2P4HX

Crystal structure of vestitone reductase from alfalfa (medicago sativa l.)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
310
Chain Sequence
KGRVCVTGGTGFLGSWIIKSLLENGYSVNTTIRADRDVSFLTNLPGASEKLHFFNADLSNPDSFAAAIEGCVGIFHTASPIEIVTKRTVDGALGILKACVNSKTVKRFIYTSSGSAVSFNGKDKDVLDESDWSDVDLLRSVKPFGWNYAVSKTLAEKAVLEFGEQNGIDVVTLILPFIVGRFVCPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDELKEIKGARLPDLNTKKLVDAGFDFKYTIEDMFDDAIQCCKEKGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.).
pubmed doi rcsb
source organism Medicago sativa
molecule tags Plant protein
molecule keywords Vestitone reductase
total genus 108
structure length 310
sequence length 322
ec nomenclature ec 1.1.1.348: (3R)-2'-hydroxyisoflavanone reductase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2p4hX00
2UUPA 1LSJA 2V6BA 3G1UA 4XKJA 1ADBA 1UP4A 2HJSA 1A9YA 5T5QA 3E03A 2J6IA 3QVSA 4MVJM 3ZNNA 3WX0A 5BT9A 3O38A 2C2YA 1XR3A 5HM8A 1GYQA 3DOJA 4J4BA 5COBA 3BMQA 2X0NA 4IINA 1P1HA 4E2WA 1I33A 4TKMA 2Q1SA 2DFDA 4ALMA 4PGFA 3PYXA 4E5KA 1GQQA 4OXKA 4MVJA 2EW8A 2YZ7A 4ND2A 5JAIA 3T7CA 1O5IA 2VZ8A 4JN6B 2ZQZA 3DZHA 3LVFO 5THKA 2IODA 3KYCA 1VKOA 4RLHA 1NHWA 5DN9A 1ZKMA 5ITWA 1IB6A 4NH4A 1ZMOA 5F1OA 2AG8A 1ARZA 3IL2A 1KVTA 1E5LA 2J3JA 2PD3A 2E49A 3GNQA 3QV1A 3BIOA 5JMPA 3QWBA 3MTGA 5T8KA 4R9SA 1KEUA 1MC4A 1NBOA 1OOEA 2Y68A 3GOHA 3H8VA 1I0ZA 3AJRA 3LC1O 4TRMA 4X54A 1PJLA 1AXEA 1BXGA 3AY6A 4XD2A 3BXXA 4KDFA 4GKBA 3P2OA 4ZU3A 3Q9NA 4IDCA 5F5NA 3V8BA 1J5PA 1Q0QA 3VPSA 3KVOA 4LRTB 3PJGA 2X5JO 4NFYA 4IQGA 1UDCA 3JD0A 3ULKA 2ZTMA 4KUGA 3WB9A 4L73A 1HE5A 3MOGA 1ISMA 5TRTA 4G65A 1M6HA 3IJPA 1MA0A 3PXXA 3NV9A 2Y05A 4QXMA 1U9JA 4M8SA 2ZKLA 1FDTA 3OJLA 3C1TA 3BYZA 4C4OA 2OBYA 1WDKA 4YWJA 2V6GA 4XJTA 3DO5A 1VSUA 4FFPA 1RM5A 2WE7A 1ZVMA 1MXFA 4AJ2A 4J3FA 5BNTA 3HDYA 2G82A 3GPDG 3L4BA 1ZJYA 1PJSA 5KNLA 4LCJA 2HKIA 3WMWA 2YQ5A 3EW7A 5TC4A 2Y1OA 3G17A 1DRUA 3MWEB 1O89A 4OQYA 5COQA 4P22A 3F6YA 1IOLA 3AUTA 1C0KA 1XHLA 3O03A 3L9WA 1DC3A 4TMFA 4EEXA 3BAZA 5JDCA 2EP7A 4RF2A 4B3HA 3AUAA 3E9QA 1AE1A 3OP4A 1CQIA 2ZB3A 4E5MA 1P44A 3A4VA 1JU9A 1OMOA 3BMNB 4XCVA 3RAJA 3C85A 4JQCA 4OOFA 3Q9UA 4OOEA 1YWGO 4YA6A 3QJ5A 5DCYA 5AXCA 4E6PA 4G5HA 4AG3A 3FCOA 3KRTA 1AUPA 4QUKA 1PJQA 3FI9A 1OAAA 4OXNA 3WJAA 4IBOA 4JGBA 3UGKA 4PIVA 5KKCA 1MV8A 3HG7A 3S55A 3DZBA 2CSUA 3EZLA 4H16A 3C1OA 5FYDA 1DHRA 2DBRA 3GR6A 4XX0A 3BZUA 2Y1DA 3OIFA 2JFHA 4P4LA 5HBRA 2ZTLA 3JSAA 1WXDA 4DLAA 1UXGA 2DPGA 2PY6A 3HDHA 4J9UE 3ETEA 4DC0A 3M6IA 4B7CA 4YDRA 4UUOA 3TZHA 3GQVA 5DCWA 3HB5X 3M1LA 5GZ3A 1LQTA 3NDRA 5HA5A 4IMPA 3LZ6A 3OICA 4I08A 4DMLA 4DIBA 2BH9A 2X5KO 1QYCA 1LX6A 1B0AA 1VI2A 2RAFA 4BGEA 1SMKA 1Y1PA 2VYND 4EYEA 3DTTA 2Q1UA 3N7UA 2E37A 4W9NA 3FRJA 5IZ4A 3QSGA 5FEUA 4GX2A 3E18A 2NU7A 4Z9YA 5BSEA 1E1MA 3RC7A 2P4HX 3HFGA 1JAXA 3HHPA 4WCFB 2HRBA 4HFRA 3U4CA 4BGIA 1P0CA 2OL4A 1RM3A 1VJ0A 2W2KA 4M55A 4B7XA 4XRRA 1EDOA 1RJWA 3I23A 2AE1A 1HLDA 4XYMA 1MB4A 5AXBA 5A06A 3MWDB 4GL4A 5KJFA 5T67A 1B16A 4Z6KA 2HMVA 1NFRA 1I10A 3GN2A 4HNHA 3M2TA 4U8GA 4A7PA 4PLCA 2R00A 1X1EA 3JYQA 4U6SA 1QKIA 3UVEA 3PZRA 1HYHA 1N5DA 2RIRA 2B5WA 2ZYAA 1GUYA 1JTVA 2D0IA 1BW9B 4WLEA 1U3UA 3WJ7A 3H9UA 4UUNA 4WJZA 3SC4A 2J3KA 4ZN6A 1ZSVA 4LMPA 3BMQB 1DRWA 3TRIA 3NDJA 2FSVA 5KVQA 1D1SA 2Q99A 2C5AA 4ZRMA 5CPBA 2HDHA 1MXHA 5BQFA 3TJRA 1RKXA 1U7HA 4RPGA 2NVUB 3SJUA 4DIOA 1HDRA 5JLAA 4CMAA 4BKOA 1A72A 4UVDA 1B15A 5L51A 4D43A 1CJCA 3QQPA 3WR5A 1U28A 2NVBA 2VUSA 3VKUA 2ZB4A 2GR9A 1U8FO 3IUSA 1RYEA 3CMCO 4PVDA 2VTEA 4NBVA 2VRCA 3VPHA 4CM9D 4Y6RA 1KIFA 1H9BA 5CDSA 1V3UA 4OGWA 3QHAA 1IUKA 1MFZA 1O95A 2ZJ0A 3G1TA 4GWGA 3ZV6A 2VYVD 1Z7BA 3AI3A 1W6UA 5B12A 1LLCA 3UHAA 2ZATA 1ZK3A 3FPLA 5JDIC 4ZJUA 3PJFA 4NJOA 3LYLA 2YHUA 1V0JA 2X58A 3RC9A 2QHXA 3VZSA 3DBLB 1NP3A 2YUTA 4R69A 4I5GA 3Q0EA 2WEKA 4BIIA 1JVBA 2W8ZA 1KVUA 1M66A 4ZA2A 4BNXA 3EYWA 4BNHA 1PJTA 2OUIA 1ZSYA 2VUTA 5BNFA 3WBBA 2IXAA 4E33A 4HADA 1H6CA 4CUZA 1BHSA 3DMTA 4RPKA 4TQGA 4BNFA 3KUXA 2FZEA 4WUVA 4CODB 4P4NA 1E3IA 1KVRA 2D59A 2X9NA 3WTBA 3FBGA 4IDAA 4DUPA 5DP2A 5U1PA 1H0KA 5H81A 5KVCA 3MOIA 4XZ3A 4ZVVA 4CV3A 4AJ1A 4AL4A 1FK8A 2NSDA 4UAGA 2YDYA 2C20A 1B8VA 2B35A 4PLHA 4L74A 3H7AA 3GA0A 4OXYA 1HZZA 3WGQA 1KC3A 4CQMB 2E82A 3PFWO 4P38A 2Q4BA 2EGHA 1DC5A 2DLDA 4NQZA 5HS4A 3DEYX 4R01A 4UREA 4CLRA 2X0IA 2A4KA 5FFFA 4BNGA 4YAKA 5C7IO 3H2SA 3RI3A 4BNTA 5TQVA 1SCUA 2WM3A 1I30A 3MJCA 5DNAA 5JNLA 4YJHA 4BS9A 3NAQA 2HK7A 3HE3A 3MJSA 4MVJP 4WASA 2OFPA 1DRVA 1EVYA 2YYYA 3JQFC 1JKJA 2NUAA 2O3JA 3RASA 1TVEA 3H3FA 4CUKA 1PIWA 1V9LA 1GADO 3GVIA 4BKUA 1C1DA 3HNPA 3KTDA 1U1IA 1ZFNA 5IZCC 1ENOA 2ET6A 3IC5A 5MGBA 1ZZEA 1XELA 3LK7A 4DLBA 1NFFA 2YHIA 4O5OA 3ENKA 3W4JA 2ZQYA 1K2WA 4FDAA 4CMEC 1EVIA 4ZICA 4B8WA 3GPIA 1BVRA 5FI3A 3ITDA 5JAMA 4UVEA 4DYDA 3AI1A 3BTVA 2O3SA 5IZCA 1Z45A 3DQPA 2P9GA 3WG9A 3ST7A 4A10A 1EUDA 4WLVA 3R0IA 5B1YA 1UZNA 3ZWXA 2DBZA 1Z74A 5DDIP 5A9SB 4PLTA 3VH4A 3VAZA 1NNUA 3OQ1A 1WMBA 1PGPA 1EK6A 4IGEA 4B4WA 3KSDO 1LDGA 1BDBA 1XQ1A 1RPNA 1Y9AA 3MTJA 3DOOA 2GNAA 4FGWA 2A35A 2IRWA 4BNVA 1KY5A 4NFHA 5DBGA 3GUCA 4YT8A 2R6JA 1CIVA 3FN4A 5K6AA 1HDYA 