2P4RA

Structural basis for a novel interaction between aip4 and beta-pix
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
b'SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2p4rA00
2LX7A 4AFUC 2B86A 2FPDA 2CH4A 3SEMA 3EGUA 4KRTA 2RQTA 1WXUA 1M3CA 2HCKA 2O2OA 2AKKA 2M51A 1KIKA 2RPNA 4J9IA 2K9GA 1GL5A 3IQLA 1K0XA 1HJDA 3M0QA 4R0KA 1PKTA 2YDLA 3VRZA 1ZBJA 3QWXX 2GNCA 1ARKA 2KR3A 4IIMA 2IIMA 2LNHB 4ZNXA 5FWBA 2H8HA 2OAWA 2EKHA 1AZEA 1RLQC 2AZSA 4IIOA 1JEGA 1ABQA 3H41A 3REAB 4AG1C 2JW4A 1K76A 3NMZC 2EVRA 1OEBA 3H0FA 4F17A 2FRYA 2BTTA 1NEBA 2KBTA 3R6NA 1MV0B 2LQWA 3EHRA 2KT8A 1ZLMA 2PZ1A 3U23A 2D8JA 1PKSA 2JXBA 3VS3A 1GCQC 2EPDA 1E7OA 2DLPA 2A08A 2I0NA 2A37A 1MV3A 1T0JA 2A28A 4JPBW 1V1CA 2OI3A 2J6FA 3VS4A 2BZXA 2DE0X 2DVJA 2EGCA 2JM9A 4FSSA 2FPFA 2K6DA 2DL4A 1ZUUA 2EGAA 2D1XA 3VS0A 1Z9ZA 2JTEA 2L3SA 1TUDA 2LJ3A 3NHNA 4RTTA 2DILA 1EFNA 2GQIA 4RTXA 1K0SA 1PNJA 2J06A 1GFCA 1X2KA 1QLYA 1Z9QA 2EGEA 4JJCA 2RNAA 5FW9A 4J9EA 1X2QA 2RQRA 1M3BA 1AWOA 4ORZA 2V1QA 3PE0A 2C0OA 1T0HA 4AFSC 2ROLA 1K1ZA 2DL3A 1CKAA 4J9DA 4JZ4A 4OMOA 1WX6A 1X6GA 2K7AA 1YCSB 2DM1A 2PTKA 1BBZA 3VS1A 4F14A 2MIOA 1JXOA 1UJ0A 3VS7A 4CC2A 3EG3A 4GLMA 1UE9A 2P4RA 4E6RA 1AVZC 2KRSA 1OPLA 2O9SA 4J9CA 2V1RA 4RTYA 2D8HA 2L3PA 4HVUA 3UA6A 4GBQA 1LCKA 4JZ3A 1K9AA 3UA7A 3NPFA 2NUZA 1GRIA 1H3HA 1M8MA 1VYVA 5IXFA 2GTJA 5IH2A 4RTZA 2XMFA 1NG2A 4HVWA 4J9HA 1Y0MA 2QDLA 1W70A 1H92A 1CKBA 2J05A 1Y57A 1G2BA 1T3LA 2LZ6B 2GTOA 1OV3A 1B3QA 1JO8A 2VWFA 4AG2C 2C0TA 4Z89A 2LMJA 2DA9A 2CDTA 2CH4W 2X3WD 4CC7A 1BK2A 3EHQA 2AK5A 1AOJA 2DL5A 4X1VA 1WXBA 3ZL7C 1WDXA 2JM8A 3O5ZA 1K4US 2L0AA 4AFZC 2DBMA 2YUQA 2RQVA 2EYXA 2ENMA 1NM7A 3M0TA 1S1NA 2LJ1A 2FO0A 2O88A 1GBRA 1WXTA 1QKWA 1XOVA 3REBB 3I5SA 4OMPA 4HVVA 1ABOA 4RUGA 4D8KA 2MOXA 1UJYA 2PNIA 2SRCA 5IHNA 1VYUA 4J9BA 3RBBB 2K79A 4WCIA 1PHTA 2KXDA 1QWEA 1M3AA 1YN8A 1UUEA 2CREA 5EC7A 5GJWB 1AWJA 2K3BA 2EYZA 1KJWA 2YUPA 2VKNA 4LN2A 2JMCA 3TVTA 3ULRB 4J9FA 5IHIA 2EBPA 2J7IA 3KFVA 1NYGA 1IO6A 2GGRA 1SRMA 2LQNA 2CUBA 2JT4A 2DYBA 3VS6A 4JJBA 1YNZA 2AKLA 3H0HA 1SHFA 2SEMA 2KXCA 2KROA 1TUCA 1X6BA 1SSHA 1SHGA 2OJ2A 1W6XA 3PVLA 2F2VA 2DMOA 3CQTA 1UDLA 2RQWA 3I9QA 3QWYA 1RUWA 1WYXA 1NLPC 4DEXA 1UECA 1KSWA 4OMMA 1U5SA 5ECAA 4OMQA 1UGVA 1E6HA 2BZYA 1QWFA 2F2WA 3I5RA 5GJVB 1QKXA 1X69A 4RTWA 3UF4A 2JS0A 2GBQA 3NGPA 1BB9A 4M4ZA 2A36A 2RF0A 4LUEA 4D8DA 1MUZA 2G6FX 3EG0A 3PVQA 4Z88A 2W0ZA 2HEQA 1WI7A 1RLPC 2YUNA 1YWOA 2D0NA 4QT7A 2JMAA 2ED1A 3LH5A 2DRKA 2RN8A 2DX1A 3I35A 5FWCA 1JXMA 1W1FA 2BZ8A 3TSZA 2C0IA 2JS2A 4HCKA 2LP5A 4Z8AA 4F16A 1H8KA 1NEGA 2HDAA 1U3OA 1UFFA 3SHWA 3TSWA 1PRLC 1I07A 2KE9A 1ZUYA 1HD3A 2KNBB 2YUOA 2KGTA 4DEYA 2M0YA 5IXBA 2DJQA 3VRYA 4CC4B 2EYYA 2K2MA 2E5KA 5L23A 1UG1A 4LE9A 1GCPA 2AZVA 5HCKA 2FPEA 2KYMA 1M30A 3EG2A 3M0RA 4K11A 1GBQA 2ESWA 1QCFA 3RNJA 1A0NB 1X27A 2LJ0A 2DL8A 1AD5A 1GFDA 2J6KA 1NLOC 4CC3A 1T3SA 1YWPA 3VS5A 2CT3A 2KT1A 4RTUA 3THKA 2MCNA 3H0IA 2NWMA 4RTVA 1AWXA 2J6OA 1AZGB 2W10A 2CSIA 4J9GA 2FRWA 2LCSA 5I11A 3M0SA 1AEYA 4LUDA 1UTIA 1VYTA 2HBWA 2O31A 1I0CA 2CSQA 4JJDA 1TG0A 4EIKA 1U06A 1N5ZA 1X43A 2F2XA 1BU1A 4OMLA 1PRMC 1JU5C 1FYNA 3FJ5A 2KRMA 1WIEA 5IHKA 3A98A 2DRMA 2L3QA 1GCQA 4Y92A 1M27C 1G83A 1UHCA 1FMKA 1NYFA 2ROTA 1JQQA 2VVKA 1ZSGA 1OOTA 1AWWA 2CT4A 2DF6A 3EG1A 4HXJA 3VS2A 1YP5A 1ZX6A 2ABLA 1SPKA 2KYBA 4A63B 2DNUA 2RQUA 4LNPA 1KFZA 2EYWA 3GBQA 1I1JA 2YT6A 4OMNA 1CSKA 2ECZA 2KRNA 1WA7A 1WLPB 2FEIA 1UHFA 2DBKA 3JV3A 1E6GA 2RMOA 1OPKA 1SRLA 4AFQC 3UATA 2HSPA 2ED0A 1RI9A 2L2PA 5I22A 2EW3A 2O9VA 1SEMA 2KEAA 2DL7A 3C0CA 1B07A 1VA7A 3M0UA 2CUDA 2EQIA 2FG0A 1ZUKA 3M0PA 2YSQA 1J3TA 1WFWA 4ESRA 2X3XD 1PWTA 1HSQA
chains in the Genus database with same CATH superfamily
3OY9A 3JCMQ 1M1FA 2DEQA 3UPUA 4P5NA 4EMKC 3SEMA 4X9DA 2RQTA 2E3HA 3M4GA 4F04B 3IQLA 1MGQA 3L2WA 2X4WA 3M0QA 3DLLA 4R0KA 1BI1A 4RCBA 2R57A 1ZBJA 3HP9A 2IIMA 2LNHB 3G6EQ 4TVRA 4BY6B 2DTOA 2H8HA 4M78F 3CXCS 1AZEA 2AZSA 4IUTA 1JEGA 1EIFA 4CRIA 1KHCA 3H41A 3REAB 3VYGA 2KMTA 3V7RA 2EVRA 4F17A 2FRYA 4OGCA 4OVAA 2RK2A 3CCMT 3E2UA 2Z0WA 2YRDA 3EHRA 2JZ2A 1QMCA 4C5IA 1ZSZB 1PKSA 1X6OA 2PUOB 1GCQC 2EPDA 3S3MA 1E7OA 3HRSA 1VQ9T 2DLPA 3D7SB 4DOWA 4JPBW 4BI8B 2OI3A 2DE0X 2DVJA 2EGCA 3TU4K 1KHIA 4M78D 2V8IA 3JB9J 4M78E 4DBQA 3NHNA 1VQKT 2GQIA 1VQMT 2DXTA 1M1KC 1VQPA 1QW1A 4M78C 1GFCA 1X2KA 1Z9QA 5FW9A 3E1SA 1VQ4T 1DJ7B 3CC2Q 5CVIA 1VQ8Q 1YJWA 1IB8A 2L5QA 4AFSC 2C0OA 2DL3A 4JZ4A 2QQAA 4J9DA 4N0AA 4LD9K 1YHQA 3GP8A 3WVDB 3CBOA 4FT4A 3CCJT 1VQOQ 2QDYB 5CKDA 3EGDA 2E64A 5KCHA 4GLMA 3L2ZA 1OZ3A 3MEVA 2GF7A 2O01E 4QVZA 1JJ2P 1NPRA 4J9CA 2V1RA 2D8HA 3MHXA 4M7DA 4N4IA 1N9RA 1WJRA 3GIBA 1G3YA 3CCEQ 3UA7A 2E10A 2DJZA 3NPFA 2QYZA 1M8MA 3LGLA 1QVPA 4IUUA 1VYVA 1PD1A 5IH2A 1VOMA 2XMFA 1IZ6A 4LXCA 1WJSA 2P0PA 4J9HA 2QDLA 2CGHA 3RKWA 4J5YA 3MP6A 5CR2A 1IRXA 5GAMg 1JJ2S 5FROA 3CCST 2LMJA 2DA9A 2DO3A 2CH4W 3L2VA 3VUBA 1WDXA 2JM8A 4XU2A 1TXQA 1VUBA 1WNLA 4AFZC 2RQVA 1NM7A 5GANg 2HNIA 3VYHB 4M7DG 2LJ1A 1ZA1B 4BY6C 2O88A 3GPLA 1XOVA 1IGUA 1BCOA 2QTVA 2RI2A 3REBB 1QVFP 3L2QA 4RUGA 2RM4A 2MOXA 3DB4A 3EFOA 1UJYA 2PNIA 2K4YA 1VYUA 5C0MA 2K79A 1PHTA 4J6XA 1YN8A 3M59A 1D0ZA 2RJCA 4E7ZA 1KJWA 2R58A 5LJ3j 3OYMA 3L2UA 1ZSZC 2JMCA 3ULRB 1Y96A 3L42A 3X28B 2EBPA 4KGZB 4ATOA 2J7IA 5LL6S 4PLIA 2V8KA 2JT4A 4C5HA 1G3WA 1YNZA 2SEMA 4WTOB 1TUCA 1X6BA 1QVFS 2MAMA 3PVLA 3UT1A 1RUWA 2CZ7B 4A4KA 1UECA 1KSWA 1RAIB 3OSVA 1UGVA 1E6HA 1F1BB 3JAME 4EPCA 3G7ZA 4PFZA 4L5GA 2CP6A 1B7TA 2GBQA 4M4ZA 1PSEA 2RF0A 2VUBA 4Z88A 2FVUA 2W0ZA 1KD1R 2HEQA 1Y7XA 4JJNK 3CD6T 1C1AA 3CEYA 5LJ3e 1I5OB 1EZZB 3LH5A 2DRKA 5LJ5f 4C0FA 2DX1A 2QEXA 1YJNT 4J6YA 1VQ7Q 3TSZA 2OX7A 2YXYA 2M0OA 2JS2A 2LP5A 5LJ5d 1NBEB 3X26B 2CZ1B 1H8KA 1NEGA 4EDUA 2ZZDA 2F1LA 1PRLC 3LX7A 4M7AA 2A7YA 5IXBA 2EYYA 3QO3A 3CC4T 2AZVA 5HCKA 3MP8A 2QTXA 4C0ZA 1M30A 3EG2A 2PQWA 1PG5B 5KE2A 3RNJA 1A0NB 1X27A 2BKDN 2EWNA 2JUFA 2HD0A 3M58A 4B6MA 1AD5A 1R8OB 2KDSA 1N27A 4Y28E 3LWIA 2M1HA 4C8QA 1YWPA 5FU7B 3JCMc 3RIRA 3VS5A 3CC7A 3CBPA 3Q1JA 4RTUA 1TS9A 2X4JA 3HTRA 4DQ2A 2NWMA 3X20B 2DYIA 4JS4A 4ZTFA 3NTKA 2CP0A 5GAN8 5KH6A 