57A 4ZANA 3WGMA 1GU1A 1OOEA 2IXEA 1NMQA 2Y6VA 5ER6A 4W7IA 3LKZA 5CDFE 4FD2A 3V7WA 2OHJA 3QU7A 1KS9A 5K8JB 2CXQA 3PX3A 4V0KA 1L3BA 2AXEA 1HDCA 2QRLA 3DOHA 5K03A 3THYA 4C6TA 3FYUB 3HVRA 1N5IA 3L7AA 5HQ3B 2XRZA 3Q5EA 1INLA 1O7JA 1OVMA 2O23A 3HKCA 4CM5A 4W82A 3ND9A 1S2DA 5MN5A 1E96A 1XTTA 3NHKA 1KNXA 1UMDA 4L07A 3NMUF 3AHDA 3QI2A 4J6EA 5HKKD 2EZ4A 4B83A 3AEUA 4HZUA 5G0VA 3OTQA 3OZAA 3C6YA 3FSEA 2CDRA 4OXKA 4Y8VA 2HIGA 3BEOA 3O3OB 3I34X 1J49A 3IL2A 1EFKA 1ETHA 2OT3B 4FOSA 2AR0A 3AY3A 3ZHQA 3B53X 3NRBA 4DIBA 4MTLA 1C4WA 5TDHA 3W05A 2SCUB 4IDAA 3UB2A 1IZ9A 1CFZA 4FUTA 1ZICA 4US0R 2EP7A 4MK4A 5CW1A 4TZ0A 2H7YA 1GVHA 5DH9A 2FFAA 5AI5A 1T6BY 1ORIA 3DQPA 1VG0B 3GZ4A 2QTCA 4LZNA 4Q1FA 4RFSA 2A8YA 2IOYA 3W3AD 4CUKA 4D41A 4HLDA 4E13A 4I4NA 3H2IA 5ALMA 2O7SA 3K96A 3A1FA 3MFQA 4AQDA 4URUR 4A73A 1QCDA 1DQYA 4PAGA 3OO0A 1EJ0A 1ONOA 4CI0B 1DTWB 3CPHA 1DEAA 2P5SA 2PGOA 5KHAA 5AKLA 1YKSA 1C3LA 3LX8A 4OXYA 4EG7A 4POOA 1QU3A 1Z4OA 1SULA 5HZMA 2ZWAA 4XLZA 2CC2A 2CKDA 4LZWA 2YJ6A 3E9MA 2D2IA 5BUSA 1E60A 2Q1SA 4H3SA 4NMXB 4YROA 2CHUA 1GPKA 1R0SA 2NZVG 3D7LA 3ONEA 2ZSUA 3DZHA 4O8ZA 1U0SY 2BSQA 1MA3A 3PTLA 3V6LA 4EIWA 4QVKA 4AN4A 1J1ZA 1CUJA 1QORA 2GD6A 1XE3A 2EGGA 3OJLA 3PUHA 1F60A 4NCIA 3KK0A 1DIGA 1L5FA 3ZUGA 4NENB 1OH6A 4Y2HA 2ODQA 5J23A 5K8CA 4AS1A 2ZR7A 2R4UA 1N92A 2P4QA 4YDHB 4BQQA 2JFZA 4W1SA 1KA9H 2XI4A 3P1JA 1KE2A 4AJIA 1K6JA 2JAHA 5LL6P 3C4VA 1TK3A 3DTVA 1FYDA 2ESRA 5LYJF 3I76A 1IEWA 3T1HB 2YWXA 4CCYA 1BCRA 1U65A 1JAXA 2CVQA 5F4ZA 4ARZB 3S7ZA 5C18A 1D5WA 3OIWA 2GAOA 4H7HA 2C7BA 2E4XA 2AFIB 2YQ4A 3LUBA 2GDJA 3HDTA 3SLGA 2GHTA 3EGOA 3R6LA 3RYHB 3T3MB 3UW3A 3E4CA 3W8EA 2MDTA 2BFFA 5ITZB 4IF4A 5DX8A 4Z5XA 3HN2A 4QJBA 4M0FA 1BZYA 3U44B 1TCVA 1UMBB 4DQKA 2NP7A 2AN4A 3MJSA 2EEPA 