2P4RA

Structural basis for a novel interaction between aip4 and beta-pix
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2p4rA00
2J6OA 2FO0A 2FRYA 1YNZA 1UJ0A 1PKSA 1TG0A 1IO6A 2LQNA 4AFZC 4JJCA 1HJDA 3UA6A 2F2VA 2IIMA 4RTTA 3EG1A 2K2MA 2VWFA 2KBTA 3VS4A 2DBKA 4DEYA 3PVQA 1OOTA 2RNAA 1W6XA 4Z89A 1NYFA 3I5SA 3RNJA 2KNBB 4HVUA 5FW9A 2D1XA 1WI7A 2OI3A 3M0UA 5GJWB 1X6GA 1SRMA 2LJ0A 1QCFA 4J9DA 3ZL7C 2EYXA 2GGRA 1ZBJA 1TUDA 2RQVA 2K7AA 2EGAA 2ESWA 3QWYA 4J9FA 5L23A 5I22A 4J9IA 4ZNXA 2O9VA 4RUGA 3UA7A 2EBPA 3H0FA 4LNPA 2DILA 1QLYA 2YSQA 3LH5A 1I07A 1NLPC 2DL4A 1SHFA 4HCKA 2O88A 2LX7A 1Z9QA 3A98A 2SRCA 1WX6A 2RF0A 4F17A 1K9AA 1GCPA 1E6HA 2ROTA 1U5SA 2K3BA 1SHGA 1QKWA 3I5RA 4D8KA 4HXJA 1NEBA 1UHFA 1RLPC 2K79A 2D8HA 2DRMA 1AVZC 1OPLA 2HEQA 2KGTA 1MV3A 2GQIA 4IIOA 2GBQA 1M3BA 1YP5A 3VRZA 5IXBA 5FWBA 1UECA 2FRWA 2F2XA 2AZSA 3M0TA 4JPBW 1K0SA 1X2QA 4IIMA 3M0QA 1B07A 2KRMA 3JV3A 1H8KA 1SSHA 2CDTA 1I1JA 5IXFA 2M51A 2J06A 1K0XA 1AZGB 2KYMA 4AFSC 1N5ZA 4AG2C 5HCKA 4Z8AA 1QKXA 1NLOC 1AWJA 1NYGA 2YUNA 4J9EA 1M27C 2LZ6B 2L0AA 3VRYA 1KFZA 1UHCA 3EGUA 4AFQC 1GRIA 2GTOA 1UFFA 3ULRB 2DLPA 3QWXX 3U23A 1WYXA 1EFNA 1M30A 3FJ5A 2DL3A 1QWFA 3UF4A 1AEYA 1ZSGA 2EKHA 4CC4B 1AD5A 2L2PA 4GBQA 1G2BA 1WDXA 3NPFA 1NEGA 3M0PA 4J9BA 2X3WD 1NM7A 5IH2A 1U06A 1ZX6A 4X1VA 2XMFA 1X6BA 4RTWA 2J6FA 1W1FA 2PNIA 1BB9A 2I0NA 4JZ3A 1KIKA 5FWCA 1JO8A 1VYUA 4LE9A 1J3TA 2FPFA 2DJQA 5IHKA 4D8DA 2KRSA 5I11A 1WXTA 1UTIA 2EW3A 2KRNA 1PHTA 3RBBB 2JW4A 1YWPA 2H8HA 4J9CA 2AK5A 3VS7A 1QWEA 2RQUA 2MIOA 3M0RA 2QDLA 2RQRA 4WCIA 2EPDA 2NWMA 4CC7A 1RI9A 2OAWA 2EGEA 2K9GA 2X3XD 2FEIA 2JXBA 1H3HA 2FPDA 4J9GA 4JZ4A 1MV0B 4JJDA 2HDAA 3THKA 2J6KA 1PKTA 1WIEA 3EG0A 1WLPB 2HSPA 2FG0A 1H92A 2LNHB 4HVWA 4E6RA 1AOJA 3H0IA 4OMMA 1WXUA 2J05A 4HVVA 4OMLA 2A37A 1AWWA 4RTYA 2C0IA 4JJBA 1KJWA 1UJYA 1T3LA 3VS1A 3CQTA 2BTTA 1UG1A 2DRKA 4CC2A 2ED1A 4DEXA 2L3SA 1VYVA 2EYYA 1HD3A 4F14A 4CC3A 1GFCA 1ABQA 2B86A 2PZ1A 1PWTA 2JTEA 2KT8A 2MCNA 1JXOA 1BK2A 1K1ZA 3EHRA 2OJ2A 2LCSA 1T0JA 4QT7A 1Y0MA 2EVRA 2W10A 4M4ZA 2BZYA 4OMNA 1M3CA 3EHQA 2DE0X 3TVTA 1BBZA 1X27A 3REBB 2LJ3A 4OMQA 1V1CA 4K11A 2DNUA 1JXMA 1XOVA 1SRLA 4J9HA 3TSWA 1Z9ZA 2KYBA 2EGCA 2MOXA 1X2KA 1HSQA 2ROLA 2V1QA 1VYTA 2W0ZA 3KFVA 2F2WA 1K4US 2O9SA 2DF6A 1K76A 1KSWA 3REAB 2L3PA 4LUEA 2RQWA 4RTVA 2ABLA 2FPEA 1UUEA 1VA7A 3UATA 1X43A 1CKBA 4GLMA 1T3SA 2G6FX 1ZUKA 2KE9A 4F16A 2KT1A 2YUOA 2JMCA 2DM1A 2GNCA 2HCKA 1GCQA 2P4RA 3NHNA 2PTKA 4R0KA 3PVLA 2RQTA 3PE0A 2DVJA 