4KT0E 2CSIA 3PIPA 4B9XA 4KULA 5I11A 1AEYA 1RAEB 1I4K1 4LUDA 3CXCA 3BDLA 2PVDB 4JRIA 2HBWA 1IXDA 1XTDA 2CSQA 4IUQA 5J26A 4M7AG 2XICA 5GAN2 1N5ZA 1O9SA 3M55A 2Y4YA 4OMLA 4IUVA 4FT2A 4QKUA 3L2RA 1FYNA 1JB0E 5A2QE 4C5GA 2CZ6B 3EGDB 4E47A 3HRUA 2RJFA 4ME7A 5I2SA 2DRMA 3O8VA 2L3QA 4C8QG 4Y92A 2ZPGB 3MJXA 3P8HA 2DXCA 2DETA 1VIEA 2XKOC 4M7DB 1ZSGA 2DZ9A 3QXEB 3EG1A 1SPKA 1XJWB 2EYWA 1WHMA 4OMNA 2KRNA 1UHFA 3P8BB 1OYXA 3G6ET 1E6GA 3PMIA 4BDYA 5KYWB 4J83A 2HSPA 3KUFA 3LW5E 5I22A 2EW3A 1YHQQ 4PKCC 1D09B 4OB0B 3CPFA 3M53A 2X4YA 1Y07A 5CKHA 3M0UA 2CUDA 3M0PA 5KYUA 2YSQA 5KE3A 2E41A 4C92A 4ESRA 1HSQA 2QK0A 2COYA 4AFUC 4V2SA 1BCMA 2B86A 3OMCA 2CH4A 3V8KA 3EGUA 4KRTA 2EJ9A 1Q82R 3CCQT 1SKUB 2O4XA 1WXUA 1M3CA 2E65A 3EH1A 1MNDA 1M90U 2O2OA 1M90R 1D1CA 4J9IA 2K9GA 1VQNA 3G4SA 3I55A 3MCAB 5D6WA 4RG2A 3TREA 3EFOB 2YDLA 4M75A 3VRZA 3QWXX 2GNCA 1ARKA 2KR3A 4IIMA 3CCVA 5FWBA 2NLUA 2EJFA 2OAWA 4IIOA 2HL3A 3PT9A 1ABQA 4AG1C 1BI0A 3NTIA 2XD0A 3E9FA 4BE1A 2BIVA 5GMKh 3QYGB 1UGSB 1NEBA 3CC2T 2P0QA 1VQ8T 3AHUA 4LDXA 4C92G 3C95A 4KUIA 2RHUA 4M7DF 4RMOA 5FU7C 3VU3C 4XTWA 3FRNA 1VQOT 2RHIA 1UGRB 1BKBA 2I0NA 3E9GA 1Y71A 2A37A 1MV3A 3OYKA 5GAMf 1M2VA 3SD4A 1B34B 2J6FA 4PFOA 3RKYA 2JM9A 3ZFJA 4FSSA 4M75G 5KCOA 1BI2A 2K6DA 4F7UA 2KVQG 2D0QB 3M54A 2EGAA 2MWPA 4M77A 3VS0A 1LJOA 1Z9ZA 2K5LA 2LJ3A 2RJDA 2FYKA 2JJ9A 2DILA 1EFNA 3UDCA 4OB3B 4N0AC 1M4ZA 5GANf 4RTXA 1TUGB 2OTJA 1FMWA 1QLYA 2OTLA 2RNAA 3JCMf 3CMAQ 3BFMA 4M7DD 2H3EB 5GANd 4HT9A 3ASKA 1M3BA 4M7DE 4ORZA 2V1QA 1T0HA 3JCMd 1CKAA 4MMKA 1RABB 1HXDA 1HK9A 1VQ9A 4C5EA 4MZPA 4F14A 4M7DC 4FSXA 4M7AB 5GAOr 2YLCA 1YBYA 2X4XA 1X75C 3MEUA 1UE9A 5KYNA 3QDRB 1M1GA 4J7FA 4F7UG 4M77G 2O9SA 3FJPA 3CXCP 5GMKl 3OS0A 4ZGJB 3OYGA 2L3PA 2MYSA 1Q86R 3UA6A 4C8QB 4GBQA 4JZ3A 1VQKA 1K9AA 2K3YA 1G5VA 2IVWA 2EQKA 2NUZA 4BD3A 1H3HA 4BDZA 2EIFA 2VYTA 2GTJA 2QG9B 1NG2A 4HVWA 5CIUA 4B9WA 1Y0MA 5CQYA 3M4YA 1VQ4A 2ZPIB 4XU3A 3GLXA 1BIBA 5AYFA 1Y57A 1G2BA 2LZ6B 3A5ZB 3RERA 2PVOB 1B3QA 3JCMW 1M9SA 2C0TA 2FZCB 3PMTA 4HCCA 3CCUQ 2EJGA 2JTMA 3OYYA 1WXBA 3ZL7C 5I21A 2CP2A 1OX8A 3HL8A 2L0AA 3O5ZA 1K4US 4FW1A 5KYXB 2EQMA 2EYXA 2ENMA 2EFIA 1XQHA 2RHZA 3CC7Q 1W2BA 4BE2A 4N4HA 1GXIE 2RI3A 3I5SA 1M90C 3CCQQ 3QZ5B 3SDZA 5A0DA 4PJMA 1RI0A 4J9BA 3RBBB 3J80E 3OYBA 4WCIA 1G3SA 2KXDA 2X35A 3FC3A 2K3BA 4J7IA 1M8VA 3JCMb 3PTAA 4RG8A 4J9FA 2PUKB 3KFVA 2C06A 4ZGDB 3MEWA 4X9CA 4FYYB 1VQ7T 3VS6A 2AKLA 1SHFA 5HK0A 4HT8A 1SHGA 2F2VA 1R0CB 3META 2DK3A 2FZKB 3LH0A 1WYXA 1H3ZA 1NLPC 4C92B 4OMMA 2YWWA 2BZYA 3RUXA 3OYAA 1YJ9Q 2F2WA 3I5RA 1X69A 2JS0A 4DBHA 3OYJA 2CZ0B 4LUEA 4M7AD 2L8DA 2G6FX 3EG0A 1AHJB 1WI7A 1RLPC 4M75B 4XAXB 3TCJA 4ELZC 1YI2Q 4M7AE 4ZN3A 2D0NA 4QT7A 2JMAA 5A0GA 1C6VX 2ED1A 5HY6A 3PNWC 3G71Q 3OW2A 3I35A 3EAEA 3H9NA 3OYDA 5GMKj 3SWNA 2BZ8A 4C8QD 1QCOA 2C0IA 1EX4A 5M9OA 4C8QE 5DY9A 4L59A 4RCCA 4HA8A 2DXBA 1U3OA 5J3BA 3SHWA 2E6ZA 3X24B 2LDMA 2DTHA 2F69A 3A8MB 1I07A 2KE9A 1ZUYA 4C8QC 1S72A 2KNBB 2YUOA 2KGTA 4ZTJA 3CCLA 2DJQA 2QGGA 2K2MA 4DBRA 1ZHIA 3GOXA 1UG1A 1U1TA 1VQNQ 3G4SQ 3QKJA 3I55Q 2FPEA 2KYMA 1NJIU 1NJIR 1V29B 2VASA 2ESWA 2KY9A 3EG9A 4X34A 2LJ0A 2DL8A 1M2VB 4MZTA 1GFDA 3HHTB 3CD6A 4JDSA 4CC3A 4F7UB 5GAMh 3HFNA 4M77B 1FXXA 2CT3A 1NPPA 3JCMg 1YITA 2DIGA 5LJ5j 3H0IA 4LD6A 4RTVA 5GMKe 1ACMB 1D3BB 2HAXA 4C92F 4PJOA 2LQ8A 2W10A 1YJWT 2P84A 5L8RE 1VYTA 2GQVA 3AT1B 3ER0A 2VB6A 1I0CA 2QQ9A 4JUVA 1YFNA 4JJDA 1YHQT 2WSEE 1TG0A 1U06A 3DB3A 1PRMC 3CC4A 3GNGA 2E3IA 2HKNA 3FJ5A 4PJLA 2KRMA 1HYOA 3OMGA 1YIJQ 1GCQA 3CMEA 2ROTA 3OS2A 4C92D 3MO8A 4R55A 1VQ5Q 2KAFA 2RO0A 2OTJQ 2I2LA 3P8DA 4C92E 4PJOG 3GBQA 5LJ5e 2OTLQ 5DLQE 4MMLA 5GMKm 2ATCB 4Z02A 1KG1A 1CSKA 2ECZA 1KD1U 2FEIA 2QA4A 2DBKA 3JV3A 6AT1B 2RMOA 1OPKA 4FCYA 3RESA 3PGGA 4AFQC 4C92C 2RHXA 2L2PA 1VQLA 3JCMX 1W2BP 2BE7D 4M78A 1RAHB 4LDVA 2L89A 2LQKA 2CP5A 2KEAA 2XHCA 2LRQA 2FZGB 3OQ5A 3QG1A 1XNIA 3M5AA 3C0CA 3JB9H 4A4FA 5GAOl 3BY7A 4M77F 2EQIA 2FG0A 1ZUKA 1J3TA 1JRIA 1WFWA 1PWTA 2JNGA 1LVKA 2LX7A 2VV5A 2NUTA 4XU1A 3FEOA 1C0MA 1OULA 2AKKA 3BE3A 2RPNA 3I56A 1W2BS 4L6V5 2Y4XA 3FIFA 4MDXA 1MMAA 1PKTA 2EYQA 5I2MA 3S6WA 4CI0C 5IN1A 3JB9I 1JBMA 2CYZB 3CPWA 2RH2A 2NUPA 2EKHA 5LJ3d 1BIAA 4FYVB 5KYYA 1OX9A 1TU0B 2COWA 4PJNA 1WZOA 4M77D 1U8RA 3CMAT 2KBTA 3F70A 4M77E 1FX7A 2K57A 2GFUA 1I81A 2LQWA 2MK5A 2KT8A 5GAOq 1ZBXA 1ZLMA 2D8JA 4FYXB 4M77C 3OW2P 2MMPA 4UC4A 1UB4A 3SFMA 2F5KA 2A08A 3EFRA 2YRCA 1NJIC 2A28A 5GAN3 3BDUA 3VS4A 4PFPA 4IUPA 1ZUUA 2HBPA 2D1XA 4EMHA 3JB9G 2JTEA 1TUDA 3M56A 2R5AA 4E7SA 1BYMA 1LOJA 1X01A 1QCNA 4NL3A 3RMSA 1VQPQ 5GAN5 3OW2S 4JJCA 2ZPHB 2WACA 4J9EA 3RR6A 1ZSZA 1VQ6A 1WGSA 3NFCA 3MP1A 2RD1A 2LC4A 2E12A 1YJWQ 3PE0A 1N6AA 1WX6A 1X6GA 1YCSB 3ZEHA 2DM1A 2PTKA 3CCUT 1WQ7A 2MIOA 3HPWA 3JRZA 1UJ0A 4CC2A 3EG3A 3R6OA 4PK4A 5GAN6 2VXEA 2P4RA 3CCRA 1P92A 5GAMj 4E6RA 1AVZC 2KRSA 3EG9B 3CC7T 4RTYA 8ATCB 2AIRB 2XK0A 1Q95G 4J8OA 3CCEA 3V7SA 1Q82U 1RAAB 2DAQA 4JLGA 3QDFA 5GAOp 2V8JA 5GANj 5EG2A 1OI1A 2KQWA 1CKBA 1QQJA 1KC8R 4PJOB 1KD1C 1T3LA 3L1AA 5HKCA 3QJ6A 1VIFA 1JO8A 4JRKA 4AG2C 1S72Q 3OB9A 1Y96B 2CDTA 3T9NA 2X3WD 4CC7A 4YTLA 2K2VA 1AOJA 2DL5A 2MF2A 4KUDK 2QASA 2DBMA 1QVGS 5FRMA 5GAMe 2M02A 2FO0A 2QAZA 4AT1B 1WXTA 1QKWA 3V7CA 4KH1B 1YJ9T 3QUIA 1YITQ 3WXMB 4D6WA 2SRCA 5IHNA 5GANe 4IURA 2H3JA 1UUEA 5EC7A 1RAGB 4GLKA 1YI2T 2EAYA 2QQSA 4LN2A 2GCXA 1W4SA 3G71T 2XU8A 2DTIA 4BACA 1KQSS 1SRMA 1PD0A 2LQNA 2CP7A 2CUBA 4JJBA 2KXCA 2M9UA 4HCBA 1SSHA 2OJ2A 3CCMA 1W6XA 1RADB 5LJ5h 2WSCE 2XI9A 5CKFA 1UDLA 2RQWA 2ZCFB 3CPWP 4DEXA 2RK1A 2ZAEA 2NUTB 3CMEQ 2XDPA 5LJ3g 5GAOm 1VQNT 3G4ST 2FB7A 4A54A 5GJVB 3HKSA 3I55T 1N8RU 4RTWA 3OS5A 1N8RR 1LNXA 4RKUE 2YRVA 2FL7A 3PFSA 3NGPA 1BB9A 2YLBA 4XU0A 2KI7A 2YUNA 2QA4Q 1YWOA 1Q86U 1UEBA 5DLOA 3ME9A 1VQLQ 5HK3A 2E1HA 4PLLA 1SG5A 2DIQA 2RN8A 3CPWS 3A8GB 3JCMV 1W1FA 2LNVA 4ANJA 2QEXQ 1VQMA 5KYYB 1SF9A 1V76A 4HCKA 1RACB 4Z8AA 4F16A 1ZA2B 2HDAA 8AT1B 4KGXB 1UFFA 4FL6A 4KBMB 3E19A 1WHGA 3VUZA 4PJOD 2M0YA 3VRYA 2WSFE 4CC4B 4PJOE 3CCJA 2E70A 2E5KA 5L23A 3I56Q 2ZPBB 1GCPA 4XTXA 4HKEA 1OQKA 1GBQA 1QCFA 1YIJT 2M16A 2J6KA 4OB1B 4PJOC 2CS7A 