1H1LA 1EFPB 4TKUA 4TTQA 2YVLA 3R6GA 3VPDA 3P0FA 1Y1PA 2E5FA 4XDGA 3FUWA 3X1ZA 2XDYA 1EWTA 4P5PA 1PWXA 1TU0A 3ANTA 3LUDA 5D87A 4LFBB 1P0FA 1TVEA 4M1MA 5D01A 4HYQA 2FZEA 3K09A 4ASUA 3RYFA 1WUJS 4DXDA 4XQEA 3BE8A 2X5JO 1HEIA 2LPMA 3U4IA 3AQ4A 3V2IA 4BMXA 3E1GA 5F2OA 5HM8A 4KTVE 3AKDA 3ZE9A 1H22A 3HBFA 4DJEC 1H8ED 1ICEA 3CT6A 3IT2A 4WXRA 3NBFA 4BL5A 4JU8A 4JGGA 4RZSA 2EW1A 1JDPA 4ZYVA 3EN0A 4TTTS 2O1WA 3QPDA 2OGSA 4FXPA 3U39A 3UFXA 2DR3A 4LJRA 4MKFA 5CR9A 3WL6A 2R7LA 1KYZA 2CVHA 5JD6A 3SFZA 1MX1A 3GLVA 5KQPA 5JAOA 3ND5A 1YV9A 3WWEA 1YIDA 1AZWA 1TEZA 3CZCA 3OF5A 1HORA 4JMLA 5CLJA 3KLOA 4IOMA 5HK9A 1Z0JA 5AK4A 1Y98A 3HABA 2E5WA 1CRLA 2L17A 3F2IA 2I4OA 3KT8A 3OP1A 3DW3X 4KFUA 2QAGA 3NR2A 4PYKA 4O5AA 2Q7OE 4TKZA 3RIEA 1HT0A 4RGBA 4DYVA 1OGJA 1DDGA 2W93A 1DC6A 2AJDA 1ISRA 2HIHA 4WFIA 4BLTA 2AJTA 2YV2A 1NQXA 5EMKA 3BBLA 5TB5A 5ECGC 2WUVA 2WE8A 5KVQA 5G3ZA 3VDMA 2CLKB 5EGSA 3REQB 2EL9A 2WM2A 4AJ4A 1QHHA 2Z4TA 1GT6A 2QZ4A 3PSAA 3T3GA 4RD4A 2O8EA 4NXMB 2C7OA 3SYKA 1MNQA 2HZBA 3GT3A 4NDZA 2YWRA 4N65A 1ZRSA 1H4QA 2Q3MA 3EYWA 4HJXA 2IC5A 3DZBA 3ANLA 3T8YA 3MS2A 1MD9A 5EXDA 4CCWA 5JS2A 1EINA 1HE2A 4XVHA 4KBYA 2W58A 2ZEJA 1BIFA 2CLSA 1P7VA 3F3KA 2C2BA 2SNIE 3QHAA 5EHXA 1T1IA 1RI1A 1XA4A 3BQMB 4U7GA 2XNHA 1IEVA 4Q4HA 1SOWA 5EEHA 4GDFA 2ISQA 4IDHA 1I80A 1NRWA 4QDOA 3FNHA 1TMYA 1GTMA 2HWXA 1W4BA 3MJTA 3KAJA 4MI6A 5C52B 3HYLA 4JDUA 5IKPA 1DKOA 2DGDA 4TWBA 5FBQB 3CJTA 5JROA 1GGNA 4WL0A 5JNUA 1W85A 5JI2E 2HSGA 4IQFA 1G55A 3K0HA 1UBHS 1DAIA 1E6LA 1FTGA 1GILA 4IXNA 4M7OA 1BJTA 1P81A 5E4TA 3LPNA 5A9TA 1AMUA 4ER6A 2JGJA 8ATCA 1YI0A 1JSCA 2AHRA 1LI7A 3IURA 1PJ8A 2D4HA 3K4HA 4ZO7A 1DQRA 1VMDA 3DVLA 4DILA 4QU5A 2VRBA 3A4YA 4O08A 1Y80A 2X4IA 5AHXA 5AXCA 4DJ5X 1I3CA 1LPOA 5IS2A 2QAIA 4PYMA 4L9AA 