1TT5A 3PLNA 4FC6A 1IHXA 3NT5A 3L6DA 5DBIA 5JE8A 5TIIA 2OP1A 2Y1EA 2FP4A 1ONNA 3ROKA 4AJOA 1PQPA 2DTDA 1BW9A 2X5OA 5EMHA 1PL7A 1YBVA 1U4OA 3GGPA 3AFNA 4L76A 3GK3A 5G0VA 5B37A 4YJFA 4B4UA 2PD4A 2FPIA 4CLOA 1YS4A 2QQ5A 3WQRA 4DQVA 1NWCA 3PHLA 1XGKA 4QX6A 3C7AA 4LGVA 2GD1O 2I3AA 3PHJA 2X1HA 3AM5A 2A9FA 1P1RA 5TT1A 5IDQA 1LA2A 4IQ0A 3NGLA 3ONEA 3QWFA 4TVBA 4YQZA 4DTIA 3ZNOA 1KEWA 1SC6A 4CM4B 3GMSA 2RHRA 1CYDA 4U0KA 1PSDA 2NLOA 1NQ5A 4J4TA 5COAA 3NT4A 4FOSA 1GEEA 1T2EA 2LDBA 1DLJA 3INRA 1MFPA 4YJDA 3TZCA 4L8VA 2HAEA 4KZPA 2GZ2A 2O48X 4R5MA 1HSZA 3HZZA 5IXYA 4PRLA 4QT0A 1X7HA 3PDJA 3NX4A 4L4XA 2Q1WA 1B3RA 2OO5A 2NVUA 3ZU5A 1GU7A 2UV8A 4CL3A 1KVSA 4GH5A 1AN9A 3PWSA 3I52A 3GRPA 3K6JA 3T4EA 4WOJA 2SCUA 3FWNA 1YL7A 1PEDA 3TDKA 3PHGA 1MC5A 2LDXA 3KLMX 2NU8A 1P1FA 1PJ4A 4DL9A 1JWBB 5C7OO 1OBFO 4J7UA 4GSLA 4NBUA 1IL0A 4FJ2A 4CQLB 3RC1A 3VHRA 3OBBA 2RCYA 4CM8A 2PV7A 1QSGA 3H5RA 1Q0HA 4E0BA 4BQRA 2P9CA 3D3WB 1NPDA 4NHEA 5G0UA 4AFNA 2Z1MA 1XU7A 1VPDA 3C1AA 4LN1A 1QV6A 5G4KB 2PWZA 1IZ0A 5GMOA 1KERA 4KP7A 5A5FA 1U2DA 1E7RA 1YL6A 5F5LA 1PZFA 4CMIA 3JD4A 1GZ3A 4U6QA 3EZYA 1Z7EA 3GVCA 5KJEA 4LCEA 1JKFA 1MG5A 1VM6A 1IE3A 3RSHA 2YJZA 4DMMA 5JCJA 3ZWBA 3UUWA 4CMCA 5B4VA 4IDFA 5DOVA 1OFGA 2AMFA 3AUUA 3D4OA 2X6TA 3NTOA 2G17A 1HKUA 3Q6IA 4E2YA 1H94A 3OETA 1K89A 4GX1A 4FD3A 1M2WA 4R4JA 1GPDG 4BO6A 5A9SA 1ISIA 3I9LA 2WDZA 3ZW9A 5KOIA 2TMGA 1U4SA 2WWRA 4LVUA 2B5VA 1GY8A 3RJ9A 3CPSA 4MVJD 9LDTA 3QLJA 3GH3A 1QLHA 3CKYA 4IDBA 4NBTA 3RCBA 4CV1A 5ER9A 1HYGA 4JROA 1A4UA 5CDYA 3RU7A 1MLDA 3G0OA 1WDMA 2O2YA 5IG2A 5KVVA 1K5HA 2HLPA 4CMKA 5CPFA 2H1SA 5CG1A 1HE3A 2BMAA 1HYEA 3LLVA 4WEOA 2GLXA 3D3EA 4LVCA 2O2SA 4WGGA 1UR5A 4DA9A 3IS3A 2FR1A 1Q7BA 2CVOA 1PZGA 3ETDA 5EINA 3KSZO 1LDBA 3DHEA 1FDUA 4YTEA 3O8QB 1CWUA 4M87A 4DXHA 1W4ZA 4R5HA 4D46A 3H9GA 5JW6A 3U62A 3L4SO 2X9GA 1E7WA 2HK9A 5EESA 3KB6A 4CLHA 3CXRA 3EVTA 2EWMA 4HY3A 5A3VA 3LT1A 1PS0A 1M6WA 1QXSA 4E2ZA 4FC7A 4YPOA 5IN4A 5JFOA 2NACA 1BDMA 5JSFA 2EKQA 1H5QA 3PJDA 1X14A 3ORFA 2H5LA 4OIMA 1W8DA 1HF3A 4Z9FA 2W2LA 4H3VA 4JBHA 2B36A 1NVMB 4NPCA 1DO8A 2O23A 1SOVA 4CMJA 4HBGA 2D5CA 4S3MA 3RC2A 4CLEA 3WGTA 2YHIB 1WAMA 3WYEA 2DBVO 4IQ8A 3A28A 4Y67A 4FR5A 3DTYA 2PZLA 1HWYA 3BMNA 3PRJA 4BKQA 4LSWA 4M54A 2OGUA 4MP8A 4F3YA 3H4VA 4GSKA 5L45A 3WLFA 2XOXA 4XIYA 4TKLA 5LCXA 3DHNA 5FF9A 3VVCA 4TRNA 3ZWWA 4E21A 1WZEA 1I5RA 4EI2A 1U2GA 4CLRB 1N7GA 2QZZA 1RWBA 3VPFA 2Q46A 4O59O 1UXIA 5TS3A 2Y1FA 1DFGA 3H9EO 2Q45A 3PLRA 3GNTA 3F1KA 4XQ9A 2G1UA 1XYGA 4YQYA 4Z3DA 3F3SA 3ZWAA 5JYEA 1U5AA 1ZEMA 3RUCA 4CUJA 1E1NA 5ICMA 4D45A 1X7DA 2PLAA 1JA9A 2QRJA 3E9MA 4MIYA 2JJYA 3GVHA 3AOGA 5G2OA 3TQHA 2UUOA 1Y8QA 1A9ZA 1BXZA 2J5KA 3EUWA 3I9OA 4KQWA 3KYBA 2C7GA 4Z9XA 3HDQA 4DGSA 5TF4A 4E2XA 1XDWA 5TNXA 3TFOA 6ADHA 4R3NA 1OZAA 1R0KA 2PH3A 1G0OA 3BMOB 4EITA 2HO5A 1Y8RA 1LLUA 4ESOA 2ILTA 3VH1A 3TPCA 3LT2A 4YT2A 1JAYA 2C7VA 5ILGA 5C7LO 1GYPA 3GGGA 4MKXA 2D8AA 3DBHA 3TSCA 1HSOA 1YB1A 3MJ4A 5GZ1A 1T4DA 3EGOA 4E5PA 4DIFA 2ZK7A 4OAQA 4FB5A 3IKTA 1XSEA 4BNMA 3OA0A 5L3ZA 4PZDA 4HKTA 3GVXA 2FHSA 3ZNPA 3W8DA 1LRLA 3I5MA 4WK6A 3TZ6A 5L4LA 3DXFA 4GVXA 5GZ6A 5AXDA 1JLLA 2VT3A 4FW8A 2CF5A 1BRMA 1DC6A 4MDHA 2VQ3A 2DUWA 2YV1A 1FMCA 4PCVA 2OXIA 3HJAA 2NTJA 4J6FA 4NU6A 4DBZA 1IY8A 1Y5RA 1UP6A 1V35A 4YAEA 1ULUA 5G4KA 1D3AA 4WEQA 4BO5A 4CQMD 1V3TA 3TZQA 2H63A 1P1JA 3PQDA 1GTMA 4NU5A 4EJMA 3ROPA 3OH8A 3HSKA 3MZ0A 1I8TA 4HXYA 4W4TA 4YB8A 3GNSA 5DBFA 3MEQA 1BXGB 1OI7A 4YJFB 1ZK2A 4NI5A 1GYRA 3P5SA 5L53A 4FOOA 3GLQA 1BWSA 4OKNA 4NNJA 3ZZNA 3SXPA 4DC1A 5TJHA 5C37A 4ZHSA 2WJPA 3NUGA 3VKVA 1AHHA 4CV2A 1IULA 3DBVO 2ZIZA 2BLLA 2HK8A 4BNKA 3FF4A 3ZHXA 1PWXA 1KY4A 3ITKA 3OQBA 3HADA 1U7TA 4ND4A 3HN2A 5DULA 4PLGA 2DVMA 3Q1LA 5T64A 3RU9A 3WNQA 3W8FA 1D7OA 3F4BA 3B70A 4CMGA 4PLWA 4KQXA 3RWBA 3JQEA 3U9LA 1P74A 2IEBA 2FY8A 5AYVA 4L4SA 4ZD6A 1KVQA 3OEWA 4BNZA 1SEVA 2Q49A 4P8RA 4E13A 5L9AA 4GX0A 1PTJA 1QYWA 2XPCA 4QO8A 3PJEA 2GN8A 3CZRA 3PI7A 1M67A 1EFLA 2CDAA 2G0TA 2PZKA 2Q1TA 2WTBA 2V65A 2Y93A 3K92A 4XJSA 4ZGWA 1EEHA 4AJKA 3JQGA 4R54A 3TWOA 3PVZA 3E5MA 4FCCA 5TGDA 1YQDA 2AA3A 2W4QA 3I6QA 4BNIA 2ZCVA 2VNSA 2Y0DA 1EK5A 4RVSA 3B20A 3PHIA 1PL6A 3KHUA 2ZB7A 2I99A 4NR0A 2O7SA 2DM6A 4J7XA 4ALJA 4CJXA 3UOGA 3QWHA 4IJUA 1Z82A 4YRBA 1KEVA 4MKRA 4G2NA 1Y8QB 2HMSA 3CEAA 3KETA 3Q3CA 3QWIA 2X0JA 3AM4A 5EL0A 1UDBA 1G0NA 3U4DA 4A0SA 4BVAA 5IDXA 3VZPA 1ZH8A 3L0DA 1FDSA 4MP3A 3LF2A 2B0JA 1HDOA 3EY4A 5T8KC 4BNLA 3ANMA 3QVWA 3SC6A 3CSDA 2GRAA 2F1KA 2XXBA 2C0CA 1H93A 3ZWNA 3KEOA 4OSOA 4Q9NA 1YL5A 2PKQO 3PDUA 4RL6A 2HMTA 3WIDA 4EGFA 2PNFA 2JD0A 4WCFA 2PFGA 1DEHA 1B26A 1XQ6A 2Z95A 3HUDA 3LSYA 3FR7A 4WOKA 1JKIA 4PLZA 3V2UA 3K2EA 3ZWMA 1I2CA 4J0EA 2GSDA 1Z73A 3BMOA 5BSHA 1Y7TA 5CAEA 1HETA 5K6AC 2CMDA 2G76A 3FBTA 4KDEA 4D41A 4R1SA 2X4GA 3I9NA 2VNAA 3PIDA 5HS6A 1IPEA 1WZIA 2UDPA 4TZKA 4OQZA 1SO8A 4YAJA 4D3FA 1D8AA 1EMDA 3NRCA 2AQHA 3GGOA 3IDSA 2HRZA 4J0FA 3FNFA 5L4SA 1PX0A 4CR8A 4PG5A 4LISA 3PYLA 3VVBA 4NG5A 4BNYA 1ZSNA 1EDZA 1SOWA 1R6DA 2D1YA 2PKRA 5EIOA 1X13A 1YJ8A 5J23A 1E7SA 4BMSA 1TT5B 3I3OA 4NJMA 2PTGA 2OP0A 1EBUA 3W6ZA 3D64A 4QQRA 4L9RA 3M2PA 