1PCXA 3JCMJ 2JN0A 2K3XA 4E7LA 1Q82C 1UGPB 3UWNA 2KT1A 1VQ5T 2VXFA 1MMNA 4DA4A 2OTJT 2MCNA 2OTLT 2J6OA 4A4HA 4E7IA 1KC8C 4J9GA 2HQHA 3EFSA 2K5FA 1UTIA 2PVGB 2XIDA 2PU9B 5GAN4 4M7AF 2QGFB 1OU9A 3CCSA 1X43A 4PL6A 4E7JA 2KK4A 3A8HB 1QP3A 4FM4B 4R56A 1WIEA 5IHKA 3JB9F 2LX9A 4MZMA 4C8QF 4BI4A 1M5Q1 5KYUB 3URGA 1UHCA 2HQEA 4PJJA 1NYFA 2VVKA 5CQXA 3M9QA 3J7AF 1AWWA 4MDWA 2DF6A 2O4XB 4HXJA 3VS2A 4A63B 2ABLA 2D9TA 1TH7A 1YCYA 4ELYC 2YT6A 2G3RA 5AT1B 1VQ6Q 2NYSA 1WA7A 3UATA 1RI9A 2CKKA 2VGNA 4FIBA 4XTVA 3QHSA 1IHVA 4BUGA 4XQ3A 1PSFA 3JB9D 1K9MU 1FWZA 4XTUA 1K9MR 4M7AC 2DL7A 3CCRQ 3INZA 4QQGA 2HSEB 3KBGA 4OP0A 2FPDA 2DD5A 2HCKA 4O6JA 1UGQB 2EQUA 2M51A 1KIKA 3RKXA 2A3LA 2EKOA 1GL5A 1IGQA 1N8RC 1K0XA 3M57A 5D7UA 1HJDA 1MMGA 5KYWA 2A0FB 4EMKA 5DM7R 1AT1B 5IAYA 4ZNXA 3CCVQ 2JVVA 1Q86C 3LGFA 1RLQC 1Q81U 4JRQA 1Q81R 4OGEA 2ZPFB 4DOVA 1QP2A 2JW4A 1K76A 1VQPT 3NMZC 1D1AA 1OEBA 1TSFA 3H0FA 1YJNA 2BTTA 4C0DB 1D1BA 5J39A 3V8JA 3R6NA 1K73U 3QYHB 1MV0B 1K73R 5GANh 3QBYA 4KGVB 4E7KA 1G8XA 1OU8A 2PZ1A 3U23A 1R77A 4IKFA 2B8AA 3JCMh 2DXUA 2JXBA 3VS3A 3OYFA 2D6FA 4KH0B 3RDVA 3OYIA 1RL2A 1I5LA 1T0JA 1WHLA 1V1CA 3EH2A 4M75F 3OYEA 2BZXA 2V26A 5D6YA 1QVGA 2FPFA 2DL4A 3OSSC 1G3TA 2L3SA 1M2OA 4RTTA 4EMGA 4C0GA 1K0SA 5CAIA 1PNJA 2J06A 3QJYA 3CMAA 2EGEA 3X25B 3LWHA 3CCMQ 1X2QA 2RQRA 3ZBDA 4QVDA 1AWOA 2ROLA 1K1ZA 1KQSA 4OMOA 1MNEA 3QIIA 1MHNA 3RMQA 1S72T 9ATCB 3CCLT 3MEAA 2K7AA 2QQRA 4WF2A 1BBZA 3JSCA 3VS1A 3N5BB 4M75D 1VQ9Q 1B34A 1JXOA 3VS7A 1SSFA 2LT4A 2X51A 5FU6B 3FB9A 2VC8A 4M75E 4F7UF 3VKIA 1MMDA 3QZ9B 1OPLA 3VJPA 4M75C 4HVUA 3H8ZA 1LCKA 3DLMA 1YITT 2JTFA 1VQKQ 1GRIA 4JRPA 3OBWA 1WHJA 1VQMQ 5IXFA 4FW2A 2DFUA 3OA6A 4RTZA 3EGXA 3OYLA 1W70A 1H92A 4BI3A 4OB2B 3HSBA 5LJ3f 3TQ7P 1VQ4Q 2J05A 1N9SA 3G6EA 2LVMA 2GTOA 5CCAA 1OV3A 4GY5A 4N4GA 5GMKi 1K8AU 3OYNA 1K8AR 2VWFA 4M78G 3CCUA 4Z89A 2DERA 4NOYA 4BB7A 1BK2A 2DZCA 3EHQA 3CCJQ 2AK5A 1K9MC 3V8LA 3BW1A 4X1VA 4F7UE 5IT9E 3S3OA 2QXFA 1NZ9A 2FHDA 1KQ2A 4E2FB 2EQJA 2YUQA 1Q7YU 1Q7YR 2QI2A 3M0TA 1S1NA 2RHYA 3CMET 1GBRA 4J6WA 2LCCA 3LLRA 3QPHA 4LDWA 4OMFB 3CCQA 2YHTA 4DBFA 4OMPA 4HVVA 1ABOA 4D8KA 1IREB 3MPUB 2RA2A 2XG8D 4C0DC 4JLIA 3OYHA 5GAOn 1QWEA 1M3AA 1RAFB 2CREA 5GJWB 1AWJA 2QA4T 2EYZA 4NS5A 2YUPA 2VKNA 3TVTA 1VQLT 2CP3A 4QQDA 5IHIA 1Q81C 1NYGA 3OYCA 1IO6A 4HCZA 2GGRA 2QEXT 2MI6A 2OAUA 3CCSQ 2DYBA 4AMCA 4Q5WA 3H0HA 1BI3A 1OZ2A 2KROA 3SWNB 5KYXA 2ZGWA 4QQ6A 3CC2A 1K73C 1VQ8A 2JOYA 2E5QA 2DMOA 3CQTA 2HZYA 3I9QA 3QWYA 3C94A 1WQWA 1KK7A 1U5SA 5CO7A 2KSSA 5ECAA 3KXTA 4OMQA 1FMVA 1PC0A 3CBMA 1YJ9A 2HMAA 1WPYA 1QWFA 3I56T 1VQOA 3A8LB 2BUDA 1QKXA 1D0XA 5GAN7 3UF4A 3OBYA 1TWBA 4XTYA 2A36A 3LYIA 2RI5A 4D8DA 1MUZA 2GFAA 4XK8E 3PVQA 1YI2A 2X9HA 2P4TA 2Y90A 2DEUA 4EMKB 3VV0A 1O75A 3G71A 2R5MA 4FYWB 1TOVA 1IHWA 1R0BG 5FWCA 4II1A 2XDBA 1JXMA 5CKEA 3NTHA 4VUBA 5FU6C 3GNFB 1QVGP 3G1JA 5A0LA 1KC8U 1ZQ1A 2XDDA 5CKBA 2LTOA 2MPXC 3TSWA 1D0YA 2LCLA 2RB6A 3TEEA 1HD3A 4O5VA 4DEYA 4NL2A 3CCLQ 4E7HA 1WHHA 4LE9A 2L3RA 2IPOB 3M0RA 4K11A 3DKMA 2MWOA 3SB2A 3C12A 4A4GA 2AHJB 1NLOC 4A4EA 1T3SA 1PM3A 3CD6Q 1KQSP 4QVCA 3H6ZA 4FU6A 4ZN1A 2COZA 5D6XA 3A8OB 3THKA 1M1KU 1M1KR 2DD4A 1YJNQ 1AWXA 2VGMA 4JS5A 1AZGB 1WJQA 4OF1A 2K5IA 2E6NA 1VQ6T 3QSUA 2FRWA 2LCSA 3M0SA 4BE0A 3JCMP 4LDYA 1JJ2A 4XTZA 2O31A 3JCMe 2E4HA 3HRTA 4QW2A 1K8AC 3MKDA 5FLXE 4EIKA 4A53A 2F2XA 1BU1A 2F5TX 1LPLA 1JU5C 4M78B 5FRNA 1I8FA 3CC4Q 4Y91A 2BE9B 2LT1A 3C4SA 3CCRT 7AT1B 2DVEA 1YIJA 3A98A 5LJ5g 1Q7YC 5GAMd 1M27C 2HL5C 5C6SA 3CCET 1G83A 1FMKA 4ZGEB 3S3NA 1JQQA 1VQ5A 1OOTA 1D3BA 2CT4A 1YP5A 2KYBA 1ZX6A 1H641 1U1SA 2DNUA 4PJOF 2P0KA 2RQUA 4LNPA 1KFZA 3SWNC 1WHKA 1I1JA 3J81E 3EGXB 2DKGA 3CCVT 1WLPB 1SRLA 2AT1B 2ED0A 3GF5A 3PIOA 1KQ1A 2HKQB 2ZPEB 3FLGA 3A1PA 5LJ3h 2DPPB 5CK9A 2QQBA 1NE8A 3FDRA 1TTHB 2NUPB 2O9VA 1QVFA 2IG0A 1VQ7A 4LDUA 1SEMA 2RJEA 4PNOA 3WVEB 2HQXA 1B07A 1VA7A 3HFOA 3OS1A 2X3XD
chains in the Genus database with same CATH topology
2LX7A 4AFUC 2B86A 2FPDA 2CH4A 3SEMA 3EGUA 4KRTA 2RQTA 1WXUA 1M3CA 2HCKA 2O2OA 2AKKA 2M51A 1KIKA 2RPNA 4J9IA 2K9GA 1GL5A 3IQLA 1K0XA 1HJDA 3M0QA 4R0KA 1PKTA 2YDLA 3VRZA 1ZBJA 3QWXX 2GNCA 1ARKA 2KR3A 4IIMA 2IIMA 2LNHB 4ZNXA 5FWBA 2H8HA 2OAWA 2EKHA 1AZEA 1RLQC 2AZSA 4IIOA 1JEGA 1ABQA 3H41A 3REAB 4AG1C 2JW4A 1K76A 3NMZC 2EVRA 1OEBA 3H0FA 4F17A 2FRYA 2BTTA 1NEBA 2KBTA 3R6NA 1MV0B 2LQWA 3EHRA 2KT8A 1ZLMA 2PZ1A 3U23A 2D8JA 1PKSA 2JXBA 3VS3A 1GCQC 2EPDA 1E7OA 2DLPA 2A08A 2I0NA 2A37A 1MV3A 1T0JA 2A28A 4JPBW 1V1CA 2OI3A 2J6FA 3VS4A 2BZXA 2DE0X 2DVJA 2EGCA 2JM9A 4FSSA 2FPFA 2K6DA 2DL4A 1ZUUA 2EGAA 2D1XA 3VS0A 1Z9ZA 2JTEA 2L3SA 1TUDA 2LJ3A 3NHNA 4RTTA 2DILA 1EFNA 2GQIA 4RTXA 1K0SA 1PNJA 2J06A 1GFCA 1X2KA 1QLYA 1Z9QA 2EGEA 4JJCA 2RNAA 5FW9A 4J9EA 1X2QA 2RQRA 1M3BA 1AWOA 4ORZA 2V1QA 3PE0A 2C0OA 1T0HA 4AFSC 2ROLA 1K1ZA 2DL3A 1CKAA 4J9DA 4JZ4A 4OMOA 1WX6A 1X6GA 2K7AA 1YCSB 2DM1A 2PTKA 1BBZA 3VS1A 4F14A 2MIOA 1JXOA 1UJ0A 3VS7A 4CC2A 3EG3A 4GLMA 1UE9A 2P4RA 4E6RA 1AVZC 2KRSA 1OPLA 2O9SA 4J9CA 2V1RA 4RTYA 2D8HA 2L3PA 4HVUA 3UA6A 4GBQA 1LCKA 4JZ3A 1K9AA 3UA7A 3NPFA 2NUZA 1GRIA 1H3HA 1M8MA 1VYVA 5IXFA 2GTJA 5IH2A 4RTZA 2XMFA 1NG2A 4HVWA 4J9HA 1Y0MA 2QDLA 1W70A 1H92A 1CKBA 2J05A 1Y57A 1G2BA 1T3LA 2LZ6B 2GTOA 1OV3A 1B3QA 1JO8A 2VWFA 4AG2C 2C0TA 4Z89A 2LMJA 2DA9A 2CDTA 2CH4W 2X3WD 4CC7A 1BK2A 3EHQA 2AK5A 1AOJA 2DL5A 4X1VA 1WXBA 3ZL7C 1WDXA 2JM8A 3O5ZA 1K4US 2L0AA 4AFZC 2DBMA 2YUQA 2RQVA 2EYXA 2ENMA 1NM7A 3M0TA 1S1NA 2LJ1A 2FO0A 2O88A 1GBRA 1WXTA 1QKWA 1XOVA 3REBB 3I5SA 4OMPA 4HVVA 1ABOA 4RUGA 4D8KA 2MOXA 1UJYA 2PNIA 2SRCA 5IHNA 1VYUA 4J9BA 3RBBB 2K79A 4WCIA 1PHTA 2KXDA 1QWEA 1M3AA 1YN8A 1UUEA 2CREA 5EC7A 5GJWB 1AWJA 2K3BA 2EYZA 1KJWA 2YUPA 2VKNA 4LN2A 2JMCA 3TVTA 3ULRB 4J9FA 5IHIA 2EBPA 2J7IA 3KFVA 1NYGA 1IO6A 2GGRA 1SRMA 2LQNA 2CUBA 2JT4A 2DYBA 3VS6A 4JJBA 1YNZA 2AKLA 3H0HA 1SHFA 2SEMA 2KXCA 2KROA 1TUCA 1X6BA 1SSHA 1SHGA 2OJ2A 1W6XA 3PVLA 2F2VA 2DMOA 3CQTA 1UDLA 2RQWA 3I9QA 3QWYA 1RUWA 1WYXA 1NLPC 4DEXA 1UECA 1KSWA 4OMMA 1U5SA 5ECAA 4OMQA 1UGVA 1E6HA 2BZYA 1QWFA 2F2WA 3I5RA 5GJVB 1QKXA 1X69A 4RTWA 3UF4A 2JS0A 2GBQA 