2P4HX

Crystal structure of vestitone reductase from alfalfa (medicago sativa l.)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
310
Chain Sequence
KGRVCVTGGTGFLGSWIIKSLLENGYSVNTTIRADRDVSFLTNLPGASEKLHFFNADLSNPDSFAAAIEGCVGIFHTASPIEIVTKRTVDGALGILKACVNSKTVKRFIYTSSGSAVSFNGKDKDVLDESDWSDVDLLRSVKPFGWNYAVSKTLAEKAVLEFGEQNGIDVVTLILPFIVGRFVCPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDELKEIKGARLPDLNTKKLVDAGFDFKYTIEDMFDDAIQCCKEKGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vestitone reductase
publication title Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.).
pubmed doi rcsb
source organism Medicago sativa
molecule tags Plant protein
total genus 108
structure length 310
sequence length 322
ec nomenclature ec 1.1.1.348: (3R)-2'-hydroxyisoflavanone reductase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2p4hX00
5GZ1A 2FRDA 4TQGA 3SEFA 4CMJA 4BNHA 2PZLA 1ONPA 3D4NA 5A05A 5JAMA 3R3SA 1DHTA 3R3JA 4NU6A 4E5KA 4XYLA 5A04A 2O3QA 4NIMA 2VUUA 2PTGA 3AM3A 2D4AA 3GEDA 5TC4A 4YAEA 1J5PA 3EVTA 2NNLD 3WQSB 1N2SA 1JVSA 3D5TA 1ZXBA 4IPTA 5KOIA 4AJKA 3G1UA 4CLHA 4O1MA 3K5PA 2A94A 2DVMA 3KV3O 1JA9A 3BMCB 1ONOA 5DBFA 1ENPA 1UR5A 1ZSVA 1E5LA 1ULUA 4PRKA 4IS2A 1PX0A 4YCAA 3MTJA 3VHRA 5JAIA 3ENKA 2FZEA 5CFZA 3L6OO 4P4NA 3VOSA 1Z82A 3A28A 4O59O 1XEAA 3FI9A 4LMRA 3TFOA 4Q3BA 3JQ8B 1N1GA 5LCXA 3GFBA 5JO9A 3W8FA 3BHJA 2G82A 1I10A 2VHWA 4JJFA 4DL9A 2DQ4A 4L4XA 4YWJA 1JDJA 1DO8A 3NTRA 2VT3A 4H16A 4LW8A 4NK5A 4J7UA 3VH3A 3ADOA 4B8ZA 5H83A 3IP3A 1PIWA 3PVZA 2NWQA 3JQCA 5MDHA 4PIVA 1GZ4A 1X1EA 1YQXA 4L9RA 4DA9A 4R1TA 3DZGA 3VVBA 4MVJF 4NBWA 4BGVA 5L40A 5JAZA 4R3WA 2AXQA 2AQ8A 5T8KC 1KOLA 3NKLA 3P2YA 3RUDA 3K6JA 4CM4A 4ND3A 4GQAA 1H6CA 2Y0DA 1UXKA 1ZXLA 2NM0A 3CEAA 1NPDA 1M2WA 2QG4A 1A7AA 3FWZA 4PG7A 4XQGA 4CLRB 5A5EA 3C1AA 4EW6A 1MB4A 1PWZA 1CF2O 4R68A 2WD7A 3ASVA 4HFJA 3H5NA 4TRMA 4BQPA 1JTVA 2X0IA 1YOVA 3JD4A 2EF1A 3V5NA 3IKVA 4JP3A 1HLDA 3DQPA 1IHYA 4CQMD 5L7WA 1ONNA 1DFGA 4D0RA 4RJTA 3AY6A 3S2EA 1UH5A 3AI1A 5JE8A 1D3AA 2IZ0A 1R4NA 2VRBA 3TOXA 3I9OA 3EHEA 3L4SO 2NACA 1E6WA 2P5YA 1H9BA 3UHAA 3DB2A 2UDPA 2FR0A 1VPDA 2P91A 4ND1A 1UUFA 1WZIA 4J3FA 4P4LA 1I3KA 2I3AA 1DEHA 4B4OA 3RUCA 3ZWNA 4D42A 4DWVA 3GT0A 4YAKA 3C1TA 3F3SA 1X15A 3RFVA 1N1EA 3UFXA 2NVWA 3DZFA 1LJ8A 4J1SA 5FFFA 3IS3A 1XSEA 4IBOA 4RL6A 4W7IA 3T7CA 2ZCVA 5I9NA 2QW8A 3DR3A 3AOEC 3H8VA 4J0FA 4MDHA 4GSLA 3DHEA 1O94A 3KYCA 2R00A 3CMMA 1W73A 3HDJA 4RF5A 3ICPA 2BGMA 3ZHYA 4R1SA 3MJ4A 4U6QA 3PYXA 4YT4A 1D8AA 4U7WA 3JQ9C 1B26A 3UAGA 3ZHZA 1B14A 2P9EA 3CTMA 3PWZA 1YRLA 3G1TA 3L4BC 3D1LA 4IDGA 5EQFA 3TL3A 1NWCA 2BGKA 3QE3A 2PZJA 2DBRA 1HE3A 2EGGA 2QIOA 3PJDA 1XCBA 4DVJA 7ADHA 3ONFA 4XKJA 2PD6A 4E6PA 1AXEA 3DWFA 1FMCA 2GYYA 1DIAA 3JD3A 5GY7A 3WGYA 1I3LA 2Y1DA 3K8ZA 1KYQA 2B36A 1YB4A 2GCGA 3HHPA 5CDUA 1FDTA 1J0XO 1E7RA 5IDWA 3BTOA 4JP2A 3JQFA 3EVNA 3O4RA 1T2EA 2BF7A 3QHAA 2JCXA 4AJ4A 1LC0A 1QP8A 5CDGA 4IUYA 3ZU2A 4MJLA 4RF2A 5IZCA 4TMFA 3SC6A 3GVHA 3IDSA 5KJCA 1B2LA 4I1IA 2HK7A 5T64A 2X5KO 3CUKA 1Q7GA 2VYVA 9LDBA 3A9WA 2ZTUA 4MP8A 1UXGA 3RJ5A 1CJCA 3RSHA 3TZCA 3RC7A 4XWYA 2DBZA 2AEJA 2B35A 4WNIA 3ST7A 3ZZNA 3JQEA 3JYPA 4L73A 1SO8A 1I3MA 2O4CA 4RQUA 1DC3A 2I76A 3KLPX 4WOKA 1P1HA 4BO5A 2EP7A 3HE3A 4IGFA 5JPIA 1BG6A 1HYGA 3S2FA 1CDOA 4JIGA 4MKZA 4NJMA 5B12A 1K3TA 1Q7CA 1RM5A 4BO8A 5G0WA 1PJSA 3U5TA 1U3VA 4YPOA 1C1DA 1LQTA 5F5LA 1ISMA 2GASA 4XRGA 4PG4A 3QVXA 4DTIA 1BHSA 2Y0EA 3BTVA 3WIDA 3Q9NA 1TI7A 4X54A 3RROA 1R15A 3JYLA 5ADHA 4A2CA 2D2IA 1EE9A 3PP8A 3D4PA 3O26A 4XYGA 1GZ3A 1A72A 2B0JA 1K5HA 4JBGA 5HBRA 5ICSA 1AN9A 1IPFA 5JMWA 3EK2A 3E5MA 1NFQA 3U4DA 3AU9A 1WDMA 4DLAA 3DEYX 1DBVO 3ONDA 3WGGA 2ZJ0A 1HDGO 4CM9D 4YDRA 4E12A 1QKIA 3WGIA 1K2WA 4I5DA 2FOIA 3MJTA 4WEQA 1ID1A 2O3UA 2O48X 3R0IA 4ZRMA 4YBZA 4ZU3A 2HSDA 3O9ZA 4RDHA 2YV1A 1VRWA 2J3KA 3AUTA 3C7AA 3MOIA 1AHHA 4JBIA 2GN4A 2AQIA 3WQQA 5EIOA 1E5QA 1JWBB 4XRRA 5G4KB 4PLYA 4F6CA 3VDQA 3ON5A 3NUGA 5C37A 4CMCA 2OGUA 4ZRNA 4YT8A 2JD1A 4Q9NA 3GGPA 3C85A 3RJ9A 2IXAA 2PNFA 4E4YA 3IL2A 1JKIA 2J6IA 3ANLA 4ILKA 4E2YA 1V9LA 3X2FA 2IYOA 3GDGA 4YJHA 4GVXA 2ZTVA 4GH5A 5COAA 1KERA 4YQYA 2Q1WA 4MKRA 4YAJA 1GUYA 1AGNA 1ZSYA 5JC8A 3QRWA 1D1SA 1JWAB 4ESOA 3S2GA 2A4KA 4WKGA 5TSDA 3MZ0A 2VUSA 3WBBA 2R00C 3RC2A 4UUPA 5IAAA 2FHSA 1SAYA 1FDSA 4Q3DA 3L0DA 2DTEA 2PKRA 5KKAA 4RPKA 5KJ6A 1E3EA 4BMSA 1J6UA 5A3JA 1NQ5A 3KUXA 4YEDA 3KBOA 1PU2A 4XIJA 3F46A 4KQWA 6ADHA 1E1KA 4FCCA 5BSFA 1S7CA 2BFOA 3VZPA 1PGJA 3R6DA 2NTNA 2FPGA 1PJBA 4E2WA 4GGOA 3OFSA 3OQBA 2JKVA 1LDMA 2E37A 1MG5A 1EDOA 4PRLA 4CMKA 1QMGA 1C3VA 1P1FA 5KIAA 2FPPA 1Z75A 3HB5X 4EBFA 3FPLA 1IULA 5DT9A 2D3TA 4TKLA 1LSUA 4FFMA 4NBTA 1HT0A 4M87A 3ROKA 1X7DA 1T2FA 5F1OA 3UCXA 3FHLA 3KHUA 5IZCC 1VJ0A 4A5OA 5IN4A 2D5AA 1DRUA 5L3ZA 4CODB 4KMSA 4D43A 3FWNA 4BKRA 3VVCA 4YRAA 4RVDA 3OJ0A 1N5DA 3QWFA 1Y5RA 3O8QA 1GV1A 2DTDA 2O7SA 4RF3A 2A9FA 2OFPA 2CF6A 4RVUA 3H6KA 3DONA 5I7VA 2C2XA 3ZU3A 1UZNA 4E5MA 1I2BA 4IQ0A 5IG2A 1ZSNA 1BVUA 1MV8A 5C7IO 1IUKA 2QRJA 3JD1A 1EK6A 3SLGA 1U3WA 2ZB3A 4LRSB 4PLWA 3BA1A 3N74A 4OYRA 3VPFA 4AICA 4WEOA 1PZGA 3TN7A 2RHRA 4J1QA 