3K96A 3KM0A 1WMAA 3V5NA 1I2BA 4Z0TA 3WGHA 3JYLA 5HRUA 2P91A 3DAPA 4HFMA 1QYVA 3NT2A 3Q2KA 4FPXA 3NEPX 4IY1A 1TXGA 3JYOA 4ALIA 3QVXA 2D3TA 3ICPA 3P7MA 3R3SA 3AU8A 1NQOA 4MVJG 3K73O 4MINA 2O50A 5ITVA 1ENZA 1MG0A 4YACA 1DFHA 2GDZA 4EJ6A 3JQ8B 1LDYA 3ROQA 1P77A 2BGLA 3DWFA 4CMIB 4D3DA 3ZHBA 3WFJA 2HMUA 5THQA 4M1QA 2NU9A 1PQUA 2WYUA 3L9XA 3W4IA 1VL6A 4JLWA 1XIVA 3NTQA 3D0OA 1YXMA 2JCXA 1E6EA 4LRSB 4N5MA 2WD8A 5JDIA 7MDHA 1OC2A 2GZ1A 3C24A 3L6EA 2O4CA 4IS2A 3ZU4A 1H6DA 3GUYA 3U3XA 1IHYA 2NTNA 4WLOA 1N9GB 4OYRA 4DQXA 3O4RA 1BTOA 1PJ2A 1TB4A 2PR2A 1N7HA 2FSSA 2JL1A 4BO2A 1KEPA 3E9NA 1K3TA 1QG6A 2JKVA 3RJ5A 5CHEA 3MCVA 2FPPA 4N5LA 3GMDA 1E6UA 3PGJA 1DC4A 4DYVA 3JYPA 2ZJ1A 2ZYGA 2DTXA 1PWZA 2NM0A 1DIRA 4DVJA 3A1NA 1QR6A 3H65A 4KUHA 3TF5A 1B7GO 1DIHA 1Y6JA 3H2ZA 2CUKA 4RPLA 3GDFA 2GUGA 5L95A 4RZHA 4QO7A 1HE4A 4FQ8A 4PLYA 5L7WA 3K8ZA 1GZ6A 2ZTVA 3DL2A 1LRKA 3KOUA 4EZBA 3U49A 2W2KB 2Y0CA 1QORA 1ISHA 1DPGA 2PGDA 1QMGA 2ZCUA 2VHYA 1DBVO 3AFMA 1PQWA 1WWKA 1Q1NA 1YDEA 4PRKA 3KYDA 1NM5A 2VT2A 5JAZA 2GPTA 3RUDA 5G0WA 5IAAA 1NR1A 2VUUA 2Y1GA 1G1AA 2PGJA 1Q7CA 3ETGA 2I5PO 3BHIA 3PTZA 1EVJA 4J43A 1GUZA 1IPFA 3FWZA 2RBEA 4U5QA 2RH4A 3LF1A 4JCOA 1ML3A 3ZWOA 3EMKA 4RVUA 4PN3A 5IFLA 2FMUA 4LSMA 5I7FA 3BTSA 2EJWA 2OMEA 4DREA 1VKNA 4Q3NA 1A7AA 1H6BA 3U4IA 2IE0A 1AHIA 1F8FA 2GO1A 4RF3A 1AXGA 3H3JA 4HFNA 3ZHYA 4BHTA 1J0XO 4PZCA 4W6ZA 3WFIA 1X7GA 2YV3A 4Y8VA 1E3WA 1PR3A 2J3IA 4K6CA 3BMCA 3DAGA 2JFFA 3PHHA 4R41A 5DT9A 4LW8A 4A03A 4IPTA 2C54A 1PGNA 3FD8A 1E7MA 4Z0HO 1Z6ZA 3JYNA 3UH1A 2EERA 4PZEA 4S1VA 4XA8A 1B8PA 4JIGA 2HMWA 2JD2A 4OO3A 5ER6A 4GBJA 3GFBA 3GT0A 3OHSX 5EN4A 5F3RA 2HU2A 3NYWA 4OMUA 3UCFA 3IP1A 3UXYA 5CDGA 3DZKA 1KOLA 2R2GA 1I24A 3ANLA 2QIOA 4B4OA 1GL3A 3OECA 1EE9A 3PZBA 5JYDA 4E5YA 1Q2XA 1F17A 1SZJG 3GEGA 4I9UA 3GDOA 3LDHA 2VWGA 2RHCA 1CETA 1X0XA 3INGA 3VC7A 2GASA 2P5UA 1HLPA 3QWAA 1J6UA 5DZSA 4E12A 4DWVA 3L07A 3Q2IA 2FRDA 4IDEA 2Q50A 3OEYA 2O3QA 4BB6A 4NIMA 1YDWA 1ENYA 3O9ZA 1ADFA 1CQJA 4CLDA 2H9IA 3TN7A 1JWAB 1T24A 3FNEA 4WPGA 3WLEA 2Y67A 4O6VA 3S2FA 3CTMA 3R3JA 4ILKA 1WDLA 1DDOA 3V1YA 1FXSA 2P5YA 3QY9A 4KOAA 4E31A 1D4FA 3FSRA 3GAFA 2R00C 1I01A 2CNBA 4CM4A 2PKQP 4INAA 1H9AA 3CE6A 1B3BA 3NJ4A 2E48A 4YRAA 4Q3EA 3KSUA 3A14A 4I9HA 3JQFA 3S8MA 3DONA 1L7EA 4YXFA 3KEQA 2NTVA 3PWZA 4IUYA 3WXBA 4CM9A 1XKQA 4IM7A 4FS3A 4W99A 4IJWA 4XWYA 2AQ8A 5EPOA 2BFMA 4CMHA 4EEZA 1QLJA 5ENDA 3WQSB 4RLSA 4ZRNA 1NVTA 5A03A 3JQAA 5B4UA 3A06A 1VSVA 1UAGA 3EK2A 4O0LA 4H15A 3JQCA 1I36A 2OZPA 4XDYA 1T25A 4RORA 1J4AA 3LQFA 3ZDFA 2X8LA 1LLQA 4J49A 4RQUA 5EERA 3AI2A 1NXQA 3RVDA 2Q3EA 3IMFA 3DBRA 4GAEA 3D3WA 2Y99A 2ZTUA 3NKLA 5JC1A 4RPHA 4UUPA 3RFXA 4OJNA 4A26A 1GQYA 4HP8A 3ZWYA 1A71A 3B1KA 1ULSA 2Q4EA 4I8XA 5DOZA 1MX3A 1ZEJA 3DR3A 2GN9A 3K9QO 4PG6A 2WD7B 2UAGA 3H9QA 1PJCA 1EUZA 2BHLA 4EW6A 1ZCJA 3FNHA 3F9IA 7ADHA 1P9LA 3JV7A 4UVIA 1H2BA 3PQFA 4E3ZA 2V6MA 4CMBA 3VDQA 1C1XA 1C14A 2VHZA 1RM4A 4BO7A 1YJQA 5KKAA 5A02A 5LC1A 4YJHB 2VWHA 4Q39A 3AUSA 2DQ4A 1O94A 4N5NA 4GQAA 2J5QA 3W4KA 2BD0A 2Y0EA 4MPDA 3UCXA 3GDGA 5CP8A 2ZB8A 1EFKA 1GV1A 1DIGA 1PJ3A 3F1LA 1KETA 3TOXA 3ANNA 3W1VA 2C82A 3K31A 1S6YA 3JTMA 1DLIA 1R4NA 4YYZA 1DOHA 5KTKA 1DHTA 2BI8A 3SVTA 2O3UA 1SBYA 3JQ7A 3QP9A 3TL2A 4GMGA 3WBFA 3D5QA 2C07A 3GFGA 4NFSA 4IJKA 4EUFA 4AJPA 2IEDA 4F6LA 5JY6A 2VWPA 5U4QA 2O3TA 2O4UX 2BGMA 3MJVA 4XR4A 3VDRA 6LDHA 3PYMA 1JW9B 2HJRA 5I8ZA 3WGGA 4DQUA 2NQTA 3Q11A 5I8WA 3DZJA 3PQEA 5A9TA 1FF9A 4FFNA 4RF5A 1BG6A 5IJZA 3ZU3A 1EVZA 1HTBA 1T2CA 3OJEA 2X86A 2EKPA 1MGOA 3JQBA 4FJ1A 4J2HA 4DPKA 1W0CA 2JCYA 2YV2A 5JXWA 3S2EA 1WP4A 3IJRA 5KJCA 4E4YA 4MP6A 1Y81A 2DBQA 2I9PA 2CF6A 1DB3A 3AOEC 4K6FA 2CFCA 2VOEA 3HFSA 2IXBA 4B79A 3WTCA 3DOCA 5HWSA 1UZLA 1CERA 1UUFA 5LDGA 4RDIA 3GEDA 5TLSA 3PK0A 1GQ2A 1R4MB 1UZMA 1M76A 2NNLD 1XLTA 1I3MA 3GHHA 3KYCB 3U09A 3DZFA 4WNCA 3WYBA 3H5AA 4QSMA 1GFSA 4YJGA 5F1PA 3V2GA 1BSVA 5EJ2A 1BGVA 2EP5A 2JD1A 4URFA 2B4RO 5IDYA 3W6UA 4R1TA 4YRDA 2J8ZA 4F46A 5JBIA 4GI2A 2X22A 4BNWA 4WECA 1P1KA 1EQ2A 1R0SA 3D1LA 4BKPA 3WGYA 3ZI0A 1E3LA 1NPTO 3ADPA 4XYEA 5ILOA 1JVSA 3GRKA 4ZQEA 4MIOA 4ONEA 4BO8A 4E5NA 1QV7A 1ENPA 4W9NC 4XRGA 4RVDA 4CLOB 4NK5A 1Q7GA 1XEAA 1HL3A 4Y98A 2AG5A 4ND1A 1T1RA 4GPD1 2E4AA 5LDHA 5AOVA 4F6CA 1ID1A 5KCZA 1O0SA 2AHRA 3RD5A 3L6OO 1YVEI 1LDNA 2AW5A 4A27A 3H5NA 3A9WA 5CEFA 3QW2A 1I3KA 1VL8A 2YDXA 1PGJA 3LT0A 1R37A 3QIVA 4AJLA 5IXSA 4TVOA 4XQCA 3RUAA 2BFOA 3G79A 1NAHA 5ES3A 4FIZA 1WNTA 4XB1A 3OJ0A 3WOHA 5AXAA 3LT4A 4ID9A 4JP3A 3E6AA 4AJNA 2I65A 4CV0A 4LK3A 3UFXA 5DP1A 4ZQBA 1U3TA 2FR0A 3COSA 1DFIA 1EZ4A 3ABIA 5F1KA 1SAYA 3BA1A 1TI7A 2UYYA 3FTPA 4Y6SA 3VZQA 1V8BA 3GY0A 3WWYA 5L40A 4R16A 3OFSA 1I3NA 4HX5A 5ICSA 2X7HA 4FJ0A 1I32A 2WMDA 3OQ6A 4AVYA 2DC1A 2HQ1A 1GPJA 2FWMX 2TMDA 2EJVA 3PFFA 3ZWVA 4AJEA 5ENVA 5A5EA 5MDHA 4BGUA 3T4XA 5KVSA 1QYXA 2A94A 2YFQA 3DFUA 3F47A 4U7WA 2EF1A 1UAYA 3D4NA 1WLYA 1E92A 3WDSA 3D5TA 2YQ4A 4WCDA 2C2XA 2JAPA 1B8UA 4PFJA 3IIEA 1PJBA 1E5QA 1RM0A 4NZ9A 4OM8A 3V1UA 3PIIA 1E77A 1P33A 2OOSA 5A3JA 2QG4A 1E7YA 2VZ0A 4YAGA 3IQDB 3BTOA 1Y9EA 4J7CA 4DLLA 3RUHA 4XEHA 3KXDA 5IN5A 3KLPX 3C8MA 