3NGPA 1BB9A 4M4ZA 2A36A 2RF0A 4LUEA 4D8DA 1MUZA 2G6FX 3EG0A 3PVQA 4Z88A 2W0ZA 2HEQA 1WI7A 1RLPC 2YUNA 1YWOA 2D0NA 4QT7A 2JMAA 2ED1A 3LH5A 2DRKA 2RN8A 2DX1A 3I35A 5FWCA 1JXMA 1W1FA 2BZ8A 3TSZA 2C0IA 2JS2A 4HCKA 2LP5A 4Z8AA 4F16A 1H8KA 1NEGA 2HDAA 1U3OA 1UFFA 3SHWA 3TSWA 1PRLC 1I07A 2KE9A 1ZUYA 1HD3A 2KNBB 2YUOA 2KGTA 4DEYA 2M0YA 5IXBA 2DJQA 3VRYA 4CC4B 2EYYA 2K2MA 2E5KA 5L23A 1UG1A 4LE9A 1GCPA 2AZVA 5HCKA 2FPEA 2KYMA 1M30A 3EG2A 3M0RA 4K11A 1GBQA 2ESWA 1QCFA 3RNJA 1A0NB 1X27A 2LJ0A 2DL8A 1AD5A 1GFDA 2J6KA 1NLOC 4CC3A 1T3SA 1YWPA 3VS5A 2CT3A 2KT1A 4RTUA 3THKA 2MCNA 3H0IA 2NWMA 4RTVA 1AWXA 2J6OA 1AZGB 2W10A 2CSIA 4J9GA 2FRWA 2LCSA 5I11A 3M0SA 1AEYA 4LUDA 1UTIA 1VYTA 2HBWA 2O31A 1I0CA 2CSQA 4JJDA 1TG0A 4EIKA 1U06A 1N5ZA 1X43A 2F2XA 1BU1A 4OMLA 1PRMC 1JU5C 1FYNA 3FJ5A 2KRMA 1WIEA 5IHKA 3A98A 2DRMA 2L3QA 1GCQA 4Y92A 1M27C 1G83A 1UHCA 1FMKA 1NYFA 2ROTA 1JQQA 2VVKA 1ZSGA 1OOTA 1AWWA 2CT4A 2DF6A 3EG1A 4HXJA 3VS2A 1YP5A 1ZX6A 2ABLA 1SPKA 2KYBA 4A63B 2DNUA 2RQUA 4LNPA 1KFZA 2EYWA 3GBQA 1I1JA 2YT6A 4OMNA 1CSKA 2ECZA 2KRNA 1WA7A 1WLPB 2FEIA 1UHFA 2DBKA 3JV3A 1E6GA 2RMOA 1OPKA 1SRLA 4AFQC 3UATA 2HSPA 2ED0A 1RI9A 2L2PA 5I22A 2EW3A 2O9VA 1SEMA 2KEAA 2DL7A 3C0CA 1B07A 1VA7A 3M0UA 2CUDA 2EQIA 2FG0A 1ZUKA 3M0PA 2YSQA 1J3TA 1WFWA 4ESRA 2X3XD 1PWTA 1HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  4AFU C;  2B86 A;  2FPD A;  2CH4 A;  3SEM A;  3EGU A;  4KRT A;  2RQT A;  1WXU A;  1M3C A;  2HCK A;  2O2O A;  2AKK A;  2M51 A;  1KIK A;  2RPN A;  4J9I A;  2K9G A;  1GL5 A;  3IQL A;  1K0X A;  1HJD A;  3M0Q A;  4R0K A;  1PKT A;  2YDL A;  3VRZ A;  1ZBJ A;  3QWX X;  2GNC A;  1ARK A;  2KR3 A;  4IIM A;  2IIM A;  2LNH B;  4ZNX A;  5FWB A;  2H8H A;  2OAW A;  2EKH A;  1AZE A;  1RLQ C;  2AZS A;  4IIO A;  1JEG A;  1ABQ A;  3H41 A;  3REA B;  4AG1 C;  2JW4 A;  1K76 A;  3NMZ C;  2EVR A;  1OEB A;  3H0F A;  4F17 A;  2FRY A;  2BTT A;  1NEB A;  2KBT A;  3R6N A;  1MV0 B;  2LQW A;  3EHR A;  2KT8 A;  1ZLM A;  2PZ1 A;  3U23 A;  2D8J A;  1PKS A;  2JXB A;  3VS3 A;  1GCQ C;  2EPD A;  1E7O A;  2DLP A;  2A08 A;  2I0N A;  2A37 A;  1MV3 A;  1T0J A;  2A28 A;  4JPB W;  1V1C A;  2OI3 A;  2J6F A;  3VS4 A;  2BZX A;  2DE0 X;  2DVJ A;  2EGC A;  2JM9 A;  4FSS A;  2FPF A;  2K6D A;  2DL4 A;  1ZUU A;  2EGA A;  2D1X A;  3VS0 A;  1Z9Z A;  2JTE A;  2L3S A;  1TUD A;  2LJ3 A;  3NHN A;  4RTT A;  2DIL A;  1EFN A;  2GQI A;  4RTX A;  1K0S A;  1PNJ A;  2J06 A;  1GFC A;  1X2K A;  1QLY A;  1Z9Q A;  2EGE A;  4JJC A;  2RNA A;  5FW9 A;  4J9E A;  1X2Q A;  2RQR A;  1M3B A;  1AWO A;  4ORZ A;  2V1Q A;  3PE0 A;  2C0O A;  1T0H A;  4AFS C;  2ROL A;  1K1Z A;  2DL3 A;  1CKA A;  4J9D A;  4JZ4 A;  4OMO A;  1WX6 A;  1X6G A;  2K7A A;  1YCS B;  2DM1 A;  2PTK A;  1BBZ A;  3VS1 A;  4F14 A;  2MIO A;  1JXO A;  1UJ0 A;  3VS7 A;  4CC2 A;  3EG3 A;  4GLM A;  1UE9 A;  2P4R A;  4E6R A;  1AVZ C;  2KRS A;  1OPL A;  2O9S A;  4J9C A;  2V1R A;  4RTY A;  2D8H A;  2L3P A;  4HVU A;  3UA6 A;  4GBQ A;  1LCK A;  4JZ3 A;  1K9A A;  3UA7 A;  3NPF A;  2NUZ A;  1GRI A;  1H3H A;  1M8M A;  1VYV A;  5IXF A;  2GTJ A;  5IH2 A;  4RTZ A;  2XMF A;  1NG2 A;  4HVW A;  4J9H A;  1Y0M A;  2QDL A;  1W70 A;  1H92 A;  1CKB A;  2J05 A;  1Y57 A;  1G2B A;  1T3L A;  2LZ6 B;  2GTO A;  1OV3 A;  1B3Q A;  1JO8 A;  2VWF A;  4AG2 C;  2C0T A;  4Z89 A;  2LMJ A;  2DA9 A;  2CDT A;  2CH4 W;  2X3W D;  4CC7 A;  1BK2 A;  3EHQ A;  2AK5 A;  1AOJ A;  2DL5 A;  4X1V A;  1WXB A;  3ZL7 C;  1WDX A;  2JM8 A;  3O5Z A;  1K4U S;  2L0A A;  4AFZ C;  2DBM A;  2YUQ A;  2RQV A;  2EYX A;  2ENM A;  1NM7 A;  3M0T A;  1S1N A;  2LJ1 A;  2FO0 A;  2O88 A;  1GBR A;  1WXT A;  1QKW A;  1XOV A;  3REB B;  3I5S A;  4OMP A;  4HVV A;  1ABO A;  4RUG A;  4D8K A;  2MOX A;  1UJY A;  2PNI A;  2SRC A;  5IHN A;  1VYU A;  4J9B A;  3RBB B;  2K79 A;  4WCI A;  1PHT A;  2KXD A;  1QWE A;  1M3A A;  1YN8 A;  1UUE A;  2CRE A;  5EC7 A;  5GJW B;  1AWJ A;  2K3B A;  2EYZ A;  1KJW A;  2YUP A;  2VKN A;  4LN2 A;  2JMC A;  3TVT A;  3ULR B;  4J9F A;  5IHI A;  2EBP A;  2J7I A;  3KFV A;  1NYG A;  1IO6 A;  2GGR A;  1SRM A;  2LQN A;  2CUB A;  2JT4 A;  2DYB A;  3VS6 A;  4JJB A;  1YNZ A;  2AKL A;  3H0H A;  1SHF A;  2SEM A;  2KXC A;  2KRO A;  1TUC A;  1X6B A;  1SSH A;  1SHG A;  2OJ2 A;  1W6X A;  3PVL A;  2F2V A;  2DMO A;  3CQT A;  1UDL A;  2RQW A;  3I9Q A;  3QWY A;  1RUW A;  1WYX A;  1NLP C;  4DEX A;  1UEC A;  1KSW A;  4OMM A;  1U5S A;  5ECA A;  4OMQ A;  1UGV A;  1E6H A;  2BZY A;  1QWF A;  2F2W A;  3I5R A;  5GJV B;  1QKX A;  1X69 A;  4RTW A;  3UF4 A;  2JS0 A;  2GBQ A;  3NGP A;  1BB9 A;  4M4Z A;  2A36 A;  2RF0 A;  4LUE A;  4D8D A;  1MUZ A;  2G6F X;  3EG0 A;  3PVQ A;  4Z88 A;  2W0Z A;  2HEQ A;  1WI7 A;  1RLP C;  2YUN A;  1YWO A;  2D0N A;  4QT7 A;  2JMA A;  2ED1 A;  3LH5 A;  2DRK A;  2RN8 A;  2DX1 A;  3I35 A;  5FWC A;  1JXM A;  1W1F A;  2BZ8 A;  3TSZ A;  2C0I A;  2JS2 A;  4HCK A;  2LP5 A;  4Z8A A;  4F16 A;  1H8K A;  1NEG A;  2HDA A;  1U3O A;  1UFF A;  3SHW A;  3TSW A;  1PRL C;  1I07 A;  2KE9 A;  1ZUY A;  1HD3 A;  2KNB B;  2YUO A;  2KGT A;  4DEY A;  2M0Y A;  5IXB A;  2DJQ A;  3VRY A;  4CC4 B;  2EYY A;  2K2M A;  2E5K A;  5L23 A;  1UG1 A;  4LE9 A;  1GCP A;  2AZV A;  5HCK A;  2FPE A;  2KYM A;  1M30 A;  3EG2 A;  3M0R A;  4K11 A;  1GBQ A;  2ESW A;  1QCF A;  3RNJ A;  1A0N B;  1X27 A;  2LJ0 A;  2DL8 A;  1AD5 A;  1GFD A;  2J6K A;  1NLO C;  4CC3 A;  1T3S A;  1YWP A;  3VS5 A;  2CT3 A;  2KT1 A;  4RTU A;  3THK A;  2MCN A;  3H0I A;  2NWM A;  4RTV A;  1AWX A;  2J6O A;  1AZG B;  2W10 A;  2CSI A;  4J9G A;  2FRW A;  2LCS A;  5I11 A;  3M0S A;  1AEY A;  4LUD A;  1UTI A;  1VYT A;  2HBW A;  2O31 A;  1I0C A;  2CSQ A;  4JJD A;  1TG0 A;  4EIK A;  1U06 A;  1N5Z A;  1X43 A;  2F2X A;  1BU1 A;  4OML A;  1PRM C;  1JU5 C;  1FYN A;  3FJ5 A;  2KRM A;  1WIE A;  5IHK A;  3A98 A;  2DRM A;  2L3Q A;  1GCQ A;  4Y92 A;  1M27 C;  1G83 A;  1UHC A;  1FMK A;  1NYF A;  2ROT A;  1JQQ A;  2VVK A;  1ZSG A;  1OOT A;  1AWW A;  2CT4 A;  2DF6 A;  3EG1 A;  4HXJ A;  3VS2 A;  1YP5 A;  1ZX6 A;  2ABL A;  1SPK A;  2KYB A;  4A63 B;  2DNU A;  2RQU A;  4LNP A;  1KFZ A;  2EYW A;  3GBQ A;  1I1J A;  2YT6 A;  4OMN A;  1CSK A;  2ECZ A;  2KRN A;  1WA7 A;  1WLP B;  2FEI A;  1UHF A;  2DBK A;  3JV3 A;  1E6G A;  2RMO A;  1OPK A;  1SRL A;  4AFQ C;  3UAT A;  2HSP A;  2ED0 A;  1RI9 A;  2L2P A;  5I22 A;  2EW3 A;  2O9V A;  1SEM A;  2KEA A;  2DL7 A;  3C0C A;  1B07 A;  1VA7 A;  3M0U A;  2CUD A;  2EQI A;  2FG0 A;  1ZUK A;  3M0P A;  2YSQ A;  1J3T A;  1WFW A;  4ESR A;  2X3X D;  1PWT A;  1HSQ A; 