5FLEX 3X0DA 1QUEA 2HTEA 3OLZA 4JKOA 1T9BA 3P9SA 1FTWA 2BTOA 4WEQA 1O77A 3E8SA 1QANA 3N7UA 4WRRA 1QPZA 3MWEB 4AUMA 5DN9A 2NUAB 3FR8A 4K28A 3QQPA 1IBLB 4JR1A 2IXBA 3WLIA 4J3NA 1QP8A 2JA2A 7MDHA 3DWEX 1KEEB 1N6NA 1RKBA 5EZ5A 1CSEE 1ODFA 4I08A 4OYYA 3PDIA 3AEKA 2IIPA 3GOHA 3O9ZA 4CR8A 4BO9A 1E5DA 4C0LA 4G5HA 1L4LA 4C5AA 4DXHA 2ORED 5JATA 3GZTB 5GONB 1WETA 1DQZA 1EQAA 3TQQA 1VCMA 4JP5A 2I6FA 2M6SA 2C1ZA 3F5MA 4RPIA 5DVZA 3RS7A 4H4DA 3UAZA 3S4YA 4F5WA 2ZBPA 1ZS9A 1R4MB 2BBTA 4X3PA 5CAEA 3WBFA 2Q5CA 1X7DA 4W7HA 4YNBA 6REQB 2H5LA 2ILTA 1Y82A 3VO8A 3MGAA 5LZ5A 5KWEA 1PN3A 1Y4DE 4OXIA 1WHTB 2PY6A 3CZ9A 3FI0A 2VWPA 4IJQA 4N5HX 3RB8A 5J43A 1ZOSA 2CFIA 2RGCA 3M9WA 1AUQA 3K09C 1EZ1A 3CZPA 3UV7A 4D6PA 3GZJA 3NBYC 1AQUA 1ORHA 3CRZA 4IJKA 4D9FA 4OX9B 1FXWF 3EPPA 4YMVA 4HR7A 3QHQA 1WCV1 4OEHA 4JR0A 4Y2XA 4QGBA 2PGJA 5BQFA 1MJ5A 5JD5A 3NWOA 1LF5A 4E6EA 4JVLA 2Z83A 3TJRA 4AZVA 3FCAA 3PVZA 1Z34A 2ZQ5A 3QPUA 1HUQA 2IXDA 4LXHA 4ARBA 4EHHA 5IXSA 3U3KA 4LRXA 5DFAA 4J7XA 1C3JA 1UKYA 2CEKA 3PUIA 1RTKA 4LVUA 5IJ9A 3NAQA 4IL5A 1Q0SA 3DE3X 4MHOA 4BNDA 4ZO4A 2YZNA 3S2EA 2FSFA 3R1IA 3CFYA 1MOPA 3IXLA 3NEAA 3VU8A 4C87A 1QBKC 3PCXA 1KU0A 3ZGLA 3L7CA 5ALLA 2ZWVA 1OH8A 4EW6A 4F06A 1AQ6A 3TS1A 4RJKA 2QAGC 3D02A 1UJMA 3DO5A 4INPA 3SF8B 1MO3A 3WJ7A 5HR5A 5G0SA 4EFMA 5AVOA 1OZAA 3ZGNA 4G5OA 1OR8A 1D6SA 2IZOA 4RQTA 2Z1NA 4HPXB 4BFVA 4DLTA 3GVHA 1GTZA 3HYCA 2MHCA 3ORFA 2G07A 3PR2B 4HV4A 1G18A 4UBOA 4ZC8A 1IHDA 1N0VC 3EZ9A 3VYSB 1Z29A 2UKDA 1G6KA 4OSEA 2FSSA 5I7FA 3G7NA 3ZW7A 5JNVA 4R1NA 5F9MA 5BOVA 1T6XA 4A4DA 4BP3A 4Z6KA 1Z35A 2QX4A 4DY4A 4DV5B 1VHDA 3NT4A 4GOND 2V8OA 1T4DA 2I3ZA 2D1TA 3F5FA 4IY1A 4B3XA 4BYGA 2N46A 3OEWA 1LTKA 2H18A 3HCEA 4K26A 2F4VB 4IOLA 2VUUA 3AVTA 2O8CA 2VHQA 5EINA 3OOYA 1D4AA 