2P4HX

Crystal structure of vestitone reductase from alfalfa (medicago sativa l.)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
310
Chain Sequence
b'KGRVCVTGGTGFLGSWIIKSLLENGYSVNTTIRADRDVSFLTNLPGASEKLHFFNADLSNPDSFAAAIEGCVGIFHTASPIEIVTKRTVDGALGILKACVNSKTVKRFIYTSSGSAVSFNGKDKDVLDESDWSDVDLLRSVKPFGWNYAVSKTLAEKAVLEFGEQNGIDVVTLILPFIVGRFVCPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDELKEIKGARLPDLNTKKLVDAGFDFKYTIEDMFDDAIQCCKEKGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vestitone reductase
molecule tags Plant protein
source organism Medicago sativa
publication title Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.).
pubmed doi rcsb
total genus 108
structure length 310
sequence length 322
ec nomenclature ec 1.1.1.348: (3R)-2'-hydroxyisoflavanone reductase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2p4hX00
5DP2A 3I6IA 1BXZA 3F9IA 2P4HX 1ZK2A 4XA8A 1GYPA 1UP6A 1EZ4A 4NJMB 2I76A 4LRSB 3TJRA 1LC3A 1WAMA 3KSUA 4U0JA 5A9SB 3H2SA 2O3TA 1I24A 4P38A 1N1GA 3S55A 2QYSA 4IGFA 2NACA 5TT1A 1U3UA 5K9ZA 1Z82A 2CZCA 4HX5A 3VZPA 4E5PA 3H6KA 1WWKA 4L74A 4AJIA 1D3AA 3H3JA 3QP9A 4TSKA 4XCVA 1NQ5A 2B37A 4WPGA 1R4MB 1E7SA 1X7GA 4BNNA 3L4BA 4P8RA 4L0QA 2PH3A 3MZ0A 4D7AA 1TXGA 1ZBQA 4B79A 1F12A 3QLJA 4PG8A 1WDMA 2VN8A 3C1TA 4FDAA 3ZHYA 3EC7A 4DYDA 3OEYA 1QSGA 2CDCA 4MIOA 1HDRA 2NVWA 4XYEA 1MA0A 4BNWA 4F45A 4N7RA 1DC5A 3HG7A 3PHLA 3WLFA 5BQFA 4Y9DA 5CDTA 3MOGA 1U3TA 3RSHA 4DMLA 3DR3A 1Y9EA 3DAGA 1TB4A 5A4DA 3DZBA 3ZWYA 1NPTO 5EESA 3ZU4A 3F5SA 4E5YA 1DIRA 2C29D 1KEVA 4HFNA 2VWGA 1D4FA 4S3MA 4HFJA 4R69A 4P4GA 4BL5A 4CR8A 2RH8A 4J16A 4CL3A 3ZNQA 5DCWA 4LW8A 1DEHA 4P4LA 1C0LA 1DIAA 4NI5A 4YAIA 1LSJA 4HNHA 3JQ8A 5GMOA 3RIHA 4MVJI 3G17A 4BGIA 1P45A 4CR6A 2OP0A 2HUNA 4TMFA 4CM9A 3D1LA 5I8ZA 4E33A 3ZWVA 4FN4A 1SPXA 4OMUA 3C8MA 4R16A 4U7WA 3MCVA 1B3BA 1ZO8A 5DBFA 2Q2WA 4C7JA 3QIVA 3PIIA 4I9HA 1AHHA 3PHJA 3L0DA 3EW7A 1UR5A 4I5DA 3WX0A 1I3LA 1WVGA 1JW9B 1LSSA 2JCVA 3ROQA 4EITA 4JQCA 3OJEA 1T26A 3ABIA 2YQ5A 5B4UA 3NJ4A 2E49A 3A28A 4GH5A 5H83A 3ZV5A 4B4OA 1XU7A 4MPDA 4XX0A 2C54A 5L7WA 1IPFA 1OZAA 1HE5A 5ER9A 4YAKA 3RVDA 3CUKA 4CQMA 5C37A 5TX7A 2BHLA 4WCFA 3DZIA 1PWZA 3EGOA 4DTIA 4DIBA 3HSKA 2P4QA 4B8ZA 1P1JA 5I9MA 4ZHSA 1GCUA 3QRWA 2LDBA 4WOJA 3FR8A 3L4BC 3RUHA 3ROMA 1OC4A 2QIOA 1VJTA 2FPPA 3EYWA 4NBVA 3TOXA 3PGXA 1O89A 3PP8A 2X23A 3BMQB 4ROSA 4GI2A 3C7AA 1PS0A 2VYVD 1VL0A 1T1RA 1BGVA 3CEAA 1ONOA 3SXPA 4KQWA 3RJ9A 5T67A 2YZ7A 3ZWOA 4CR7A 2BGLA 1N9GA 2Q4EA 2H6EA 2Q99A 5T6BA 2IXAA 3F46A 4Z9FA 3HDHA 5G0UA 4CMIA 1YS4A 2PZMA 4XGIA 1HTBA 3ZU5A 1BRMA 1M66A 1AGNA 4W99A 4GWGA 5JMWA 3OIGA 3GVXA 1F8GA 2HMSA 3BHIA 4B7XA 1GPDG 4J43A 4NK4A 1D1TA 4RCVA 3GGGA 3SLKA 1OI7A 1NYTA 2O2SA 5AXBA 4LVCA 4IM7A 2C2YA 4YT4A 3F47A 1ZNQO 1PZHA 2CVQA 3DOCA 4UUPA 2DBVO 3WICA 5KVVA 4DREA 2WD7A 2AE1A 4XJTA 5JPIA 3GHHA 4DA9A 2DFVA 2E6UX 3VDQA 3QWHA 1AUPA 2XXBA 2CFCA 4S1VA 1JAXA 1UH5A 5THKA 1XDWA 2BGKA 4B4WA 2X6TA 1MC5A 3B1KA 1E5LA 2PD6A 4ZICA 3GG2A 3FR7A 4GMFA 3ULKA 3PXXA 1H2HA 4J2OA 3DMTA 4BGEA 8ADHA 1C1XA 4INAA 5L9AA 3S2FA 4EI2A 1YE3A 1T2EA 3IP1A 1VKNA 4H3VA 4KWIA 4MVJA 4Z0TA 5IDQA 5G2OA 4TKMA 3WSVA 4CLOB 2AG8A 5A5FA 4OOEA 1X0XA 4FC6A 1NWHA 2EKLA 3L4SO 1O0SA 3ETGA 3DBHB 4EUHA 3VPHA 3OM9A 4CMIB 2OGUA 1GUFA 2YV1A 1H9AA 1XSEA 3TZCA 5FF9A 4AG3A 5JSFA 4J9UE 4UVGA 3K30A 4FIZA 4I8XA 3H3FA 4JBHA 4K28A 2IXBA 2RH4A 4QTZA 4OSOA 4J90A 2VUTA 3RJ5A 5A9RA 5B4TA 4DLBA 1O9BA 5EQDA 4RL6A 4TKLA 4B8WA 4J7CA 1KYQA 3UKOA 4NZ9A 3KLPX 1GUYA 3Q11A 3DL2A 4JN6B 1DHTA 2VWQA 2EXXA 3RAJA 1P9LA 3A06A 2VTDA 1YL6A 3MJVA 4W9NC 3AUUA 4Q3NA 4YRBA 4A2CA 3LVFO 3LU1A 1PJQA 1T4DA 1J5PA 4CQMB 1I2BA 1GZ6A 1QYDA 2CNBA 1LTHR 2FPIA 4UEKA 2VNSA 7MDHA 2Y0DA 1NHWA 1R4NB 2FY8A 1N7HA 4W7HA 8LDHA 3VKUA 1P77A 1V3VA 4FGSA 4UREA 4MKXA 2J5KA 1WNTA 5L3ZA 4CM1A 3K31A 2Y1FA 3PYXA 3GVPA 3AJRA 2VTEA 4FFOA 1RM0A 3AI2A 3D0OA 3DBHA 1ISHA 4M87A 1ISGA 5L4NA 4BNMA 2EW8A 1DOHA 1HDZA 5KVQA 3UN1A 2GZ1A 3ZU3A 2CMDA 2OBYA 2HK8A 3B20A 4I08A 4ZRNA 5JLAA 5TSDA 2QRKA 4CM7A 2P2SA 1M75A 1VM6A 1AXEA 1Y6JA 1PQUA 1R16A 4MKZA 4OQYA 4M8SA 3LT0A 3N74A 4E4YA 1DJNA 4B4UA 4UUNA 5K6AA 1B0AA 4UUOA 1NFQA 3JQCA 2X8LA 1VJ1A 3SJ7A 5DF1A 4C7KA 5EPOA 2UV8A 4IJKA 4W9NA 3UVEA 4EUFA 3GK3A 1ZK1A 3TL2A 3P2YA 1FDUA 1K3TA 2VQ3A 1X7HA 4Q3AA 4E13A 4Y6SA 3AOEA 3DZKA 4PLWA 1BDBA 5EQFA 1KEPA 5G4KB 2D0IA 1LLCA 1NQAO 1ARZA 5EL0A 4XIYA 2AQHA 2CF5A 4BMSA 4J9VA 2ZYGA 3H9UA 4E5KA 5U1PA 2B5WA 1PL7A 1SO8A 1U5AA 2ZTLA 2Q3EA 1JKFA 1ORRA 3E1KA 1HDCA 1HZJA 1I8TA 5ILGA 5F1PA 1ULSA 2X0IA 3C24A 3NTRA 2DKNA 3WGOA 1LLQA 3DZJA 1IOLA 3IUPA 1XR3A 3FI9A 3HQ4O 4PVDA 3WB9A 4DRYA 3U5TA 2RHRA 1Y81A 2GUGA 5C7IO 2Y1DA 3M2PA 2J6IA 1N7GA 2XOXA 3JD3A 4H15A 2DPHA 3JQAB 1IHXA 3JQ7A 4XJSA 4E12A 3A4VA 4CV1A 4DL9A 2ZK7A 2BFOA 2C82A 4II2A 3DBRB 3DONA 5CEJA 1RPNA 4GWKA 4XYLA 4G81A 5FEUA 2QYTA 1EMDA 2ET6A 5JCXA 5DOZA 2VOJA 5KOIA 2Q46A 2GN9A 1H5QA 3TZHA 1DXYA 3KO8A 3DTTA 5K6AC 4FSHA 1QYCA 3G0OA 4DWVA 1LDMA 2NV6A 4BNUA 4RJTA 3ANNA 3WNQA 1OC2A 3PDUA 4WECA 3VKVA 1GEEA 1E5QA 2ZKLA 3Q0EA 5ENDA 3UCFA 5CEEA 3EZLA 1A9ZA 1DDOA 3BTVA 1H9BA 1PSDA 3I6QA 1JKIA 