#chains in the Genus database with same CATH topology
 3OY9 A;  3JCM Q;  1M1F A;  2DEQ A;  3UPU A;  4P5N A;  4EMK C;  3SEM A;  4X9D A;  2RQT A;  2E3H A;  3M4G A;  4F04 B;  3IQL A;  1MGQ A;  3L2W A;  2X4W A;  3M0Q A;  3DLL A;  4R0K A;  1BI1 A;  4RCB A;  2R57 A;  1ZBJ A;  3HP9 A;  2IIM A;  2LNH B;  3G6E Q;  4TVR A;  4BY6 B;  2DTO A;  2H8H A;  4M78 F;  3CXC S;  1AZE A;  2AZS A;  4IUT A;  1JEG A;  1EIF A;  4CRI A;  1KHC A;  3H41 A;  3REA B;  3VYG A;  2KMT A;  3V7R A;  2EVR A;  4F17 A;  2FRY A;  4OGC A;  4OVA A;  2RK2 A;  3CCM T;  3E2U A;  2Z0W A;  2YRD A;  3EHR A;  2JZ2 A;  1QMC A;  4C5I A;  1ZSZ B;  1PKS A;  1X6O A;  2PUO B;  1GCQ C;  2EPD A;  3S3M A;  1E7O A;  3HRS A;  1VQ9 T;  2DLP A;  3D7S B;  4DOW A;  4JPB W;  4BI8 B;  2OI3 A;  2DE0 X;  2DVJ A;  2EGC A;  3TU4 K;  1KHI A;  4M78 D;  2V8I A;  3JB9 J;  4M78 E;  4DBQ A;  3NHN A;  1VQK T;  2GQI A;  1VQM T;  2DXT A;  1M1K C;  1VQP A;  1QW1 A;  4M78 C;  1GFC A;  1X2K A;  1Z9Q A;  5FW9 A;  3E1S A;  1VQ4 T;  1DJ7 B;  3CC2 Q;  5CVI A;  1VQ8 Q;  1YJW A;  1IB8 A;  2L5Q A;  4AFS C;  2C0O A;  2DL3 A;  4JZ4 A;  2QQA A;  4J9D A;  4N0A A;  4LD9 K;  1YHQ A;  3GP8 A;  3WVD B;  3CBO A;  4FT4 A;  3CCJ T;  1VQO Q;  2QDY B;  5CKD A;  3EGD A;  2E64 A;  5KCH A;  4GLM A;  3L2Z A;  1OZ3 A;  3MEV A;  2GF7 A;  2O01 E;  4QVZ A;  1JJ2 P;  1NPR A;  4J9C A;  2V1R A;  2D8H A;  3MHX A;  4M7D A;  4N4I A;  1N9R A;  1WJR A;  3GIB A;  1G3Y A;  3CCE Q;  3UA7 A;  2E10 A;  2DJZ A;  3NPF A;  2QYZ A;  1M8M A;  3LGL A;  1QVP A;  4IUU A;  1VYV A;  1PD1 A;  5IH2 A;  1VOM A;  2XMF A;  1IZ6 A;  4LXC A;  1WJS A;  2P0P A;  4J9H A;  2QDL A;  2CGH A;  3RKW A;  4J5Y A;  3MP6 A;  5CR2 A;  1IRX A;  5GAM g;  1JJ2 S;  5FRO A;  3CCS T;  2LMJ A;  2DA9 A;  2DO3 A;  2CH4 W;  3L2V A;  3VUB A;  1WDX A;  2JM8 A;  4XU2 A;  1TXQ A;  1VUB A;  1WNL A;  4AFZ C;  2RQV A;  1NM7 A;  5GAN g;  2HNI A;  3VYH B;  4M7D G;  2LJ1 A;  1ZA1 B;  4BY6 C;  2O88 A;  3GPL A;  1XOV A;  1IGU A;  1BCO A;  2QTV A;  2RI2 A;  3REB B;  1QVF P;  3L2Q A;  4RUG A;  2RM4 A;  2MOX A;  3DB4 A;  3EFO A;  1UJY A;  2PNI A;  2K4Y A;  1VYU A;  5C0M A;  2K79 A;  1PHT A;  4J6X A;  1YN8 A;  3M59 A;  1D0Z A;  2RJC A;  4E7Z A;  1KJW A;  2R58 A;  5LJ3 j;  3OYM A;  3L2U A;  1ZSZ C;  2JMC A;  3ULR B;  1Y96 A;  3L42 A;  3X28 B;  2EBP A;  4KGZ B;  4ATO A;  2J7I A;  5LL6 S;  4PLI A;  2V8K A;  2JT4 A;  4C5H A;  1G3W A;  1YNZ A;  2SEM A;  4WTO B;  1TUC A;  1X6B A;  1QVF S;  2MAM A;  3PVL A;  3UT1 A;  1RUW A;  2CZ7 B;  4A4K A;  1UEC A;  1KSW A;  1RAI B;  3OSV A;  1UGV A;  1E6H A;  1F1B B;  3JAM E;  4EPC A;  3G7Z A;  4PFZ A;  4L5G A;  2CP6 A;  1B7T A;  2GBQ A;  4M4Z A;  1PSE A;  2RF0 A;  2VUB A;  4Z88 A;  2FVU A;  2W0Z A;  1KD1 R;  2HEQ A;  1Y7X A;  4JJN K;  3CD6 T;  1C1A A;  3CEY A;  5LJ3 e;  1I5O B;  1EZZ B;  3LH5 A;  2DRK A;  5LJ5 f;  4C0F A;  2DX1 A;  2QEX A;  1YJN T;  4J6Y A;  1VQ7 Q;  3TSZ A;  2OX7 A;  2YXY A;  2M0O A;  2JS2 A;  2LP5 A;  5LJ5 d;  1NBE B;  3X26 B;  2CZ1 B;  1H8K A;  1NEG A;  4EDU A;  2ZZD A;  2F1L A;  1PRL C;  3LX7 A;  4M7A A;  2A7Y A;  5IXB A;  2EYY A;  3QO3 A;  3CC4 T;  2AZV A;  5HCK A;  3MP8 A;  2QTX A;  4C0Z A;  1M30 A;  3EG2 A;  2PQW A;  1PG5 B;  5KE2 A;  3RNJ A;  1A0N B;  1X27 A;  2BKD N;  2EWN A;  2JUF A;  2HD0 A;  3M58 A;  4B6M A;  1AD5 A;  1R8O B;  2KDS A;  1N27 A;  4Y28 E;  3LWI A;  2M1H A;  4C8Q A;  1YWP A;  5FU7 B;  3JCM c;  3RIR A;  3VS5 A;  3CC7 A;  3CBP A;  3Q1J A;  4RTU A;  1TS9 A;  2X4J A;  3HTR A;  4DQ2 A;  2NWM A;  3X20 B;  2DYI A;  4JS4 A;  4ZTF A;  3NTK A;  2CP0 A;  5GAN 8;  5KH6 A;  4KT0 E;  2CSI A;  3PIP A;  4B9X A;  4KUL A;  5I11 A;  1AEY A;  1RAE B;  1I4K 1;  4LUD A;  3CXC A;  3BDL A;  2PVD B;  4JRI A;  2HBW A;  1IXD A;  1XTD A;  2CSQ A;  4IUQ A;  5J26 A;  4M7A G;  2XIC A;  5GAN 2;  1N5Z A;  1O9S A;  3M55 A;  2Y4Y A;  4OML A;  4IUV A;  4FT2 A;  4QKU A;  3L2R A;  1FYN A;  1JB0 E;  5A2Q E;  4C5G A;  2CZ6 B;  3EGD B;  4E47 A;  3HRU A;  2RJF A;  4ME7 A;  5I2S A;  2DRM A;  3O8V A;  2L3Q A;  4C8Q G;  4Y92 A;  2ZPG B;  3MJX A;  3P8H A;  2DXC A;  2DET A;  1VIE A;  2XKO C;  4M7D B;  1ZSG A;  2DZ9 A;  3QXE B;  3EG1 A;  1SPK A;  1XJW B;  2EYW A;  1WHM A;  4OMN A;  2KRN A;  1UHF A;  3P8B B;  1OYX A;  3G6E T;  1E6G A;  3PMI A;  4BDY A;  5KYW B;  4J83 A;  2HSP A;  3KUF A;  3LW5 E;  5I22 A;  2EW3 A;  1YHQ Q;  4PKC C;  1D09 B;  4OB0 B;  3CPF A;  3M53 A;  2X4Y A;  1Y07 A;  5CKH A;  3M0U A;  2CUD A;  3M0P A;  5KYU A;  2YSQ A;  5KE3 A;  2E41 A;  4C92 A;  4ESR A;  1HSQ A;  2QK0 A;  2COY A;  4AFU C;  4V2S A;  1BCM A;  2B86 A;  3OMC A;  2CH4 A;  3V8K A;  3EGU A;  4KRT A;  2EJ9 A;  1Q82 R;  3CCQ T;  1SKU B;  2O4X A;  1WXU A;  1M3C A;  2E65 A;  3EH1 A;  1MND A;  1M90 U;  2O2O A;  1M90 R;  1D1C A;  4J9I A;  2K9G A;  1VQN A;  3G4S A;  3I55 A;  3MCA B;  5D6W A;  4RG2 A;  3TRE A;  3EFO B;  2YDL A;  4M75 A;  3VRZ A;  3QWX X;  2GNC A;  1ARK A;  2KR3 A;  4IIM A;  3CCV A;  5FWB A;  2NLU A;  2EJF A;  2OAW A;  4IIO A;  2HL3 A;  3PT9 A;  1ABQ A;  4AG1 C;  1BI0 A;  3NTI A;  2XD0 A;  3E9F A;  4BE1 A;  2BIV A;  5GMK h;  3QYG B;  1UGS B;  1NEB A;  3CC2 T;  2P0Q A;  1VQ8 T;  3AHU A;  4LDX A;  4C92 G;  3C95 A;  4KUI A;  2RHU A;  4M7D F;  4RMO A;  5FU7 C;  3VU3 C;  4XTW A;  3FRN A;  1VQO T;  2RHI A;  1UGR B;  1BKB A;  2I0N A;  3E9G A;  1Y71 A;  2A37 A;  1MV3 A;  3OYK A;  5GAM f;  1M2V A;  3SD4 A;  1B34 B;  2J6F A;  4PFO A;  3RKY A;  2JM9 A;  3ZFJ A;  4FSS A;  4M75 G;  5KCO A;  1BI2 A;  2K6D A;  4F7U A;  2KVQ G;  2D0Q B;  3M54 A;  2EGA A;  2MWP A;  4M77 A;  3VS0 A;  1LJO A;  1Z9Z A;  2K5L A;  