1W1UA 3LXMA 2PUBA 1GGMA 1K63A 1R0YA 3I09A 4FFBA 3NH9A 4KO2S 4NMHA 4XWGA 2X1LA 5AKXA 3RG8A 1NVAA 4RCVA 5IM5A 1V11B 3HI4A 5CDSA 2QN8A 1G60A 3NBMA 3KLNA 3VDRA 3ZWPA 3GLUA 1YD7A 1T13A 5CTAA 1YOBA 4UPVA 1ISMA 2CVFA 1PJZA 2IF0A 4ZI5A 2B92A 4MUEA 2GHIA 3OCXA 2AXPA 1LC3A 3LP5A 4BNUA 4Q4DA 4QOEA 3FPLA 4NE9A 2JB9A 4JJ8A 5HCUA 4YRCA 3C6KA 3PIIA 3FSRA 1V26A 1MB3A 2P8SA 1XD9A 2QN7A 4PPGA 3SHTA 421PA 4EG6A 4K2HA 4D0SA 1V7CA 3HBJA 4X7PA 1MBZA 3AP3A 1XNGA 1Z2PX 3DVAA 2C5HA 4JLJA 4F4UA 4QYIA 1U3FA 4HAYA 4PPYA 4YP1A 2GGSA 3S44A 1QC5B 1JDNA 1RTTA 1CQIA 3ETEA 3WGIA 2Q5EA 2CXRA 3LMKA 1N9GA 3EGXA 3OX2A 3F9IA 3ITEA 1EDOA 4JKIA 4UBNA 5EL0A 4LYFA 5AVWA 1KTVA 2XYGA 4RPCA 3SX4A 4Q1EA 4DLZA 2BKVA 1HETA 2XR1A 1DIRA 4S1OA 1TGYA 4FX2A 3TLAA 1IN5A 3EAGA 4FI3C 3KVYA 3OE5A 3GA0A 4Q4AB 3BILA 4BFCA 3ANNA 5DGHA 4EZEA 2HSZA 2CYBA 2IYEA 2QX9A 3CY6A 2EBHX 3EF3A 5BV7A 3T7IA 3W34A 1KEWA 3B2NA 3PGVA 1K5GA 1Z13A 3ZDZB 1P19A 2EC5A 4U9UA 1E3DA 4RHUA 3UGTA 5IMBA 4AB1A 1JHYA 2H54A 3PS9A 4LJ6A 2BCJQ 5SYMA 1BE0A 4DE5A 2XQGA 4HWSA 2TMGA 3OQBA 1I32A 3X1XA 3QPVA 1E4OA 4CU5A 1ODLA 1TIBA 3GLGE 2X6RA 4TS9A 4AK9A 1GDTA 3IA2A 4P98A 4ZQGA 1MG0A 1P1FA 3CT4A 4C01A 1U3TA 2DLNA 2PXCA 5DJ5A 5ECYA 1BQEA 1HYBA 1JB9A 1ZCJA 3S1SA 2NZXA 1M34A 2P11A 3LBHA 3H5TA 1DOZA 2GASA 1HFKA 4JI0B 3AJRA 1U2GA 1KQGA 3LOUA 3P7MA 2GCIA 3F3MA 4OYRA 5DBHX 3UT6A 3VR6D 1W87A 3EJWA 2HTFA 3SC6A 1SBCA 5CUQA 1JTFA 4BB5A 2NSDA 3A05A 3SC2B 4G26A 2CNWD 4PO1A 4ZVQA 1QDEA 3VPXA 2Z6QA 1NC1A 1V2HE 2XW6A 4UD6A 5CT4A 2DH6A 3P71T 1BVRA 1JNYA 4C89A 3JAWB 4PRKA 3GYGA 3M83A 4DLSA 1QQBA 3RSSA 1JIVA 3GQVA 2HIMA 4H4EA 4TSFA 2OWDA 1UBRS 1A9YA 5DX1A 5HQTA 1ELOA 3I5UA 5FWYB 2BD0A 3K9GA 2PWYA 3WSWA 1IB6A 2Z2XA 1XRNA 5AKJA 3KJHA 2J6HA 4JBWA 3OFND 2GAAA 4XQ0A 5DNVA 3R0JA 