3UAGA 1NFQA 2EW2A 3RROA 2B69A 4NBWA 3ZW8A 4EUEA 5BSGA 3CIFA 4BNUA 2DT5A 4CQMA 3U5TA 4GX5A 2YFHA 3S2GA 5G0TA 2BI7A 3RKUA 3SLKA 4F45A 9LDBA 3WQQA 4I5FA 3KBOA 2DKNA 3GG9A 4J2OA 1WPQA 4AJIA 4A5OA 3H6KA 1LQUA 2NV6A 2CZCA 1ONOA 4RZIA 2IZZA 5CEJA 3ZU2A 1YQGA 3BTUA 3ZWPA 2WSBA 4I5EA 2GN4A 5IF3A 1ZMTA 1XA0A 3K2BA 5KIAA 3AWDA 4J90A 1PGOA 3RBXA 3DFZA 4Q3DA 2VTDA 3PP8A 3PEFA 4Y6PA 3RUIA 1YE3A 1QRRA 4XGIA 3WGIA 1NX6A 4OSPA 2EHDA 3D7LA 4RCVA 1BVUA 3I9KA 2AEMA 3B1JA 1P0FA 1MUUA 3TOZA 1YH3A 2CDCA 2VZ9A 3OJOA 4K9DA 3L4BC 1EE2A 2B4QA 2QX7A 3HDJA 1NQAO 2QZ9A 4NMHA 1Z75A 1YB4A 2OORA 1DJNA 2OBNA 4YAIA 1I3LA 1GR0A 3TZKA 3RFVA 2PK3A 4IDGA 3L77A 4XIJA 2QYTA 3AW9A 2DPHA 3CINA 2JCVA 4YVFA 3JQ9A 2UVDA 1JDJA 4RVGA 3GF4A 3UN1A 3HQ4O 4O63O 3EAGA 2AQIA 4CL8A 1A27A 3BMCB 1T2DA 2RH8A 4RDHA 3WGOA 2GZ3A 3ZNQA 3EC7A 3QVTA 3AM3A 2VRBA 4IZIA 5JMWA 1C0PA 1A5ZA 4NDNE 1F8GA 1RYDA 3K5PA 1KBZA 3GG2A 4DPLA 4CMEA 3C7CB 4B7UA 1F06A 4FGSA 2GCGA 4FN4A 3WNVA 2CY0A 5AQ1A 1K6JA 1ONPA 1YBAA 2VHXA 1PR9A 3HWRA 5JPIA 3SLGA 4BO0A 5A4DA 5C5IA 3RBZA 3KYDB 2J3HA 5T6BA 4TWRA 1YOVA 3MJEA 3MJTA 1DJQA 4M89A 3FR8A 3JQ6A 4J1NA 5TSDA 5I9LA 4WCFC 1LXCA 4RGBA 5I9MA 4GKVA 1LSOA 4XDZA 1UDAA 4TRRA 2HCTA 2C59A 4UEKA 2FOIA 3ROMA 2P2SA 3JQDA 1HZJA 5GY7A 3JCZA 5A9RA 4Q3BA 2AE2A 4BQPA 4D44A 1N8KA 1HDGO 3V2HA 4UULA 5I7EA 4PLVA 1PS9A 3I83A 1HRDA 4JJFA 1YGYA 4MKZA 2DU8A 4JJGA 3E5RA 3K30A 5FWNA 4HUJA 4N7RA 2VCYA 2DUUA 1GZ4A 1XWFA 2P68A 1U3VA 4XGKA 1HXHA 3WWZA 4B4VA 2AQKA 2AEJA 3VH3A 3W8EA 3WSWA 2I76A 2QRKA 1ADGA 2IYPA 5I7VA 1C3VA 3VZRA 3KZVA 4D0RA 2H6EA 3OM9A 4CM5A 2O3RA 4MVJH 1C0IA 1G6KA 1ZIDA 1Q0LA 3CZMA 5EQDA 3WSVA 2J5RA 4YT4A 1VLLA 3DDNA 1LSSA 5A05A 1LC3A 1LUAA 4XYLA 3GZ4A 4NK4A 1NHGA 2CDBA 5BR7A 2VYVA 1DIAA 3B6ZA 4B8ZA 4KTVE 1GCUA 1DAOA 3LC7O 3QE3A 3TNLA 4B3IA 4CQLA 1ZXLA 2VRCD 4RQTA 2D2IA 3SJ7A 4BMNA 3I6IA 3JQAB 1R15A 3VPGA 4BMVA 3OIGA 3ASVA 3E82A 1DIBA 2WE8A 1P1IA 3ADOA 4FFLA 4XQEA 1LBEA 2VOJA 4WKGA 5IDWA 3UICA 3WGZA 2POQX 1K6XA 2X0RA 2F00A 2Y66A 3AY3A 3TFQA 4WLUA 3G3EA 5CG2A 3PPIA 4NJMB 3HB4X 3V1TC 1O9BA 1N1EA 3JD1A 4R9RA 4A2CA 4BGVA 1SNYA 1UH5A 1C1DB 1VC2A 2GN6A 1ISGA 4BUCA 3JQ7B 3GZNA 3I9MA 2I6TA 3RKRA 4I9NA 4M86A 2HSDA 4YEDA 1LNQA 4ROSA 4RO0A 5KWEA 1GD1O 1NYTA 2VWQA 3R6DA 1OC4A 3P19A 1LC0A 1TLTA 2EG9A 5JCJD 4KTTE 1PU2A 3WS7A 3JQ8A 2EGGA 3I4CA 3GAZA 2B37A 3FPCA 4IMRA 1KS9A 4RF4A 2B83A 1LLDA 3DZGA 3CMMA 3E48A 2DFVA 1CF2O 4MO2A 2WYVA 3KV3O 4PVCA 4GLOA 2D4AA 2A92A 1BXKA 1CEQA 3NJ8A 5L7TA 2Q2QA 4FFOA 2C5EA 2GGSA 3DMTC 4BO9A 4CM3A 4BB5A 4QECA 1FDWA 2CD9A 3GC6A 1V6AA 4LMRA 3ZH2A 2VYNA 1O8CA 3ZN2A 1PS8A 4L0QA 4PG4A 4BV9A 3T7EA 4HV4A 4R51A 2BRUA 5I9NA 3ONFA 4AJHA 4R1UA 3U4HA 1LI4A 3LLSA 2ZYDA 4GVLA 2NWQA 2JHFA 3UW3A 2IZ1A 4GWKA 3F46A 4RVHA 1NASA 5A04A 1R16A 2X9VA 2YW9A 1E0DA 3GN1A 1C0LA 4D79A 4BO3A 2PGLA 1GAEO 1LTHR 4J16A 4CLXA 2O7QA 4N54A 1R12A 1PL8A 4KUEA 1SB9A 3OF2A 3NDIA 4RV9A 4J1QA 3I9JA 3DMYA 2V7PA 4GLLA 4BNJA 3B1FA 1KYQA 3TL3A 4JNKA 3F5SA 1UJMA 5B4TA 3CH6A 4DRYA 4IS3A 3GHYA 2AXQA 2BFAA 3AOEA 3WICA 4Z3KA 2VHWA 3ONDA 1XU9A 1X0VA 3X2EA 4HFJA 1GEGA 4MIEA 4RVFA 4CR7A 1A4IA 1T2AA 2NU6A 1ZW1A 2PA3A 4FSHA 1R4MA 1IYZA 1ZK1A 4C7JA 1E1KA 8ADHA 1HDXA 1S7CA 1UXHA 5CDTA 3IP3A 5JCXA 1ZNQO 1F14A 1VL0A 2CVZA 4UVHA 3EVNA 4L75A 4BL5A 1JN0A 4JP2A 3EDMA 4K1LA 3O8QA 2AEFA 4GGOA 2I66A 4UUMA 1YKFA 2IDZA 5TJ9A 3F4LA 1L7DA 1JQBA 2FR8A 2XAAA 1R4NB 1W73A 3AU9A 3ZV4A 1K6IA 3O26A 4JK3A 1V3VA 4WLFA 1R0LA 4C7KA 2NQ8A 4IXTA 4TRJA 5HTOA 3ZV5A 2VN8A 4U0JA 3INTA 3VTFA 3X2FA 2XF8A 4Z0PA 4ALNA 8LDHA 4XB2A 1PGQA 2NVWA 3RFTA 2BKAA 5L7YA 2B4TO 1HDCA 3ASUA 2QRLA 1DAPA 4W82A 3JQGB 2JFGA 2FZWA 1MP0A 3DC2A 1PZEA 1VE9A 1N92A 3JQAD 1DXYA 1GDHA 4PLFA 1GCOA 4IXWA 3FHLA 4II2A 2GERA 3D4PA 1E3EA 4N18A 4IDDA 4EUHA 2YY7A 2Y1CA 1L1FA 4KMSA 3KO8A 2EKLA 1FJHA 4Y9DA 2WYWA 4G81A 1EQUA 4BKRA 1T26A 1WVGA 2V6FA 1H6AA 1LU9A 1T1SA 3QRWA 4BNNA 2Z1NA 3H9JA 4MVJE 1WW8A 4XGNA 3VTZA 3ENNA 4HNGA 4JJIA 4OL9A 5T57A 5BNIA 3DHYA 1LSUA 2EIHA 4J1TA 5TT0A 4XYGA 3N74A 4XQGA 4CM7A 1NVGA 3U0BA 1N9GA 4H7PA 1NTOA 1N1GA 2Q2VA 5ADHA 1F12A 4PLPA 3STHA 3PGXA 4R3WA 1HT0A 4PG7A 4CM8B 1E3SA 3P2YA 4O1MA 3N58A 5EQFA 1Y8RB 1U5CA 4I5DA 4XYBA 4EJ0A 4DBVO 4ZQHA 1HEUA 2IZ0A 3PWKA 4ZQGA 4CM6A 1UXKA 4IGFA 4IIVA 1ISJA 1E1LA 2P9EA 1K0UA 3BHJA 2EEZA 4JX8A 3DZIA 1N2SA 4YBZA 5H82A 4OH1A 1YQXA 4E32A 1LRJA 1YO6A 1KC1A 5I7SA 4UVGA 4WNIA 1VJ1A 1P31A 3ZHZA 3QA9A 2OHXA 3OJFA 4YT5A 4D0SA 3E1KA 5TX7A 1X15A 4M49A 1A7KA 4J4HA 3G49A 2JHGA 2WD7A 4FFRA 2GF2A 4KWIA 4A73A 5CFZA 4IZHA 1E6WA 3UKOA 1YRLA 4CR6A 3RUFA 2I67A 3ZWCA 4YR9A 1IZ9A 1CRWG 2BFPA 4UEOA 4QFCA 3UF0A 3FTNA 5A1TA 5H83A 1DSSG 4P4GA 2X23A 3DBHB 4BV8A 1T2FA 4BO1A 4J1SA 5JAQA 1NQTA 3SBOA 4YCAA 1J49A 3VOSA 2FPGA 2W98A 4QFDA 2Z5LA 3GEMA 2GYYA 1UXJA 5JO0A 3SX2A 1YONA 5JS6A 3OA2A 1X1TA 4W7HA 3LU1A 1QYDA 4ALLA 4QTZA 1ORRA 2DTEA 3M1AA 5JY1A 3IUPA 4R1NA 3OMLA 2FN7A 1YB5A 4II3A 3DAFA 3RQSA 5CDUA 2BF7A 4JXKA 1E3JA 3I4FA 1NWHA 1D1TA 3ICCA 2PD6A 3HN7A 2IYOA 4D42A 1PZHA 4FFMA 4PG8A 2NADA 4WLNA 3NTRA 3JD2A 3AY7A 1ZO8A 3IKVA 3IOYA 4ND3A 4AICA 4RJTA 1O6ZA 3GZNB 4MVJF 1M75A 4K28A 1ADCA 3ON5A 4R68A 