4KMSA 3SC4A 2FHSA 4IZIA 4OAQA 4ALJA 5A5EA 1N5DA 5B4VA 2GPTA 2O50A 2NVBA 3I9JA 1WMAA 2BFPA 2D5CA 1U8FO 3RUDA 1KVRA 1P0FA 3ZW8A 3COSA 4OXKA 3ASVA 2H9IA 4PLGA 5JDIA 1PWXA 4F6LA 1NPYA 4IXTA 4ZQBA 2XAAA 1PR3A 1A27A 3HDYA 4ONEA 4JXKA 4M49A 4D3SA 1I5RA 1KC3A 4XQEA 2FPGA 5AYVA 4B3JA 1X0VA 3AUAA 3ZI0A 4G2NA 1BHSA 5JY6A 4J1QA 2BKAA 1M6HA 1PJSA 1F06A 1Q0LA 1X15A 1ZMTA 5JDCC 4BO3A 5HRUA 4AJKA 1XA0A 4E32A 3C7CB 3PWZA 2I3AA 2FZEA 2ZJ0A 3AY7A 4WLNA 2QG4A 4GQAA 5A04A 5JAMA 1FDVA 3RU7A 3JQFC 3LQFA 2NQ8A 1IULA 5H81A 4AJHA 1R12A 4BOYA 4J4HA 3VH3A 1NQOA 4PLCA 1SEPA 4OM8A 4D45A 2UAGA 2IZ0A 3HFSA 5IN4A 5HA5A 3PWKA 2VUUA 2PV7A 2NTNA 3JQ9A 4PG5A 3ITDA 4XIJA 3V1TC 4GKVA 3PRJA 4RPLA 2W2LD 4EUEA 4RVDA 3WQSB 5HM8A 1EQ2A 4R9RA 1ENOA 1IL0A 3FN4A 3HUDA 1GZ3A 1ZEMA 4I5FA 2CVZA 4YJFB 1C14A 1X13A 1I0ZA 3B1JA 4IDCA 3JYPA 1Y1PA 1EE9A 4HADA 4YT5A 3MJTA 1O6ZA 1A7AA 1TLTA 1B16A 1MFZA 4AJLA 3D64A 3PPIA 1MUUA 1BVUA 3N58A 4A27A 1M67A 2Y0EA 1EK5A 4L9RA 4TQGA 1ZK0A 2C07A 2EIHA 3GAZA 3LT2A 1IPEA 5THQA 2P68A 5IXSA 4PFJA 5AQ1A 3FSRA 1T24A 1DB3A 4DYVA 1ULUA 3TPCA 1SC6A 1YO6A 1LBEA 3B70A 3C85A 3LDHA 4FOOA 3RD5A 4CMJA 3PTZA 1C1XB 4XQGA 4EJMA 3INRA 2NUAA 3PLRA 1MXHA 1E7MA 1ISJA 2YY7A 4AJJA 4L73A 4IJVA 4J1TA 2ZTUA 2OZPA 1MB4A 4CUZA 2J3JA 5JCJD 1T25A 1EVZA 1GEGA 4AJPA 3DXFA 4LGVA 2AG5A 3JQAD 4YA6A 2IZZA 1VC2A 5COBA 3RUCA 4YR9A 3GEMA 4FOSA 5IG2A 3UFXA 3MJ4A 5JMPA 4QQRA 5IJZA 1K6JA 4YXFA 4I9UA 3FPCA 2DQ4A 3U3XA 4G65A 1E3EA 4YJHB 4BO8A 4TZTA 5CP8A 2O48X 3E9MA 4IDDA 5LDHA 4BVAA 4YQYA 1UUFA 4MP6A 4BIIA 1PGPA 3DAFA 3IL2A 3AM4A 2FN7A 1UDAA 2JHFA 2ZJ1A 1X7DA 2DBQA 2H63A 2ILTA 5ICSA 2YFQA 1G0OA 4HXYA 3TSCA 2UYYA 2HCTA 1U8XX 1P1FA 1QV6A 2HJRA 3VDRA 3HJAA 2DPGA 4GBJA 4R5HA 1O94A 4QUKA 2R6JA 2X4GA 2PZKA 1PEDA 4WJZA 4K9DA 3MWDB 1KVSA 4ZU3A 1OMOA 1V3TA 1RM3A 4ZRMA 2Z1NA 4AFNA 3BMQA 3LSYA 1PZGA 6LDHA 1DLIA 3NGLA 4PLVA 2G17A 4L75A 2BI7A 4HBGA 3W6UA 3L9WA 4QXMA 4CM8B 4DPMA 4PN3A 1PS9A 2JAHA 2AHRA 1EFLA 4JJFA 1U3VA 3G49A 2Q45A 2W90A 3GNSA 1LU9A 4ITUA 5DN9A 1EVIA 4RVSA 4GX2A 2DFDA 1CDOA 4DXHA 1NAIA 2I5PO 1WDKA 1JWAB 2C5EA 5EMHA 3RFXA 3QWBA 5DT9A 2LDXA 5A05A 3RCBA 3WFJA 4X54A 2BELA 5JS6A 3V1UA 3W4JA 3I83A 4ALLA 2D4AA 1U2GA 3PHGA 4GGPA 3U62A 2VT2A 4UEJA 3FCOA 4CM3A 3NGXA 3JD1A 3JYQA 2UVDA 2O2YA 1HXHA 3FRJA 3QWIA 2GN6A 4E2WA 5I7SA 3NT4A 2DLDA 2NU8A 1HDYA 2EHDA 5HS6A 3TQHA 1LDBA 2IZ1A 3EMKA 1DC6A 1JTVA 3UOGA 4BKOA 2O23A 4Z9YA 3WBFA 4DLLA 4YEDA 5AXAA 3ADPA 5F3RA 4JCOA 3UW3A 3V8BA 2JAPA 3ZWPA 4YACA 3CE6A 4PZEA 3QWFA 1GU7A 2PNFA 4XRRA 4A7PA 5BSEA 3MEQA 3RASA 3U0BA 1YKFA 3G3EA 3H65A 1OBFO 2X5KO 1GTMA 1V0JA 2Y99A 2R00C 2RHCA 4ZQGA 3D5TA 1U4SA 2DBRA 1I32A 1BVRA 2JD1A 2J5RA 4DPKA 5C3MA 1YJQA 4MVJG 2EW2A 3VPXA 3VZQA 3AUSA 1EDZA 3INTA 3DEYX 3KEOA 2ZB4A 1E1KA 5A06A 4C4OA 2YYYA 4PG6A 1H94A 3L77A 5IF3A 3JD2A 1VE9A 3WWZA 4CM4B 2HLPA 2AMFA 4AL4A 6ADHA 3KXDA 3GN2A 2XXJA 1B15A 5T5QA 3S1LA 4FFRA 2F1KA 4OQZA 3W4IA 3FD8A 4CLXA 1QKIA 4WEOA 1K5HA 3GFGA 4J49A 4OKIA 1EVYA 3HB5X 3A1NA 4BB5A 4O6VA 5LCXA 1DRUA 2HAEA 3H9JA 3NJ8A 1BMDA 4TRRA 2X9VA 2Y66A 2WD8A 3ADOA 5C7LO 4JNKA 3OJFA 4NDNE 4RDHA 3S2GA 1L1FA 4XWYA 1S6YA 2W8ZA 3GRKA 4U5QA 4NJMA 2EWMA 3LYLA 4MVJF 4WEQA 3U4HA 3IUSA 1H2BA 1DC4A 4CM4A 1RJWA 2VRCD 2XPCA 1I10A 1GADO 3M1LA 1ML3A 4H7PA 1GD1O 1Z75A 1PQPA 1JVBA 2OUIA 2R2GA 3Q9NA 4ILKA 1Y7TA 4PZDA 4XR9A 1YQXA 1A5ZA 3WGHA 5G0VA 4R1TA 4U6QA 1DFHA 3PFWO 4WGGA 1IHYA 5F5LA 1A7KA 3LC7O 4IIUA 1GQYA 2PZLA 3ZHXA 3DHYA 4CMGA 3NDIA 3DFUA 1YBAA 1P3DA 4UVIA 4EW6A 2J3HA 1KERA 2ZQYA 3ENNA 2P9EA 1FMCA 3JQEA 1L7EA 3M6IA 1QG6A 2P5UA 3BMCB 3HHPA 2OHXA 3AI1A 3H9GA 4B7CA 2GF2A 2V6FA 4OL9A 4MIEA 2ZYAA 4U0KA 4JK3A 2Q1SA 4IY1A 4RV9A 1KVTA 4OHUA 1ENYA 3O8QA 1MP0A 2EEZA 4O0LA 3TDKA 1EBFA 2CY0A 1RYEA 3IQDB 4HWKA 1GV1A 3NX4A 4BV8A 3GOHA 4OSPA 5IZCC 1YXMA 3IOYA 3ASUA 3ROKA 4N18A 2GCGA 4M54A 3PEFA 1Q1NA 2OORA 1I33A 4RPJA 3ST7A 3ZGYA 1ZMOA 4KQXA 1A4UA 3ZZNA 4CV3A 3MJCA 3GZNA 3AUTA 1DJQA 1GY8A 1NWCA 5KKAA 3WTCA 2HMWA 3ETEA 1SB9A 3H5RA 4M89A 5JYDA 2C0CA 1YWGO 4BNJA 3JD0A 3L6OO 1RM4A 2C7GA 2VCYA 4WE3A 3MJEA 3HDJA 2EG9A 4ND5A 3DDNA 5GZ6A 3IMFA 4YT8A 2G82A 3GNTA 2OFPA 4MJLA 5TJHA 4EZBA 4Z0HO 4IQ8A 2OXIA 4E3ZA 5JFOA 3LT4A 2Y1EA 3HNPA 4FQ8A 3ZWNA 4BKPA 4BO9A 1HLPA 1JU9A 3SX2A 4WCFB 2DUWA 2JKVA 4WCFC 5MDHA 4E2XA 1Z6ZA 4PLZA 3MTJA 4FFNA 4MVJH 3R0IA 1RM5A 4CPDA 3GHYA 4R1UA 5KWEA 3ZN2A 5AOVA 1SZJG 3N7UA 1F0YA 3CSDA 4JLWA 5EERA 3KBOA 5I8WA 1PJ4A 4CUKA 2Y1CA 4IDGA 1C0PA 5FWNA 3RC7A 1R66A 5IXYA 2X22A 1U1IA 4RF5A 1NR7A 3ZHZA 1SCUA 4OJNA 4MINA 5A1TA 4FJ1A 1XWFA 3C1OA 1EFKA 1HE2A 1LXCA 1NVMB 3I9KA 3PJDA 3F3SA 1BXGB 4GX0A 1U28A 1AN9A 1YL7A 1UXIA 2HO5A 3JV7A 3PHHA 5H82A 2AE2A 3T7EA 3ZDFA 2A94A 4BO6A 2E82A 1O5IA 4IQ0A 1GL3A 2JFFA 3MTGA 2A92A 2OMEA 4YQZA 4D43A 2PTGA 3PYLA 5TC4A 3E18A 3I9NA 4E6PA 1I36A 4KUEA 1ZEJA 1D7OA 3W4KA 1XEAA 4Q3EA 5B12A 2X58A 4PLTA 2HK7A 4DQUA 4EEXA 1MC4A 2VWPA 1R0SA 3D5QA 1EUCA 3VC7A 4BUCA 1M6WA 4CM6A 9LDBA 4W4TA 2ZB3A 1MLDA 2E37A 1XLTA 2NU7A 3JQ6A 1MXFA 2GYYA 4DIOA 1C3VA 4D0RA 4W7IA 2EJVA 4WLUA 1HL3A 2B36A 3TFQA 3ZNOA 3PHIA 3ROPA 1QLHA 4DGSA 4QO7A 4E21A 3PGJA 4J7UA 4XEHA 4FCCA 1NVGA 1R4MA 