1LU9A 3IC5A 2NVBA 3PXXA 2B5WA 3HUDA 4IS3A 3ADPA 2X5OA 1SEPA 4C7KA 1ZMTA 1V35A 3U49A 1KVTA 3IUPA 1FJHA 4KWIA 5ER9A 2DUWA 1Z6ZA 1G0OA 4Y67A 4FSHA 1LC3A 5U4QA 3SJ7A 4JCOA 3DL2A 2NLOA 3QWAA 3GF4A 4DIOA 4R9SA 5JDIC 4B4UA 4CMIA 3HN7A 3KYDA 3UN1A 1R0KA 4E30A 2J3JA 4M8SA 1B7GO 2CD9A 3D64A 3L9WA 2VWHA 5KVCA 2BFAA 3D4OA 1ZEMA 4E21A 3JTMA 3ZNQA 1C0KA 3ZV6A 5BT9A 3ZV3A 4FFRA 3A06A 4JBHA 5DCUA 1LLDA 1V3UA 2O7QA 2NVUB 1WXDA 2CDCA 4WECA 4DRYA 1UXJA 1GQQA 4MVJA 4XB2A 4RPGA 1PZFA 4R16A 2W2LA 3A1NA 4J90A 1H9AA 4QO8A 2YFHA 3EY4A 3EZYA 4AJHA 2HRZA 3GLQA 2PD3A 4UEOA 4YACA 4PLPA 3D3WA 3ROMA 1BMDA 1MXFA 4I5GA 4N5NA 4R5HA 1ISHA 1Y6JA 3OH8A 1WDLA 2Y1EA 4R51A 2QQ5A 2VYNA 4YJGA 4B3IA 5HWSA 4IY1A 1NPTO 3OJEA 1HZZA 1H0KA 3TPCA 3ASUA 1HTBA 3IJRA 4CLOA 1U8XX 1GDHA 1Y8RB 3LC7O 1O6ZA 4NFSA 4FGWA 4H7PA 1PS9A 3B70A 4WASA 1ZEJA 4Q3CA 4XX0A 1SPXA 3QVTA 3ANNA 1YKFA 3PHLA 4WOJA 5HM8A 3ENNA 2PZMA 1ZCJA 6LDHA 1EFLA 1VJ1A 3ZH2A 1AHIA 3S55A 3I9NA 1NAIA 2G17A 3JYNA 1DRVA 2BFPA 3HDQA 3L6EA 4OL9A 1O89A 3AOGA 4B4WA 4AG3A 4L4RA 1M76A 3TZQA 3BZUA 2GN9A 2XPCA 1EBUA 3DBLA 3T4XA 2B5VA 2YY7A 2JFGA 3OECA 1LLQA 1KEWA 2ET6A 3IUSA 3AUSA 4XJTA 4J1TA 4NI5A 4IJWA 3V1YA 3QQPA 3JQBC 2B4TO 1F14A 1HYEA 3LC1O 4H15A 3JSAA 3ROQA 1NR1A 1VSVA 2OMEA 4LN1A 1HXHA 3QP9A 5IDXA 3ETGA 3OIFA 3GMDA 4ZICA 1FXSA 4K6FA 3GUCA 5CP8A 4CM7A 3GFGA 4MP6A 4MVJP 5DULA 2IRWA 4CR7A 4FB5A 4ZQBA 1XA0A 1C0PA 2E82A 4BUCA 3PZBA 4BL5A 1C1XB 1N9GB 2UUPA 2JD0A 3AY3A 4BV9A 5IF3A 5JDCA 1UXIA 4O5OA 1LRLA 1JAYA 3PWSA 4ALKA 4G2NA 2FY8A 4PLFA 4BO2A 4C4OA 3NYWA 4QUKA 4GLLA 1QLHA 4EYEA 1D1TA 2DC1A 4CMEA 2OO5A 4J49A 2HU2A 3EMKA 2QYTA 4XYBA 3H5AA 1WPQA 2IZZA 4AJ2A 5COQA 4CL3A 1NFRA 3GDFA 4DLLA 1A4IA 3LSYA 5A9SB 1PZHA 4ZQHA 1XGKA 4NK4A 4I8XA 2E48A 2EERA 1SOVA 4FR5A 4BNWA 3VZRA 2ZCUA 3AUAA 4BGIA 4E5NA 2GERA 1U8FO 2JJYA 2EWMA 1UDCA 3BMQB 2GD1O 4MP3A 1H6BA 3CIFA 4QSMA 3RUEA 1LDEA 4YQZA 1PGPA 4FDAA 4NPCA 5I8WA 1PR3A 1ADCA 4PLZA 4W82A 1N7GA 3PTZA 2ZKLA 2X5JO 4KTVE 3PQDA 1Z74A 3W4JA 1U2DA 4E3ZA 4BMVA 3V8BA 1QV7A 1EZ4A 3GMSA 4DQVA 2YUTA 4U6SA 4PVCA 4W9NA 2FSSA 4CM3A 4FC6A 3D5QA 1WWKA 2B4RO 4B79A 3F5QA 3JQ6A 4UEKA 4RO0A 3NJ4A 3JQGA 1NQAO 3E9QA 4ZHSA 4JROA 3PFFA 1GADO 4M1QA 4CV3A 4GPD1 1HWYA 1E92A 1QYVA 4MIOA 4B4VA 5L4LA 5CHEA 1ZK3A 1ZNQO 4HV4A 4IZIA 2GF2A 1LRJA 2AW5A 1TA4A 3R1IA 2OL4A 1IYZA 2OORA 4PLGA 1U3UA 2EEZA 4HWKA 4P8RA 1ADGA 4WPGA 4J7XA 5CG1A 1MP0A 1KY5A 3X2EA 4B3HA 2RCYA 1D4FA 4M55A 2GO1A 2WMDA 4Y6PA 3GZNB 3CZMA 1VKOA 3V2UA 1E6EA 4CQLA 2EJWA 1S6YA 3JYQA 2PK3A 1BVRA 4HADA 4NU5A 4JK3A 2Q4EA 2QHXA 2PH3A 3OBBA 3ITKA 3KM0A 4RCVA 3EYWA 3W6UA 4UULA 2BFMA 2PA3A 3GEGA 1KBZA 3U0BA 5K6AC 3FF4A 2DBVO 2NQ8A 3H2ZA 1LBEA 2HQ1A 5FWNA 4FD3A 4J2HA 4OXKA 1TXGA 3BMOA 2D59A 3RCBA 1W0CA 4GSKA 1RM3A 4RGBA 1I5RA 4P38A 4BB6A 3FBGA 3WTBA 1I0ZA 4J43A 1WLYA 1BXKA 1SOWA 1MA0A 3TSCA 1PJ4A 3ZI0A 3ZDFA 3RKRA 3P19A 4EJ6A 3HQ4O 5CEEA 4D7AA 1P45A 4GKVA 1IPEA 4Q3EA 1HZJA 3WXBA 4CL8A 4RVHA 3DMTC 1XQ1A 3QSGA 1GYPA 3G17A 1LLCA 4NBVA 1DB3A 5L45A 2GN8A 1T2DA 2V6FA 3RBVA 2JCVA 3LQFA 5TX7A 4IM7A 2EW8A 2UV8A 1IHXA 3JQ7A 3JQAB 3Q9UA 1PS8A 3O38A 2AMFA 2J5QA 1Y9AA 4G65A 4YJFA 5DP1A 2HMVA 3MJEA 2E6UX 3P7MA 3JD0A 3LT1A 2NU8A 3GNQA 3OP4A 3NTQA 4Z0HO 3G79A 1YQGA 1YB1A 1ZKMA 2YW9A 4FOSA 4M89A 3UF0A 3ZV5A 4OM8A 1BXGB 2CVQA 3LT0A 5CPFA 4E2XA 3K2BA 4XEHA 2EIHA 1BW9A 1E1NA 1KVQA 4PGFA 1YL7A 4XCVA 1U2GA 2CY0A 2DAPA 3IMFA 2ZB8A 2IXBA 1DAPA 4XYEA 1ZBQA 2GZ3A 1SC6A 5DDIP 1SB8A 2Y1OA 5B37A 2OP1A 2FP4A 2O3TA 1H6AA 3E18A 2Y0CA 3I4FA 1BDMA 2X9VA 1YDWA 1ADFA 4D41A 4YAGA 1UZMA 2Q50A 2Q2VA 4CV2A 4ZQEA 2AA3A 3GAZA 1PS0A 1EVYA 1WNTA 1IB6A 1E3JA 3M1LA 3WMWA 3NRCA 3PHIA 1IE3A 4FW8A 2CDBA 5ITVA 5ILOA 3DXFA 3WWYA 2VYVD 3RAJA 4EDFA 1Y8QA 4R4JA 4DUPA 4OH1A 4BO9A 4TRJA 1SMKA 5JFOA 4BHTA 4AFNA 1ZJYA 1Z7BA 3NT4A 3NX4A 4GLOA 3VH2A 3VC7A 4TVOA 1I30A 3WOHA 2Z95A 1YL5A 3BXXA 3C7CB 4MVJI 3GG9A 3GA0A 3NDRA 2C5EA 3RC9A 3W4KA 3ZNNA 4BO0A 3Q3CA 3I4CA 3BMNB 3I9MA 4MVJE 4XD2A 4DBVO 5FEUA 2HUNA 2FSVA 1FDUA 1O95A 4I9NA 4R1NA 1C0LA 3KOUA 4F46A 1ENZA 1PR9A 1R4MB 5EINA 4DXHA 2VUTA 3PJFA 1FDVA 1M67A 4PN3A 1OC2A 4YJDA 3D3EA 1G6KA 2DFVA 3GVXA 1ZK4A 2NV6A 3AW9A 3ORFA 2PGLA 2IDZA 4LISA 5B4VA 1VM6A 4OXNA 2Y66A 3LC2O 1SZJG 3E8XA 3K2EA 3DZJA 4RORA 4KUGA 5DOZA 1T1SA 4PG6A 3OA2A 2OZPA 3ZHXA 1GQYA 1V3VA 4OSOA 1EE2A 4RDIA 1DC5A 1PL6A 4B3JA 1DIRA 1X0XA 3IKTA 3WYCA 3GK3A 5ES3A 2BMAA 1U5CA 1GU7A 3TOZA 2RIRA 5AQ1A 5G4LA 2WSBA 3IQDB 1FDWA 2GR9A 4J9VA 3T4EA 4EITA 2X22A 2X0NA 3AI2A 4DYDA 3L77A 2GUGA 4AL4A 2Q3EA 4A10A 1DHRA 4DC0A 5EL0A 1GTMA 3KLMX 1O9BA 4AJIA 4MVJG 4DREA 4B7UA 1AUPA 3DOOA 1HE2A 2P9GA 3WICA 4UUNA 2GPTA 2E4AA 5B4TA 1YWGO 3I1JA 1JU9A 4PZDA 2DPHA 4RZHA 4D0SA 4Z0TA 2QX7A 3CINA 2EKLA 4CV0A 5L7YA 3GH3A 4RQTA 4CM5A 3F4BA 2FPIA 2WE7A 3ICCA 3WX0A 4WCFA 4R69A 1C14A 4RLHA 5A9RA 1GL3A 1W4ZA 4Q3AA 4W7HA 4CLDA 4YYZA 4XJSA 3ZU4A 4I5FA 3EDMA 5LC1A 1Y7TA 2PWZA 3F5SA 4LSWA 1QRRA 2NADA 2DKNA 2ZJ1A 4Q3NA 2YHUA 3NJ8A 1ZJZA 3RUHA 3UICA 5DZSA 4CQMA 3L6DA 1SB9A 1YH3A 3TQHA 2UVDA 3WIEA 3DDNA 1T1RA 4Y9DA 3NT5A 3ITDA 4DC1A 3QVOA 3KB6A 1ZO8A 3QWHA 4FFPA 4EEZA 5U9CA 1GPDG 1LI4A 4CM4B 1P1KA 1YE3A 1UAGA 