2EXXA 2PZJA 5U9CA 1ISFA 4HWKA 4GMFA 1XCBA 3ZGYA 4J9VA 5K9ZA 3CUKA 3FNGA 1E3WB 3JQBC 4WE3A 3S1LA 3OIDA 4KWHA 4QEDA 5G0SA 3JQ9C 3S2IA 4RPJA 5JO9A 4B3JA 3AK4A 1R66A 4ND5A 4GGPA 3SEFA 1I2ZA 5JC8A 3IAHA 4FBGA 3DB2A 1ZK4A 4AJJA 3E8XA 1ZJZA 1EBFA 1LDEA 1B14A 1TT7A 4ZQFA 4W7IA 2DAPA 1NR7A 5FI5A 1SEPA 4EBFA 5BSFA 2Q2WA 2XXJA 4IIUA 1U8XX 1LJ8A 1VRWA 4D7AA 3C7DB 1Y5MA 1TEHA 4CM1A 2C29D 1EUCA 4Q3AA 1P45A 4AJ4A 1NPYA 5K0ZA 1ZK0A 2PZMA 4TSKA 4BOYA 1LDMA 2D5AA 5KJ1A 1XG5A 1P3DA 5G4LA 3NGXA 2PH5A 3JD3A 4YJGB 3UCEA 3EHEA 2BGKA 4E30A 3GVPA 1HDZA 1VJTA 3RBVA 2E6UX 2QW8A 4J91A 1BMDA 2W90A 4MJLA 3VH2A 4I1IA 4TROA 1YBMA 2VHVA 1ZBQA 3R1IA 4XR9A 5AVOA 2I3GA 2JAHA 3QVOA 4MVJI 2QYSA 1F0YA 2BELA 2G5CA 1LEHA 1FDVA 1YOVB 1ZXBA 4TZTA 5KJ6A 4IJVA 4L4RA 4DPMA 1C1XB 4JBGA 1B2LA 1E7QA 3DBLA 4CPDA 2W2LD 4ALKA 5JDCC 1H2HA 3ZCXA 1U3WA 2HUNA 4K26A 3ZV3A 4JBIA 5DF1A 3I1JA 4OHUA 1QP8A 3WYCA 1GV0A 1SB8A 3LC2O 3VPXA 1TA4A 3C3XA 1HE2A 5CEEA 2EV9A 4EDFA 5F21A 1UP7A 4BO4A 1NAIA 4MOWA 1GUFA 4OKIA 1T4BA 3RIHA 4D3SA 3RUEA 3WMXA 5L4NA 2CVQA 3DBRB 1AGNA 5C3MA 1ZUD1 5DCUA 3OSUA 1SPXA 2P4QA 4ITUA 4UEJA 4NBRA 4Q3CA 3WIEA 3F5QA 1CDOA 3BHMA
chains in the Genus database with same CATH superfamily
5AOCA 2YWDA 1RHJA 3H6HA 4RCYA 1UP4A 1KMNA 1JEDA 2XTZA 4L2IA 4LI0A 4B6PA 5KDDA 3WX0A 4MWGA 4RAOA 1GVNB 2C2YA 3NM4A 3OQOA 1XR3A 3ZY6A 2D5LA 2ZSIA 3DE6X 1GYQA 1MPXA 3KFLA 1ZS9A 4JB3A 4JUBA 1QONA 1JG3A 4ZAVA 3IXMA 2DWPA 2DR2A 3EPJA 2QVLA 5F2OA 5EEGA 4C6RA 5LA6A 2BKXA 3M5WA 5FWYB 1RLMA 4Z5XA 2FPSA 3LY8A 3FTEA 2O2ZA 2B9VA 2ERYA 2W8BB 1U3CA 3L8DA 3AEKA 1SKYB 4P3XA 4X71A 1VIDA 3TTWA 4S04A 5IT5A 1FYEA 2EW8A 2YZ7A 1YJBA 4LWQA 3R7LA 3SAJA 2YVKA 3HGTA 3W5BA 1O5IA 3EFEA 3Q2OA 4JN6B 4U2DA 1H1DA 1KJYA 5THKA 4K9SA 2ZRMA 3O75A 3KYCA 1S4MA 1QRTA 1NHWA 4KN8A 1ZKMA 4MROA 5DN9A 1E1RD 2H1LA 3GELA 2P9QA 3IEKA 3O8LA 4FZ5A 3KS9A 4NH4A 2IKQA 5TQJA 5B2EA 1JA0A 1SUSA 2AG8A 4QOFA 1ARZA 3IL2A 3EGCA 4RELA 5IBPA 1G38A 1E5LA 2J3JA 2PD3A 3BDVA 3L5OA 3L7DA 4BVBA 1LPNA 1WZCA 4XX1A 3BIOA 1L5KA 4D9EA 3QG1A 2JI4A 3CR3C 4U3JA 1MC4A 4YRQA 1I0ZA 2GZDA 3AJRA 3OHMA 4P84A 5DNVA 4D57A 2QX9A 5SYNA 1AGYA 3HDGA 1J8YF 1G6HA 4IHQA 3BXXA 4REQB 4XTRA 5CM8B 4KDFA 2AXPA 3O6VA 1ULBA 3ZC3A 4GXNA 1T5BA 4LXUA 2NUBA 3OUZA 3Q9NA 4FUTA 5F5NA 3V4OA 3VPSA 2R60A 2IEIA 3PJGA 3C4VA 4NFYA 4WXHA 2WJZB 3TQSA 3A6JA 3ULKA 1G5PA 4KUGA 4HAVA 3NFRA 2BSQA 5IPFA 3NB0A 2ABWA 5DYWA 2O8DA 2JEZA 1M6HA 3ACDA 2VBIA 4HLUC 2Y05A 2WAYA 4C3UA 4L51A 3EIUA 2GK4A 5IULC 5M7EA 2ZKLA 3OJLA 1L5HB 1VBFA 3FYUA 1ND5A 3T3OA 3T9DA 4YWJA 1IDOA 4OEHA 4AO8A 5EJIA 1FDIA 2MU1A 1OAKA 1RM5A 2XUHA 3CZPA 5BXQC 2GYWA 3L1HA 3AR6A 4V0MA 2FUG1 3U17A 4YUVA 3GPDG 1L4UA 5BNTA 1FRFS 1PJSA 3ZIAA 5A6SA 1SHUX 2V7TA 2HI0A 2GM4A 5KHOC 1UAAA 2HKIA 1JKMA 1G19A 3K9WA 5DRTA 5LIPA 3G17A 1DRUA 4OQYA 2ZRCA 4PQYA 2DFTA 4LJYA 2QS9A 1OE0A 2XNCA 2RHTA 3KQNA 2AUMA 4EEXA 4UM9D 4JCCA 1AQNA 3THYA 2B1RA 3LX8A 1CRZA 1J7KA 1YD7A 4OHZA 4B3HA 3W5DA 3K3PA 4RHUA 4MV1A 2BFBA 2QGFA 2ZB3A 3O5AA 1P44A 4LZZA 5KUTA 5HE9A 2R65A 5IVPA 2EU8A 5LD2C 1IXKA 2WLSA 1GAJA 3BMNB 4RJJA 4TUYF 5TVKA 4JQCA 3WIUA 2F67A 5JXIA 1E2NA 1Z3IX 1NZFA 4CCWA 1SU4A 1DARA 4JR0A 2ICAA 2J41A 2ORYA 5FFMA 1SCUB 3NHBA 3OX2A 4G5HA 1ZN8A 3KRTA 4M1WA 1P2BA 3FI9A 2PPVA 1OAAA 5AKHA 3SYRA 4IBOA 3UGKA 4YRTA 5KKCA 1UFKA 1MV8A 1VYHA 3EGEA 1CFZA 1BWPA 4EA7A 4Z2YA 2CSUA 3WL5A 3HM2A 5C1OA 5FYDA 3KDPA 1CUDA 2QN2A 1WOYA 3EGXA 2IQ5A 5EOVA 3HBNA 3FKSD 1U5BB 4KLCA 3OIFA 4KXYA 5HFNA 2RSLA 5CYGA 1QHEA 2R1VB 2ZTLA 3KQYA 4J9UE 2EZ4A 4D9IA 4GM1A 4B3GA 4AF8A 3I4LA 4NONA 1IEWA 3CSSA 2XA9A 1LQTA 5HKAA 1ZVVA 4RKRA 1Y48E 3W0LB 1NJ8A 3MPOA 4IMPA 3LZ6A 3WLOA 4DIBA 1J0EA 2DQSA 2PGNA 3ESRA 4LXQA 3AQ4A 4YCBA 3CJTA 4UUQA 3UPUA 1QYCA 4H59A 1UEJA 2PNJA 4XFKA 3B38A 1N1DA 3T35A 4EYEA 1NMEA 4GE3A 3NXKA 3E22B 5JG7A 5BWCA 2QM7A 2JJ1D 5JCOA 3UBMA 1DBQA 1S7GA 1FYWA 4RCZA 3LKVA 5BSEA 1E1MA 4JYCA 1A98A 3RC7A 4CW7A 3HHPA 1JQAA 1W0JD 2HRBA 2R25B 3OPYI 4B34A 2QORA 3B82A 2WHEA 3VU8A 3A7DA 3GA5A 1P1BA 2OHFA 4CDGA 4I50A 3RFUA 1WZNA 3ZW7A 4JUCA 4K8OA 4JH0A 5DM0A 2APJA 1NNLA 2ATVA 2Y2VA 2OYRA 4QXAA 1GKYA 4B47A 2XKBA 2G0AA 1HLDA 1ZN2A 2M9MA 1UINA 1U8AA 5AXBA 4TV9A 5J1SB 1W29A 3AINA 4QYIB 1NFRA 4KN9S 3DDWA 1I10A 2F4NA 2QD5A 3JWGA 2ZAYA 1EX9A 5A04A 2XXAA 4DC0A 4QBHA 3ETJA 4E7OA 4C4ZA 4PLCA 1P2UA 2PFSA 1RP1A 3PUYA 3JYQA 3RSQA 1O3YA 1EVEA 4AG6A 2Z4SA 4ZIRA 3PZRA 4RKEA 1O9GA 2V9ZA 4UHBA 3P0FA 3JARA 1COWA 2N0SA 3RB8A 1GUYA 2K7ZA 2AT1A 1BW9B 1IQ0A 4WLEA 4Z7NB 5DNCA 5K0CA 1UZUA 5EUBA 4ER5A 4V3CA 4KXMA 4N7BA 2ACKA 2JLWA 1P17A 3W5SA 3NMUF 3NATA 4I4TA 2C8VA 5KVQA 4KO2S 2REOA 1D1SA 2I7CA 2J9FB 2Q99A 4V1CA 1RFLA 2Q3HA 4O2AA 2FFQA 1TVCA 4KBFA 4DKJA 2AHOA 4L2IB 3E35A 3G6WA 4MQ4A 4XIGS 4GNKA 1YA4A 3SJUA 4LOKA 2G3YA 3LIPA 3E7FA 3L7KA 5AM2A 1P5JA 5BMOA 1KOGA 4KQ2A 1KTVA 1B15A 3NEYA 3I09A 5KHLB 5LXTF 2PWPA 3Q7EA 3I6ZA 2WJIA 4JUAA 4RE6A 2C9DA 2ZB4A 5E3IA 1YDMA 4KR3A 3CUUA 1AJEA 2PBRA 4YREA 1ZGAA 3VKWA 2VS1A 1ZIXA 4EG6A 5ILQA 5DJ5A 3CLUD 1QR2A 3IURA 4ZTBA 3ROGA 2RGGA 3QHAA 4PGMA 1MFZA 5LLTA 2ZJ0A 1YR9A 3G1TA 4F04A 4GWGA 1CUHA 3ZV6A 121PA 4UUBA 3U3KA 4EKNB 1OXUA 2FDRA 1L8QA 