3GGOA 3U9LA 4BNZA 1YH3A 4J0EA 3Q1LA 5L51A 2YUTA 3JQBA 1SOWA 1ZZEA 1NXQA 2DAPA 1VRWA 2BMAA 2GGSA 3KYCA 1UP7A 4WK6A 4FS3A 4LVUA 2HDHA 3DWFA 3K8ZA 2HRBA 2AA3A 3IKVA 1N1EA 4O63O 4LK3A 4A03A 3ANMA 2X7HA 4AJ2A 3D4NA 3GA0A 4ZVVA 2Z1MA 2VYNA 4IS3A 4I5EA 3H9EO 2DC1A 2HMUA 3RFVA 3H5NA 5GZ3A 1JAYA 1Y5MA 3WLEA 2PR2A 2YV2A 3H5AA 5KJ6A 5IDWA 4FW8A 5KNLA 3SEFA 4BKRA 1LRKA 1GUZA 1ZVMA 1A71A 1E7QA 3JCZA 3OETA 4K1LA 3WIEA 1R0LA 5KKCA 4W6ZA 5KTKA 5CFZA 4BNLA 3F1LA 3D4OA 1E3LA 3BTOA 1KVUA 4NBWA 4TROA 4DC0A 1W0CA 5A9SA 1WLYA 4A0SA 4B4VA 2PWZA 1EUZA 1QXSA 3QVOA 3AU9A 2VWHA 3KYDB 1NHGA 4I9NA 1HEUA 1NFRA 3O4RA 3P5SA 1QR6A 1FF9A 4D44A 1K89A 2VHXA 4N5NA 4N5MA 1VPDA 4OYRA 4BNTA 4GGOA 4GLLA 3OECA 2FOIA 2C59A 1I3NA 3VHRA 2D3TA 4UVDA 2NTJA 4YJHA 3WYCA 4MVJP 3D3WA 1A72A 4HFMA 4BNIA 1Z73A 4HUJA 3O8QB 1MX3A 2RCYA 1ZIDA 2VUSA 2VZ9A 1ZFNA 2C7VA 3I9LA 3GY0A 1SEVA 1TT7A 3QVWA 2QZZA 4OOFA 4BNYA 3CXRA 5C5IA 4BNVA 3CZMA 2O7QA 3VPSA 1I3KA 4XB1A 5KIAA 3CINA 2PGLA 3BMNA 3DBLB 2IEBA 1UDBA 3GDOA 1A4IA 1DSSG 4RQUA 2IE0A 3PVZA 5ENVA 4D0SA 4AJ4A 4YB8A 1E3WB 5JAIA 3WOHA 1JA9A 2IYPA 3RUEA 3D7LA 3EY4A 2GZ3A 1NNUA 1GZ4A 3TWOA 4M55A 3L9XA 4EJ0A 4CV2A 2B4RO 2CF6A 3JQ7B 4UEOA 4Y6RA 2X5OA 2VHWA 3K6JA 1OAAA 2D8AA 3GUCA 3WQQA 4RPGA 1BW9A 4WKGA 4MKRA 1GQQA 3R3SA 5BSHA 2AW5A 2RAFA 1PL8A 4HY3A 5BT9A 3W6ZA 4E30A 1YB1A 3VTZA 4JJGA 2C5AA 3CTMA 5IDXA 4FFLA 2PGDA 2WMDA 3WYBA 3GDGA 2FRDA 1QYVA 4EYEA 4BGVA 4Z9XA 1LX6A 2UUOA 2ZCUA 3PLNA 3S2IA 4NK5A 4F6CA 5KJ1A 1KC1A 1ZH8A 2HKIA 1Y9AA 1CWUA 4RF4A 5LDGA 1W4ZA 3HFGA 1ZK4A 3HB4X 3PYMA 4YAEA 4RDIA 1NBOA 1IZ9A 1GQ2A 1VSUA 4YBZA 1UP4A 2O3QA 2ZTMA 4G5HA 1GYQA 4IDBA 4KTTE 3KVOA 1TT5B 4URFA 5L7YA 4CLOA 1QMGA 2Y05A 4CMHA 3PZBA 5L95A 3K2BA 1IZ0A 5A03A 5CDSA 3M1AA 2CD9A 3I9OA 3WGZA 1HSOA 2E4AA 2VHVA 1E6EA 4IPTA 1SBYA 1NQTA 1LLDA 1PR9A 2A35A 3GUYA 4BO7A 4BNFA 1CJCA 5AVOA 5JBIA 4XDYA 3OHSX 1PZFA 4IBOA 2RIRA 3I9MA 4QSMA 1SNYA 2V6MA 2IRWA 5CDUA 2AEMA 3OEWA 1TT5A 3RUIA 1X14A 3DC2A 2BRUA 1E3IA 5I7FA 3BHMA 1LQTA 3NT2A 5JC1A 3S8MA 1B8PA 4XZ3A 4J1NA 4AICA 4I1IA 4BKUA 2EGHA 3DZHA 2ZATA 5JY1A 3OIFA 4Z0PA 5A3VA 3GVIA 4HP8A 4GPD1 2PY6A 4BNGA 3SC6A 3C7DB 1FK8A 1P44A 5B37A 4JGBA 3QJ5A 3CPSA 3WR5A 4K6FA 1WZEA 1Y8RA 3W8FA 3BTUA 4Q3BA 3I4FA 1E7WA 5B1YA 3TZKA 3TNLA 1DIGA 1F14A 4F3YA 3JQBC 4YVFA 4ESOA 2CVOA 3QVXA 1PGOA 3ZWXA 1H0KA 2OL4A 3KZVA 1F17A 2WWRA 3WMWA 4MVJD 1JQBA 4GLOA 5TF4A 2ZQZA 3KTDA 4YJDA 5DCUA 5BNIA 4NHEA 4L8VA 5DDIP 2X5JO 1RWBA 1QP8A 2DTXA 2JD0A 5FI5A 1J0XO 1CQIA 1EE2A 3FNFA 3NV9A 5CG2A 1E3WA 4KP7A 2PKQP 4YT2A 5JE8A 5GY7A 4DMMA 3RQSA 3WXBA 3ANLA 3S2EA 4A5OA 3ENKA 2NVUA 4CM9D 2I99A 4KZPA 4ALNA 2O3SA 4LN1A 4R51A 3WYEA 4IDAA 1SOVA 2DU8A 3VTFA 3RBZA 2CDAA 1A9YA 9LDTA 3LLSA 5KJCA 5G4KA 4W82A 3V2UA 5K0ZA 1LDYA 4BQRA 5FI3A 2X0RA 5KVSA 3KEQA 3UICA 3WGIA 3AOEC 1GPJA 2TMDA 2VZ8A 1KEUA 2GLXA 5G4LA 1UZLA 3QY9A 4BO5A 3SVTA 4R41A 1HKUA 1SAYA 2P9CA 4TZKA 4RF3A 1WZIA 4J91A 3WTBA 2ZB7A 2A4KA 1NVTA 5A9TA 3FTNA 4HKTA 4NFYA 3TZQA 3NTQA 2DUUA 4QFCA 3Q3CA 2YJZA 1UXKA 2FR8A 5DBIA 1QYXA 3U49A 1T2FA 1KS9A 4WLFA 1ADBA 3BA1A 3ICCA 5DULA 3BMCA 3QHAA 2Q1UA 4WCDA 4KOAA 1C0IA 2DBZA 4IGEA 5F1KA 3WFIA 1HETA 3BXXA 3DOJA 3AY3A 4IMPA 4R68A 3U4CA 5L7TA 4DIFA 1ID1A 3MOIA 5DNAA 1BSVA 3WGTA 2ZYDA 2R00A 5EJ2A 3FBTA 5ITVA 1KVQA 1R4NA 5EN4A 1HSZA 2G5CA 4NH4A 4ZGWA 2QRJA 1GAEO 3MWEB 1IYZA 4K6CA 4XD2A 4LSWA 1JWBB 1XELA 2NADA 2QHXA 3ZWCA 5TGDA 2WDZA 1I3MA 1PS8A 3RFTA 3WWYA 3DB2A 1Q0QA 4GVLA 4YJGB 1WMBA 3ZWBA 4YAJA 3E9NA 4J6FA 1QORA 3RC9A 4ZQHA 3ONFA 1GCOA 2D1YA 1CRWG 3EDMA 2AQIA 1MG0A 5ILOA 5ICMA 3KM0A 4MVJE 4AJ1A 3MJSA 1Y8QB 2W2KA 3QV1A 4BQPA 3BYZA 1ZKMA 4P22A 1YDEA 3IS3A 2V7PA 3OSUA 5TNXA 4BHTA 4RZIA 4BS9A 3KV3O 3WQRA 5CEFA 5L4LA 4CMEA 1ISIA 3I52A 2G76A 2WM3A 5HWSA 4U8GA 2DTEA 1HDXA 4QECA 3ONDA 4FJ2A 4J7XA 3L6DA 1MFPA 5IN5A 1VL6A 3RUFA 3U4DA 5JW6A 4IJUA 1CERA 2WYWA 3CIFA 4GX5A 4IDFA 3GMDA 2Q1TA 3JD4A 3QVTA 3ZW9A 1V3UA 3IC5A 2NNLD 1XGKA 2OOSA 3DO5A 1SB8A 4Z3DA 2BLLA 3O03A 4NQZA 2FR0A 2CDBA 5FYDA 3LZ6A 5JNLA 1B7GO 4IS2A 1GV0A 2DVMA 3FF4A 2VOEA 5JC8A 5BSGA 3OA0A 2BF7A 5L4SA 4R9SA 1R37A 1CF2O 2B35A 1JDJA 4Z3KA 1DO8A 1PJLA 3HN7A 4M86A 1TEHA 1JVSA 1WW8A 4B3IA 5JYEA 1J4AA 3PI7A 2JJYA 1XKQA 1BDMA 3O38A 4AJNA 3U09A 1FDTA 5I7VA 4ALKA 2RBEA 3B1FA 1C0KA 3X2FA 2YW9A 3OJLA 4IJWA 3WJAA 1U3WA 3HADA 1PGNA 1E0DA 3PQDA 4UUMA 1XQ1A 4PZCA 3FWZA 3T4XA 1Q7GA 4EBFA 3HZZA 4ND1A 5EIOA 1MV8A 1P1IA 4KDEA 3FNHA 3NYWA 3CKYA 4XGNA 5TQVA 4CUJA 2HU2A 4XQCA 1Q7CA 4GMGA 4II3A 4CQMD 1DIHA 4NU6A 1Z74A 3PJEA 4QEDA 2W4QA 4OH1A 1NM5A 2GDZA 4CM8A 1DRWA 4FR5A 4PLHA 3C1AA 1KBZA 1ZJZA 3VOSA 1EQUA 1HT0A 3ON5A 3QSGA 3ZV6A 5ADHA 5ER6A 1ADFA 2FZWA 3GT0A 5L53A 2HJSA 1FDWA 1V8BA 1LDEA 5G0TA 4UVEA 4DPLA 2VYVA 1HDGO 1LDNA 1LEHA 1LC0A 2D2IA 4ID9A 4BNKA 2B5VA 4XB2A 1ADCA 4QFDA 3WSWA 1C1DB 3E03A 3V5NA 3WNVA 5CHEA 3X2EA 2Y68A 3DZFA 4FC7A 5JDCA 1Y8RB 5T8KC 2Z95A 3L07A 4ZN6A 3BIOA 4RORA 4NBRA 3HWRA 3W8EA 4N5LA 3OICA 4L4RA 1HDOA 5TLSA 3Q9UA 3NT5A 3G1UA 4J4TA 3DMYA 3PK0A 3KYBA 3AM5A 4PRLA 2WSBA 1WDLA 4HFRA 3FPLA 4NPCA 1NPDA 1YDWA 5IZ4A 3V2GA 1LJ8A 4D79A 1ZSNA 4J0FA 4A73A 1H6AA 3H9QA 4Y98A 3SJUA 1CYDA 2AEJA 