1OAAA 2NSDA 1X1TA 1I01A 4AJEA 2H1SA 3ZWBA 3INGA 4FQ8A 5KJ1A 1DC6A 2FMUA 2J3HA 4J9UE 5EMHA 5JY6A 3RFXA 2WD7B 1V0JA 1PSDA 2IZ1A 3AWDA 4E2ZA 1MFPA 3DTTA 4XGKA 2Y99A 5AXCA 1Z7EA 3ZW9A 4MO2A 4EJMA 5L9AA 3E6AA 3VPSA 1TT5A 4TWRA 3VPHA 3RUAA 4IINA 4UVHA 4E5YA 1I24A 2G5CA 4G5HA 4Y6SA 1A27A 4UUMA 4GMGA 4LSMA 1Q0HA 4L8VA 2P4HX 1U3TA 3IOYA 4PLHA 5K9ZA 1QYCA 1R4NB 3E03A 5TS3A 4CM8A 1P1JA 4Q39A 3GDOA 3RIHA 1KS9A 5BSHA 3WNQA 3KYBA 4WE3A 4R1UA 5IXSA 4CUKA 1WAMA 4M86A 3HG7A 4GI2A 2PKQP 2F1KA 5CDSA 1EVIA 2ZK7A 4I9HA 2IODA 4NFYA 2HDHA 3DBVO 5G0VA 3SLKA 3OMLA 1Z73A 3QVWA 5CG2A 1UAYA 2HO5A 4TZKA 4BNIA 4OXYA 2CDAA 1U28A 4ZVVA 4ALMA 3QWBA 4FN4A 1OC4A 3GVIA 3VAZA 4XQCA 4PZEA 4E33A 3DFZA 4IDDA 4WLUA 4YVFA 2J5RA 3WB9A 4K26A 3OEYA 4D3DA 3ULKA 4I9UA 1RKXA 2I99A 5THKA 1HDYA 2Q2QA 3IP1A 1DFIA 3KYCB 1RM0A 1BTOA 1GV0A 4YA6A 5L51A 3L07A 4AJJA 1PJ3A 1QYDA 2B4QA 3DO5A 3LZ6A 3H9JA 1Y8RA 1X7HA 1DLIA 1YONA 4IJKA 3B20A 3W4IA 5CEFA 1EUZA 3ROPA 4XDZA 1UDBA 2C7GA 4ALLA 3HSKA 3WLEA 3JQFC 1NWHA 1NAHA 1QYXA 4NBUA 2ZYGA 4UAGA 3WGTA 3ZWCA 2EW2A 4WLNA 4DMMA 5JS6A 1UDAA 3I5MA 1HE4A 3IIEA 4RF4A 1J49A 2B83A 4ALIA 2W2LD 4RVGA 3OICA 1O0SA 5C7OO 5KTKA 1DAOA 2BI8A 1NVTA 2GGSA 2W98A 2VHYA 3GR6A 3I52A 4S3MA 2YYYA 2B37A 2WYVA 1GEEA 5KNLA 2FN7A 5DCWA 4P4GA 5F5NA 2DFDA 2VYND 2YHIA 3OIDA 4PLTA 4CUJA 2JAHA 1VI2A 1A9ZA 2PY6A 2NU7A 1PQPA 2TMGA 3Q0EA 3UOGA 3WLFA 2RHCA 4KUHA 2AQKA 1YVEI 3QY9A 4LVUA 1U4OA 2W2KB 5JCJA 4CMHA 1Y9EA 4CM9A 2YDXA 1O5IA 3VTZA 3Q2IA 4TZTA 1XHLA 3TRIA 3NDIA 4RLSA 1H2HA 3BTUA 4TVBA 1OFGA 1LDBA 2VNAA 3DBHA 3TF5A 2AE2A 3BAZA 1LRKA 4NJMB 5F1PA 4CPDA 1E3WA 2Y1FA 2HAEA 1BSVA 2H63A 1B3BA 1HETA 1C1DB 1M75A 3ZNPA 3AJRA 3QVSA 1XDWA 2X23A 4WGGA 3NV9A 3AM4A 2UUOA 1P0CA 2JAPA 2WJPA 4B8WA 5L53A 1KETA 2IEDA 2YQ4A 2D8AA 3PI7A 3PQFA 1HL3A 1KEPA 2I3GA 1BRMA 2VZ9A 4TROA 3OQ6A 3Q6IA 3U9LA 2O3JA 1X13A 4K28A 5I9MA 4DIFA 3PHGA 1NQTA 3CE6A 3FTPA 1SBYA 3O03A 4BKPA 1PJQA 4BQRA 1HYHA 5HS4A 1QV6A 3CH6A 5DBIA 1RM4A 3ABIA 1ML3A 1DIBA 1E1MA 5T57A 1QORA 3TWOA 4NQZA 4XDYA 4DBZA 2DU8A 1P9LA 4NNJA 4O0LA 4UEJA 3INRA 4BNUA 1CQIA 2G76A 1NBOA 1E3IA 2JHGA 1HEUA 3VZQA 4B7CA 4BIIA 3PEFA 3I9LA 1LDYA 3JQAD 1DOHA 3DOJA 3PGXA 5JSFA 1ZW1A 4E13A 4XA8A 1Q7BA 4XB1A 4KTTE 4JX8A 3GVCA 2R6JA 2XF8A 3NEPX 5U1PA 1EUCA 1LDGA 3SBOA 3EW7A 5JNLA 5JXWA 2YQ5A 2J8ZA 3K9QO 5BNIA 5ENVA 4OHUA 4Z6KA 3K30A 1GR0A 4D3SA 1RYDA 2ILTA 4TKMA 5KVSA 1XQ6A 3HFSA 4E32A 3DTYA 3GQVA 5I9LA 4YJHB 3CMCO 3KSUA 5A5FA 3DZHA 3KSZO 3ZWWA 4YRBA 1M6WA 1N92A 2YV2A 3DZIA 3KEQA 2AEFA 1BGVA 5A4DA 4N7RA 1E7QA 3AK4A 4NFHA 1MUUA 4BO6A 4DQXA 3HZZA 4HFRA 5JW6A 4TRRA 3OSUA 5G0UA 3RD5A 2X86A 4D3FA 2CZCA 4ONEA 5L4SA 3UKOA 1ENOA 3H65A 1ZK0A 1GD1O 1YDEA 4BNVA 3HN2A 5DCYA 2EXXA 1CWUA 4WCDA 4N5MA 1VSUA 3M1AA 3KSDO 5KKCA 4FPXA 4JJIA 2C7VA 3OEWA 1R0SA 3GN1A 1F06A 5B1YA 3W8EA 3E48A 3CPSA 1ZIDA 2AEMA 3GZNA 4BNYA 1IZ9A 2JFFA 4HUJA 1H6DA 1SCUA 1RPNA 4BV8A 1HDXA 5I7SA 4JQCA 5EPOA 2Q45A 2W90A 4QTZA 3AU8A 3HDHA 3TZ6A 5KWEA 4CUZA 5BSGA 1ZH8A 1NXQA 2G1UA 2SCUA 5DOVA 2O50A 2Q4BA 3PHJA 5COBA 4GL4A 2HMWA 3GVPA 5JYDA 2X7HA 4OIMA 2WTBA 1ZK2A 4RPLA 3FR8A 3O8QB 2C0CA 3P5SA 4ND2A 4J7CA 4PG5A 4CMAA 3BHMA 1DRWA 3I23A 3F1KA 2QRLA 1TVEA 2O2YA 2OUIA 3OJFA 3LF2A 3FPCA 2DTXA 3BMCA 3F1LA 2C20A 1XU9A 1BDBA 4IXTA 4HX5A 4U8GA 1R12A 4OQZA 1VLLA 1Q0QA 4AJLA 4AVYA 2VTEA 5L4NA 5TT0A 1X0VA 3NAQA 2VOJA 1PJ2A 2Y05A 4OGWA 1JW9B 3AY7A 4OJNA 5KVVA 4H3VA 5CDYA 1FF9A 1LSOA 3ZNOA 4UVEA 3MJCA 5GZ3A 3PHHA 4KWHA 3U09A 3JQ8A 5AXAA 4CR6A 5FI3A 1GAEO 2VN8A 5DBGA 3FRJA 4J1NA 3DFUA 5HRUA 3V2GA 2WYWA 3GNTA 1B16A 4KDFA 1VL0A 2R2GA 3KEOA 1HDCA 5DNAA 5GZ6A 5DF1A 3B1KA 3ETEA 4OOFA 2VNSA 1O8CA 1GCOA 3OQ1A 5FI5A 3COSA 3AUUA 4FFOA 1ZVMA 4U0JA 5JCXA 4CMIB 3KYDB 1CERA 1Q2XA 3NT2A 5TF4A 3VPXA 3FD8A 1PGOA 1PL8A 2CNBA 5T5QA 3AFNA 3FR7A 2PGJA 4BB5A 4BOYA 2HMUA 4HY3A 4MVJH 1P74A 3ZW8A 1VL6A 3C1OA 4CLXA 4WLOA 4N5LA 1HKUA 1M6HA 5T8KA 4CLRA 5A03A 1GFSA 3PIDA 4BO7A 1HE5A 4GWGA 2D5CA 2POQX 3DZBA 5THQA 2VZ0A 4EZBA 1MLDA 1U7TA 1WDKA 1PQWA 4IDFA 3CXRA 3AI3A 5TRTA 3FNEA 5IXYA 2P9CA 1LA2A 3CKYA 1L1FA 1PEDA 1DJNA 3A4VA 4KP7A 1E3LA 3V2HA 1MGOA 1WMAA 3C24A 1R6DA 2C82A 9LDTA 4A73A 2NQTA 4YJGB 3STHA 5C7LO 3H9QA 2AHRA 4JNKA 3OF2A 3IJPA 1WVGA 4CLOB 3DBRB 1PZEA 1T2AA 2EKQA 3KRTA 5T67A 4IDCA 3G3EA 1OMOA 2ZTLA 5T6BA 3F6YA 1PWXA 4Z3KA 2CFCA 4J4HA 2WM3A 5A06A 1GQ2A 4Y6RA 1XR3A 2AE1A 5A02A 1EK5A 5CDTA 4ZN6A 3BYZA 4GAEA 1OI7A 1Q0LA 5DN9A 5ENDA 3JQDA 5TQVA 1HDRA 1B8PA 3D0OA 1P44A 4R01A 2ZATA 4BVAA 3SC4A 1ISGA 2UAGA 5I7EA 4XR4A 4IMPA 4L76A 2Q2WA 3GZ4A 4OMUA 1P1RA 2OP0A 3HDYA 3WGZA 4A0SA 1DIHA 4AJPA 3QV1A 3PQEA 3DBLB 3CSDA 3HWRA 2QYSA 3LF1A 4ROSA 2RH8A 4RPHA 4XQEA 4ZJUA 1YS4A 3PJGA 4YT5A 4GVLA 1XKQA 3SVTA 4N18A 3ZU5A 3AOEA 3VKUA 1N8KA 1OZAA 2P5UA 4L0QA 3WTCA 1JLLA 4XIYA 4YR9A 2ZB4A 2HJSA 2HK9A 1E6UA 2C5AA 2YFQA 3H3JA 3RQSA 1L7DA 4M54A 3E1KA 2D0IA 2CVOA 3SJUA 3JQ9A 5JDCC 2EP5A 1WZEA 3L4BA 4OKNA 1GEGA 5CPBA 4IQ8A 5F1KA 1U9JA 4B7XA 1WW8A 2VWQA 3UXYA 4DPKA 2I65A 3G0OA 3ANMA 4Z9XA 1NR7A 2WD8A 2ZIZA 3BHIA 5HA5A 3PYLA 1NVMB 4WUVA 4CMEC 3FTNA 2GSDA 4BKQA 4UUOA 2NTVA 4QFCA 2PFGA 3H9UA 2Q46A 1T25A 1XYGA 1Y5MA 