2LJ3 A;  2RJD A;  2FYK A;  2JJ9 A;  2DIL A;  1EFN A;  3UDC A;  4OB3 B;  4N0A C;  1M4Z A;  5GAN f;  4RTX A;  1TUG B;  2OTJ A;  1FMW A;  1QLY A;  2OTL A;  2RNA A;  3JCM f;  3CMA Q;  3BFM A;  4M7D D;  2H3E B;  5GAN d;  4HT9 A;  3ASK A;  1M3B A;  4M7D E;  4ORZ A;  2V1Q A;  1T0H A;  3JCM d;  1CKA A;  4MMK A;  1RAB B;  1HXD A;  1HK9 A;  1VQ9 A;  4C5E A;  4MZP A;  4F14 A;  4M7D C;  4FSX A;  4M7A B;  5GAO r;  2YLC A;  1YBY A;  2X4X A;  1X75 C;  3MEU A;  1UE9 A;  5KYN A;  3QDR B;  1M1G A;  4J7F A;  4F7U G;  4M77 G;  2O9S A;  3FJP A;  3CXC P;  5GMK l;  3OS0 A;  4ZGJ B;  3OYG A;  2L3P A;  2MYS A;  1Q86 R;  3UA6 A;  4C8Q B;  4GBQ A;  4JZ3 A;  1VQK A;  1K9A A;  2K3Y A;  1G5V A;  2IVW A;  2EQK A;  2NUZ A;  4BD3 A;  1H3H A;  4BDZ A;  2EIF A;  2VYT A;  2GTJ A;  2QG9 B;  1NG2 A;  4HVW A;  5CIU A;  4B9W A;  1Y0M A;  5CQY A;  3M4Y A;  1VQ4 A;  2ZPI B;  4XU3 A;  3GLX A;  1BIB A;  5AYF A;  1Y57 A;  1G2B A;  2LZ6 B;  3A5Z B;  3RER A;  2PVO B;  1B3Q A;  3JCM W;  1M9S A;  2C0T A;  2FZC B;  3PMT A;  4HCC A;  3CCU Q;  2EJG A;  2JTM A;  3OYY A;  1WXB A;  3ZL7 C;  5I21 A;  2CP2 A;  1OX8 A;  3HL8 A;  2L0A A;  3O5Z A;  1K4U S;  4FW1 A;  5KYX B;  2EQM A;  2EYX A;  2ENM A;  2EFI A;  1XQH A;  2RHZ A;  3CC7 Q;  1W2B A;  4BE2 A;  4N4H A;  1GXI E;  2RI3 A;  3I5S A;  1M90 C;  3CCQ Q;  3QZ5 B;  3SDZ A;  5A0D A;  4PJM A;  1RI0 A;  4J9B A;  3RBB B;  3J80 E;  3OYB A;  4WCI A;  1G3S A;  2KXD A;  2X35 A;  3FC3 A;  2K3B A;  4J7I A;  1M8V A;  3JCM b;  3PTA A;  4RG8 A;  4J9F A;  2PUK B;  3KFV A;  2C06 A;  4ZGD B;  3MEW A;  4X9C A;  4FYY B;  1VQ7 T;  3VS6 A;  2AKL A;  1SHF A;  5HK0 A;  4HT8 A;  1SHG A;  2F2V A;  1R0C B;  3MET A;  2DK3 A;  2FZK B;  3LH0 A;  1WYX A;  1H3Z A;  1NLP C;  4C92 B;  4OMM A;  2YWW A;  2BZY A;  3RUX A;  3OYA A;  1YJ9 Q;  2F2W A;  3I5R A;  1X69 A;  2JS0 A;  4DBH A;  3OYJ A;  2CZ0 B;  4LUE A;  4M7A D;  2L8D A;  2G6F X;  3EG0 A;  1AHJ B;  1WI7 A;  1RLP C;  4M75 B;  4XAX B;  3TCJ A;  4ELZ C;  1YI2 Q;  4M7A E;  4ZN3 A;  2D0N A;  4QT7 A;  2JMA A;  5A0G A;  1C6V X;  2ED1 A;  5HY6 A;  3PNW C;  3G71 Q;  3OW2 A;  3I35 A;  3EAE A;  3H9N A;  3OYD A;  5GMK j;  3SWN A;  2BZ8 A;  4C8Q D;  1QCO A;  2C0I A;  1EX4 A;  5M9O A;  4C8Q E;  5DY9 A;  4L59 A;  4RCC A;  4HA8 A;  2DXB A;  1U3O A;  5J3B A;  3SHW A;  2E6Z A;  3X24 B;  2LDM A;  2DTH A;  2F69 A;  3A8M B;  1I07 A;  2KE9 A;  1ZUY A;  4C8Q C;  1S72 A;  2KNB B;  2YUO A;  2KGT A;  4ZTJ A;  3CCL A;  2DJQ A;  2QGG A;  2K2M A;  4DBR A;  1ZHI A;  3GOX A;  1UG1 A;  1U1T A;  1VQN Q;  3G4S Q;  3QKJ A;  3I55 Q;  2FPE A;  2KYM A;  1NJI U;  1NJI R;  1V29 B;  2VAS A;  2ESW A;  2KY9 A;  3EG9 A;  4X34 A;  2LJ0 A;  2DL8 A;  1M2V B;  4MZT A;  1GFD A;  3HHT B;  3CD6 A;  4JDS A;  4CC3 A;  4F7U B;  5GAM h;  3HFN A;  4M77 B;  1FXX A;  2CT3 A;  1NPP A;  3JCM g;  1YIT A;  2DIG A;  5LJ5 j;  3H0I A;  4LD6 A;  4RTV A;  5GMK e;  1ACM B;  1D3B B;  2HAX A;  4C92 F;  4PJO A;  2LQ8 A;  2W10 A;  1YJW T;  2P84 A;  5L8R E;  1VYT A;  2GQV A;  3AT1 B;  3ER0 A;  2VB6 A;  1I0C A;  2QQ9 A;  4JUV A;  1YFN A;  4JJD A;  1YHQ T;  2WSE E;  1TG0 A;  1U06 A;  3DB3 A;  1PRM C;  3CC4 A;  3GNG A;  2E3I A;  2HKN A;  3FJ5 A;  4PJL A;  2KRM A;  1HYO A;  3OMG A;  1YIJ Q;  1GCQ A;  3CME A;  2ROT A;  3OS2 A;  4C92 D;  3MO8 A;  4R55 A;  1VQ5 Q;  2KAF A;  2RO0 A;  2OTJ Q;  2I2L A;  3P8D A;  4C92 E;  4PJO G;  3GBQ A;  5LJ5 e;  2OTL Q;  5DLQ E;  4MML A;  5GMK m;  2ATC B;  4Z02 A;  1KG1 A;  1CSK A;  2ECZ A;  1KD1 U;  2FEI A;  2QA4 A;  2DBK A;  3JV3 A;  6AT1 B;  2RMO A;  1OPK A;  4FCY A;  3RES A;  3PGG A;  4AFQ C;  4C92 C;  2RHX A;  2L2P A;  1VQL A;  3JCM X;  1W2B P;  2BE7 D;  4M78 A;  1RAH B;  4LDV A;  2L89 A;  2LQK A;  2CP5 A;  2KEA A;  2XHC A;  2LRQ A;  2FZG B;  3OQ5 A;  3QG1 A;  1XNI A;  3M5A A;  3C0C A;  3JB9 H;  4A4F A;  5GAO l;  3BY7 A;  4M77 F;  2EQI A;  2FG0 A;  1ZUK A;  1J3T A;  1JRI A;  1WFW A;  1PWT A;  2JNG A;  1LVK A;  2LX7 A;  2VV5 A;  2NUT A;  4XU1 A;  3FEO A;  1C0M A;  1OUL A;  2AKK A;  3BE3 A;  2RPN A;  3I56 A;  1W2B S;  4L6V 5;  2Y4X A;  3FIF A;  4MDX A;  1MMA A;  1PKT A;  2EYQ A;  5I2M A;  3S6W A;  4CI0 C;  5IN1 A;  3JB9 I;  1JBM A;  2CYZ B;  3CPW A;  2RH2 A;  2NUP A;  2EKH A;  5LJ3 d;  1BIA A;  4FYV B;  5KYY A;  1OX9 A;  1TU0 B;  2COW A;  4PJN A;  1WZO A;  4M77 D;  1U8R A;  3CMA T;  2KBT A;  3F70 A;  4M77 E;  1FX7 A;  2K57 A;  2GFU A;  1I81 A;  2LQW A;  2MK5 A;  2KT8 A;  5GAO q;  1ZBX A;  1ZLM A;  2D8J A;  4FYX B;  4M77 C;  3OW2 P;  2MMP A;  4UC4 A;  1UB4 A;  3SFM A;  2F5K A;  2A08 A;  3EFR A;  2YRC A;  1NJI C;  2A28 A;  5GAN 3;  3BDU A;  3VS4 A;  4PFP A;  4IUP A;  1ZUU A;  2HBP A;  2D1X A;  4EMH A;  3JB9 G;  2JTE A;  1TUD A;  3M56 A;  2R5A A;  4E7S A;  1BYM A;  1LOJ A;  1X01 A;  1QCN A;  4NL3 A;  3RMS A;  1VQP Q;  5GAN 5;  3OW2 S;  4JJC A;  2ZPH B;  2WAC A;  4J9E A;  3RR6 A;  1ZSZ A;  1VQ6 A;  1WGS A;  3NFC A;  3MP1 A;  2RD1 A;  2LC4 A;  2E12 A;  1YJW Q;  3PE0 A;  1N6A A;  1WX6 A;  1X6G A;  1YCS B;  3ZEH A;  2DM1 A;  2PTK A;  3CCU T;  1WQ7 A;  2MIO A;  3HPW A;  3JRZ A;  1UJ0 A;  4CC2 A;  3EG3 A;  3R6O A;  4PK4 A;  5GAN 6;  2VXE A;  2P4R A;  3CCR A;  1P92 A;  5GAM j;  4E6R A;  1AVZ C;  2KRS A;  3EG9 B;  3CC7 T;  4RTY A;  8ATC B;  2AIR B;  2XK0 A;  1Q95 G;  4J8O A;  3CCE A;  3V7S A;  1Q82 U;  1RAA B;  2DAQ A;  4JLG A;  3QDF A;  5GAO p;  2V8J A;  5GAN j;  5EG2 A;  1OI1 A;  2KQW A;  1CKB A;  1QQJ A;  1KC8 R;  4PJO B;  1KD1 C;  1T3L A;  3L1A A;  5HKC A;  3QJ6 A;  1VIF A;  1JO8 A;  4JRK A;  4AG2 C;  1S72 Q;  3OB9 A;  1Y96 B;  2CDT A;  3T9N A;  2X3W D;  4CC7 A;  4YTL A;  2K2V A;  1AOJ A;  2DL5 A;  2MF2 A;  4KUD K;  2QAS A;  2DBM A;  1QVG S;  5FRM A;  5GAM e;  2M02 A;  2FO0 A;  2QAZ A;  4AT1 B;  1WXT A;  1QKW A;  3V7C A;  4KH1 B;  1YJ9 T;  3QUI A;  1YIT Q;  3WXM B;  4D6W A;  2SRC A;  5IHN A;  5GAN e;  4IUR A;  2H3J A;  1UUE A;  5EC7 A;  1RAG B;  4GLK A;  1YI2 T;  2EAY A;  2QQS A;  4LN2 A;  2GCX A;  1W4S A;  3G71 T;  2XU8 A;  2DTI A;  4BAC A;  1KQS S;  1SRM A;  1PD0 A;  2LQN A;  2CP7 A;  2CUB A;  4JJB