3ZNPA 2Y1OA 1PJ3A 4PLYA 4YPOA 3GVCA 1YB4A 4OGWA 1RYDA 1LNQA 2WE7A 3NTOA 3WJ7A 2B0JA 4P4NA 3TOZA 4BO2A 1VJ0A 3JQ8B 4WUVA 2PKRA 1UXGA 2F00A 2X86A 3QA9A 3G1TA 1E1NA 2FSSA 2J3IA 5CDGA 5JAQA 5BR7A 4R1SA 4CLEA 3B6ZA 3JSAA 2UDPA 1B14A 3QE3A 1P33A 4FBGA 4FD3A 4CLRB 3NKLA 1E92A 3AOGA 4D3FA 4JP3A 1Y8QA 4PLPA 5ES3A 1X1TA 3GDFA 3OBBA 1CIVA 2V6GA 1XIVA 3D3EA 4GSKA 5DBGA 1PGQA 3O9ZA 3F4LA 1YONA 2P91A 4UVHA 1E3JA 3A14A 4YDRA 4GAEA 2PD3A 3GZ4A 3OJOA 3GN1A 1H6CA 1NX6A 3DTYA 1E1LA 2VHYA 2ZCVA 4NG5A 3WDSA 3KSZO 1I30A 2YHIA 4QO8A 1SMKA 2C20A 1ZSVA 1W6UA 3T4EA 2QW8A 4CODB 2WJPA 2O3UA 1DAOA 4BKQA 2YHIB 2C2XA 1VLLA 5G0SA 3VPFA 2UUPA 2W2KB 1I2ZA 1H6DA 1ONNA 4CMBA 3FWNA 1Q0HA 1T4BA 3VH2A 2X0NA 1ZXLA 3BMOA 2NLOA 2IYOA 2X9NA 4Q3DA 1I01A 2GASA 5A02A 1YL5A 4ND4A 2Y67A 1OOEA 3QVSA 1YVEI 4PLFA 1KOLA 1ADGA 4PIVA 3ZV3A 3BZUA 1DLJA 3HDQA 3RI3A 1FJHA 2JD2A 4XDZA 3DMTC 3F4BA 4WNCA 2A9FA 3FBGA 1E1MA 3JYOA 2P5YA 3WIDA 1IE3A 4R1NA 4DBZA 3GFBA 3E5MA 2J5QA 3C3XA 2Q2VA 2BD0A 4E0BA 2VT3A 2EKPA 2B4TO 4K26A 4R4JA 4YWJA 4L76A 3UH1A 4IUYA 4ZD6A 3EVTA 2QRLA 3UUWA 4L4XA 3ZCXA 4PVCA 4XYMA 4MDHA 3BMNB 3TZ6A 4J2HA 3AY6A 4ND3A 3E6AA 1TI7A 1NTOA 4AJEA 3HE3A 4MO2A 1BTOA 3K96A 3BAZA 3ZWMA 3WBBA 3D3WB 3GMSA 2GN4A 1UAGA 3KOUA 3ZU2A 3GR6A 1QV7A 1VI2A 3KRTA 2Q49A 2W2LA 4CJXA 3GH3A 1NASA 1R0KA 3ZWWA 4DQXA 1BXGA 1LDGA 4IMRA 4E5MA 3EVNA 1QYWA 4CMAA 1X1EA 2H5LA 1C1DA 2V6BA 1T1SA 3AK4A 4B7UA 3NDRA 2GSDA 4IQGA 4PRKA 3KYDA 3I23A 3INGA 1N9GB 1MGOA 1V6AA 3KSDO 1N8KA 3GG9A 1PQWA 4KUGA 4KUHA 5LC1A 1XG5A 3DBRA 1W8DA 2P9GA 4J4BA 3R3JA 4FFPA 5EINA 3EHEA 2PD4A 2NWQA 3LF2A 5IDYA 4FJ0A 4YRAA 3UAGA 3OF2A 1E6UA 4IIVA 2B83A 2EJWA 1Q2XA 3UGKA 4JBIA 2NVUB 2QZ9A 1PJBA 5IAAA 2G0TA 4LRTB 2HMVA 4BB6A 5HS4A 4OIMA 1YB5A 1P74A 1PL6A 3RBXA 1VSVA 2GNAA 4TRJA 4XR4A 3T7CA 4HV4A 3K73O 3P7MA 3V1YA 3OMLA 2H1SA 1ISMA 1HF3A 1PJCA 5JCJA 2BH9A 4A10A 1E77A 5CPBA 1YBVA 1HYEA 4E2YA 2FWMX 3JQAA 1N2SA 4Y8VA 3OH8A 4H16A 4CL8A 3DHNA 2WEKA 2FR1A 3RBVA 1J6UA 3AW9A 2GO1A 1YQGA 2NU6A 3RC2A 1ZJYA 3K5PA 2NQTA 2HQ1A 3VZSA 1XHLA 3JQFA 5JXWA 1EK6A 4R01A 4RO0A 2Y93A 3V2HA 1NP3A 3OIDA 1T2AA 3LT1A 3CMCO 1AE1A 3D4PA 5TJ9A 1MG5A 1BXKA 3ONEA 1CQJA 3K9QO 2DM6A 3AWDA 4JP2A 2Q50A 2CSUA 4AJOA 2O3JA 3BTSA 1AXGA 1E3SA 2E48A 4Q9NA 2Z5LA 4IXWA 4U6SA 1WXDA 3RROA 2AQ8A 5F21A 1ISFA 4TVBA 4RVUA 4DC1A 5TS3A 1U7TA 2SCUA 1XCBA 4JX8A 2X9GA 4YRDA 4ZA2A 4A26A 1AHIA 2PFGA 4RZHA 3KETA 2AEFA 2WYVA 4EGFA 3AU8A 4ALMA 4E5NA 1HE3A 1B8VA 1Z7BA 2W98A 3RU9A 4Z6KA 1JKJA 2OBNA 3JYNA 1V35A 2JL1A 1B2LA 4MVJM 3AFNA 5HTOA 1T2CA 3ITKA 3GPDG 5TT0A 4CMKA 1ENZA 3TRIA 3DBVO 4NBUA 4NJOA 4B3HA 3JQGB 5IZCA 2JFGA 4RVHA 5JAZA 1OFGA 4MIYA 1IUKA 3OP4A 1D8AA 3EK2A 2BFMA 1DHRA 4E2ZA 1Z45A 2FSVA 3EUWA 1JLLA 3TN7A 3PDJA 2ZTVA 2HSDA 3IP3A 2ZB8A 4O59O 3VH4A 2EP5A 4Q3CA 1M2WA 5COAA 1XU9A 3FHLA 3R6DA 4BGUA 4NFSA 3IIEA 3AI3A 3WGYA 1IY8A 3PJGA 3E5RA 3VZRA 4ALIA 2VHZA 4YAGA 4TRNA 1TA4A 3UCXA 2I6TA 1E7YA 3QWAA 1LUAA 4LSMA 2VYND 3I3OA 3F5QA 3QW2A 3KUXA 4E31A 1L7DA 3NUGA 1UXJA 4O1MA 2WTBA 1BWSA 4LMRA 1U5CA 2Q1WA 1HWYA 3PIDA 1IB6A 2O4CA 1HRDA 5DCYA 4D3DA 3E82A 3ZHBA 5MGBA 2I67A 1DC3A 2GN8A 3U4IA 1E7RA 3DBLA 1T2DA 2V65A 3FTPA 5JO0A 1UJMA 3UHAA 2CUKA 5C7OO 1U7HA 1PU2A 1K6XA 1Y5RA 3OQBA 4AVYA 5CDYA 1DAPA 4RLHA 3CZRA 1EUDA 3CMMA 1P1HA 1V9LA 2EV9A 2O3RA 1M76A 4YCAA 3GAFA 4DQVA 5CPFA 1O8CA 5BNTA 3GZNB 3ETDA 3F6YA 3H4VA 5BNFA 2EERA 4EEZA 2FP4A 4DLAA 2AQKA 3Q2IA 1K6IA 3SBOA 3H8VA 3SLGA 2GRAA 3GC6A 4BO4A 3ORFA 2WD7B 4DBVO 3ZH2A 2X1HA 4LCJA 1LA2A 3PJFA 4Q39A 4IZHA 1YOVA 1LRJA 3GLQA 3KB6A 2HK9A 1XQ6A 2FMUA 4BO1A 4F46A 2D59A 2HRZA 2BGMA 3AFMA 2TMGA 3BHJA 3K92A 4UULA 4BV9A 1R6DA 5CG1A 3FNGA 4LISA 1JN0A 4O5OA 2GERA 5KCZA 3PZRA 3TF5A 1WPQA 4J1SA 5ITWA 5U4QA 1ZK3A 5FFFA 3OQ6A 4WLVA 1B26A 1YJ8A 1S7CA 3LF1A 4NBTA 3UF0A 3I1JA 3ZV4A 4OKNA 4BMNA 3O26A 1RKXA 1NR1A 4JROA 2VRCA 3GEGA 1YQDA 3JQ9C 3TFOA 1VL8A 2BI8A 2YDXA 5U9CA 4RF2A 1P1KA 1LLUA 1U9JA 4GVXA 1Z7EA 5I9LA 4RPKA 4JJIA 1HYHA 1QLJA 1DPGA 3IAHA 2OP1A 2D5AA 3OA2A 1P31A 1U2DA 2Q2QA 2YV3A 4R5MA 1PGJA 3LC1O 4GSLA 4Y67A 1G1AA 2ZIZA 2YQ4A 2YDYA 3JQDA 4DUPA 1TVEA 3JTMA 4R3WA 4CM5A 2PLAA 4OXYA 3PFFA 4R3NA 3KYCB 3E9QA 4LCEA 1PX0A 5J23A 2WE8A 4MP8A 5F5NA 2B69A 2JFHA 2PKQO 4BMVA 1GR0A 4DVJA 2IODA 4IINA 4TWRA 2J8ZA 1BG6A 4NNJA 3R1IA 4UAGA 3EZYA 1GYRA 1J49A 3FNEA 1HZZA 4JBGA 3DHEA 3VPGA 4CLDA 4RPHA 3OJ0A 2AXQA 2G1UA 3RKUA 5JO9A 1UXHA 1EDOA 5DOVA 2VZ0A 1LSOA 4M1QA 1YGYA 1ZW1A 4CLRA 3JQGA 2EKQA 1FXSA 3GQVA 4KDFA 4CMCA 3IJPA 5CAEA 4FB5A 3UCEA 4J3FA 2NU9A 4WASA 5G0WA 4FPXA 2Y0CA 4L4SA 5TIIA 1ENPA 1PIWA 2EGGA 2YHUA 3DAPA 3LK7A 4FGWA 1KETA 1R15A 4EJ6A 1CEQA 4CLHA 1DFGA 4PG4A 3LC2O 3IKTA 1LI4A 4ZQEA 3PWSA 4TVOA 4RVGA 1ZCJA 4GL4A 1CETA 4KWHA 2EF1A 3GGPA 4RGBA 3A9WA 3STHA 1LSUA 1Q7BA 1H93A 1ZSYA 2HMTA 5KJEA 5AXCA 4QX6A 4XYGA 5T57A 1O95A 5A3JA 2POQX 3E8XA 5F1OA 3ZWAA 4YTEA 2JCYA 4RLSA 4HNGA 1PZEA 5COQA 3WGGA 4RQTA 5DP1A 5KVCA 4R54A 3RWBA 3PQEA 4PGFA 2GD1O 7ADHA 2PK3A 1DFIA 3L6EA 3OQ1A 1H6BA 3WGQA 4KTVE 3H7AA 2JCXA 4NMHA 3ZNNA 2QX7A 4IDEA 3DFZA 4NIMA 1W73A 5BSFA 3H2ZA 4TRMA 1ZXBA 3G79A 2I9PA 3RKRA 1DBVO 3NRCA 2Y1GA 3VVBA 2X0JA 4PG7A 