2WWIA 5AP9A 4DQDA 1W6UA 1MTOA 4QJBA 2W42A 3IDOA 3HVRA 5C31A 1U04A 1FUYB 2WIKA 3GU3A 1ZK3A 2OWDA 3L6UA 4HSGA 4PWZA 4YECA 1DIOB 1BCSA 2A57A 5ALUA 4FDUA 4ZJUA 3RC9A 4NYIQ 3JVIA 2A9JA 1XYVA 1LCIA 1YFKA 1OZFA 3B6EA 3IDZA 4M9ZA 3RS9A 4A8JA 4EAAA 4MH0R 1JTEA 1KHHA 2QVGA 4DCPA 2WEKA 2JHCA 2XDWA 4L28A 1CY8A 3VO1A 4H35A 4UM9B 1K06A 1NJ6A 4ZA2A 1U90A 4BNXA 3LD9A 1E9DA 1TK2A 4KAAA 2OUIA 2P2GA 4E33A 1UT6A 3PV0A 2ZPTX 1H6CA 2DGDA 3UATA 3SHVA 4HTFA 1V1MA 2FZEA 4LTDA 5E1MA 1GGMA 4FM9A 2BFFA 3U60B 1K27A 5AKGA 1VHWA 4XSVA 3LX5A 3FHJA 3KKEA 1VKHA 2ZBVA 3PD1A 4IXMA 4D8XA 1SKAA 5U1PA 4DUPA 5KVCA 3MOIA 2H2WA 2VP3A 4ZVVA 3RK0A 3U6KA 4PR0A 4AJ1A 4PC2A 2ZE8A 2QQEA 2NSDA 3AILA 4UAGA 4UFNA 5T3YA 4AY5A 4BQQA 1B8VA 4PLHA 4N3NA 4IGAA 4IKOA 4MYRA 4DLSA 5FBZA 3H7AA 3OKPA 4C6TA 4ZEOA 4AW9A 1N25A 2NTEA 4HLCA 3AFHA 5FORA 5BQPA 2OFFA 3WGQA 4JJ6A 2E3JA 3A0UA 1TIBA 2GLTA 2I3ZA 4RKYA 3EDCA 4FMDF 1NN3A 4NQZA 2DYKA 1J42A 1ORDA 1W4BA 1YJAA 3CH7A 3RIEA 1XXHB 3ZBPA 3LLCA 2ZJZA 3RSOA 1A7UA 4R01A 1T5TA 2V7WA 3DVQX 4CLRA 2X0IA 2H52A 2O2DA 3NDBB 2A4KA 2BMWA 3DB1A 5FFFA 4RMJA 1AF7A 4W5QA 2A67A 2ZR7A 3KALA 4J75A 2CVFA 3TD2A 1QF9A 2O8VA 2WM3A 1JR3D 4M37A 3VPBA 2FQYA 3EG9B 5LZ5A 1ZNXA 5JNLA 5E2AA 2IELA 4YJHA 1KMQA 1SVLA 1NLFA 2F62A 3KJEA 5DK6A 1NXTA 2QTLA 2EQ5A 1NXOA 4URWR 4R8LA 4OFZA 2P7HA 2L42A 1EVYA 2XRYA 4ZCRA 2O0HA 2CXSA 5JAUA 5KB3A 2Q4DA 4CUKA 1R0BA 4HEJA 2E7ZA 4GI5A 1G20B 1OV4A 2C5BA 4MWZA 4DSZA 2C4MA 3KTDA 1ANKA 5ALWA 4BYGA 3G9UA 1U1IA 1ZFNA 4U2BA 4WY2A 4B73A 4XEUA 4ZCMA 3BA6A 1XELA 2YHIA 4A6DA 1RKVA 4DLXA 3SDBA 4UNRA 1K2WA 4CMEC 4ZICA 2I4TA 1PYDA 2QP4A 1BVRA 2B2XA 3OPYB 1C7IA 1NA5A 5FI3A 5CD1A 4ZYVA 4PX2A 1RZVA 2INGX 2JZNA 1DJLA 4MWCA 4US2R 1BS9A 1Z45A 4H31A 4DS3A 2AFHE 2P9GA 4M1OA 3WG9A 3CPJB 3ST7A 4PYRA 3RREA 1VPWA 2X3FA 5SY6A 5B7QA 3EIWA 2OQVA 2PMCA 3DDUA 1R3DA 2ECPA 5B1YA 3ZWXA 2DBZA 4KMOA 3DP7A 5DGHA 4Z9BA 1Z74A 3HV0A 2RHOA 2B2NA 3JAKA 4E09A 2VC2B 2AG1A 1KK0A 1OT3A 5JOQA 1THMA 1WMBA 4NOMA 3A25A 3A1SA 5EWMA 3WA7A 4HQFA 3C7TA 1JKJB 1KYWA 7AT1A 3RW9A 3EXIA 3F8TA 1LDGA 3OZUA 3QFTA 2XQFA 2YY5A 3V32A 3OE7A 3CVYA 4JENA 4L6AA 2AN3A 2G9NA 3WLJA 5LDDC 1Y9AA 2ZITA 4HHEA 3KT0A 4G1VA 4YMUA 2GNAA 2XE7A 4FGWA 2A35A 5JJIA 3DLBA 4Y2SA 5BYBA 4K46A 4QEZA 5EWMB 3DV2A 3THRA 5DCLA 1L1EA 2RAPA 4NFHA 4HAWA 2UZ0A 2IHVA 5DBGA 3V4RA 2XIQA 4PNPA 3R2JA 4JVSB 4K9NA 4MYCA 5HMMA 2D1TA 4U2GA 5C8DA 1EP3B 1IHXA 3TSAA 1LKZA 1W19A 2Z98A 5D00A 2WF7A 3FDZB 3AETB 3GCZA 4MV5A 4BQSA 5GGYA 3ER9A 2XUJA 2X5OA 3C3JA 5GJBA 2OV1A 2ACVA 1N7JA 3AFNA 4BRUA 1TAQA 3RHZA 4YJFA 1LPSA 4J8PA 3GJ7A 2I3DA 3JZFA 4ISCA 4PQRA 2HV9A 3L8FA 2CMFA 3IUQA 5CHYA 1NWCA 1TF5A 4KR9A 3PHLA 4FHCA 4F1JA 2Q5HA 2P27A 5AKKA 2E4ZA 5CDFE 2I3AA 4DLWA 5J4LA 1N0WA 1II0A 1YDFA 1E64A 2PLRA 2X1HA 4Z99A 5TT1A 2VQFB 5DI3A 1LA2A 4KXXA 5IDQA 3QUAA 1CR2A 2XW6A 4TVBA 2IYYA 5CH8A 4OSEA 5I45A 2DECA 1FNSA 1DWQA 3IO5A 2ZM5A 3M6XA 1X7WA 4BEWA 4U0KA 5EJ4A 2VYCA 1LPPA 4K87A 4QA9A 2J9GA 5IT4A 1GEEA 2ZSEA 3VSCA 5K45A 2OPBA 1DBSA 4HLQB 1TKAA 4AXBA 2OLJA 4R5MA 4CF3A 3DVLA 2XB9A 3LUPA 1GQFA 3N59A 4PRLA 5DRYA 3CBQA 4C6TB 5DBHX 4HVLA 4RZQA 3DS8A 4L4XA 3L7IA 2ZM6B 2ZQ5A 1QCCA 2GAJA 2AZMA 2UV8A 4EJSA 1KVSA 2EP8A 2J85A 1JDTA 3NC0C 5CVCA 4J29A 4KDCA 4NECA 4RV4A 3GRPA 3I37X 3T4EA 2SCUA 1T34A 4KN6A 1YL7A 4TXJA 4HVCA 1VPLA 2ZT8A 3PHGA 1TRHA 2FEWB 1W96A 2LDXA 3CEHA 1QRSA 2UUAB 4FXPA 4I66A 2HFKA 2I6XA 3E3LA 1TAGA 4EJSB 3MXTA 3B3FA 3V34A 3PUKA 3AF4A 5F23A 5DMHA 4CQLB 4TTVA 1SHKA 1J8FA 2ADFA 4EYSA 4FDLA 3OBBA 4UTXA 3CWQA 3WKAA 2PV7A 1X3SA 3IERA 3HYNA 1Q0HA 3KB1A 1NPDA 5K51A 1I51A 1T3SA 1U0SY 3CUSA 3IP9A 4RKFA 2PN1A 5BW5A 4LN1A 4BUZA 1UWVA 3BIXA 4OQ4A 1IZ0A 3CX3A 4KP7A 5A5FA 3GPCA 1E7RA 1N5IA 1ZYUA 2MMCA 3FOAA 2HC9A 3BHMA 1DBIA 1JFFB 1TZMA 1ECGA 2XYRA 3NKVA 3JD4A 1BX3A 4Y9TA 4KQ6A 3EZYA 3IVCA 4B81A 1TIKA 3U3JA 1CY2A 5B1SA 3P9IA 4ESHA 1MG5A 2WU1A 5ERXA 2F55A 1IE3A 3HB1A 2NN3C 1BCRA 1F2DA 4AZWA 5LMUB 2XWSA 1K1EA 2VHJA 3IIJA 4L4UA 2Q9UA 3AEQB 3IUEA 4Y2QA 5HCIA 1FXUA 2FMFA 4OHOA 5B4VA 4IDFA 4B6JA 1O6CA 5DOVA 1OFGA 1P73A 3H87A 2KM1A 2RB4A 4KQEA 4LJKA 5TARA 3OQPA 3P2IA 2WY2D 1R64A 3Q6IA 3CG0A 3MD9A 1J8DA 4QPPA 3UW1A 1E8MA 1SN7A 1LF0A 1Z0UA 4FD3A 4R4JA 1GPDG 3SS9X 3W2GA 3NTXA 2TMGA 1IOVA 2WKWA 3M1YA 2COEA 16PKA 4LVUA 1GY8A 5EC8A 3UB4A 4MVJD 1MRNA 3QLJA 1QCZA 3RR2A 3GH3A 1GUDA 3CKYA 5IAKA 1SBCA 3W1EA 3AZQA 4DR6B 4FWIB 5CDYA 3RU7A 2ZUFA 1F3OA 3DMNA 1CFJA 3OLXA 2FPMA 4M8KA 3I0ZA 1KI6A 4B6RA 2R6AA 3NLLA 1EX7A 2BMAA 4E2FA 4UBNA 3TXYA 4I99A 4JDPA 2WOJA 2YWXA 4NRDA 4JKYA 3QHPA 1DMRA 4DTCA 1X1QA 2O2SA 1EIZA 2V7VA 4IG4A 2DZDA 5IP5A 3PNPA 2XT9A 3EXFA 4K9QA 4Q6WA 1QRAA 1V5WA 1LDBA 1P7CA 3DHEA 1I3CA 2QPLA 3G2HA 3HCPA 3KSZO 4IXDA 6REQB 1I1OA 1E2BA 2CFRA 5SY4A 2ORED 3L92A 1CWUA 3ZVLA 3I8SA 4HDNB 1O77A 1VMKA 4AS3A 9ABPA 1P9NA 4R5HA 4D46A 4PQEA 3F7OA 2B94A 3UXEA 2J07A 1ESCA 5FHQA 1TJYA 5JW6A 4NYJQ 3L4SO 4EHAA 4UHDA 2UZ1B 1W48A 2ZVDA 2G6BA 4O33A 4WBNB 1K8RA 4TQUS 1SZCA 1R1DA 3LT1A 4LTNA 1PS0A 1FFWA 3WLKX 3GGCA 5JFOA 2IIQA 2JGFA 1TYBE 3JQRA 5JSFA 4BXOA 1P39A 4LQDA 1X14A 2FXIA 4FZ3A 5EXSA 5C51B 1TTHA 1Q77A 1HF3A 3BWBA 3AKEA 4MR9A 3GJ4A 