4P22A 2X4GA 5G0SA 3WWZA 2J5KA 2W4QA 1PJCA 2ZYDA 3U4IA 3WFIA 3WR5A 1KIFA 1PGQA 1XWFA 5TT1A 3U4HA 3GNSA 2UYYA 2VWGA 4O6VA 3GG2A 4EUHA 3PLRA 3ZWYA 3RBZA 1E7YA 3GHHA 3E9NA 2X0RA 4MPDA 5IFLA 3IAHA 4FJ2A 4A7PA 1LTHR 4DPMA 4Z0PA 4U0KA 4ZD6A 1AXGA 4NR0A 1YJQA 2Q1UA 3KZVA 3WNVA 4WLFA 1MG0A 4F45A 3WMXA 1B15A 5C5IA 4W4TA 2HRBA 4CLEA 4KUEA 4EUFA 2VRCA 2P4QA 3GGOA 4K9DA 1VC2A 1EMDA 3GUYA 5TLSA 1L7EA 4JGBA 1T4DA 1F8GA 5A3VA 1QR6A 3OETA 4BGEA 5IDQA 4HXYA 3RUFA 4HFMA 4CR8A 4JXKA 5IN5A 1U5AA 4W9NC 4EJ0A 4KQXA 1I2CA 3SXPA 1U4SA 3PPIA 1NX6A 5FYDA 4LCJA 5BR7A 4GX2A 3LVFO 4QXMA 1YBVA 4OKIA 4S1VA 1LX6A 2AQHA 4CMGA 1OOEA 3JQGB 4BGUA 1KY4A 1F17A 1MX3A 2O3SA 3MWDB 4YAIA 2BKAA 2TMDA 3PK0A 5F21A 3WSWA 4UVIA 2GNAA 3HB4X 2WWRA 2WE8A 4D79A 5JAQA 4TRNA 1EBFA 4NBRA 1GY8A 1GCUA 1JKFA 3DC2A 3I6IA 5G4KA 1EUDA 5KVQA 1QSGA 4QT0A 2AG5A 4BNJA 4BNFA 3I3OA 3AM5A 4KZPA 1XLTA 2BD0A 5KJEA 3GRPA 4ND4A 1E7MA 3PGJA 1DIGA 3MTGA 3GGGA 5JBIA 2C2YA 5L95A 2Y68A 1PQUA 3FCOA 4CQLB 2FR1A 4FGSA 3H4VA 1ADBA 3DAPA 5BNFA 2VWPA 2V6GA 4GMFA 3E82A 2VOEA 2O2SA 1PJLA 3DZKA 3EUWA 2Y93A 3GY0A 4BO1A 1EVZA 1NTOA 2B69A 3ETDA 1E0DA 2P2SA 3MJVA 5JC1A 2GN6A 4WJZA 1QXSA 3C7DB 1JAXA 4DQUA 2AG8A 2H9IA 3BMOB 3H9EO 1XG5A 1T24A 2NU6A 3W8DA 2JHFA 3V1TC 3WDSA 3JYOA 5ILGA 4TSKA 1UZLA 4D45A 1UJMA 3L9XA 4RVSA 1AE1A 3LK7A 3E5RA 3PYMA 4LVCA 1PTJA 3TZHA 4AJOA 5TIIA 3QW2A 1U7HA 8ADHA 1E7SA 3QLJA 4GGPA 3N7UA 3GN2A 1VL8A 3K73O 5KCZA 5I8ZA 5B4UA 2ZYAA 3NGLA 1B3RA 1PGNA 2F00A 5IJZA 3JQ7B 5FF9A 3WS7A 1KVUA 2JCYA 1IOLA 1LSJA 1I33A 1EQ2A 3T7EA 3U3XA 5L7TA 3DHNA 4YJFB 4ID9A 4M49A 3VKVA 3UGKA 4PLVA 2X8LA 4RPJA 1J4AA 2VHZA 3CZRA 1Q1NA 4OAQA 3DMYA 2GZ1A 1H94A 1ORRA 1U1IA 3GEMA 4FS3A 5J23A 1BXZA 3EGOA 5JY1A 4IMRA 4GWKA 1YL6A 4YRDA 2W2KA 2HLPA 4I08A 1BW9B 2J3IA 2NTJA 4WK6A 3I6QA 5EN4A 1H5QA 2NUAA 4NZ9A 4GKBA 1NNUA 1X14A 5LDGA 3WJ7A 4RZIA 4W99A 5C3MA 4BNXA 3S1LA 1IY8A 1GPJA 2CSUA 1NQOA 4GX0A 3OIGA 1ZMOA 3RBXA 4GX5A 1ARZA 3KETA 2Q49A 1ZZEA 4ALJA 1B0AA 5TJHA 3Q11A 4RVFA 3S8MA 3ZWOA 4CV1A 1P0FA 4BO4A 1P1IA 2HK8A 2X6TA 4R9RA 2G0TA 3PFWO 4XGNA 4ZA2A 3ZWMA 1QYWA 3H5RA 1UP6A 1ISFA 1YOVB 2PLAA 4UREA 1E3SA 2Y67A 1NVGA 5DP2A 2FR8A 4QX6A 2HCTA 1YO6A 4MINA 1MC5A 4E0BA 3NGXA 3MEQA 1Y8QB 4LCEA 4O63O 4QECA 5ER6A 1NHWA 2JFHA 2DUUA 5JLAA 3RVDA 1Y81A 4Z9YA 1P77A 1R66A 5JCJD 3LT4A 1UP4A 3BTSA 3OJOA 1HSZA 3FNFA 3DHYA 3FSRA 3TNLA 1VE9A 5IZ4A 2PKQO 2CVZA 4QQRA 3H7AA 1CQJA 1KC3A 1Z45A 4ND5A 3C3XA 5JDIA 1B8VA 2DM6A 3B1FA 4A26A 1A9YA 2I9PA 4II3A 2Q1SA 4Y8VA 3UUWA 4CJXA 3RASA 3RC1A 4NH4A 5JYEA 4W6ZA 2ZTMA 4ZQFA 2YV3A 3UVEA 2DLDA 2C07A 2NVUA 1EQUA 2WYUA 2BLLA 1MFZA 3B1JA 2P68A 4URFA 1HF3A 1Y1PA 5KJFA 4IIUA 3WQRA 3S2IA 4F6LA 3RWBA 5LDHA 3I9JA 3JD2A 3KVOA 1DC4A 1W6UA 4J0EA 4IDBA 3P2OA 5GMOA 4INAA 2CUKA 4Z9FA 4RV9A 1P33A 2O3RA 1KVSA 3DOCA 2WDZA 1B8UA 1GUZA 1HRDA 3EAGA 4FOOA 1NFFA 2RBEA 4IIVA 4E31A 1LLUA 5TGDA 4HKTA 4J4TA 5A1TA 1UP7A 3GPIA 4QO7A 4FC7A 4L4SA 4KDEA 2VQ3A 1E7WA 2Z5LA 5JMPA 3VH4A 4A27A 4A03A 1EDZA 5HTOA 4WLVA 4YT2A 3JV7A 1K6IA 2LDBA 4MVJD 2OBYA 1N7HA 1YXMA 5BSEA 3VTFA 2IEBA 5G2OA 2EJVA 1G0NA 4DPLA 1C0IA 4PLCA 1V6AA 4PCVA 1KC1A 1DFHA 1UXHA 2CF5A 4WNCA 3VH1A 1LNQA 1TEHA 3PDJA 1ZK1A 3KXDA 2EG9A 2C59A 1BWSA 4PVDA 2EKPA 2OOSA 4WCFC 2VTDA 4Y98A 4J6FA 4U5QA 1P3DA 2PZKA 3K92A 4DGSA 2O23A 4NHEA 2FWMX 1I32A 2LDXA 1VJTA 3C8MA 3GAFA 4FJ1A 4WCFB 4D46A 4LK3A 4OO3A 2PGDA 3BIOA 3JQBA 4MKXA 4ZQGA 3RU7A 4DMLA 5IDYA 2O4UX 1CETA 2BI7A 4II2A 5HS6A 2BH9A 5JO0A 3G49A 4R3NA 3WGOA 1CYDA 1LUAA 4NG5A 3PRJA 1C1XA 1E77A 3RI3A 1N9GA 3ZHBA 4GX1A 4XZ3A 4CQMB 1A4UA 5F3RA 3QIVA 2VHVA 1R37A 1DPGA 1VKNA 1G1AA 2FZWA 2QRKA 5EESA 3ZV4A 5H82A 4NMHA 4QEDA 2WEKA 2X0JA 1A71A 2QZ9A 2X9GA 3DAGA 4KOAA 2DPGA 1YBMA 5CAEA 4N54A 4K1LA 3WBFA 4ZGWA 3N58A 2OHXA 4J2OA 3F47A 5A9SA 5TNXA 5EQDA 3WYEA 1K89A 3PZRA 5AYVA 4YTEA 1I8TA 2XOXA 1M66A 4PFJA 5H81A 1CIVA 1LSSA 1TT5B 5TJ9A 2H6EA 3VPGA 4BNNA 4YXFA 1HSOA 4BNGA 3BMQA 4EI2A 4CMBA 1TB4A 2RAFA 4AJNA 4BNLA 4WLEA 1HDZA 2QZZA 4Z3DA 4PG8A 2BHLA 3KO8A 4CM8B 4CM1A 5BQFA 3UW3A 4AJ1A 3NTOA 3LYLA 1I36A 4XYMA 2I66A 3RUIA 1YBAA 1H2BA 3M6IA 1WMBA 5A9TA 4E5PA 1I2ZA 3HADA 2PH5A 1T26A 1XIVA 3OHSX 2JL1A 1A7KA 2E49A 3D7LA 1LEHA 1IZ0A 1FK8A 2YZ7A 2X1HA 2I67A 3Q1LA 2I6TA 1ULSA 1TLTA 3FBTA 1EEHA 1E1LA 1T4BA 5MGBA 4IXWA 1JKJA 3AFMA 3U62A 3LLVA 3JCZA 4K6CA 3WGQA 3QJ5A 2EV9A 1I3NA 2A92A 2HKIA 3MJSA 4R54A 3ZWVA 5EERA 3K31A 2YDYA 1A5ZA 1XELA 2HMSA 1GUFA 1LDNA 2OBNA 5EJ2A 3PJEA 2PD4A 2H5LA 1NYTA 3DBRA 1YB5A 4IZHA 1LXCA 3H3FA 4IDEA 3FNHA 3QWIA 4DYVA 1PJTA 4FFNA 1DXYA 1RWBA 2ZQYA 1DDOA 2XAAA 2ZB7A 3GHYA 3TFQA 2RH4A 4DIBA 3PWKA 3B6ZA 3W1VA 2CMDA 3TJRA 5AXDA 3SX2A 1MC4A 2HMTA 4LRTB 1HLPA 4IDAA 4EEXA 1T2CA 1K6XA 2VHXA 1RYEA 4OQYA 4R5MA 4EUEA 2Y1GA 1R0LA 3GRKA 5K0ZA 3ZCXA 4EGFA 3LLSA 1SNYA 4J4BA 1PL7A 4FFLA 2HJRA 4LMPA 5CEJA 5ITWA 1V8BA 1KVRA 2V6MA 3KTDA 4F3YA 2YHIB 4BKOA 1ZUD1 1DJQA 4JJGA 1D7OA 5K6AA 1GYRA 2DT5A 4BKUA 2EGHA 3DAFA 2ZQZA 1NASA 4DLBA 4ALNA 2Z1MA 5I7FA 3WG9A 4D44A 4GBJA 3TZKA 3H9GA 1DSSG 1X7GA 4YB8A 2VCYA 3EC7A 1DLJA 1QLJA 3ZWXA 2EHDA 1MXHA 5AXBA 3DBHB 4OSPA 3RU9A 4MIYA 4I5EA 3ONEA 2BRUA 3VDRA 1E3WB 3UCEA 