3VYWA 4NFYA 3HCBA 1I7QB 4LQ4A 1KFKB 1MW8X 1MU0A 2OORC 4J0QA 1FIUA 4C5CA 2LKCA 4PN3A 4UQOA 4OUKX 4V0QA 2FMFA 4OBEA 4QVGA 4YLGA 5LA6A 3JWIA 4PZZA 4B6GA 3A7DA 4XM2A 2R8YA 4DUGA 1HPLA 1KFCB 4OHOA 5LDDC 3CF0A 3TOVA 2HPAA 1F1JA 5CX1B 4RSRA 3REFA 1DU4A 3T38A 2OXEA 4G25A 4D8WA 2X15A 1VG1A 9LDBA 5AKKA 1JIXA 4G1EB 4N5LA 1I5OA 3A70A 3EH2A 1JQ3A 4JL5A 4C7BA 4HUTA 5BRAA 3L0OA 4KXWA 4FB4A 1GG9A 3C4JA 2C84A 5FOVA 3W4IA 5IVPA 4HXYA 3RU3A 4KNVA 2Y2UA 3VC7A 3D1VA 3F0TA 1TCCA 2QMUA 3GJ4A 4EB3A 2ZRJA 3WHIA 4TLEA 3GFVA 3QP9A 3HPQA 3H5IA 2R2AA 4I55B 1N0WA 5LQAA 2PE5A 5U4XA 2H4WA 5JHHB 4D45A 4ZT2A 1OB5A 1OZ0A 2VPZA 1RHJA 2IYSA 3FFTA 4JZYA 1WX1A 2QMOA 4YR9A 1NLYA 4CKCA 1IN4A 4UREA 3LK6A 4BKRA 2PNFA 3B6EA 5HJ2A 4FZVA 2AG1A 2XMRA 1U31A 2CSUA 5CIYA 2RK4A 1GV0A 1VDZA 5LQKA 5EE1A 4N76A 4OXNA 1BQ3A 1TX4B 4DIOA 1YVRA 3HYRA 2R1UA 5G4LA 1ZD8A 2C3MA 3VH4A 3PJFA 5A0VA 3NU1A 4P81A 5FT9A 4IXMA 2L2QA 4RPJA 5THQA 3USZA 1YB4A 1YI8A 3IBYA 3OCZA 3OCYA 4GSLA 5EFOA 1KAOA 3ZGXA 1TB4A 3O2JA 3IBGA 3OICA 4B79A 1NI5A 5HILA 1MC4A 4Y6SA 2ZIFA 3EGDA 2P2CA 3W9SA 2QGZA 2WWWA 4ROSA 1WDKA 2HHAA 4LFCB 1S6YA 2BHNA 4RD6A 3SIXA 2NVWA 3P9YA 4LDAA 5I9LA 5JFTA 1RXWA 2UXBB 3VRHA 3NHLA 4Q39A 4CKBB 5IRCD 1T8RA 3H1BA 5CNKA 3G2IA 5TVKA 1CUBA 4TSRA 4BU1A 4F3NA 1QB8A 3QLVC 3ZV4A 2I7DA 8ADHA 3ZU2A 5H70A 3NP9A 3DHVA 3H05A 3N9IA 4L27A 3NNSA 2ZUFA 2GCGA 4Q16A 3LU1A 5F7XA 1X8KA 4GLJA 3ZDBA 1GADO 3V4PB 3LYUA 5JZ9A 3IAXA 4C6HA 2Q9BA 2VUTA 1YR6A 4DM4A 2OECA 1FX0A 4HDSB 3N53A 2YRFA 4IP0A 2WIDA 1P2UA 2QMZA 2IXAA 2ZYDA 4KMMA 1OH7A 1EJBA 1YDGA 3EFHA 3VR4H 3EMVA 3VVCA 3AERB 1FRQA 8MHTA 2QL9A 3X2SA 2GZDA 4U63A 3UHAA 2BY4A 3ER8A 1AUPA 3T54A 4WX2B 5BWOA 3T5GA 3E8XA 3SSNA 3JYQA 1KGSA 1QKKA 1BE8A 2P1RA 4L8FA 3KTOA 2J3JA 3JALA 3ASYA 3M6WA 5M7EA