3QFFA 3QVMA 1SBZA 1AKTA 4KH0A 2FPKA 1C30A 4NPCA 4DIEA 3PXAA 3R0ZA 3A4TA 1RAEA 1SOVA 2G28A 2O23A 4JP1A 1Z8HA 3L1JA 1D0SA 2Q41A 2SECE 4Q4DA 1EZZA 1WAMA 3WYEA 4Q37A 3WYDA 4ZI7B 4EZIA 2CXXA 4CEJA 1NLUA 3E4CA 4DSTA 1TGVA 5FB3A 3BGOS 2EATA 2OGUA 4BDTA 4F3YA 5EIEA 4GSKA 2QZ4A 5LZ2A 5BUSA 3BWVA 3PHBE 4JYBA 4A0RA 1PEAA 2G5PA 3VR2A 3BRCA 4F3NA 4TKLA 4KIJA 3VX3A 3VVCA 1PUXA 2J31A 2WJYA 3AYXB 1M6YA 3LGSA 1CV2A 3NYIA 3VOBA 4RTNA 4TMXA 3NTLA 1Z4PX 2R8OA 1N7GA 4MMXB 1RWBA 5SICE 4DCUA 2D7JA 4O59O 4TMWA 5TS3A 4D9MA 4EARA 1QDUA 1DFGA 1U9IA 1CDDA 2G72A 3B48A 1WUYA 2IPAB 2Q45A 3H9EO 3BFXA 4TM7A 4BO0A 2FGJA 1FRNA 3F1KA 1CY4A 2G1UA 4MV9A 3OTIA 3F3SA 4PZPA 4Q9DA 5ENZA 1T8RA 4TTTS 4MW5A 4A3SA 4Z49A 1ZEMA 3RUCA 3IV9A 4OB8A 1E1NA 1UEXC 3OOHA 3VKFA 1L5RA 1UC5B 1GPH1 1X7DA 2PLAA 5CLQA 4EUNA 5JXGA 2C88A 1P2DA 3D8UA 5G2OA 4X00A 3REQB 4GI7A 4JVMA 1WPGA 2YW2A 2V58A 3NBFA 3ODPA 4QUBA 2QSUA 2OY0A 3AIIA 3GP8A 2Z9CA 4RD4A 3FPSA 1L5LA 3MB8A 3HDQA 1O96B 1GPUA 1SXJE 2CMGA 1XDWA 4Q00A 1P4JA 4PIMA 3TFOA 3IP8A 3WVNA 3GJ0A 2B20A 2PH3A 2ZVQX 2OXFA 3EBPA 5DX8A 4JD5A 3VH1A 4PN7A 3TPCA 4YT2A 5HZMA 3OOYA 5MF6A 5CYFA 5JJCA 2EJTA 1GYPA 3RYCA 1DO0A 4MKXA 3DBHA 2PRKA 2XA1A 2CJWA 4IVRA 4Q34A 2P6NA 1YB1A 5GZ1A 1MB9A 4OI0A 5T4EA 3FDIA 5FOXA 2A6PA 4DIFA 3VR4D 2DT8A 1XSEA 1JV2B 5LFAA 3MIIA 3OA0A 4CRWB 4HKTA 3HP4A 4JLBA 3HLKA 3RTAA 3TE6A 2EFCB 4TUYA 4NC9A 1MZVA 2WWHA 4D6XA 3I5MA 4WK6A 3SKYA 1NATA 3RSGA 1NZJA 1W2HA 4G25A 3ZBQA 1M3SA 4JI8B 4RSGA 2P3QA 1OAOC 1LPAB 1ZJ4A 1RI1A 4FFSA 3TLJA 5A6VA 2Q2OA 1REQB 2P2YA 2V0NA 3TLGA 1L4FA 3MIZA 2OV8A 3ZDRA 3AEYA 3G23A 1KWKA 1B0UA 4NU6A 3U3OA 3NIFB 4UPVA 4D97A 3S5UA 3IVAA 5IC6A 1TU0A 1C3XA 4OGFA 1TL7C 3PE3A 1OAOA 5G4KA 3IE2A 5AW7A 3ZJ5A 4BO5A 3N2EA 2O0JA 3AGPA 4Q9LA 4HGQA 3TZQA 4M8NE 3IR7A 1P1JA 3PQDA 1GTMA 3LOUA 3OH8A 3MZ0A 2NZYA 3KDAA 4W4TA 4YB8A 5K8LA 2FQ1A 1R3UA 3F6EX 5CCDA 2J3DA 2VHCA 4PSCA 7ABPA 3VXKA 4DMCA 4YJFB 5LUBA 1ZK2A 4NI5A 1GYRA 4JP8A 4F21A 1Y1KE 5BV2P 2P30A 4G4JA 4J0DA 4EHIA 5C37A 2C5FA 3ZXYA 3P9NA 1YZUA 3N2GA 4G5QA 3VKVA 3FVWA 4HDKA 1AHHA 2YXDA 1UPAA 2JHPA 1IULA 3CLHA 2HK8A 2GAOA 1DOAA 2FUNB 5JSQA 3MERA 5TF0A 1MEJA 5TMDA 1JX6A 1M0SA 2WPDA 3T7RA 1VG1A 3ITKA 3GCXA 1HG0A 3UV6A 3IILA 3VOAA 2LCIA 2GK6A 5CXXA 3Q1LA 1TEZA 3RS8A 3RVBA 3SBDA 1OTXA 4I1SA 4LC0A 4S0ZA 1OD6A 1RHUA 1TMOA 2OSBA 1FFBA 1XZPA 4YXWA 3JQEA 3U4QA 1DV2A 3O4HA 4Q05A 2XNKA 1CZHA 1SEVA 3DOFA 3NHFA 3E7WA 1J25A 4E13A 4GX0A 3PDWA 4RSHA 4MYTA 1YFZA 3T95A 2DPMA 1WZ2A 3CZRA 3PI7A 1GO2A 1JQKA 4C20A 1M67A 1FTQA 3KT8A 1EFLA 5K8TA 1T1GA 4XJSA 4P0QB 1O08A 3QPCA 3NOXA 4LOHA 1Y63A 1EEHA 1NIPA 3MJDA 4AJKA 4GMDA 1GNLA 5EE1A 1J8QA 3G9QA 3HKBA 5BW6B 3W79A 2ODTX 3QVGA 4FCCA 1U0FA 4ML3A 4NKRA 2AA3A 4OGKA 3RFCA 3D4LA 4BNIA 3HKCA 1Z6XA 1L5FA 2DQKA 2G1KA 2Y0DA 4WKCA 4WRRA 4ZZ2A 3MYRA 4H3KB 3TNFA 3QVKA 1SOMA 2WQZA 3OT5A 1V7PC 2VDWB 2J0VA 2OV6A 2ZB7A 3FFTA 2I99A 4NR0A 2O7SA 3IAS6 4ZO6A 1XMPA 4A4DA 1KYZA 3H1EA 1KEVA 4MKRA 3MVEA 3L46A 1Y8QB 5C5EA 3FOFC 2FMHA 3RAEC 1MJGA 1OX4A 3NEAA 3WGUA 5JEDA 1V48A 2X0JA 4M22A 3DL7A 3U4DA 3OX1A 2WSIA 4BVAA 2ZU0C 3L0DA 4ILEA 4BVKA 4MP3A 1GSIA 1KA9H 3PCXA 3LF2A 3QKRA 5BRJA 3LHFA 2FSPA 5JHGB 1OXVA 3F96A 1J2TA 5T7BA 2WFAA 4PQGA 5T8KC 3DCJA 2C7QA 1CUFA 3ANMA 3QVWA 1C9NA 1A4RA 1HNNA 3CSDA 1YVDA 2BE9A 3OT1A 3SC6A 5BN1A 2GRAA 1OASA 4N0MA 1OPRA 3FSGD 1Q0UA 3H0KA 1YQ9A 4EW1A 4Q9NA 1XRPA 2BGUA 1FS5A 2CXHA 1YL5A 2P9TA 2PKQO 3W9UA 4ZI7A 5BR1A 1SD2A 3ORSA 4NJEB 1NZDA 3DCYA 2FG6C 1H3FA 3WIDA 4KNYA 1G2QA 2Q0HA 4LHSA 1BIFA 1XQ6A 2A5FA 5K3CA 1L8LA 1R6BX 1Z0AA 2ZDHA 3AJAA 1CJKC 3FR7A 4WOKA 4HUQA 2DUJA 3EIFA 4PLZA 1CJMA 3UAXA 3V2UA 1MX5A 3BMOA 4IV0A 3QA3E 1Y7TA 5CAEA 2PRYA 4KDEA 1QKJA 1KI3A 4D41A 2DHRA 4M0FA 3I9NA 2VNAA 3PIDA 5FNVF 3EDYA 3LFUA 5HS6A 2RAUA 1VQ1A 4OQFA 5KQLA 3CEPB 3F7TA 1D8AA 3N7AA 2X0KA 5B57C 2BVNA 2AQHA 5JYBA 3ZJUA 2RGNA 3OZAA 1XL1A 2G06A 5LYJF 4M8LA 1A7JA 4EG0A 5L4SA 1F2TA 3KLOA 4AIRA 2QXUA 3X3HA 4YDHB 4L57A 3JASB 2AN1A 2I8AA 2D1YA 2C4VA 3I53A 1RS0A 1U7ZA 5EIOA 4RX1A 5JJBA 2PU5A 4RM2A 1TNDA 1E59A 1IU9A 4U7PB 4UXIA 1Y42X 5J23A 2AWOA 3C14C 4RK0A 2QRGA 5DXJA 1TT5B 1ZX1A 3I6MA 4J1TC 3C6KA 4NJMA 5F12A 1CS0A 1W581 1H2ZA 2WHQA 2HIMA 3S6JA 2BFEB 3ASYA 4QQRA 4X63A 3V33A 3KM0A 1KOJA 2GPYA 1SKBA 3DSRA 4PTZA 4Q1EA 2AR9A 2F3TA 1CVLA 2W2XA 3B6MA 2YJ4A 3CR7A 4TSRA 5H7XA 5HRUA 2R11A 4MV0A 1M72A 1Y37A 2GK3A 1EUQA 4L6IA 3JYOA 4KGVA 5DHRA 1PAUA 3RYFB 3P7MA 4OX9B 3LYAA 2XD4A 2YZKA 2A0FA 2PIDA 4KXQA 4KR2A 1FP2A 5ERYA 3ASZA 2VXOA 3LXRA 1UKCA 3BM5A 1TAHA 4JOSA 4MINA 1Z17A 4DJFC 1J5EB 4YACA 1DFHA 2GDZA 1U0RA 2CNLA 3JQ8B 1LDYA 4PE5B 2UYQA 1P77A 3CR8A 4S2EA 3ROQA 5THQA 1AHNA 2NU9A 3OU6A 4X0EA 3W4IA 3B7PA 2OV3A 4DNQA 1XIVA 3NTQA 2PUFA 1NVVQ 4JR1A 1ITZA 2IH2A 4ZYTA 3ETNA 1KO5A 1NDHA 1FX0B 2WD8A 4WA8A 5CX1B 5IVDA 2GZ1A 4C03A 1N2BA 4RIEA 4YPFA 3S1AB 5FNVA 4HAOA 1RZUA 4PFSA 5CB8A 2YHSA 1JEQA 2Y76A 4YRAA 1Y5NA 4WN9A 3HR4A 3ORRA 4OYRA 1BTOA 3V4FA 3D43A 4A0QA 3L3BA 4DAEA 4M7WA 2XCIA 4YMHA 4NXNB 3H4TA 3K0EA 4P35A 1JF8A 1I7PA 3G5MA 2JL1A 3BSSA 2JGNA 1WEHA 1GGJA 3E9NA 4RABA 2CL5A 5ICFA 3K6SA 3RJ5A 1DDGA 4ID3A 5CHEA 3MCVA 2A88A 1VSQA 1RWWA 