3PIIA 3EZLA 4NDNE 2V6BA 1H93A 1ZFNA 1ENYA 2PR2A 3DMTA 1F8FA 1WP4A 4XGIA 3JQAA 3WSVA 3LDHA 3FNGA 4G81A 4BS9A 3NDJA 1ISIA 4PZCA 3GC6A 3V1UA 2IE0A 2XXBA 1K0UA 2GLXA 2BGLA 4HFNA 4CM6A 4JLWA 4BNKA 1EVJA 1P31A 2D1YA 3I83A 2IYPA 4BO3A 1IL0A 4XR9A 3TL2A 3WFJA 1CEQA 4J16A 4UVGA 1YGYA 3MWEB 3I9KA 3MCVA 1BXGA 4HBGA 4MOWA 3H2SA 3GPDG 1QG6A 2VT2A 2X9NA 4MVJM 4IJUA 2GDZA 3FN4A 2BELA 3M2TA 1EFKA 4HNHA 5AVOA 1JQBA 2C54A 2NU9A 3F9IA 2XXJA 3MOGA 3W6ZA 2Z1NA 3PLNA 4FBGA 4BMNA 2GRAA 2V65A 3ZWPA 4LGVA 3HNPA 4IJVA 2Q99A 3E9MA 3ZWAA 1TT7A 4J91A 3OM9A 1CRWG 3WJAA 2Y1CA 4BNZA 4OOEA 1KEVA 4BNTA 4FJ0A 1V3TA 1RJWA 4L74A 3M2PA 1JN0A 3F4LA 2V7PA 3GOHA 3INTA 4IGEA 3QA9A 2YJZA 2I5PO 3D3WB 4MIEA 3HJAA 2JD2A 3TDKA 1KEUA 2A35A 2C29D 3UH1A 1W8DA 1YQDA 4FIZA 5AOVA 4IQGA 8LDHA 3WYBA 4QFDA 3HFGA 1F0YA 1OBFO 3K96A 1NHGA 4UVDA 1XU7A 2VZ8A 2VRCD 4HNGA 4BNMA 1LQUA 1K6JA 3ZN2A 3LT2A 2OXIA 4L75A 2GZ2A 3BMNA 3RKUA 1ISJA 3A14A 1YJ8A 7MDHA 3ZGYA 5BNTA 3Q2KA 3OJLA 3PDUA 4NJOA 4XQ9A 5ICMA 1JVBA 3LU1A 1NPYA 1R16A 1SEVA 1NM5A 3WGHA 1R4MA 4ITUA 1GYQA 2DBQA 1GZ6A 3OA0A 5G0TA 2W8ZA 4JN6B 2Q1TA 2X58A 3RFTA 3UCFA 1NP3A 1HDOA 1F12A 2PV7A 4R41A 3VZSA 4C7JA 3U4CA 4HP8A
chains in the Genus database with same CATH superfamily
1RFLA 1PWEA 2EVWX 3HGTA 3OPXA 3OQHA 4WTOA 4EM6A 4CMJA 4ZYUA 2CV2A 1WR8A 3EFHA 4HL6A 5AICA 1K8XB 5B3AA 2MSEB 4BQNA 3IFSA 1R0RE 2Y1XA 2OFXA 4N03A 3HDGA 2XSZD 4PHGA 2VUUA 2FSUA 4MITA 5TC4A 2I80A 3H5VA 4N12A 1J5PA 1JXOA 1KYTA 2FUEA 2IX9A 2YMLA 4N9QA 2NNLD 2VDMB 4QXAA 2NUTA 3USZA 3EZ9A 2EFJA 4E09A 1JVSA 3B2EA 5JH7A 3D5TA 4IPTA 2R1TA 3D3NA 4Y0NA 3BB4A 1WZ2A 2WNHA 1SUIA 3C97A 3G1UA 3OU6A 1Q3KA 3DJFA 4OEHA 4WK2B 3RC3A 5D3ZA 3BQMB 1XYVA 1RHKA 5ELXA 3KV3O 1JA9A 2YXDA 3BMCB 3CN9A 5DBFA 2QTNA 4D3XA 1MVLA 3MSCA 3P2IA 1Y1KE 4IGAA 4LKRA 5HE9A 1XRSB 3MTJA 3VHRA 3U19A 3ENKA 3T7RA 3D2BA 2WT9A 4P4NA 3VOSA 5T4FA 4GL2A 1SCAA 4EF6A 2B99A 2JGFA 4CKYA 4K9KA 5FWAA 3TTVA 1TM7E 4BAGA 2FPRA 4MJ3A 3SZGA 1D2EA 4RD4A 1OB5A 2G9RA 1GG9A 3WY9A 5CB4F 1GN9A 3JQ8B 4BFCA 4LV8B 4AWBA 2X1LA 1OIWA 4ZVSA 4DWJA 2UYCA 3P9NA 2H2WA 1JSLA 1H2RS 1M0WA 2M1XA 4JJFA 4DL9A 1OY1A 4DLTA 3R7NA 2OBFA 2WFLB 2Z2IA 2QN3A 4R83A 3NTRA 3H6HA 3R0QA 3HL4A 5HIMA 2IJGX 1VYVA 3HP1A 3ADOA 4MR7B 1T5DX 3K0AA 3NHYA 2V7WA 3IP3A 3WBJA 1H66A 2NWQA 5E9QA 1A4XA 1QH1A 4QATA 4L9RA 1YQXA 4U39A 1DADA 1Y3BE 3DZGA 3PQ3A 1S9DA 1MJGA 1T8TA 1ES9A 3LMKA 3QYFA 2H4FA 4TKUA 5IJWA 5JAZA 1THTA 4R3WA 3ZBQA 5T8KC 3RUDA 3P2YA 1E9AA 3W8NA 4US0R 1QAQA 3ESCA 3ZE6A 1OXUA 1C9DB 1RQ7A 6NULA 1QNFA 1TZCA 2V4UA 3DVAB 2NM0A 4C30A 3GEBA 3C3BA 1M2WA 4WN3A 4DJFC 3VSDA 4JJKA 2V96A 3QU9A 3MD9A 1DWPA 1ZRNA 1JR3A 5DTJA 4ZOBA 3ASVA 3FUXA 5AW7A 1T10A 3PD0A 1II8B 4RE5A 4F3CA 2X0IA 1YOVA 1TLLA 2IVFA 2AFVA 3GRRA 4G2TA 4TUYB 2EF1A 3E9EA 4K05A 1UPUA 1RMQA 2I2DA 3G7UA 2PO7A 3E3MA 4UCXA 4MV5A 4ZZ1A 5HCIA 1SZCA 5EXPA 3VR2A 4M9RA 3O6VA 3S2EA 2GXUA 1PE0A 2I8CA 1EM8B 3MS7A 1D3AA 2VHJA 1ORVA 1H1LA 2UUBB 1DT5A 5I5GA 1VFNA 3ZBUA 2RB5A 3EVEA 4DIKA 3MGAA 4MMZB 3I9OA 3L4SO 4BQSA 2NACA 3C16C 5KOJB 1KP3A 1U0FA 2QVYX 5HCNA 3OSZA 3ORSA 2ZVQX 3DB2A 2WWTA 1VHDA 1VE6A 2QI9C 3HSYA 2V7BA 3BL6A 4HH3C 5FX2A 3HJHA 1ZDMA 3R3XA 4ND1A 2ZI7A 3WBKA 5ALVA 3M6WA 2I3AA 1DEHA 1XZJA 2H2FA 2JIDA 2DUMA 4HMPA 2E3JA 2WNSA 3UPTA 2Z2XA 5K3FB 3C1TA 5LXTA 3E7WA 1A9XB 3F3SA 5EKDA 3JS5A 3HKBA 5TPWA 3H2YA 1W1UA 3LOQA 3P4YA 3VMFA 1US8B 3MT8A 2PRZA 3HI6A 4QPZA 3BGIA 4JIMA 4S1TA 3RT1A 3ZXUB 5PNTA 3WLMA 2VXYA 5FFFA 5KQPA 7MHTA 5FPQA 1X2BA 2WTEA 3KLOA 1T8YA 2ZCVA 2A9VA 1ZNXA 2F8LA 2QW8A 3DR3A 5CT9A 4J0FA 4MDHA 4B2YA 1NZDA 4GSLA 3BGWA 3C98A 1P6XA 4UBOA 2H7VA 3DHEA 4DTCA 4D4IA 1X6VA 1CNEA 4DE5A 4TZ6A 1UBSB 3NYQA 1E2GA 1QCDA 4L08A 4UARA 2JLUA 2IW1A 3T9BA 3KJHA 1RJGA 4R1SA 3MJ4A 4U6QA 3PYXA 4U7WA 4BCBA 1B14A 2P9EA 1Q1QA 3AFOA 3CTMA 1JLLB 3E23A 3D1LA 3K32A 3PWZA 1L5VA 3ASYA 4L0MA 3K0FB 2XQVA 2NZYA 3UH0A 1NWCA 2PZJA 1H69A 5EKXA 1HE3A 1C30A 2EQBA 2QIOA 2IHTA 3CWZA 3EQ7A 1E5TA 1FP4B 1XCBA 3ESYA 3OY7A 3PJDA 2OCAA 3QVUA 2EBWA 2RBGA 4BBJA 4DVJA 4F9FA 5BV8A 2YYSA 5CXUA 2GYYA 1DIAA 3I2IA 3FOAA 3JD3A 3VJMA 3DP9A 4B09A 3WGYA 4LOHA 6AT1A 1KYQA 2B36A 1YB4A 3HHPA 1FDTA 1J0XO 2BDUA 2PKYX 3E3OA 4OFZA 5IAJA 2WIBA 1A9RA 2I78A 3HTXA 2KBFA 1ZLYA 1ZI9A 4QRIA 1E66A 4EZIA 1HY3A 4YMTA 4TLAA 2BF7A 3QHAA 5JJCA 1V9SA 1O2DA 2HNKA 2Y4NA 4H27A 2ORYA 2DJ5A 2Y76A 3LRTA 2FW7A 5C2JB 3ZU2A 1NTRA 1NJSA 3B60A 4KAXA 4RF2A 3EVBA 3LVRE 5AM1A 5IZCA 5F73A 1GAQA 4FYHA 3IDSA 2NT3A 3IVCA 3CG0A 4N0PA 5E4YA 2X5KO 4TSRA 3BIWA 2FFAA 5T64A 4EHBA 1D03A 3ZUGA 2EKZA 4ZVOA 4YDSA 2GA8A 1U0SY 2FDRA 3FCCA 3UMMA 4AI6A 3IQZA 2AEJA 2B35A 3L0PA 3QITA 2IUYA 1Z62A 2AI3A 2O4CA 4RQUA 5KAMA 1DC3A 2I76A 3H2HA 4PXSA 1IOZA 2QTMA 2CMKA 2QBYB 4BO5A 1Z6QA 2GHIA 4BBPA 3DP7A 1HYGA 3GFRA 4ZQCB 2JLVA 1M8KA 4IX9A 3LOPA 1WUIS 2A5YB 2NSHA 2C4UA 1GKYA 2WIFA 4R8VA 1Q7CA 2OSBA 3BWYA 3VSEA 3GLKA 5FOXA 1BXRB 1PJSA 5B12A 1Z38A 1E2KA 3OQPA 4D3ZA 2FKNA 1F2TA 2JLBA 5F5LA 3H13A 3N5KA 1BC5A 1RYFA 3QVXA 4PG4A 1BHSA 2PX4A 4YI3A 4TQ9A 4HEJA 1A82A 2H1WA 2ZUTA 3QLUA 4EKNB 1U6IA 1L7MA 2O7NA 3G2HA 1G5QA 1H5UA 2WLSA 1TZ2A 3NTVA 2AUMA 1SHKA 2GD2A 3C70A 2D2IA 5CTJA 3D4PA 