2YFHA 1KEWA 1F8FA 4XQ9A 3BMOB 4YJGA 1GFSA 3GPIA 3I4CA 3P2OA 4MOWA 4YJFA 3W1VA 3JYLA 1EBUA 3TL3A 1B8UA 3M2TA 1KIFA 3GNQA 4XGKA 4CMEC 2NSDA 3KHUA 5TRTA 1UAYA 5KJFA 4MP3A 3CH6A 2XF8A 3E48A 3KLMX 1G6KA 3LLVA 3DOOA 3GF4A 1B3RA 3OFSA 3HN2A 4D46A 4D41A 2GR9A 3VH1A 5T8KA 1UDCA 2I3GA 1NFFA 1ONPA 4GX1A 4XYBA 5HBRA 4XKJA 1P1RA 1HYGA 5I9NA 1KY5A 3GVHA 4ZQFA 2BFAA 3Q2KA 4BO0A 1BW9B 1G0NA 1PJTA 4OO3A 2DT5A 1I2CA 3F1KA 3WMXA 1QRRA 1N92A 3WS7A 2O4UX 2EP7A 1LQUA 1K0UA 4ZJUA 2IDZA 1VKOA 2J3KA 2NM0A 3K2EA 3RUAA 4XRGA 4BNXA 1K2WA 2I65A 4JIGA 3IDSA 4WOKA 4NFHA 2PA3A 2PH5A 5DZSA 5L40A 3EAGA 2PGJA 2GZ2A 3NAQA 1PTJA 4FFMA 1UZMA 1YBMA 4PCVA 3VAZA 1HLDA 5I7EA 3QQPA 1FDSA 1HE4A 2Q4BA 4LMPA 4CQLB 5L45A 1ZUD1 3W8DA 1EVJA 4Y6PA 1GDHA 2VNAA 3ICPA 5AXDA 5IFLA 1U4OA 3DZGA 1NAHA 3GRPA 4CQLA 4I5GA 1LRLA 4WNIA 4CV0A 4YYZA 4WLOA 3NEPX 2QQ5A 2B4QA 2VRBA 1P0CA 3GEDA 3Q6IA 4QT0A 4WLEA 5T64A 1PJ2A 4OXNA 2NTVA 2PZJA 1WP4A 1YOVB 3AM3A 1YRLA 3I5MA 3NDJA 4NR0A 4EDFA 1KY4A 3IJRA 3UXYA 3P19A 5JDIC 3WG9A 4NU5A 1D1SA 3DQPA 3RC1A 2JHGA 1DIBA 2OO5A 4D42A 1XYGA 4GKBA 1EEHA 1UZNA 2IEDA 1DRVA 1E6WA 5GZ1A 2DTDA 2WYUA 2I66A 3PQFA 4ND2A 3VVCA 4BNHA 4RVFA 2O7SA 4N54A
chains in the Genus database with same CATH superfamily
1FLVA 1H2RS 3FCSB 3I6IA 3OURA 3F9IA 4GZ5A 3AERB 1EZ4A 3K9GA 4EVRA 3HRHA 4RHYA 4FB4A 3EBLA 1LC3A 1WAMA 2XWBF 5AVWA 1QGUB 5A9SB 4AY3A 5CLFA 2O3TA 4AF8A 4EECA 5SZJA 4RHFA 3W5SA 4AAYA 2QN6A 3GJXC 5TT1A 4MV1A 1MT0A 4UE3S 1H85A 4FZRA 1QG4A 2W00A 4MDEA 1P1BA 1O97D 5CVUA 2JLXA 1CEYA 3FCAA 4B48A 1TAUA 1D3AA 1ESEA 3QP9A 1CTQA 1N2CE 4JY7A 2F17A 1R4MB 1OFUX 5IABA 4HDNA 3S8YA 1CY6A 1NVVR 4P8RA 2GEFA 3DWGA 3VOAA 2OG1A 2PH3A 3KAQA 3MZ0A 4A0FA 3WLAA 2G4LA 1VKJA 4D7AA 4X71A 1W581 4EKEA 5GQSA 3QLJA 1U3CA 1NF9A 1WDMA 2R85A 4FDAA 4GOJA 4IOJA 1JPNA 3OAAD 2CNDA 3OEYA 4LMAA 2EZUA 3EXIA 1C4OA 3D8BA 4MUMA 1XYVA 3GLFB 2H9AA 2NVWA 5EUMA 4XYEA 2AZDA 4L0DA 4Q00A 4H3SA 1O1YA 4WHMA 3HG7A 3N2YA 4JASB 1XTPA 3PHLA 4RH0A 5BQFA 4ZCPA 5EJ7A 4ZPJA 3MOGA 1E1CB 3RSHA 4BLOA 2V7XA 3IAAA 4BE7B 1UMCA 5A4DA 2QRVA 3PD1A 3IODA 4JL5A 4R31A 3V3KA 1E61A 3LGSA 3ZU4A 4WY8A 2SKEA 2J31A 4MVYA 1R0WA 3E7XA 3LHIA 4EKYA 1KGSA 5HRAA 2JH8A 2VWGA 3C3CA 2PQ0A 5ALUA 1D4FA 4S3MA 3BFJA 5DI3B 2GPNA 1KZ1A 2GXQA 3AV3A 3SS7X 1W88B 1IXYA 2CN1A 5FA6A 1Z2NX 4H18A 2RH8A 3P32A 3SC2A 3ZNQA 4QBHA 5AT1A 3T5GA 2QTHA 5DCWA 2GCOB 3FDIA 1K3FA 1DEHA 1IM5A 4NI5A 5EJIA 1UQRA 2H4YA 1AKRA 4G0UA 3DOHA 2J0VA 3AVUA 2YHSA 2J46A 3SHQA 4BGIA 2BZSA 4BMDA 3FOEC 3D1LA 1PKXA 5I8ZA 1GOTA 2QZSA 1SPXA 2VCHA 1H8ED 3AVPA 2EJUA 3C8MA 1FYVA 2ZM5A 2NZUG 3PCTA 4U7WA 3UK0A 3AP2A 3OY2A 5DBFA 4MTCA 4NBNA 2MR6A 3GCGA 4B84A 5T7BA 4F6RA 3Q8MA 1WRBA 3ZQ4A 3QZUA 4PN7A 1AHHA 1VB3A 2HC9A 4BLRA 1VLJA 5LXTA 1V45E 2CCGA 1UT5A 3H5VA 4I5DA 1CP3A 3TM5A 1JW9B 3ROQA 1HE1C 5B4UA 1UK8A 3NJ4A 4KR3A 2NXNA 4GH5A 2ZYIA 3NH6A 4S1WA 1KRHA 4TL6A 5FP0A 3DTVD 1XU7A 3PF8A 1ZGBA 2YBEA 4FK8A 4JQYA 5L7WA 4R7TA 1D09A 4X90A 1G8HA 2VEDA 2CEAA 3LE8A 5JXIA 4FINA 5AM4A 1VL5A 5ER9A 1NG1A 4OAOA 5EHNA 4YMSA 4P4UA 3SF8A 3SS8A 2HIHA 3MNFA 3OOWA 3EGOA 4DTIA 2GH1A 3KVYA 4DIBA 4DLXA 5ELLA 2E4VA 1X70A 3KD3A 4Y2JA 1I6MA 4ZMSA 1ZUIA 3QRWA 3UJBA 2LDBA 2XKBA 4TXHA 3QXJA 3L4BC 3UJ7A 4ZGGA 2J4FA 3D7KA 4WK4B 3ROMA 5GPBA 3OZSA 4Z2AA 3U7QA 3L2OB 2H57A 3P9PA 1G8SA 3PGXA 4TV9B 3UUFA 1U2PA 4GI2A 3C7AA 4JUCA 4NX2A 3Q98A 1NW5A 3UHFA 1MV5A 1AKMA 3GCDA 2VYVD 4UZEA 2RONA 1T1RA 3JX9A 1BGVA 3MWEA 5J2TF 5LUBA 3TX2A 2JVKA 2X7XA 1KH2A 5IH7A 1ONOA 2IYWA 3GLGB 2BFCB 3SXPA 2REXB 5KYVA 5CFRA 2Z2YA 1WB6A 2GPAA 3RVNA 2BGLA 4XFDA 3PXDA 3C3AA 1Y7HA 2C1XA 2Q4EA 4KJZA 1HO3A 2Q99A 4IGIA 5T6BA 1E79A 2R8EA 4K03A 1R1DA 3F46A 1SQSA 3MERA 3HDHA 4QA9A 3RS5A 3RSLA 3UATA 5K0JA 1PR2A 2G0NA 2FJUA 2PZMA 3ZU5A 4HAVA 3NHSA 4MW6A 3NLLA 1AGNA 3EY9A 4GWGA 3VR6H 3EGDA 1C1HA 1B00A 1PHRA 2OZKA 2JARA 3GVXA 4RGQA 5C1PA 1PUIA 2HMSA 1LF5A 4B7XA 1GPDG 1XL0A 3CBGA 4J43A 4QFMA 1GQRA 1ZS9A 2B1IA 1QLWA 1WUYA 3KR0A 2C00A 4LVCA 1X80B 2RGGA 1ZNQO 2CVQA 2DBVO 2ZRBA 5KVVA 3UMYA 5C9ZA 2HN9A 3BHNA 2O8VA 3IEXA 3FCCA 4UE2A 3X1XA 1TMKA 2LVBA 1BZYA 1JAHA 2UZ0A 2AG0A 2DY0A 2O2IA 4TN5A 3QU2A 3SSNA 3A3OA 4DA9A 5KREA 1XNRB 1AUPA 3CRW1 2XXBA 3L7NA 4C14A 1U4NA 2PX5A 2X14A 4QPNA 5THKA 2BGKA 4IP0A 4B4WA 4GM1A 2XV1A 2Y2VA 3ETHA 3LECA 4OHVA 5IBCA 1XU4A 3B1KA 4RHXA 1NKSA 2CFTA 3WYDA 3MINB 1V43A 2EARA 3GG2A 3FR7A 3P27A 1L7BA 4ZICA 3VNUA 3KQNA 1G63A 1H2HA 1JFVA 2VDOB 1AV7A 1E2GA 2ZRJA 1KE2A 1P75A 4OB6A 5EWLA 3S2FA 3VUFA 1T2EA 2MHCA 4H3VA 3FMIA 1ZN9A 3AR2A 4ITVA 4KWIA 4MVJA 4Z0TA 2W6JA 4PSVA 5IDQA 3EQZA 4FKZA 4QD3A 4TKMA 2I80A 4F71A 4XWKA 4UBKA 1CUAA 1KZ9A 3FDJA 5FOVA 4CKWA 3DNPA 3K70D 3FOZA 3ZPXA 2DEUA 5IVIA 1NWHA 5AD1A 4BN0A 1O0SA 2H1CA 3EIFA 3LBNA 2X5NA 2Y27A 4A8JA 1A50B 3GV0A 3RV4A 3LUDA 4FP9A 5KHLB 1H9AA 1SC4A 1VE3A 1XSEA 3R3WA 4AG3A 3HRKA 3UV6A 4TUYF 3CS3A 4HB0A 4JBHA 2XHZA 4DMUB 2IXBA 3ETNA 4JUBA 1HEIA 3QOWA 3X3HA 2X42A 3NZEA 4D8WA 2G70A 1DDIA 1DNPA 4XD7A 5BY2A 5JAHA 3TEFA 5IRCD 2IYSA 5KCMA 1BHJA 2VA9A 2GA9A 2CLHB 3Q11A 1SZCA 1U04A 3QKRA 4J3NA 4O8CA 5TB5A 5ESRA 1GZSA 2XCQA 3CR7A 3RTCA 2WSSA 3RAJA 1YKGA 2VH2A 3R8XA 4W5TA 4CTKA 4Q3NA 