1UJ6A 3N6RA 5EJMA 3TQQA 3WXMA 3WAGA 3PGJA 1DC4A 1T6NA 1WUTA 3AEQA 2WMOB 4UNQA 3RG2A 3UMCA 1PWZA 3I9V1 3BF7A 2HA2A 3H65A 5ECGC 4CFZA 1S2GA 4N0DA 3SXUB 1T8WA 4GI1A 5LQCA 4S05A 4G0QA 3H9BA 4BLUA 4DMGA 4MDEA 2CUKA 3GDFA 2GUGA 3AUXA 2FF7A 1JIJA 4TWZA 2XDQA 1PT7A 2QTVB 4Q9JA 3BRQA 1JYEA 2ZTVA 2BZ0A 1J23A 2P67A 1LRKA 3IX7A 1QGUA 1W6RA 3KOUA 3OIVA 3U49A 4NZPA 1NLZA 3O8RA 5P21A 1XQVA 2ISCA 2Y1WA 2VHYA 5JROA 2VP4A 3IQHX 4M7PA 1MH9A 3HJFA 1VG0B 3G0DA 3LDGA 4LJLA 3UT0A 4EFLA 1PCXA 3S29A 1Y3AA 5BV7A 2O0MA 2D00A 2RHGB 3KYDA 2HT1A 2VT2A 3QUTA 2QLJA 1MQ8B 2ZSAA 1YTLA 5JAZA 5KOJB 3H05A 2GM5A 5G0WA 3QJGA 3QPDA 3WNBA 1W30A 1TTTA 1LBSA 1NR1A 4J0HA 2Y1GA 2O1SA 1TZKA 1G1AA 3LAWA 1IN5A 3M6MD 1Q7CA 2VPTA 2I5PO 5C8YB 3BHIA 1ZJ5A 3MELA 4RHYA 1NBAA 2ZRIA 3EVBA 3RS3A 4JITA 2RBEA 1MJ5A 2TMYA 3MCAA 1T9GS 4D82A 3ND5A 2IY7A 3DLHA 4LY6A 2FMUA 3WK7A 2R8RA 4FWBA 4LSMA 3BTSA 1KZ9A 2G9ZA 3FHTA 2X7JA 2ODWA 4LDZA 5GJWC 1M34E 1Q3TA 1A7AA 2HHLA 4OXIA 4YCSA 4V0QA 1TO6A 1DJPA 2C04A 4G1FA 4WIAA 1L7VC 3NWOA 4LPKA 2IE0A 1AHIA 1F8FA 2GESA 3Q8WA 1Z6QA 3A8TA 1G8FA 4EQ6A 3ITEA 1M7GA 3CY6A 2WZDA 4JGGA 1J0XO 1I1QB 2HHJA 2JGAA 1E2UA 1EHCA 4W6ZA 1X7GA 3NUQA 1W1WA 1H8EA 4K6CA 2J3IA 3EXG2 3QEMA 4Q9KA 1SH7A 4R41A 5DT9A 4Z7JA 2ZJOA 3LOQA 4OD0A 1CS0B 2A86A 4PZUA 4PYJA 4O29A 2C54A 1PGNA 3ZI7A 3I45A 1NN0A 4UTPA 4G0XA 1N5JA 2EERA 1GL7A 1V9CA 1B8PA 2G88A 3D7SA 1N5MA 1XLUA 2JD2A 3KZ1E 1RAFA 4OO3A 5AKLA 3ICVA 3STTA 4KXVA 1EA5A 2P9HA 3D4BA 1M2VA 4L5JA 5TGTA 3SYTA 2HU2A 4OMUA 4AWAA 4F9TA 5CDGA 3UXYA 2AC2A 1O03A 1CVIA 2EFDB 3EUAA 1KOLA 1I24A 3ANLA 4OJMX 4B4OA 4F4FA 4CEHB 1ZMBA 3OECA 1EX1A 1DUSA 2WKRA 3DFIA 1BXRA 4JKIA 4KAJA 4UQPA 4TPKA 1YNSA 5JYDA 2J4DA 1N32B 5EWLA 1Q2XA 3OHPA 2BBSA 1F17A 3GEGA 2NG1A 1LS6A 4NZOA 4G56A 4RULA 1UL1X 2UXBB 1CETA 3INGA 2IPMA 1C80A 4E12A 2GCEA 2BH2A 5G41A 2OILA 3Q2IA 3Q7RA 3KXLA 2HWYA 2J32A 1SBHA 3G7NA 3OEYA 3R7BA 4HQ6A 4IEIA 2B1JA 3RT7A 3H11B 2ATIA 3GXOA 4BB6A 1Q92A 3IHTA 1NV9A 2CXTA 1PJZA 4K6MA 2HO4A 3O9ZA 1ADFA 1JG7A 1OLOA 4KL8S 2H9IA 4CLDA 1JWAB 3NZEA 2O0LA 1BE0A 1R0ZA 3FNEA 4JELA 2OYCA 2FV8A 3BJIC 4L8GA 5E7MA 1NW5A 3ZHVA 3C4QA 2CFIA 3RRBA 3S2FA 3URMA 1JYSA 2C42A 3QF4A 3NORA 1VIYA 3MK31 4X62B 2YKGA 3N75A 2OGWA 4NEQA 4PFQA 3WK6A 3SP1A 1QO0D 3LHDA 1L5YA 3KB8A 2P5YA 4J3NA 1CP3A 3H3XA 4KFTA 3AGQA 4XGQA 1SQSA 1Y5LA 2GEUA 1OU0A 4QWWA 4K0RA 1YHZA 4M0PA 3ORHA 1XVAA 3PSAA 4E31A 3FSRA 3IKMB 4V02A 2PZGA 4EKGA 1SWVA 4E22A 1E61A 4EA9A 3C8ZA 5DW3A 1EWVA 1Q1EA 2CCGA 3RIGA 1RU3A 3LNCA 1QHFA 1CUWA 1EM8A 3L8EA 2E48A 4QAQA 4JI3B 2AZDA 1EGVB 2RC5A 4QBKA 4RESA 5A3SA 1F5SA 4YFVA 2BR4A 4LE0A 4QVGA 3PPVA 5AW8A 3S8MA 4UDYX 1Z62A 1YC2A 3PQ4A 1YRWA 4CIXA 3KEQA 4X97A 1U7XA 2Y1XA 4B9EA 2QVYX 4CEIB 4IUYA 4CM9A 1XKQA 2UXDB 2AW3A 5LXTA 4IM7A 1MIOB 3EA0A 4FS3A 1IZYA 3ZOKA 1TVKA 4GL2A 4XVRA 2O5EA 3F7NA 3DWGA 1QO7A 5EPOA 2GXUA 4U7TB 4YS6A 4EEZA 4FGKA 4RLSA 3IXLA 3EQ6A 4NCBA 1SR8A 3N2KA 3NWPA 1DGQA 1OWPA 5KYUB 3A06A 3MINA 1VSVA 1TCUA 3EK2A 5CLFA 2WHYA 2O52A 1TYAE 3RV4A 3JQCA 1I36A 1G5QA 3GOQA 3QMPA 1JU4A 4EF4A 2OZEA 3H2GA 1EESA 3LQFA 1SIOA 1GZ5A 3U3MA 1EVKA 2O57A 2JFPA 3VM6A 5I9BA 3HVJA 1LZKA 3DZCA 3HJGA 3DE3X 2DH6A 1OIWA 2XDAA 5ESWA 1RE0A 1XTIA 1NXQA 3FWYA 2UUCB 1GILA 3IMFA 2D2VA 4OJYA 2V3CC 1GGHA 4LZAA 2QF7A 3BXPA 1C1YA 2XWBF 3DGEC 1FFXA 4FILA 4BVEA 1G4UR 1NT2A 2ZRDA 1UFOA 2Z1DA 4U2EA 3FOZA 4DC1A 2JGMA 4GT1A 3R7NA 3WRXC 1K8YB 3WMFA 4HP8A 4QNNA 4NSNA 1DKMA 1SUBA 2JBHA 1OTYA 4FONA 5BQ5A 5KAPA 3B1KA 2O1WA 4WJKB 3OLQA 5J9FA 3DFFA 5TR9A 1P8JA 3LUJA 1R9JA 1QG4A 3Q0IA 3H9QA 4H6PA 4GZ5A 1PJCA 4NZNA 4PG6A 1AD2A 1ZCJA 1OZHA 5LB2A 2QUKA 1JJFA 3ETCA 3FNHA 2LW7A 3QBDA 4IAOA 2H5JA 3TW4A 1E3DA 1UBJS 3KKLA 5J2UB 2VP2A 3PQFA 4RTMA 2FMIA 5JVDB 1U80A 2JLSA 2V6MA 3SF0A 5C46F 4LQLA 2AMYA 3DEZA 3GGJA 2O19A 1Y3DE 4EOGA 1W2WB 3ZLVA 1NJ2A 3TE7A 3KB2A 1L4NA 5KKAA 1UPTA 4JQSA 5LC1A 4YJHB 3TCXB 1ETHA 2VWHA 3EIOA 3I2KA 1PWEA 2DQ4A 4KPGA 4YYEA 5A2GA 5GTDA 1RC0A 1L7PA 3W4KA 4IVQA 2BD0A 3F5FA 3N2YA 4MEJA 5ED0A 3UCXA 4HH1A 4CGYA 1GV1A 1H0HA 1Z25A 3MRTA 1JPNA 4IDPA 1Z34A 1T3GA 3TOXA 3W1VA 2C9OA 3JTMA 1DLIA 3AEXA 2ODNA 3F8WA 2YIMA 1SBYA 1NYRA 1H1TA 2PUHA 2DWCA 1VDZA 2C07A 4OJQA 5FBVB 3ICEA 4NFSA 4IJKA 3V3TA 3EYAA 2WF5A 3U26A 2I91A 1F7VA 5HSGA 2OUKA 4JB0A 2IEDA 5C8YA 1G7TA 2JG3A 5HHTA 1H4QA 2H1OA 2VWPA 3EHDA 1RJFA 2ZUSA 3OAAD 3GRVA 1WTAA 3VDRA 4OA5A 1EDDA 2EYQA 3SHWA 1GUBA 4PR3A 4YO8A 2IOFA 4LMAA 5A9TA 1FF9A 2CYAA 1IEQA 4ZHQF 5LQNA 2B4YA 2V96A 1WPXA 1CLUA 1N9KA 3B1WA 3WL4A 3EWAA 4DEVA 3HACA 4C88A 3EAFA 1R74A 4ND8B 1OU4A 2OHGA 4FJ1A 5DM4A 2PX6A 1NRIA 1U0EA 1M5TA 3IPAA 2FW0A 3KFVA 2YV2A 3HPQA 1VIAA 3FZQA 3K09A 3I3SR 2QUIA 3IJRA 3KP1A 4JBWA 1OYWA 4MWBA 5B5SA 1N6RA 4YRRA 5EY5B 3KQVA 4E4YA 4MP6A 2I9PA 4HDKB 4XAQA 4PPNA 4S1TA 4M6WB 5I3ZA 7MHTA 2BONA 3HR8A 3M34A 3O4IA 1I2DA 4ZEVA 4B79A 4I1VA 3CB2A 4MR8A 5GJVC 3DOCA 3HJCA 3WTCA 3HZHA 2XKAA 3DV0A 5LDGA 2XBUA 1KYIA 4AM8A 4EMBA 2NNLD 1KBQA 3U09A 1NNEA 2N3ZA 3R3UA 1Q44A 4WNCA 3WYBA 4QSMA 2O07A 3T1NA 5H16A 2H9YA 3V2GA 5EJ2A 3AXTA 1BGVA 1JYFA 4URFA 3BWMA 3ICOA 5IDYA 4Z4HA 3FVRA 1C7QA 1TVKB 5FBRB 1II8B 4GI2A 1DE0A 4PC1A 1VHQA