1NP6A 2C95A 4G41A 1U04A 2R6DA 2RH9B 1COZA 5I7HA 2PRIA 3Q3GE 4EPYA 1H8EA 3EXEB 3DEYX 1DBVO 3TZBA 2R5NA 1NMXA 2WJIA 2ZR7A 4ARUA 3WGGA 1HDGO 2K7ZA 4YDRA 4FKZA 4PW0A 1QKIA 3MRTA 2FPSA 3L7LA 1UT6A 4FEGA 5TEVA 3BE8A 3ZE1B 1VB3A 1W96A 1XUOA 3MJTA 1L5KA 2O3UA 4ZRMA 3BH0A 4YBZA 4TV9B 3K6SA 4LGMA 4RDHA 2YV1A 2FH5B 3U4AA 3A1WA 3PC6A 3WWDA 3AHCA 3C7AA 5JWHA 4B73A 3MOIA 4F21A 2PS3A 1AHHA 3IBGA 2A3RA 3TLGA 4LK2A 1N1DA 3GLFE 1V11A 1T9CA 3FKJA 4C7OA 4P0QB 4C2TA 1E5QA 4F6CA 4GRIA 4PLYA 3NBUA 4LJ7A 4ZO9A 3VDQA 4OK6A 4Y9UA 5E7QA 4DARA 2Y0BA 3N2ZB 4FGKA 2OGUA 4BX8A 4Q00A 5TS2A 1KFBB 3I30X 3DMFA 3R76A 3HJRA 4ER3A 1ESZA 3C85A 1KQGA 1LPNA 4YMVA 3CM0A 1UJ6A 4PO9A 4MARA 3IL2A 1FRVA 1TVKA 3E9DA 3UJ3X 2VYQA 4YJHA 1QR2A 2GUWA 4FBLA 3IE2A 4DSAA 4EF4A 1UQTA 4YQYA 1C8BA 3DLPX 3OCYA 3CF4G 3IV7A 4N0EA 4BTVA 1JDBB 1AGNA 1UT5A 3IA2A 3KJZA 2WAOA 4DLRA 4WZBB 4MCJA 4RTQA 1ZH6A 3MLAA 1A8UA 2A4KA 3TNFA 4ON9A 4IUBS 5EHIA 4NYMR 4KRGA 4W9MC 3R40A 2QTCA 2SICE 4MKGA 4X1IB 5EMJA 1AK2A 2PKRA 1I0IA 2VXCA 4RPKA 1E3EA 4D4GA 1MDBA 4WT7A 1J6UA 4HQNA 1A8PA 3K35A 5IKPA 5KUTA 3OOSA 4R1MA 3VR0A 3KUXA 2COUA 3SFTA 3ZVKA 5B57C 4Y2UA 4J0JA 1P8AA 4CDNA 3C3KA 3KVVA 4KO8A 2EIXA 3Q7TA 4LTDA 4PRYA 3UV7A 1K7YA 5DGXA 3R6DA 4UDOA 1QU3A 3A7EA 2A6PA 5JS1A 2P3OA 1RACA 4JI7B 2E37A 3THYA 3LHIA 4EO9A 2OGZA 3B6KA 1ZN9A 2QMQA 2PUHA 2R6CA 3OFNA 3PL1A 5EIEA 4WOCA 3V3KA 1AKWA 1P4SA 2FPPA 3WLJA 2XUKA 1SIWA 2QU7A 1O6FA 3HB5X 4RH3A 3BE5A 4TKLA 1LSUA 4FFMA 4XM0A 1O6CA 2ZIXA 4EYOA 4NBKA 3UCXA 2QVGA 4QEZA 2CHEA 1E63A 3PRYA 5AI5A 1L9XA 2QT9A 4D9CA 2ZRQA 4N0MA 5IN4A 1DRUA 1D1PA 1QQTA 2XVZA 3NTXA 1V8DA 3R6LA 3EG9B 4F4CA 4G5GA 1ODCA 1K97A 1YHYA 2X76A 4LJYA 3VVCA 2O8VA 4KXVA 4CG0A 1WCIB 1XZMA 5KYYB 4DZRA 2QUKA 2GEVA 2IYEA 4ND7A 1TEZA 3O8QA 1E2QA 2DTDA 2XA1A 3L4EA 2A9FA 3H2IA 3I1FA 2QZJA 4NABA 2YWJA 4QUDA 2VF4X 4G1MB 3U81A 1JDPA 2Q27A 2C2XA 3LUKA 4TLLB 5EWLB 3ZU3A 2WQ7A 1ZWKA 1ZSNA 3AI7A 2ZJOA 4AY3A 2C3UA 2QUAA 3EVAA 3FY4A 3HRKA 4PPNA 4WNYA 1QGYA 4YRCA 1MABB 3JD1A 2PL9A 3ZQJA 3GCGA 2GEUA 1U3WA 2NUAB 1CLEA 1RI2A 1EFRD 1N5RA 2J4FA 3ANTA 3BB3A 4KQJA 1F2DA 5FHRA 4PLWA 2ECQA 3F7MA 4OYRA 2J5BA 4RK0A 3VPFA 3LCMA 4MWSA 3DCYA 4WEOA 4B3FX 3FVWA 3V8NA 3MJFA 2C97A 4OSEA 1QAOA 4MKIA 3LPNA 1LU9A 5BW4A 3IC5A 5FQNA 3UOAB 5JALA 1WUYA 2NVBA 2HTFA 4FFDA 1OIVA 4CIAA 3KEMA 2WYIA 1KY2A 3HVJA 4JLJA 3WJ2A 1XMOB 1MQ9A 2HMYB 2QRPA 1IQUA 2Q4DA 3F6EX 3BWCA 1ZMTA 5LP6F 1C9JA 2Q6KA 3QZUA 2GRUA 1UPXA 3GELA 5TMPA 4F3NA 2QN1A 5IVKA 1DXHA 8GPBA 1Z6ZA 4NULA 3OE7D 2ZJAA 1I6KA 5JECA 2BEVB 521PA 1MAUA 1OIXA 1SBNE 4QOJA 3A2MA 4DA8A 2DWCA 2NLOA 2AEEA 2AXPA 6YASA 5A7FA 3K0KA 1GPNA 4DIOA 4R9SA 5JDIC 5CM9C 3HN7A 3KYDA 3PUYA 1ST2A 2OZEA 3AG5A 5HKBA 2Q9BA 4H9GA 3GDWA 3ZEIA 4MLZA 5ULLA 3HJGA 2CD9A 1CQJB 2IF2A 2RK4A 3D64A 1NKVA 2VWHA 3LL4A 2A78A 3D4OA 1S8OA 1T1EA 1Y3FE 3WOVA 3QENA 2UYGA 3BRWD 1SVNA 3ZNQA 1NUTA 2PFSA 2GZAA 2UZ1A 4C0AC 5DNVA 2OBMA 3CLSC 5ECYA 5FPYA 5I47A 1LBSA 2BC9A 4B82A 2RHHA 1LLDA 1V3UA 4NS1A 4JV5B 2CDCA 1FP6A 3R0JA 4OHWA 4C01A 3B5EA 5AJYA 4TQUS 3T7KA 4DRYA 4WJLA 5JSZA 3VR4A 4R16A 1H9AA 2YFHA 1GITA 3M9XA 3EZYA 1HM5A 4IIDA 4TV8B 5AQEA 1BNCA 1TUBB 1JI0A 1OKKD 2I2FA 4PLPA 4YACA 5EEGA 4LDJA 3ROMA 4R5HA 1G5RA 4MRMB 5TQ0B 4JR1A 4PZLA 3REQB 3BDIA 2X13A 3OH8A 3IQEA 4HSEA 2FFRA 3MQFA 2VYNA 4YJGA 4B3IA 3CKKA 4MS1B 1HZZA 1Z68A 5B3JC 4DR7B 4ES6A 6PFKA 4PNPA 3HA5A 4LYHA 4JYCA 5DW0A 4NYJR 1UBHS 2AR9A 3VISA 1J2UA 4H7PA 1JAZA 4WASA 3FIUA 3IHTA 2VLIA 2F1HA 3W5HA 1RLIA 1SPXA 2F3PA 3Q7PA 1R6VA 3ANNA 3G0GA 4WOJA 5GJWC 2H2AA 2XNHA 4DQDA 1AS0A 1UBCA 2WJZB 4LJKA 2ZE8A 3CVVA 5LB2A 2H8KA 4KJZA 4PZPA 6LDHA 3KR2A 1PVDA 4LWPA 5D3QA 1E0KA 1JR2A 1NMYA 2RGUA 2HFJA 3I9NA 2GILA 2FF5A 3S55A 1KO4A 3NC4A 2C4KA 2PMDA 3E2IA 2PH1A 4IX1A 3VNVA 1UBRS 4FNMA 1PSWA 3ZCRA 2AOUA 3ADKA 3CLHA 4OL9A 1XVTA 3AOGA 1C81A 1O3YA 2QLJA 3LI2A 1M76A 4U2KA 2TECE 4IDPA 4FHCA 4ZVTA 3K16A 2X0DA 2JFGA 4C07A 1LLQA 3K4HA 3IBSA 5LQNA 3FYUC 4XJTA 3RC8A 3KCNA 1SQ6A 2WILA 3EBOA 3COPA 3BSYA 3TIXB 2IBSA 5AW5A 2HWXA 1ACLA 1LBQA 3S1AA 3IT1A 3ZHRA 1SR8A 4LN1A 1M2VB 2QT1A 3WAKA 1QZ3A 1CJSA 3AETA 1QCYA 3KUUA 4FKBA 4TTPA 4DJ5X 4DCMA 3MUEA 1JMYA 3HCWA 3U37A 5CP8A 3EF1A 1QX3A 3GFGA 3OAAD 5DULA 2O7VA 1YAJA 1XA0A 1NXPA 2E6KA 5HKKA 2F8SA 3NEYA 4ZYTA 3SZ3A 1ZPDA 2G1AA 4Q9IA 4UKDA 3S29A 5IF3A 5JDCA 1E5XA 1UXIA 5KYVA 4ZK2A 4FI3C 2ID4A 5KU1A 4D4LA 4E7OA 1DQPA 4G2NA 1ICIA 1NVFA 221PA 2JZCA 2FY8A 3WLPA 4BEJA 4GOOD 3HC7A 3M83A 3R20A 4QNMA 4UE2A 5CDFE 1GTJ1 4BO2A 1JSRA 2FDXA 3H2JA 4OPMA 4AJ9A 2R4TA 1JA0A 1QLHA 1D1TA 1EB8A 3WDLA 2DC1A 4CCWA 2OO5A 4J49A 1KBOA 1E58A 1T5BA 5A7GA 2FEXA 4CMEA 4EY8A 2AKEA 2DJIA 2IZZA 3ONNA 4CL3A 2C3YA 4YBRA 3W7BA 2OHGA 2O2DA 3D02A 4OA5A 3FPAA 3MA0A 3AEKB 1K63A 2ZT6A 4B0OA 5IT5A 1SBZA 2FW6A 3OZUA 1T6XA 2GWHA 1AF4A 1DQYA 2CLMB 2KSQA 1YDGA 2X3UA 4NLLA 2JG3A 1QLWA 2HA5A 2RJ3A 4KFTA 4P93A 4O1IA 1JHOA 4FR5A 1JIKA 5AKXA 1JJAA 4BNWA 4HN4B 3VRHA 3UWDA 4BGIA 4E5NA 4BP8A 2YYAA 3A4NA 4LBVA 4S0XA 4A6XA 4CNQA 1GTG1 2ASEA 4EAQA 3IPCA 3KQWA 1PGPA 1BMFD 1VIYA 1QGUB 4FDAA 1G9SA 3UATA 2XYPA 4NPCA 1JECA 2ID8A 3WZLA 5KYXB 3VKWA 1RWXA 4JMPA 3HEBA 1U4NA 2XMBA 4W82A 