4G5YA 4A2CA 1PJQA 3UWMA 2JFYA 4DAEA 4BPRA 1I2BA 4BVBA 1Z2CA 2CNBA 3V4ZA 2HI0A 4R1OA 2OG2A 7MDHA 3DLPX 2OD9A 1A69A 1HPLA 1N7HA 3PVCA 4M8LA 4P7KA 5GM1A 1SC1A 4R40A 4QC2A 4N01A 1J0BA 4FGSA 5K0BA 4RJJA 1Y3FE 2XMCA 1IY9A 2VSYA 3K31A 2P7HA 4QGHA 3QMMA 421PA 1W19A 5ALZA 4BN4A 2IDJA 2VTEA 4FFOA 2H9YA 4DKJA 5JEEA 1GTRA 1U1GA 3BH6A 3TSOA 2HCJB 5JECA 1Z7GA 1YZQA 2J30A 4DBLE 1RE0A 4BVEA 2WK1A 2SKCA 3QFTA 4KAXA 4B85A 4JKOA 4DCSA 1HDZA 3A6GA 4OI0A 1XOIA 3RU2A 3DF9A 4HLCA 2CMDA 2OBYA 3B20A 3M4YA 2Y76A 2GB4A 3GT3A 1N2GA 2QRKA 4LQLA 4Y2TA 3M3DA 3VO9A 3ZCSA 1AXEA 3S6JA 5BWLA 1GPUA 1PQUA 2JIZD 3FVRA 1X8JA 3B3JA 3PUZA 3C0KA 1SKUA 1G1MA 4DCMA 4M8SA 2IU6A 2FUG6 3FSEA 1J22A 1TUEA 2AVDA 1DJNA 4PHFA 4UUNA 4B4UA 2IDKA 2VS1A 2W6MA 2CJYA 3B1VA 4WI1A 1KI6A 1I0LA 1BE6A 1RD4A 2CLIB 4HDAA 5H1YA 3ZGOA 1XPRA 1H69A 1Z88A 2Q8NA 2RKBA 1HYQA 1BVHA 4HTFB 1XXHA 3VJRA 1XTBA 2UV8A 1G5FA 4HNRA 2CNKA 4IJKA 4RJLA 4W9NA 2B8TA 3CZCA 2Z5GA 3RG2A 1M1YB 1TF7A 2QQ0A 1T2UA 2NAFA 3JYHA 4LF7B 1FDUA 3FKQA 1K3TA 2QP4A 2VQ3A 1XMVA 4JVNA 2GJ4A 2PHZA 5JFGA 4PLWA 4ZWNA 1BDBA 4X7PA 2B4AA 5EQFA 1AKEA 1Q12A 2F1OA 3BB4A 4WNYA 1ARZA 2DOKA 1RQGA 2G5PA 2IEGA 2UZAA 1J97A 1B73A 3C74A 2BUAA 5DTMA 4BMSA 5JIBA 2R0QC 2Z83A 4ENTA 1EM8A 1H0RA 4E5KA 1M5RA 2EQAA 1TUBB 4GKAA 2FLKA 2J4CA 3TGPA 2R79A 1CY7A 3AEQA 1T10A 3ODGA 1CFJA 2HFJA 4K6KA 3QF4B 4MAMA 3ZYCA 3EZGA 1A9RA 3PQ7A 4XM2A 4B3RB 5LZ9A 1CLUA 3HQ4O 3KKKA 2YOGA 4UTPA 2X77A 3II6X 1HRKA 1PV2A 3BWDD 4DV0B 3VC2A 3OF5A 4TZ6A 4H15A 1Z8FA 2L2QA 2W42A 4XJSA 5DGDA 3PRKE 4PZLA 4Q19A 5LP6F 3A8TA 3DPSA 5EIFA 3IVRA 3DONA 2POCA 1RPNA 3QVJA 5BR8B 4INZA 3D6FA 2A5FA 4GWKA 2G7MC 1LZKA 2VYFA 4ESVA 4G81A 5FEUA 4ENSA 1MOQA 5BUQA 3KQOA 5CMLA 4ICIA 2PEYA 3MGKA 3SI7A 1ST2A 1RKVA 1YK1A 1QZ3A 5J43A 1LV8A 2FN8A 1SRRA 4WBSA 4F2PA 2FPWA 1JR3A 4FSHA 3O2SB 1QYCA 3G0OA 3OOYA 1LDMA 4HHEA 4EUNA 4PRZA 2HHLA 4KFCA 3ZCPA 3NDBB 2F8SA 3AIKA 4BFWA 4B17A 1OC2A 1QIIA 1XRMA 3PDUA 4D56A 4V2UA 3VKVA 2QTCA 3LW8A 1E5QA 2XH8A 3HCNA 3Q0EA 4R8MA 3TKAA 3HWSA 4RTLA 4C3UA 1DDOA 1N0WA 1U63A 1H9BA 3ZLUA 3S7ZA 3SC4A 1O08A 2BFBB 1ECFA 4IZIA 2XKJE 4KO2S 3O1LA 4ALJA 1SBIA 3CLKA 3UGJA 2RARA 2GPTA 2O50A 2BFPA 2D5CA 5JRDS 1U8FO 4DIDA 1CE8A 3H8WA 3ROGA 4PLGA 2BEUA 3T9DA 1P62B 3KLNA 4IXTA 4D9FA 2JBHA 1QG2A 4HUQA 2XAAA 1W75A 1PR3A 2J9ZB 3HDYA 3I9V1 4ONEA 3ZKWA 4G8CA 5AYVA 2H1HA 3PWTA 2FPGA 8ATCA 1QQ6A 3J81A 3AG6A 1G8KA 1QFSA 3AUAA 3H7IA 2E4XA 2EZ4A 2P40A 2WTNA 4MWSA 5JY6A 3EF3A 1M6HA 1Q44A 1Q0LA 1BNCA 1ZMTA 3I34X 3MCAA 2NMVA 3PC8C 4HWSA 4CKYA 3PNLA 1RRMA 5EWJA 4V3CA 2JGRA 3IEMA 5IT9A 1LS6A 4DT1A 4KPUB 3SOZA 4D98A 3EAQA 3IP8A 4WLNA 1EG7A 3TZLA 2TYSB 4J0HA 3TE7A 1A4RA 2IUSA 3RU7A 3NH9A 4NHOA 2IVZA 3JQFC 4I5IA 5AW7A 1IULA 2FMHA 2B78A 1P17A 1R12A 3G2NA 2FN4A 4UZSA 1NI4A 4K05A 4D45A 1N0VC 2PL5A 5HA5A 3FMFA 2G8NA 3PWKA 1M7BA 3VNBA 4WXHA 3VU0A 4AN1A 2PV7A 1YB6A 4LFAB 3HUTA 3ET5A 1QM5A 3O4GA 3JAWA 4DCTA 4UZFA 1P6XA 2ZSHA 2ID9A 2J08A 1K7SN 1T9KA 1FUYB 3PRJA 5AOBA 1K8RA 3RS0A 2ZS9A 1IY1A 1X74A 1UPTA 1QAQA 3F96A 4Q3LA 4C6TB 2BKLA 3Q6MA 4FE4A 5IUKC 3P4XA 4RVDA 5HM8A 2QVGA 2QTBA 1ENOA 5FA5A 4BQIA 3FN4A 3HL4A 5M34A 1VYTA 1R0RE 3TMKA 4DEXA 3HUDA 4QM6A 4JGGA 1EGAA 4G8DA 4I5FA 1NMEA 3MW8A 1YV9A 4G0YA 1L5ZA 4PZ0A 4YDSA 4IDCA 2CYCA 3JYPA 1Q2UA 1BXRB 1X87A 3HTXA 4AF6A 1A7AA 1SXGA 1TLTA 3EXFA 4AJLA 3LVQE 2BPOA 3GLRA 1BVUA 1RVV1 3N58A 4XARA 3QFSA 1DRKA 3H5OA 3GMTA 4RD2A 4MR9A 3HWX1 1KO8A 3EUFA 2EKBA 2I9KA 3GAZA 1IPEA 3VUEA 1XTSA 3OWXA 5TSDA 2GTIA 3CLVA 2VJYA 4P7JA 1YTLA 2BTOA 4MCAA 2V45A 3ABRB 1BC5A 2ZRFA 3B70A 3Q88A 1F2TA 4EF4A 5CVCA 1DT5A 1C1XB 1JG4A 3M6FA 3KJZA 4ENVA 1Z8DA 1QGUA 2WVAA 2NUAA 5JUWA 4D9JA 4M0LA 4J0GA 1EUCB 1Z2EA 2F2TA 4REMA 5C5DA 3T7JA 4WXRA 5T6MA 3K2IA 3KPWA 2CLCX 4C2TA 2FZVA 3QQ5A 1EWRA 4N9WA 1SUCA 1KIMA 3LQKA 4A36A 3T3IA 1C3XA 1RJDA 3EGWA 1MOSA 1XQVA 3I01A 4AJPA 3E9CA 5KSZA 3JRNA 1MIHA 2CVHA 5A7HA 4FYVA 3K4PA 5COBA 3RUCA 5J2UB 3GEMA 3D3KA 4X41A 3LRTA 3QVGA 4ZEXA 3ECCA 2VK1A 2UVPA 4ZVRA 5D3QA 3W77A 5KYUB 1H4SA 3O74A 3L4JA 2D62A 2RC5A 3URMA 3IO3A 2DQ4A 3U3XA 3O7WA 3QYJA 1K7FB 3FLBA 2VJPA 4IDDA 2OZLA 3M6MD 1JDBC 1CQWA 2MYNA 4FD2A 4MP6A 2WKPA 3ZGVA 2JLBA 3MUFA 4ZEOA 5EHXA 1CVRA 2HF9A 5A3RA 2ZJ1A 1E6MA 1VSTA 1IBCA 2QN2A 2W8BA 3EPHA 3FHCB 2BSQA 5A0FA 1X9HA 1FSZA 3AB8A 3NAGA 4UBJA 2LW7A 3CF2A 4L78A 2J9GA 1P1FA 1T1JA 3DDUA 5E3HA 1M8PA 4PYIA 4RY8A 4GECA 1P18A 1SU8A 1EDDA 1RT9A 1V26A 3VX4A 1BQ4A 1FXWA 3AP3A 3QPBA 1T5SA 4EHJA 3ZXUB 1ZOOA 2ACVA 1K27A 3HXKA 1OMOA 7REQA 1QH8A 2PLWA 3DDCA 4W1QA 2QDXA 1V3TA 3MMZA 1YJXA 4ZRMA 2Z1NA 3Q3VA 2P6OA 2GYUA 4BXOB 1PZGA 5FPHA 3T1HB 2IYFA 2XOKA 5IK2A 2K5UA 1OXUA 5L3SA 3NGLA 1RMQA 2G17A 3UJDA 3L8FA 4L75A 4ZK2A 3W6UA 3I53A 2VHEA 3NNNA 1C9KA 4QXMA 4R8RA 5CR9A 1MW9X 4CM8B 1ZGCA 4PN3A 1SG6A 2PKCA 3T8YA 2MSKA 5AK0A 1GNVA 1SXHA 3O0DA 2WF5A 3VZCA 2BJHA 4RIHA 5ECYA 4MO9A 4MR7B 3HABA 3GJ8A 5BSWA 3IIMA 2I4LA 1NBHA 1KA9H 3G49A 3N0TA 1V1RA 2I7VA 4ZEVA 4JI7B 4BKMA 2YMPA 1DAIA 1FVFA 2XVZA 3B51X 1WVIA 4HGRA 4BEJA 1JJFA 1JLMA 1WM1A 2RKWA 3RYIB 4DSOA 4D5GA 5IAGA 2CMGA 1C1YA 1CDOA 3WMGA 4CIDA 2WFAA 4V03A 2I5PO 3L4EA 1WDKA 1JWAB 1K7XB 3I45A 3LOUA 