A;  2KXC A;  2M9U A;  4HCB A;  1SSH A;  2OJ2 A;  3CCM A;  1W6X A;  1RAD B;  5LJ5 h;  2WSC E;  2XI9 A;  5CKF A;  1UDL A;  2RQW A;  2ZCF B;  3CPW P;  4DEX A;  2RK1 A;  2ZAE A;  2NUT B;  3CME Q;  2XDP A;  5LJ3 g;  5GAO m;  1VQN T;  3G4S T;  2FB7 A;  4A54 A;  5GJV B;  3HKS A;  3I55 T;  1N8R U;  4RTW A;  3OS5 A;  1N8R R;  1LNX A;  4RKU E;  2YRV A;  2FL7 A;  3PFS A;  3NGP A;  1BB9 A;  2YLB A;  4XU0 A;  2KI7 A;  2YUN A;  2QA4 Q;  1YWO A;  1Q86 U;  1UEB A;  5DLO A;  3ME9 A;  1VQL Q;  5HK3 A;  2E1H A;  4PLL A;  1SG5 A;  2DIQ A;  2RN8 A;  3CPW S;  3A8G B;  3JCM V;  1W1F A;  2LNV A;  4ANJ A;  2QEX Q;  1VQM A;  5KYY B;  1SF9 A;  1V76 A;  4HCK A;  1RAC B;  4Z8A A;  4F16 A;  1ZA2 B;  2HDA A;  8AT1 B;  4KGX B;  1UFF A;  4FL6 A;  4KBM B;  3E19 A;  1WHG A;  3VUZ A;  4PJO D;  2M0Y A;  3VRY A;  2WSF E;  4CC4 B;  4PJO E;  3CCJ A;  2E70 A;  2E5K A;  5L23 A;  3I56 Q;  2ZPB B;  1GCP A;  4XTX A;  4HKE A;  1OQK A;  1GBQ A;  1QCF A;  1YIJ T;  2M16 A;  2J6K A;  4OB1 B;  4PJO C;  2CS7 A;  1PCX A;  3JCM J;  2JN0 A;  2K3X A;  4E7L A;  1Q82 C;  1UGP B;  3UWN A;  2KT1 A;  1VQ5 T;  2VXF A;  1MMN A;  4DA4 A;  2OTJ T;  2MCN A;  2OTL T;  2J6O A;  4A4H A;  4E7I A;  1KC8 C;  4J9G A;  2HQH A;  3EFS A;  2K5F A;  1UTI A;  2PVG B;  2XID A;  2PU9 B;  5GAN 4;  4M7A F;  2QGF B;  1OU9 A;  3CCS A;  1X43 A;  4PL6 A;  4E7J A;  2KK4 A;  3A8H B;  1QP3 A;  4FM4 B;  4R56 A;  1WIE A;  5IHK A;  3JB9 F;  2LX9 A;  4MZM A;  4C8Q F;  4BI4 A;  1M5Q 1;  5KYU B;  3URG A;  1UHC A;  2HQE A;  4PJJ A;  1NYF A;  2VVK A;  5CQX A;  3M9Q A;  3J7A F;  1AWW A;  4MDW A;  2DF6 A;  2O4X B;  4HXJ A;  3VS2 A;  4A63 B;  2ABL A;  2D9T A;  1TH7 A;  1YCY A;  4ELY C;  2YT6 A;  2G3R A;  5AT1 B;  1VQ6 Q;  2NYS A;  1WA7 A;  3UAT A;  1RI9 A;  2CKK A;  2VGN A;  4FIB A;  4XTV A;  3QHS A;  1IHV A;  4BUG A;  4XQ3 A;  1PSF A;  3JB9 D;  1K9M U;  1FWZ A;  4XTU A;  1K9M R;  4M7A C;  2DL7 A;  3CCR Q;  3INZ A;  4QQG A;  2HSE B;  3KBG A;  4OP0 A;  2FPD A;  2DD5 A;  2HCK A;  4O6J A;  1UGQ B;  2EQU A;  2M51 A;  1KIK A;  3RKX A;  2A3L A;  2EKO A;  1GL5 A;  1IGQ A;  1N8R C;  1K0X A;  3M57 A;  5D7U A;  1HJD A;  1MMG A;  5KYW A;  2A0F B;  4EMK A;  5DM7 R;  1AT1 B;  5IAY A;  4ZNX A;  3CCV Q;  2JVV A;  1Q86 C;  3LGF A;  1RLQ C;  1Q81 U;  4JRQ A;  1Q81 R;  4OGE A;  2ZPF B;  4DOV A;  1QP2 A;  2JW4 A;  1K76 A;  1VQP T;  3NMZ C;  1D1A A;  1OEB A;  1TSF A;  3H0F A;  1YJN A;  2BTT A;  4C0D B;  1D1B A;  5J39 A;  3V8J A;  3R6N A;  1K73 U;  3QYH B;  1MV0 B;  1K73 R;  5GAN h;  3QBY A;  4KGV B;  4E7K A;  1G8X A;  1OU8 A;  2PZ1 A;  3U23 A;  1R77 A;  4IKF A;  2B8A A;  3JCM h;  2DXU A;  2JXB A;  3VS3 A;  3OYF A;  2D6F A;  4KH0 B;  3RDV A;  3OYI A;  1RL2 A;  1I5L A;  1T0J A;  1WHL A;  1V1C A;  3EH2 A;  4M75 F;  3OYE A;  2BZX A;  2V26 A;  5D6Y A;  1QVG A;  2FPF A;  2DL4 A;  3OSS C;  1G3T A;  2L3S A;  1M2O A;  4RTT A;  4EMG A;  4C0G A;  1K0S A;  5CAI A;  1PNJ A;  2J06 A;  3QJY A;  3CMA A;  2EGE A;  3X25 B;  3LWH A;  3CCM Q;  1X2Q A;  2RQR A;  3ZBD A;  4QVD A;  1AWO A;  2ROL A;  1K1Z A;  1KQS A;  4OMO A;  1MNE A;  3QII A;  1MHN A;  3RMQ A;  1S72 T;  9ATC B;  3CCL T;  3MEA A;  2K7A A;  2QQR A;  4WF2 A;  1BBZ A;  3JSC A;  3VS1 A;  3N5B B;  4M75 D;  1VQ9 Q;  1B34 A;  1JXO A;  3VS7 A;  1SSF A;  2LT4 A;  2X51 A;  5FU6 B;  3FB9 A;  2VC8 A;  4M75 E;  4F7U F;  3VKI A;  1MMD A;  3QZ9 B;  1OPL A;  3VJP A;  4M75 C;  4HVU A;  3H8Z A;  1LCK A;  3DLM A;  1YIT T;  2JTF A;  1VQK Q;  1GRI A;  4JRP A;  3OBW A;  1WHJ A;  1VQM Q;  5IXF A;  4FW2 A;  2DFU A;  3OA6 A;  4RTZ A;  3EGX A;  3OYL A;  1W70 A;  1H92 A;  4BI3 A;  4OB2 B;  3HSB A;  5LJ3 f;  3TQ7 P;  1VQ4 Q;  2J05 A;  1N9S A;  3G6E A;  2LVM A;  2GTO A;  5CCA A;  1OV3 A;  4GY5 A;  4N4G A;  5GMK i;  1K8A U;  3OYN A;  1K8A R;  2VWF A;  4M78 G;  3CCU A;  4Z89 A;  2DER A;  4NOY A;  4BB7 A;  1BK2 A;  2DZC A;  3EHQ A;  3CCJ Q;  2AK5 A;  1K9M C;  3V8L A;  3BW1 A;  4X1V A;  4F7U E;  5IT9 E;  3S3O A;  2QXF A;  1NZ9 A;  2FHD A;  1KQ2 A;  4E2F B;  2EQJ A;  2YUQ A;  1Q7Y U;  1Q7Y R;  2QI2 A;  3M0T A;  1S1N A;  2RHY A;  3CME T;  1GBR A;  4J6W A;  2LCC A;  3LLR A;  3QPH A;  4LDW A;  4OMF B;  3CCQ A;  2YHT A;  4DBF A;  4OMP A;  4HVV A;  1ABO A;  4D8K A;  1IRE B;  3MPU B;  2RA2 A;  2XG8 D;  4C0D C;  4JLI A;  3OYH A;  5GAO n;  1QWE A;  1M3A A;  1RAF B;  2CRE A;  5GJW B;  1AWJ A;  2QA4 T;  2EYZ A;  4NS5 A;  2YUP A;  2VKN A;  3TVT A;  1VQL T;  2CP3 A;  4QQD A;  5IHI A;  1Q81 C;  1NYG A;  3OYC A;  1IO6 A;  4HCZ A;  2GGR A;  2QEX T;  2MI6 A;  2OAU A;  3CCS Q;  2DYB A;  4AMC A;  4Q5W A;  3H0H A;  1BI3 A;  1OZ2 A;  2KRO A;  3SWN B;  5KYX A;  2ZGW A;  4QQ6 A;  3CC2 A;  1K73 C;  1VQ8 A;  2JOY A;  2E5Q A;  2DMO A;  3CQT A;  2HZY A;  3I9Q A;  3QWY A;  3C94 A;  1WQW A;  1KK7 A;  1U5S A;  5CO7 A;  2KSS A;  5ECA A;  3KXT A;  4OMQ A;  1FMV A;  1PC0 A;  3CBM A;  1YJ9 A;  2HMA A;  1WPY A;  1QWF A;  3I56 T;  1VQO A;  3A8L B;  2BUD A;  1QKX A;  1D0X A;  5GAN 7;  3UF4 A;  3OBY A;  1TWB A;  4XTY A;  2A36 A;  3LYI A;  2RI5 A;  4D8D A;  1MUZ A;  2GFA A;  4XK8 E;  3PVQ A;  1YI2 A;  2X9H A;  2P4T A;  2Y90 A;  2DEU A;  4EMK B;  3VV0 A;  1O75 A;  3G71 A;  2R5M A;  4FYW B;  1TOV A;  1IHW A;  1R0B G;  5FWC A;  4II1 A;  2XDB A;  1JXM A;  5CKE A;  3NTH A;  4VUB A;  5FU6 C;  3GNF B;  1QVG P;  3G1J A;  5A0L A;  1KC8 U;  1ZQ1 A;  2XDD A;  5CKB A;  2LTO A;  2MPX C;  3TSW A;  1D0Y A;  2LCL A;  2RB6 A;  3TEE A;  1HD3 A;  4O5V A;  4DEY A;  4NL2 A;  3CCL Q;  4E7H A;  1WHH A;  4LE9 A;  2L3R A;  2IPO B;  3M0R A;  4K11 A;  3DKM A;  2MWO A;  3SB2 A;  3C12 A;  4A4G A;  2AHJ B;  1NLO C;  4A4E A;  1T3S A;  1PM3 A;  3CD6 Q;  1KQS P;  4QVC A;  3H6Z A;  4FU6 A;  4ZN1 A;  2COZ A;  5D6X A;  3A8O B;  3THK A;  1M1K U;  1M1K R;  2DD4 A;  1YJN Q;  1AWX A;  2VGM A;  4JS5 A;  1AZG B;  1WJQ A;  4OF1 A;  2K5I A;  2E6N A;  1VQ6 T;  3QSU A;  2FRW A;  2LCS A;  3M0S A;  4BE0 A;  3JCM P;  4LDY A;  1JJ2 A;  4XTZ A;  2O31 A;  3JCM e;  2E4H A;  3HRT A;  4QW2 A;  1K8A C;  3MKD A;  5FLX E;  4EIK A;  4A53 A;  2F2X A;  1BU1 A;  2F5T X;  1LPL A;  1JU5 C;  4M78 B;  5FRN A;  1I8F A;  3CC4 Q;  4Y91 A;  2BE9 B;  2LT1 A;  3C4S A;  3CCR T;  7AT1 B;  2DVE A;  1YIJ A;  3A98 A;  5LJ5 g;  1Q7Y C;  5GAM d;  1M27 C;  2HL5 C;  5C6S A;  3CCE T;  1G83 A;  1FMK A;  4ZGE B;  3S3N A;  1JQQ A;  1VQ5 A;  1OOT A;  1D3B A;  2CT4 A;  1YP5 A;  2KYB A;  1ZX6 A;  1H64 1;  1U1S A;  2DNU A;  4PJO F;  2P0K A;  2RQU A;  4LNP A;  1KFZ A;  3SWN C;  1WHK A;  1I1J A;  3J81 E;  3EGX B;  2DKG A;  3CCV T;  1WLP B;  1SRL A;  2AT1 B;  2ED0 A;  3GF5 A;  3PIO A;  1KQ1 A;  2HKQ B;  2ZPE B;  3FLG A;  3A1P A;  5LJ3 h;  2DPP B;  5CK9 A;  2QQB A;  1NE8 A;  3FDR A;  1TTH B;  2NUP B;  2O9V A;  1QVF A;  2IG0 A;  1VQ7 A;  4LDU A;  1SEM A;  2RJE A;  4PNO A;  3WVE B;  2HQX A;  1B07 A;  1VA7 A;  3HFO A;  3OS1 A;  2X3X D; 