3CVUA 1M54A 2Z2YA 1YACA 1XRQA 4OQQA 1NN5A 3FLAA 2OV2A 3IVXA 2CEKA 2X5JO 3TFWA 3I28A 1ESDA 2J5XA 1U2DA 3R8XA 4E3ZA 2O9JA 1RQNA 1ADJA 2CJFA 3W90A 3JVVA 1QV7A 3TPFA 3BQNB 1FFBA 1TM1E 1V2HE 3GMSA 2V3CC 1ACJA 4U6SA 3QE0A 4Q9KA 4FQ7A 2FSSA 1E2NA 1WY7A 1SU4A 2YJNA 1PR2A 1QPGA 5DYIA 4EGAA 4HJXA 2B4RO 1Y82A 5IT9A 2JKZA 2ZI4A 4RO0A 2E85A 1RC0A 2HWYA 4XWWA 1YB2A 3D6MA 1NN3A 1R8XA 2CFOA 3E9QA 4HQRA 4PTLA 3TQOA 2BH2A 1JI3A 2J4CA 3CLRD 3KR1A 3RYFB 4AMBA 1G9XA 3WLQA 5JTTA 1QYVA 1OILA 1VA4A 2X6RA 4XFKA 1RC8A 2FKAA 4DABA 1WXHA 9GPBA 4KFCA 4DUGA 2OFWA 4JQOA 2OL4A 1IYZA 1ZD1A 3OKAA 2WJHA 4PLGA 3D5EA 2HZBA 3CUSA 4LZJA 4HWKA 4RHXA 2FI1A 3DT9A 1ADGA 3K0CA 2NXWA 5H7XA 5J1TB 4YIHA 3F96A 3OZGA 4JITA 5C18A 2Q7DA 1MP0A 1KY5A 4D99A 4DZZA 1FUUA 2VJMA 4L8YA 4MLCA 2RCYA 1D4FA 3O21A 1TPYA 1W6RA 3CZMA 3FGZA 4URXR 4CQLA 3STWA 1IFXA 5JQGB 1G7TA 4M99A 3SF0A 4YMHA 5AIBA 2II6A 1U3CA 1PJAA 2XIJA 3BIFA 1LWOA 4ZI5A 2FP3A 1BVRA 3NH6A 1L4NA 4QOSA 5HMMA 2OILA 1X1RA 3QLVC 1JR3D 3VOAA 3TO5A 2Y4OA 1UANA 2PH3A 3KM0A 2KMLA 3LKDA 1Y63A 1OU0A 4KMMA 3OE5A 4R7TA 1EFVA 5EY5B 3CKLA 2RGXA 3QTBA 5EJFA 3BGVA 5BWLA 3KOZA 2WF9A 1R27A 4JMLA 4L27A 4PHFA 4EB6A 3BWBA 5K6AC 3I5XA 1YT5A 1LBEA 1UZUA 3VR2D 1TVMA 1WU8A 2A84A 2Q07A 2A67A 3IDOA 1RJDA 3BMOA 3I42A 4BV2A 2NIPA 4CV1A 2P62A 4RGBA 1I5RA 4Q1BA 2D7DA 3FBGA 3WTBA 1I0ZA 2N47A 1GARA 3C41J 4CKXA 4Q4AB 5GJBA 3D6VA 4MHOA 4XGQA 4EJ6A 2OXRA 3GRCA 2I4OA 3HQ4O 1NW7A 2R11A 5CEEA 2LTAA 2P40A 5AESA 3ZCSA 2BRUC 5DN6D 3BC1A 1BKYA 1XDGA 2SECE 5K3AA 1XQ1A 1O03A 1GYPA 3G17A 1AO3A 1UBEA 4NCBA 1LD3A 1E1RD 2EX0A 1T2DA 4H3SA 3MCWA 4N5IX 3OT1B 3T9DA 1XJCA 1ZC3A 2GDJA 5KWJA 2B2CA 3EQ6A 3A1UA 4H35A 3K09C 4EOGA 5AMXA 2AWOA 4JCCA 4AWXA 4TXHA 5FWYB 3TTXA 1X80A 1BYIA 3RGGA 4CF5A 1QP0A 3G02A 1Y9AA 4G65A 3X1XA 2VAXA 4YJFA 2FX2A 2G6TA 3CISA 7REQA 5E2BA 2AC2A 2PQMA 3DCIA 4XJXA 1CZRA 2W83A 3GQBB 3JD0A 4FVTA 1N7IA 4EO7A 2MSDB 2WIKA 3HCCA 2LCIA 3OP4A 4JVLA 5CVTA 3GV0A 3E27A 3G79A 1T13A 1KEKA 1SD5A 5ES4B 1OBCA 1PBTA 1PFYA 2CVQA 2OWEA 2PA0A 1N6NA 3LT0A 3UC5A 3K2BA 4QAJA 1Z6YA 1KVQA 1MIHA 4Z7JA 4BJ6A 4UDNA 5CJPA 1YL7A 1NRXA 1U2GA 1W85A 2CY0A 5KNBH 2A1IA 3HVIA 3T38A 3LL7A 1DAPA 3GJZA 4BMXA 5KDDA 4UBKA 1SC6A 5DDIP 2YW2A 3TLEA 4NZMA 1N32B 3A04A 2FP4A 1P7ZA 3S2ZA 5EFZA 1UKBA 3AF0A 1DPFA 4GOMD 5EIBC 1ILWA 4DEVA 4DG5A 2POCA 2BONA 1EG2A 3E8SA 2X9VA 1YDWA 3I4FA 1TZKA 2ZVPX 2Q0XA 1WBJB 4HDMA 2WUEA 3DO8A 1UZMA 3Q6MA 4JOCA 2Q50A 3T4UA 4NTZA 1OTHA 1TE2A 2IY8A 3A6LA 3H16A 2VAMA 4YP9A 3J81k 2LIVA 3GJ0A 3M1LA 1DEKA 1XZHA 5KYWA 4M9QA 3I9FA 1IE3A 2E9SA 1I7LA 2A59A 1GPUA 1Y8QA 2Q0SA 4IHJB 1XZCA 4R4JA 5DWDA 3WL5A 1RABA 5HJEA 2Z5VA 1KPIA 3RRXA 4BRSA 5KKNB 4MWTA 2QM0A 1VRCA 5H02A 2GN1A 1MO3A 2CNOA 1XFDA 5FQOA 1VYTA 4Z99A 3DD1A 2CEAA 5A2GA 1ZJYA 2FG7C 1Z6AA 3H0CA 2AV6A 3DPIA 2BP7A 3NX4A 4GLOA 4HGYA 4TVOA 3AVXA 3QLEA 3TXXA 3H8JA 1TCCA 4G5OA 4Q4HA 3BXXA 3ICOA 1WZUA 1EU1A 3K2IA 3GG9A 3AF3A 3GA0A 3NDRA 3OO0A 1CJKC 4LY9A 2C5EA 3RC9A 2W37A 3OM1A 3WYFA 3NVKI 4MVJE 4BBAA 1N0VC 5BYAA 3GLGA 2XV1A 4ZCMA 4RTRA 4Q05A 1PZNA 2QX6A 4N8DA 3MINA 1LNSA 3V4PB 9MHTA 2BDTA 2H4JA 2FSPA 5KQMA 5DX0A 1RJEA 4ZEOA 1X7WA 4YRNA 4UNIA 1CS4C 1FX0B 3FFBA 4TTIA 1H65A 1LPOA 3D3EA 2JBAA 3LQ4A 2XGJA 2FPOA 3FPJA 1D6MA 1M1NA 2RG7A 3BDAA 1EGHA 1H8ED 5JD6A 5MN4A 2WKWA 3IAXA 3KXKA 4H4DA 3U3DA 2NV6A 3ORFA 4DM7A 1I4OA 4F93B 2J9YB 3UJ9A 4R1LA 3LC2O 5TVKA 3CF6R 2GI4A 4PFKA 3K8OE 3K2EA 1UK9A 4KUGA 5DOZA 5DM2A 3T5CA 1D2HA 3W2TA 5AVZA 1ZR4A 3KT3A 2FJPA 1RI5A 1Q15A 1LS1A 1EE2A 5AUPB 2XTJA 3LLMA 4HWOA 5KYTA 1MAAA 1X0XA 5B7NA 2IU3A 2B94A 3WYCA 2BMAA 4IMIB 4ZP1A 4ENWA 1U5CA 2KBEA 4I1VA 1W76A 2RJOA 3TOZA 2AYXA 5AQ1A 4POOA 3OZBA 3OLQA 1XMQB 1IG0A 4RPGA 4UFNA 3ZE2B 3ZH9B 4PWYA 2PYDA 8ABPA 1X9HA 4J9VA 3MTBA 4DYDA 5B5SA 1JQLB 1KFJB 2Q3EA 3Q98A 3GJXC 4YASA 5JHGB 4O4HA 3C4JA 2XMPA 4AJIA 3CUYA 4MEJA 4RFVA 4RLFA 5GOTA 4DIDA 4DREA 4MULA 1HDIA 5F76A 2ZIWB 3BCSA 2WQ6A 1G5IA 1HE2A 3ITEA 2UKDA 4BX9A 4F38A 1K7CA 5BV7A 4E5UA 4AXXA 3CV3A 4GI3A 2E4AA 2HNBA 5HX7A 1GRVA 1MPXA 4WN9A 2M9MA 1F20A 5CDFA 3RHFA 1TK9A 4YLYA 4D0SA 3N39C 2EKLA 2MINB 4CCYB 1L7VC 2VJPA 4N9WA 3GH3A 4RQTA 4YAFA 5ERGB 1NKTA 3TS1A 3IIJA 5DCLA 4CM5A 1CUEA 4A8HA 5IHXA 4W1SA 1VCNA 2GFIA 5AJHA 3JZIA 3A2LA 4BFLA 4NX2A 3OY2A 4C89A 1WQ1R 3IIKA 4I9FA 3HVKA 1Y5LA 3R7WB 4OHFA 3O4IA 1VIVA 1GL3A 1TD1A 4C05A 3QE4A 5JIBA 1PV1A 4YYZA 2RC5A 4X85A 2HF8A 4NENA 4EARA 4MYHA 3IKMB 1L8LA 1WV1A 3VNBA 3F71A 2WV9A 3ZU4A 1T5LA 3L40A 1Y7TA 2Q8QA 4YCBA 5HE8A 5IYZA 4OMCA 3UZUA 1Y6GA 2NADA 3EA4A 3T3GA 4UUQA 3NJ8A 1ZJZA 1F3LA 1VG0B 5DZSA 2IBTA 5H1YA 1YH3A 3TQHA 2R8XA 2XVYA 4KO1S 3HBMA 2IHVA 1HT3A 5HK9A 3DBIA 3QJGA 4Y9DA 4KK4A 1Z6GA 1NJFA 4H3KB 3SN6A 1YVUA 2CN1A 3OFND 4EEZA 4Z2AA 3K70D 4N6NA 1WETA 3PEUA 3KALA 4LHWA 3ZE8A 4QPNA 1GPDG 1LI4A 1RLTA 4ZO4A 3TSYA 2JLQA 3KJIA 4MEAA 4MUBA 3WNBA 3ZY3A 3VKHA 1XNHA 1OAAA 3ETCA 4CFZA 2JCGA 1X1TA 1ISPA 2NSDA 1QPZA 3AR3A 1DEAA 1AS3A 4FQ8A 4B84A 2RGBA 1BMTA 2FMUA 1WHTB 1I7SB 4MA0A 2JANA 4OB6A 2WD7B 3ISJA 1JLHA 1CY1A 3CC8A 3I2FA 1ILEA 1MFPA 1PEAA 3PPVA 1CYEA 1RBYA 1TT5A 4IGIA 1YZUA 4O2BB 3BWXA 4TWRA 4V0KA 1DCKA 3RVJA 4AB1A 4C4YA 4F2GA 4E5YA 