5EMHA 4YHHB 1CB7A 3UPUA 3OPYI 5A05A 5IJWA 4NOLA 2O8BA 4UFPA 3E3OA 3V1UA 3FPBA 3W4JA 2F64A 2C7PA 1HR0B 1USVA 2XIQA 2P6MA 4MW7A 5TEWA 1L4UA 3BK7A 3FGZA 2NZVG 2VT2A 3P2KA 4QYXA 4UEJA 1QO7A 4CM3A 5HX7A 2P3SA 4GYJA 1XDUA 4MGZR 1E2UA 3JYQA 4JJZA 4Y0AA 2O2YA 1HXHA 2F4NA 4DRXB 4E5SA 4E2WA 4M76B 1NZFA 5I7SA 3NT4A 5KX5A 1A77A 1AKWA 1OF1A 4XSGA 4D9MA 1G3UA 2PFSA 1EFPB 1HDYA 3V46A 3HCOA 2VF2A 3TQHA 1LDBA 3R7NA 1NG9A 5DIFA 3O1IC 4HPWA 1H2XA 4Y0NA 4WZBE 1SKQA 1XD8A 1DC6A 3C3MA 4LJAA 4EG1A 3CUUA 3IRUA 3UH0A 2N42A 3GJ5A 2QS9A 1K92A 1KJWA 1DMSA 2YIDA 3CO0S 4YEDA 5JSZB 1W4BA 2FWAA 4QUDA 4G0PA 2DLCX 1ZDMA 3DWEX 4JCOA 4QRIA 4NYIQ 4EKIA 1H23A 4N41A 3EYAA 1GU7A 4XRRA 3WLOA 5H3CA 1LVUA 4RQAA 3GROA 3GXOA 4JB0A 1EXNA 2WF8A 3RRXA 5BSEA 1A9XB 4GD3Q 4B43A 5FULA 3JASB 3LY8A 3H65A 2X5KO 4YP1A 1NYQA 3QV2A 2QLBA 3IP6A 3M8KA 2RHCA 4MRNA 4PM4A 4BC1A 4XJXA 5HZHA 1O8BA 3HO6A 3L1HA 1N3YA 4B1FA 4I4TA 3GFOA 1OROA 1U4SA 2DBRA 4H7FA 1ZQ9A 3EGEA 4EHIA 4I99A 1Q15A 4YQEA 4CIVA 4ZZ0A 4ZHQA 5C3MA 3OOSA 2PZBA 1UBCA 3OKPA 2YL2A 3VPXA 3GJRA 3ND6A 4IX9A 3CUWA 4NZMA 1QO0A 2QN8A 4KDRA 5AI4A 3ND5A 1NUHA 5M3BA 3JD2A 1A5AB 1RW4A 2IOFK 3QELA 1E94E 2HLPA 5EJMA 2AYYA 4CM4B 2DUJA 1VRVA 3E2PA 4Q6BA 1A82A 1Q7EA 2XXJA 3DG9A 1DCMA 3LBYA 4FFRA 1DCKA 1BD3A 4WEOA 4CLXA 1K5HA 4TYPA 2FMXA 4EB3A 1JEEA 1LS1A 2XKAA 2GEDA 1DRUA 1KZ6A 5DE3A 1BMDA 1XFDA 3V9PA 3GJ3A 3I1FA 3P71T 4B74A 3ZC3A 4INJA 3M5CA 2V98A 4NDNE 3WDKA 2O2HA 2UZ1A 4FZ3A 5B36A 1SN7A 3GRKA 1VHJA 1YQUA 3U3KA 1XDBA 1DV2A 1RI5A 1N5KA 2PA0A 2Q7XA 1JNYA 2QR5A 2QJRA 3AR4A 1G7CA 3AJ8A 3IE2A 1H2BA 3IUSA 2ZB2A 4AMBA 1U11A 4EX7A 1G3QA 5KI6A 1QRTA 2VRCD 4KQ2A 5A3QA 1GADO 3MGGA 1GD1O 1Z75A 2PVSA 2R2GA 2WIAA 5ESDA 4XR9A 1CNEA 4PZDA 3DYIA 3B2EA 3S2UA 1LB1B 1A5ZA 1JSCA 2XYRA 3TKLA 3W5AA 1UK7A 5G0VA 3WRXC 4G63A 3EIWA 2WQ6A 2GCIA 3C5VA 4U6QA 4GYWA 2IXGA 4W1SA 1KGDA 3KEFA 3LC7O 1QHXA 1DQYA 3LWBA 3REQB 4ZIRB 4NEGA 4A9AA 2PMEA 1MB9A 2FZLA 2J6HA 1P2DA 2FW0A 3P96A 2AK3A 4HEA6 4R1MA 3DHVA 1T4GA 4KLNA 4IIJB 2JI6A 2CHVA 3NO4A 4K6GA 3ZBQA 4CMGA 1YBAA 3HBFA 1ZD2P 5H7XA 4Q37A 3OFND 1TCCA 4YAFA 1KERA 1V8ZA 3A9RA 5DSTA 1IXSB 3OZVA 1RVDA 5IYZA 3PFGA 2XY4A 4FR0A 4AECA 1GTG1 3HV2A 5AK3A 5FLKA 5LU9A 1L7EA 4OUDA 4DNQA 4HMOA 3PXGA 2P5UA 4NENA 1GITA 3AI1A 3PD7A 3H9GA 2UUBB 2BEUB 3OUZA 3PL5A 1YJ5A 2QNIA 2ZYAA 3B53X 1RWNA 2JA1A 3DS8A 4MIEA 4N49A 2QKYA 1RFGE 4RK6A 3V7YA 3G5UA 1ENYA 3O8QA 4O0LA 2H5IA 4CXMA 1UMDB 1H2WA 2JAXA 1E4EB 3F49S 1NURA 3E22A 1YXMA 2QX8A 3CGWA 1M74A 3IOYA 4N1AA 4Y1FA 5BUSA 4FYHA 3ST7A 2OORA 5KDOA 3JSXA 5FLEX 3HYSA 5JAPA 1A4UA 5JH7A 2IUTA 2P6UA 1P9NA 3GZNA 1AQLA 1BROA 2DULA 1GKUB 5F7XA 1U0HC 5D5HA 1DJQA 1NWCA 4KYVA 5KKAA 4B6OA 3WQHA 1BYIA 2R60A 4KVAA 5C3UA 4DLSA 1JR4A 2PYZA 5B5SA 1SB9A 1H8HD 4L8WB 1Y3HA 3L0IB 1O57A 1YWGO 3D02A 1MX5A 3L6OO 2D0PB 4DUYB 1RM4A 2CHEA 4IGAA 2VCYA 3MJEA 1Y8AA 3NWPA 1Y48E 4LNHA 1IIRA 2PT9A 2ISCA 2YYZA 4MW5A 2W70A 3G7SA 3BIJA 2CJPA 3GRRA 4KQCA 1N8SA 3YASA 1UINA 2P9JA 4IKOA 1B1CA 3M5DA 2CD7A 1KRWA 3N2LA 4FQ8A 1JR3E 3ZWNA 4BKPA 5FPKA 4CEJA 1HLPA 1JU9A 1OFTA 3CVOA 3G59A 4JI3B 1N1DA 3WMEA 2YASA 3RAGA 1TUBA 4PLZA 1DELA 3RF7A 5HJEA 2NO1A 3T7AA 3ADKA 3EF0A 3GHYA 4G9BA 2R7NA 3M9LA 1J8MF 1SZJG 2A88A 1Y33E 2C42A 3ROTA 3RS3A 3UMCA 1FZQA 1T9GR 3P8ZA 1B6RA 3CSDA 4JLWA 4FEYA 1P2GA 4D9NA 4EJSC 1TVKA 5I8WA 3U16A 2MU1A 1RXSA 3ZY6A 2OV4A 2XDAA 5FWNA 3K9BA 3RC7A 4G37A 5KNBD 1TZMA 4EATA 1JFSA 1NOIA 1EHIA 2IF2A 3IIKA 2W6JD 4P98A 3ZHZA 1KMHB 1Z4JA 4QDOA 4PHTA 4CHGA 1AJEA 3L7CA 4FJ1A 1XWFA 4PNPA 5KNCD 4C0WA 3O95A 4G4JA 3W9SA 1SHZA 2PH7A 3PJDA 2C4HA 1BXGB 4AZ3A 4X1IA 4GX0A 1JXMA 2H29A 1YL7A 4C20A 4ZI7A 2WIDA 5HKKA 5H82A 2XCOA 4XX0B 2PSHA 4BO6A 4KQGA 2CB0A 2E82A 3G0BA 3Q12A 4XVUA 2WV9A 1DDGA 3JQRA 4RMGA 1O5IA 2HLDD 2GDJA 3R3YA 4UQLA 4QUBA 2OVFA 2AN9A 2A92A 2OMEA 3BSWA 2GXUA 2XZTA 3IPXA 3SQWA 1RP1A 3KX2A 4L2IA 1I36A 1Z4MA 1ZEJA 3L7LA 4I46A 4MB0A 2F48A 4YMWA 3W4KA 4F84A 4MKGA 4P83A 3IDOA 3QBEA 4K2HA 2L82A 1GKYA 2K2WA 3BZBA 5TMPA 4PLTA 2HK7A 4DQUA 3GGSA 5HKAA 2KB0A 3C4QA 1TM7E 2YIMA 3I37X 1ADYA 1XNHA 3C3YA 2CBZA 4UNSA 1IXZA 1E0SA 4ZO8A 4IEFB 1G5HA 1F6DA 4EARA 3WXMA 1XMQB 3DDHA 5DNVA 1RR6A 4CM6A 3OIUA 3IMCA 3F3MA 4LHYA 3A4IA 1SIBE 3ZE0B 2B30A 3N59A 1E5DA 5KSOA 3WAGA 2H08A 4LI3X 2I4RA 2H85A 4D0RA 4I1SA 5EPUA 5JNRA 3EZ6A 1V4VA 3O93A 4W7IA 4NOMA 4WLUA 1KJ9A 4A23A 1OWNA 1UKVY 4AMYA 4JKIA 1LVGA 1QLHA 4DGSA 5K6RA 3KPVA 1XZFA 2YJ4A 3CLSC 5FWXA 1S96A 4QO7A 1Q91A 3PGJA 3ANTA 3EOZA 1L9KA 4EKDA 3F98A 3GMIA 4RC9A 4DADA 1GLGA 4J0EA 3IUYA 2DPXA 3Q1LA 1RC8A 1SOWA 2DAPA 1JDBB 4Q7MB 1DMRA 2GVNA 2FJPA 2D5IA 2BMAA 1G8AA 1FA9A 2A5YB 3DC7A 5M2QA 1UP7A 3EVBA 4LVUA 1CUJA 5EJ8A 2AA3A 1LBHA 1PK8A 3GW8A 1U9YA 4O63O 3C43A 1PLKA 4LOAA 2QM7A 2JAWA 3CX7A 4K6MA 4YJ3A 4B82A 3GA0A 3KJXA 1JLKA 4E94A 2VYNA 1JDPA 1BU5A 4IS3A 3IESA 4FX5A 1KWGA 4DEVA 2HMUA 5DTRA 3RFVA 3RE1A 3TS1A 3OTOB 3R5KA 5GZ3A 1Y5MA 4YBRA 3WLEA 5D3KA 4HVAA 4F5ZA 5KNLA 1VHQA 4RZUA 4BKRA 3WY9A 2LUOA 3TL6A 3RM3A 1JVNA 1LRKA 1ZJJA 1RZVA 3EVZA 1KK2A 2FR8C 5KKCA 2GD6A 4W6ZA 4YUXA 2CKDA 1TO1E 2E89A 2OUKA 3AH8A 3B60A 3F1LA 4RM3A 1GNQA 2H06A 5EE5B 2FMKA 4NBWA 5I4CA 2J9XB 3ZJ4A 