#chains in the Genus database with same CATH homology
 2LX7 A;  4AFU C;  2B86 A;  2FPD A;  2CH4 A;  3SEM A;  3EGU A;  4KRT A;  2RQT A;  1WXU A;  1M3C A;  2HCK A;  2O2O A;  2AKK A;  2M51 A;  1KIK A;  2RPN A;  4J9I A;  2K9G A;  1GL5 A;  3IQL A;  1K0X A;  1HJD A;  3M0Q A;  4R0K A;  1PKT A;  2YDL A;  3VRZ A;  1ZBJ A;  3QWX X;  2GNC A;  1ARK A;  2KR3 A;  4IIM A;  2IIM A;  2LNH B;  4ZNX A;  5FWB A;  2H8H A;  2OAW A;  2EKH A;  1AZE A;  1RLQ C;  2AZS A;  4IIO A;  1JEG A;  1ABQ A;  3H41 A;  3REA B;  4AG1 C;  2JW4 A;  1K76 A;  3NMZ C;  2EVR A;  1OEB A;  3H0F A;  4F17 A;  2FRY A;  2BTT A;  1NEB A;  2KBT A;  3R6N A;  1MV0 B;  2LQW A;  3EHR A;  2KT8 A;  1ZLM A;  2PZ1 A;  3U23 A;  2D8J A;  1PKS A;  2JXB A;  3VS3 A;  1GCQ C;  2EPD A;  1E7O A;  2DLP A;  2A08 A;  2I0N A;  2A37 A;  1MV3 A;  1T0J A;  2A28 A;  4JPB W;  1V1C A;  2OI3 A;  2J6F A;  3VS4 A;  2BZX A;  2DE0 X;  2DVJ A;  2EGC A;  2JM9 A;  4FSS A;  2FPF A;  2K6D A;  2DL4 A;  1ZUU A;  2EGA A;  2D1X A;  3VS0 A;  1Z9Z A;  2JTE A;  2L3S A;  1TUD A;  2LJ3 A;  3NHN A;  4RTT A;  2DIL A;  1EFN A;  2GQI A;  4RTX A;  1K0S A;  1PNJ A;  2J06 A;  1GFC A;  1X2K A;  1QLY A;  1Z9Q A;  2EGE A;  4JJC A;  2RNA A;  5FW9 A;  4J9E A;  1X2Q A;  2RQR A;  1M3B A;  1AWO A;  4ORZ A;  2V1Q A;  3PE0 A;  2C0O A;  1T0H A;  4AFS C;  2ROL A;  1K1Z A;  2DL3 A;  1CKA A;  4J9D A;  4JZ4 A;  4OMO A;  1WX6 A;  1X6G A;  2K7A A;  1YCS B;  2DM1 A;  2PTK A;  1BBZ A;  3VS1 A;  4F14 A;  2MIO A;  1JXO A;  1UJ0 A;  3VS7 A;  4CC2 A;  3EG3 A;  4GLM A;  1UE9 A;  2P4R A;  4E6R A;  1AVZ C;  2KRS A;  1OPL A;  2O9S A;  4J9C A;  2V1R A;  4RTY A;  2D8H A;  2L3P A;  4HVU A;  3UA6 A;  4GBQ A;  1LCK A;  4JZ3 A;  1K9A A;  3UA7 A;  3NPF A;  2NUZ A;  1GRI A;  1H3H A;  1M8M A;  1VYV A;  5IXF A;  2GTJ A;  5IH2 A;  4RTZ A;  2XMF A;  1NG2 A;  4HVW A;  4J9H A;  1Y0M A;  2QDL A;  1W70 A;  1H92 A;  1CKB A;  2J05 A;  1Y57 A;  1G2B A;  1T3L A;  2LZ6 B;  2GTO A;  1OV3 A;  1B3Q A;  1JO8 A;  2VWF A;  4AG2 C;  2C0T A;  4Z89 A;  2LMJ A;  2DA9 A;  2CDT A;  2CH4 W;  2X3W D;  4CC7 A;  1BK2 A;  3EHQ A;  2AK5 A;  1AOJ A;  2DL5 A;  4X1V A;  1WXB A;  3ZL7 C;  1WDX A;  2JM8 A;  3O5Z A;  1K4U S;  2L0A A;  4AFZ C;  2DBM A;  2YUQ A;  2RQV A;  2EYX A;  2ENM A;  1NM7 A;  3M0T A;  1S1N A;  2LJ1 A;  2FO0 A;  2O88 A;  1GBR A;  1WXT A;  1QKW A;  1XOV A;  3REB B;  3I5S A;  4OMP A;  4HVV A;  1ABO A;  4RUG A;  4D8K A;  2MOX A;  1UJY A;  2PNI A;  2SRC A;  5IHN A;  1VYU A;  4J9B A;  3RBB B;  2K79 A;  4WCI A;  1PHT A;  2KXD A;  1QWE A;  1M3A A;  1YN8 A;  1UUE A;  2CRE A;  5EC7 A;  5GJW B;  1AWJ A;  2K3B A;  2EYZ A;  1KJW A;  2YUP A;  2VKN A;  4LN2 A;  2JMC A;  3TVT A;  3ULR B;  4J9F A;  5IHI A;  2EBP A;  2J7I A;  3KFV A;  1NYG A;  1IO6 A;  2GGR A;  1SRM A;  2LQN A;  2CUB A;  2JT4 A;  2DYB A;  3VS6 A;  4JJB A;  1YNZ A;  2AKL A;  3H0H A;  1SHF A;  2SEM A;  2KXC A;  2KRO A;  1TUC A;  1X6B A;  1SSH A;  1SHG A;  2OJ2 A;  1W6X A;  3PVL A;  2F2V A;  2DMO A;  3CQT A;  1UDL A;  2RQW A;  3I9Q A;  3QWY A;  1RUW A;  1WYX A;  1NLP C;  4DEX A;  1UEC A;  1KSW A;  4OMM A;  1U5S A;  5ECA A;  4OMQ A;  1UGV A;  1E6H A;  2BZY A;  1QWF A;  2F2W A;  3I5R A;  5GJV B;  1QKX A;  1X69 A;  4RTW A;  3UF4 A;  2JS0 A;  2GBQ A;  3NGP A;  1BB9 A;  4M4Z A;  2A36 A;  2RF0 A;  4LUE A;  4D8D A;  1MUZ A;  2G6F X;  3EG0 A;  3PVQ A;  4Z88 A;  2W0Z A;  2HEQ A;  1WI7 A;  1RLP C;  2YUN A;  1YWO A;  2D0N A;  4QT7 A;  2JMA A;  2ED1 A;  3LH5 A;  2DRK A;  2RN8 A;  2DX1 A;  3I35 A;  5FWC A;  1JXM A;  1W1F A;  2BZ8 A;  3TSZ A;  2C0I A;  2JS2 A;  4HCK A;  2LP5 A;  4Z8A A;  4F16 A;  1H8K A;  1NEG A;  2HDA A;  1U3O A;  1UFF A;  3SHW A;  3TSW A;  1PRL C;  1I07 A;  2KE9 A;  1ZUY A;  1HD3 A;  2KNB B;  2YUO A;  2KGT A;  4DEY A;  2M0Y A;  5IXB A;  2DJQ A;  3VRY A;  4CC4 B;  2EYY A;  2K2M A;  2E5K A;  5L23 A;  1UG1 A;  4LE9 A;  1GCP A;  2AZV A;  5HCK A;  2FPE A;  2KYM A;  1M30 A;  3EG2 A;  3M0R A;  4K11 A;  1GBQ A;  2ESW A;  1QCF A;  3RNJ A;  1A0N B;  1X27 A;  2LJ0 A;  2DL8 A;  1AD5 A;  1GFD A;  2J6K A;  1NLO C;  4CC3 A;  1T3S A;  1YWP A;  3VS5 A;  2CT3 A;  2KT1 A;  4RTU A;  3THK A;  2MCN A;  3H0I A;  2NWM A;  4RTV A;  1AWX A;  2J6O A;  1AZG B;  2W10 A;  2CSI A;  4J9G A;  2FRW A;  2LCS A;  5I11 A;  3M0S A;  1AEY A;  4LUD A;  1UTI A;  1VYT A;  2HBW A;  2O31 A;  1I0C A;  2CSQ A;  4JJD A;  1TG0 A;  4EIK A;  1U06 A;  1N5Z A;  1X43 A;  2F2X A;  1BU1 A;  4OML A;  1PRM C;  1JU5 C;  1FYN A;  3FJ5 A;  2KRM A;  1WIE A;  5IHK A;  3A98 A;  2DRM A;  2L3Q A;  1GCQ A;  4Y92 A;  1M27 C;  1G83 A;  1UHC A;  1FMK A;  1NYF A;  2ROT A;  1JQQ A;  2VVK A;  1ZSG A;  1OOT A;  1AWW A;  2CT4 A;  2DF6 A;  3EG1 A;  4HXJ A;  3VS2 A;  1YP5 A;  1ZX6 A;  2ABL A;  1SPK A;  2KYB A;  4A63 B;  2DNU A;  2RQU A;  4LNP A;  1KFZ A;  2EYW A;  3GBQ A;  1I1J A;  2YT6 A;  4OMN A;  1CSK A;  2ECZ A;  2KRN A;  1WA7 A;  1WLP B;  2FEI A;  1UHF A;  2DBK A;  3JV3 A;  1E6G A;  2RMO A;  1OPK A;  1SRL A;  4AFQ C;  3UAT A;  2HSP A;  2ED0 A;  1RI9 A;  2L2P A;  5I22 A;  2EW3 A;  2O9V A;  1SEM A;  2KEA A;  2DL7 A;  3C0C A;  1B07 A;  1VA7 A;  3M0U A;  2CUD A;  2EQI A;  2FG0 A;  1ZUK A;  3M0P A;  2YSQ A;  1J3T A;  1WFW A;  4ESR A;  2X3X D;  1PWT A;  1HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...