4YRIA 1C9MA 5DE3A 3EXIA 3W1WA 4P35A 3CVOA 3K0BA 1XU4A 3QYAA 4LSMA 4L8VA 2G08A 3Q8MA 1NVAA 1J2RA 3NETA 3E03A 3R5TA 4FHEA 3HP7A 2FSGA 5AOCA 1BH6A 3ZLVA 1PR4A 3OLXA 4IFBA 2HJVA 3ZCVA 1NNSA 2M32A 3KVRA 5BSHA 3K4PA 1VCHA 4BXOB 5JVDB 4HCJA 3UAYA 4X7RA 3HHEA 1GTRA 2F1KA 3BB1A 5M7EA 1XZKA 4CN8A 3RSGA 1O95C 3KZKA 1P81A 1PDOA 4FUTA 1FRFS 2HDHA 3HU1A 1TF2A 1EPUA 3H2KA 1Z73A 3N1UA 5CG2A 4U7PB 2JI8A 4YJ3B 4U2CA 2W42A 2DB3A 5IUJC 1VIAA 1N6KA 2CDAA 4PO1A 3W5UA 2D2VA 3BXOA 3QWBA 4ZVVA 3LP5A 1P4GA 4WY5A 1O94C 3C4VA 2XZTA 4PZEA 4QGHA 3DFZA 5K8JB 2O2XA 3KZMA 3OCXA 1QRTA 4U7JA 1GPWB 2B78A 3ZJYA 4MEBA 4QYWA 3FETA 4RXUA 5ED0A 5THKA 1RKXA 2I99A 6CHYA 1M2FA 5LLTA 2Q2QA 3IP1A 2L19A 4HB3A 5ADUS 1R8QA 1NBEA 3AF5A 4UPDA 1UWLA 5IJ9B 1QKJA 1E18A 1E3MA 2Q5LA 3TRHA 3TXAA 1RYHA 3DO5A 3HU5A 4FDMA 1N78A 1Y8RA 2PT5A 4KYTA 1OLOA 1V43A 1A5AB 4JLDA 4IJKA 1B00A 4I55A 3W4IA 5SZHB 4G8CA 1EUZA 1OLXB 3KB8A 4RGQA 4XDZA 5FPTA 2OG1A 3MXOA 4KBYA 3U7EB 4DT1A 2LGJA 3F7TA 1NI4B 3KAKA 3L79A 4I1SA 4EPTA 1H05A 4PNEA 1VLQA 5FBHA 5FTKA 4WLNA 4DMMA 4WZAB 3AGPA 3ER8A 3IIEA 2ANBA 3KJFA 3CRQA 1VB5A 4IMJB 5BSVA 4BJ1A 1LI7A 1P0MA 3RSZA 4ALIA 4D4HA 2BCGY 5FPKA 1SUDA 1O0SA 3N07A 1U2QA 3P97A 5C7OO 1QCCA 1DAOA 2I7DA 2W98A 5LBUA 5E3HA 2XJ4A 3I52A 1T35A 1HPLA 2DCMA 2B37A 4KGVA 3LD9A 4CF7A 4OQEA 1GEEA 5HGJA 4M88A 2ODQA 1QE0A 1VMKA 4JUAA 2M1ZA 2VYND 4TPKA 1BDHA 2BBTA 3NANA 3ORHA 4PLTA 4CKZA 5JBNA 4OI1A 1NQXA 4CUJA 5B36A 4FHDA 1A9ZA 3GBPA 3CLUC 2Z6QA 5C8YB 2TMGA 3PS9A 1CXZA 2RHCA 3BXEA 2AQKA 3QY9A 1A8QA 4H7IA 1AMNA 5E0KB 2HH9A 4HLNA 4H2DA 5JCJA 3NP7A 4CMHA 3HB0A 5SYAA 1KAHA 1Y9EA 4R71A 3P71T 5TVGA 3ICVA 2C31A 3ET4A 1FJ2A 4DKJA 1SIOA 1TEVA 5CLLA 2HF9A 1FDRA 3HB7A 3MNFA 1GWNA 2YV4A 4NBLA 2FF7A 3Q7SA 4O02B 4F9TA 2QT0A 3GIWA 4NJMB 1T4GA 2XE4A 1E3WA 3RR2A 3RIEA 2A9PA 1XK7A 4A92A 5A6SA 1RZ3A 1Z3CA 1HETA 4XVRA 4L8FA 5M5BA 3ZJUA 5JJKA 3QVSA 4J07A 1XDWA 2X23A 3F3YA 4IO1A 1S9HA 1AO0A 3Q88A 1K68A 2YHSA 4ZV7A 3UHOA 3HKEA 1KETA 5L53A 2IV7A 1SPBS 3PI7A 2G9UA 3EA5A 1DAMA 1RT9A 3OQ6A 4L07A 3Q85A 4G0QA 1OH5A 1IUOA 3ZDYB 1CKEA 2OAP1 3PHGA 4AX8A 4B3BA 4DZTA 2ZW9A 3KQSA 3KAQA 1HYHA 3MWEA 3SSNA 1M2GA 1Z18A 3CH6A 2B82A 5DBIA 1QZUA 5BVHA 4GZMA 1ML3A 1HE8B 2FMTA 1E1MA 4ZWNA 1Z06A 4KXLA 3KYIB 3YASA 4MVYA 2JPDA 3BRCA 4O4JF 4QOFA 4YJ2A 3OCWA 4EPWA 2GCIA 3PL5A 4FNGA 2BN4A 3ND5A 4TN1A 2QDXA 5HJ5A 1DS6A 3TBKA 2IDKA 3IILA 1GNVA 5HKKD 1XTPA 4ILEA 2R1ZA 2GK7A 1BU5A 1ODSA 2PJUA 5LWQA 4EPRA 4BNUA 1CQIA 3W5JA 4BIIA 4AKHA 4AUNA 1LDYA 3QKSA 3VYRB 5JSFA 5ENZA 5HFNA 1RADA 1ZW1A 4UCWA 5H3CA 1JG4A 2ZRBA 4E13A 2RGAA 2LKDA 4Z4IA 1ZVVA 3SBOA 2XF8A 2XWJI 2ONZA 4KQIA 5U1PA 4KIWA 2VP9A 3T5MA 4F4UA 4ACAA 4BX3A 4DJDC 3F8SA 2FZLA 3A8TA 1QO0D 2GESA 4QLBA 2LCFA 4IVNA 4OHUA 4Z6KA 1U0TA 2O0JA 1GKIA 3IA7A 4NFLA 4EA8A 1GR0A 1PW7A 1UFQA 3BFVA 1KDYA 1C1HA 2ILTA 3E7XA 5KVSA 2E2WA 2IA5A 3DTYA 1RLMA 3HFSA 3N0WA 3PA8A 1F9EA 2C92A 4HDNB 4I9GA 3TOCA 3PPYA 3ZWWA 3ELWA 3AP1A 4G9EA 5C4IA 4GP6A 2B8EA 4TM7A 1L4HA 2ZJ4A 3C3DA 1OWPA 1RLOA 1O54A 1TZJA 3U16A 5LA6B 1HR0B 1X7ZA 3NONA 2PLRA 3STVA 5A4DA 1E7QA 2ADMA 3L4JA 3AK4A 3M81A 4DQXA 3A31A 3HZZA 1UC4B 5JS7A 1C7EA 4AY6A 2WUGA 3LXUX 3A6GA 3RD5A 3V8QA 4JL6A 1EA7A 2X86A 1YVRA 1NW6A 4D3FA 2Q7XA 4PPFA 1NVWQ 2A5DA 2OTCA 1RWVA 4BNVA 3Q7IA 2X14A 1QS0B 1FYVA 2F67A 2M98A 3AR7A 4WCDA 4N5MA 5AP9A 2PUTA 4B32A 4RIFA 1OLSA 3PXBA 3B53X 1IIRA 4FWBA 1R0SA 3WYGA 4B34A 3I3SR 5FO0A 1F06A 2FWJA 4JFRA 5B1YA 1I3CA 3E48A 4NY1A 3W8EA 2M6SA 5I9BA 3A6EA 5DX8A 2AEMA 2B20A 4B33A 3KETA 4BNYA 1IZ9A 2FQYA 2WW8A 3TRFA 2AOTB 2JFFA 1TO1E 3EMVA 1JZSA 3L02A 1XF9A 3WDMA 2WP0A 4WZBE 2F1IA 2OVBA 4FFWA 1IRIA 3IP7A 1BU8A 2BMJA 3TEMA 1ZJ6A 4BV8A 3G82C 4BP9A 1USUA 3BZWA 5CIWA 5GJVC 1DE0A 1Q5PA 1G19A 1RDFA 4QTZA 3SQWA 1K8YB 2P75A 2ILVA 2IS2A 2ST1A 3TMYA 4LV5B 1P1BA 2FLKA 2KW5A 4QPCA 3CN7A 1KEEB 3ZJ5A 5DOVA 3IAS6 1ZD9A 1NUQA 3PHJA 2E4VA 1RWWA 1ZD3A 3PDHA 4AUKA 1G59A 3AJ8A 1CIPA 4OIMA 1C3EA 1MO5A 2IEYA 3UK1A 2CCGA 5J5AA 4DUGD 3FOFC 1JMVA 2Q5QA 3IO3A 2GPNA 2QXUA 2ACWA 1N2CE 2F48A 2FFHA 5K4GA 4J29A 4RY9A 3SEAA 3I23A 1EXDA 2J1LA 5E9JA 4BVEA 2H4XA 2OUIA 1WQ3A 3A4YA 5DM4A 1SOUA 3FPCA 3AR9A 4LUCA 4MQBA 3RG2A 3BMCA 5FORA 3I5AA 4IKPA 4Q21A 2XCQA 2NSLA 3IIIA 3P2MA 3QG5A 3Q87B 1R12A 2ZPAA 1O96B 4KIJA 2XUZA 1N6PA 2VTEA 1YZFA 3GAMA 5LIRA 7YASA 1X0VA 2VPWA 4JELA 3IMKA 1HV8A 4GEKA 4HLUA 4Z9AA 2VQEB 4OGWA 1K5GA 3AY7A 2WQZA 1JH8A 4GSYA 5C34B 1XVVA 4BC0A 1FF9A 3P5BA 3RTDA 1ESNA 3C6MA 3GA7A 2EKBA 2YICA 4UVEA 3ROEA 1YJBA 4QUAA 2IUFA 1FEZA 3PHHA 4EY4A 2REQB 3JQ8A 4REMA 5AXAA 1TM3E 4EY7A 4CR6A 1G4UR 1GG8A 2AFHB 1G8JA 4Z7QB 3BXHA 3I1YA 1XHEA 1SJ9A 3LX8A 5DBGA 4J1NA 2RHWA 1MPTA 3DFUA 4XJVA 3T06B 2N75A 5CT6A 2WYWA 5GZ6A 1B16A 1KA9H 1BVYF 1DKPA 2R2GA 3KEOA 2XEDA 3IMCA 2Q4RA 1CTQA 3LECA 3IAS1 3L7AA 1VBFA 4KN9S 5DNAA 1Z6PA 1AJEA 4OOFA 2VNSA 4ER5A 4B2IA 4EB8A 4MR7A 2I7VA 4K9MA 4R2IA 3BJMA 2X3FA 3GRZA 1ZVMA 4X64B 3BERA 3G2KA 5EXTA 2ZE7A 2ZXUA 4A0RA 5IKMA 3U7IA 3L43A 2OV3A 2SBTA 3PBKA 2NO5A 1Z0SA 2W70A 2JRCA 1PL8A 2CNBA 3R9XB 1VDZA 2PCJA 5IRCD 2PGJA 3HXLA 3A58B 1M5TA 4C5CA 1P74A 2QD5A 1U80A 3VR4H 3OOJA 2ZZNA 1MJHA 4MS4B 3UAWA 2XTAA