2VAXA 3CPEA 1H3FA 1I7PA 3F5MA 2ZRPA 2BBOA 2IZ7A 2VWHA 3KYDB 4X94A 2PWBA 2O19A 1O6GA 1HX7A 3KKOA 1TCUA 1WW2A 2AXNA 2J5BA 2E87A 4OD0A 3AUKA 3AUXA 1E66A 4N5MA 4OBEA 3E58A 4Q18A 1VPDA 4H7EA 5IJ9B 1ULAA 4BNTA 2R5NA 5AVRA 3AZPA 1T5TA 4FYJA 1LWNA 1VBKA 4PO8A 3N70A 1YI0A 1YZYA 3TK1A 4YMLA 3WRYA 1O95C 3FYCA 2JEOA 4NDZA 2OGZA 3G9XA 3PPYA 5BYJA 4ZTUB 4UMEA 3MAAC 4ON9A 5EXPA 1A72A 2KLHA 4HFMA 4JV5B 2D2XA 3OQJA 3O8QB 4MI1A 2RCYA 2VZ9A 1CKEA 3EG9B 1TEXA 4X8MA 1YASA 5HGXA 2O8CA 2C7VA 3I9LA 3QJGA 5IBRA 2V1UA 1HNNA 2F43A 3CXRA 1TJ3A 3CZMA 3MMXA 4OXXA 2UYQA 1CUWA 2ANBA 2PGLA 2F3RA 3IOEA 2OCIA 2IEBA 4H6XA 2CZGA 4X00A 3AB3A 3GDOA 2IU0A 3JAMA 1TRKA 1XLTC 2P2LA 3IMGA 3RJZA 1QTRA 4QG3A 3OUTA 4IJ5A 4PGHA 3QUTA 1QVVA 3CNOA 4L8FA 4Q15A 5ENVA 3UT5A 3UOWA 4UUQA 4YB8A 5AMXA 5FR2A 2R5WA 4IHAA 3WOHA 3WJ1A 1L7AA 1E5TA 1J5XA 2IYPA 3KQYA 2WJHA 1EXMA 4DLNA 1KOGA 4MMXB 2EZ9A 4DCUA 1NNUA 4JI1B 3ILVA 3TINA 3AFHA 3NHRA 4EJ0A 5IBPA 1JV2B 1LPOA 4Y6RA 5ALIA 2O1EA 2FETA 2QJFA 1OAAA 4ISBA 1Q77A 4DDWA 3KOOA 1GQQA 1QK5A 3KJNA 5BSHA 1E2KA 4E15A 4AI6A 1PL8A 1USIA 1YR9A 2CXHA 3TLMA 4GR4A 1R8QA 1W59A 5DHQA 3BG5A 4DFDA 5ITSA 3ORSA 5KHAA 1NQVA 2HRQA 5DIZA 1NRWA 5IDXA 4TTAA 4NZZA 3IAS6 3U44A 1EVQA 3UWPA 3GDGA 3Q72A 2BV3A 1SBHA 5DLYA 2ZEJA 3EA4A 1ORTA 3CKKA 5JMTA 1ODTC 1RLTA 2ZCUA 1R5BA 1CK4A 4BIMA 1G59A 5AHXA 3SHFA 4R1QA 3BWEA 1RZRA 3LK6A 2JI7A 5CLLA 3CZ4A 3B6EA 4HDCA 4I50A 1UXOA 4KLRA 4ZCQA 3SIRA 2XZLA 2JS7A 1GG5A 1ZK4A 1XAJA 3PYMA 2RCNA 3AVXA 1IZ9A 4YBZA 3V8PA 2Z9CA 3EOAI 3CR3C 1Z2DA 2GM9A 5T41A 2DJ5A 4F3TA 5WRFA 3LS2A 4G5HA 1VCHA 4NICA 4AKGA 2XYHA 4YV7A 1VMAA 3B38A 1BMFD 2WJ3A 4KTTE 5CT4A 5DO9A 4F6RB 3E7FA 3LL7A 2EBHX 4CLOA 1I4TD 2HJHA 2I8CA 3KYIB 5ICGA 4DR7B 4KXYA 4DLVA 3I76A 3NC0C 2I4TA 3VHQA 3BJRA 3N05A 1DCFA 3PR3A 1VB5A 3I9OA 4ZHQB 1P9RA 2C5GA 1O7JA 2JNWA 3GFSA 3KDSE 2HT1A 1RYHA 2W9XA 4IPTA 3H8SA 1Y8CA 4AY6A 4BVHA 1E8NA 1VYHA 2VSNA 3ENWA 1FU7A 3RTDA 1YS6A 4XVHA 3A6ZA 3Q15C 4HX9A 4B3CA 4BVGA 1TKBA 3DNMA 4GRAA 1PZFA 4KFTA 4KPFC 1IHUA 4XOIA 5JBIA 1I51A 2RIRA 1I4DD 4UOQA 1SNYA 3K0CA 3R7BA 3WGUA 1NVAA 4OU4A 3TRKA 4U02A 2GPWA 3W2IA 3J81k 1G5IA 3I32A 3RUIA 1X14A 5AUNB 3LRXA 4MRAA 1RRCA 4LY0A 1MTOA 2QAGA 1VBNA 1B8PA 3HCFA 4XZ3A 4BKUA 3GNLA 5EP3A 2ZATA 2ZSFA 5JY1A 4Z0PA 4JQOA 3RT1A 3GVIA 1MB2A 4OEHA 2PY6A 5TMDA 4ACAA 3SC6A 4TQ9A 5FPYA 4JLAA 5B37A 3DCJA 3F5FA 3W3ZB 2AGVA 2IIBA 3CRVA 2GBFA 1LJLA 1WZEA 1KOJA 5DMXA 2YTZA 1ZJWA 1W5AA 2YS6A 2ATCA 2XUAA 5JXJA 3BDAA 3I4FA 4HWGA 4PHHA 3UFBA 1AA6A 1FUEA 3R7WA 1N8TA 2G1PA 4FE3A 2XUDA 4C5CA 1FB5A 1F14A 3KT0A 3OJXA 3BXOA 2IU4A 4F3YA 3T5AA 4S05A 1TA9A 3N8KA 4YVFA 4FZ5A 1NBIA 1PGOA 2C2GA 2OLEA 3BXGA 3DSRA 3GLHE 1H0KA 2NV2B 1YMQA 3JW8A 3SX4A 5I7HA 2ZS7A 4MUIA 1ONSA 2OFXA 4EB8A 5C0OE 2CFRA 3N2IA 2XA9A 4OI4A 3I0NA 4GLOA 3H86A 4LXTA 4JJKA 5EP4A 3RHSA 3KTDA 1Y9ZA 1Z3CA 3LQRA 2ID7A 1KYYA 3T6KA 3LSTA 1U8YA 2P0YA 4N0QA 3MWDA 3IP5A 1L6IA 3PGMA 3BXPA 4QTUB 1UEIA 3U3MA 5BYKA 1RWBA 3RYHB 1M3SA 3KKZA 5KNCA 4M0MA 5FQNA 2HPVA 1R5NA 3I42A 5C18A 1XI2A 4UASA 4E1BA 3GARA 4FNOA 4N48A 1CXZA 3PEVA 3NALA 5LA6A 5YASA 3WXBA 3G9QA 1SWWA 3FCYA 4A5OA 2BDTA 2NVUA 5DSZA 4KI0A 2E0IA 2I99A 5ALOA 4YUZA 4ALNA 2HLDA 2O3SA 3OZEA 3KDPA 1UJ5A 4ZARA 1Y9JA 4LK2A 2Y0PA 3RBZA 3TGWA 3KT6A 1SCDA 1Q1GA 3L6CA 4RIGA 3G8CA 3NOVA 4RD4A 2IK8A 5JSKA 4K9NA 4B45A 2FK7A 3LLSA 5JARA 3MELA 3NHWA 5JS7A 5G4KA 4ZOLF 5KJCA 2YS7A 1LD3A 1LDYA 2WV7A 2CUZA 3WI7A 5KVSA 2VVTA 4M88A 3WQBA 2ZRCA 1N5MA 4C7OA 3UICA 3WGIA 1Z8HA 3E05A 4C9BA 2PTHA 2GLXA 4MNTA 2H1LA 1X7ZA 5KZMB 1VPWA 1SCBA 1T2VA 5GONA 5KQRA 4D9GA 4RVNA 4YONB 1BRTA 2RIPA 3NTXA 4TZKA 5AKZA 5T4FA 2N1MA 3KQVA 1FBTA 4RF3A 4FGZA 1TM2A 3WTBA 3F9RA 1VIAA 4G0OA 3K9FC 5T4EA 3IOCA 1S4MA 4C89A 3I2KA 4YH1A 3TZQA 5IHPA 4JI4B 1FFXA 3X1JA 1G20E 2FR8A 2F6RA 3U49A 3HA2A 3IR6A 4OHRA 3RK1A 4UHHA 4D8VA 3C4JA 1TZCA 4C6HA 4BP9A 3LQ4A 2PKXA 3AX6A 5A4AA 3ZQJA 1K5PA 2CXPA 4NARA 5J5CA 4KPEC 1P3JA 1X7WB 1JJIA 1S2IA 3HU1A 4FN5A 4JDUA 1V9CA 4ZVLA 1J0DA 3ESCA 3HXMA 3NCTA 3BXXA 2DCUA 4UAUA 4ZOCA 3WFIA 3AY3A 2M6LA 4DE5A 1ATZA 1ICIA 3GZTB 3MOIA 4I14A 2F3PA 3GFQA 1BSVA 4LHXA 4P4TA 1G2PA 5DNAA 5GV8A 5ITVA 3B85A 1KVQA 2IW1A 1HSZA 2G5CA 1FS6A 2J5XA 3ELYA 1V96A 4JP5A 1GKKA 1PNVA 1GAEO 3C6ZA 3T5TA 4Q9LA 4ZAFA 3W3AD 4DM7A 3RYCA 2XVXA 1JWBB 1XELA 2FEPA 2NADA 3UAZA 4QDTA 3IX7A 3DVAB 3LCMA 4GUAA 4F8JA 3WWYA 3TAUA 1Q0QA 3HKDA 5TQ2B 1WMBA 2J09A 4MVWA 4YAJA 2WFMA 3DNFA 2W2OA 3R40A 2Q7OE 5TEVA 1VJCA 3RC9A 2D1YA 3IV9A 2V3VA 3C5WP 2RHTA 1NXTA 1X94A 2WYOA 3U5ZB 2JCSA 1G19A 4D02A 4ND6A 3IHTA 3R3VA 2PS0A 2YZNA 3BK1A 4PZUA 4JENA 1VMKA 2ODNA 4EVQA 3ROZA 3IS3A 3LP8A 2CMKA 1SUSA 3PPWA 5E0KB 3CNLA 3EEOA 1AZTA 1N2OA 4B9AA 1QX4A 5TPWA 2A5DA 1FP2A 3OLYA 4QECA 1EVLA 1FYDA 3ONDA 3RIMA 4JHLA 2BCGY 3L6DA 1SUFA 2F9MA 2WRZA 1T5OA 3I2YX 4WZZA 3PEYA 5EAIA 1E6LA 2GKOA 1TLLA 2I2DA 4P0QB 2Z2XA 3LVBA 4IJUA 2WFLB 1US8A 1T1EA 2FG6C 2W37A 3GJ7A 1T3LA 2R65A 1W5FA 2FF7A 3MWJA 4Q4DA 5IP5A 2ONKA 3AXTA 3I1IA 3JD4A 4JFAA 3T3EA 3QVTA 3V4VB 2O8EB 3V4LA 4EJSB 3OIVA 2PAFA 1LW6E 4DLUA 5CK4A 4N0DA 5DX0A 2GBPA 2AFIE 3P9XA 2ZTSA 4JL8A 4MLZA 3ZGLA 4JBLA 4HDMA 4NQZA 3D5EA 5AK5A