4AFUC 1WA7A 2GTJA 2CT4A 2DMOA 5EC7A 1T0HA 2AKLA 1G83A 4Z88A 2ECZA 3SHWA 2KXCA 2HBWA 3VS0A 5IHNA 4AG1C 1WFWA 2E5KA 2LMJA 1FYNA 1AZEA 4RTZA 2M0YA 2ENMA 2CSIA 4ESRA 2JM9A 2DYBA 3VS6A 2A08A 1OEBA 1JQQA 2CT3A 1B3QA 2JS0A 3EG3A 1GL5A 2JS2A 2A28A 2CUDA 2YDLA 2JM8A 2VVKA 2DX1A 3NMZC 4Y92A 5IHIA 1LCKA 3H41A 1W70A 4ORZA 1YN8A 2KR3A 1RLQC 3SEMA 4A63B 1UE9A 3H0HA 2ED0A 1MUZA 2CUBA 2DL8A 2A36A 5GJVB 1OPKA 4RTUA 1U3OA 1GBQA 2YT6A 2LQWA 1SPKA 2DL5A 2KEAA 1Y57A 2BZ8A 2SEMA 2K6DA 3I35A 3R6NA 3VS5A 1PRLC 3C0CA 2O2OA 2DBMA 1CSKA 3TSZA 2D8JA 2VKNA 1RUWA 1BU1A 2LP5A 4KRTA 1E6GA 1PRMC 1X69A 1NG2A 2KROA 1ZUYA 3NGPA 1UGVA 2CSQA 2V1RA 1CKAA 1TUCA 1JEGA 2JMAA 4LN2A 3GBQA 1YCSB 2L3QA 2DL7A 1JU5C 2J7IA 2NUZA 2C0TA 4RTXA 2RN8A 3EG2A 2C0OA 4OMOA 4OMPA 2AZVA 1AWXA 1WXBA 2YUQA 2CREA 1GFDA 1M3AA 1GCQC 1OV3A 2RMOA 1I0CA 1PNJA 3IQLA 4LUDA 2RPNA 2YUPA 2JT4A 1YWOA 2AKKA 4EIKA 2LJ1A 1ARKA 2EYWA 3VS2A 1SEMA 2EYZA 1E7OA 1UDLA 3O5ZA 5ECAA 1A0NB 3I9QA 4FSSA 2CH4W 1AWOA 2CH4A 1ABOA 1ZUUA 2DA9A 3M0SA 3VS3A 1FMKA 2EQIA 1M8MA 2KXDA 1ZLMA 1GBRA 2BZXA 1S1NA 2D0NA 2O31A
chains in the Genus database with same CATH superfamily
4L59A 2OAUA 2HKNA 4XTWA 1TG0A 5LJ3d 1QVFP 1VQOQ 3V7SA 3UA6A 3MO8A 3RMQA 1VQ9Q 2VWFA 5KYUA 3VS4A 2DBKA 1Q82U 4C5HA 1LVKA 3PVQA 4F7UA 5A0LA 4QVCA 1RACB 2XU8A 3CC2A 3OS5A 1NYFA 4XTYA 5GAN2 5FW9A 3E9FA 3MPUB 3S3MA 2COYA 3HTRA 2OI3A 3M0UA 1QCFA 2XDBA 1MMGA 1WZOA 2DXUA 4MMLA 1TUDA 3OYDA 2FB7A 2COWA 3QWYA 5L23A 4J9IA 3TQ7P 3CXCA 3H0FA 2RJEA 3L2QA 5CKHA 4DBQA 3LH5A 4N4HA 1NLPC 2RI5A 3CD6A 2DZCA 3M57A 2K5LA 5DM7R 4F17A 4NL2A 4IURA 4TVRA 1GCPA 3EGXB 3G71A 2CP3A 1VQLQ 3V8KA 5LJ5j 3WXMB 5GAOm 3OYKA 2M16A 2H3EB 5CKFA 1RLPC 4BY6C 3R6OA 4M78A 2DRMA 1AVZC 2HEQA 2JNGA 1M1FA 1MV3A 3H9NA 1M3BA 3HKSA 3MP8A 1VQMQ 2F2XA 1TOVA 1R8OB 1WHGA 4JPBW 3EGDA 3LGFA 4IIMA 5CO7A 3JV3A 4QW2A 1BKBA 2J06A 1AZGB 4B9XA 2G3RA 5GMKi 5FRNA 3HPWA 2RJDA 4EMKA 3S3OA 1VQ6A 1SF9A 1NLOC 2JUFA 1AWJA 3CC2T 2VXFA 3QXEB 1JJ2A 3SWNA 1OYXA 1M8VA 3HL8A 2D0QB 3VRYA 1KFZA 2RD1A 4B6MA 2CP6A 1ZSZB 3V7CA 4M77C 1QQJA 3RIRA 3ULRB 2E3IA 3QWXX 3OW2S 1KQSP 1KQ1A 1D1CA 1M30A 1M9SA 4BE2A 2QEXT 2EKHA 4CC4B 2M0OA 3NPFA 2BUDA 1FWZA 5IH2A 4KBMB 1ZX6A 2KK4A 3I55A 4C92F 3CPWS 5IT9E 2K3XA 3CCJA 2J6FA 2M1HA 2NUPB 2BIVA 2MWPA 2I0NA 4JZ3A 5CKEA 6AT1B 1KIKA 4X9DA 2E1HA 3VYHB 2LX9A 1J3TA 5IHKA 3BDUA 4D8DA 1QVGS 2YWWA 3EFSA 2KRNA 3CCUQ 1SG5A 3QIIA 3QG1A 4MZMA 3A5ZB 1D0YA 4C92E 3QSUA 2H8HA 4F04B 1ACMB 1VQ7Q 2QAZA 2RQUA 3M0RA 1UEBA 2RQRA 4WCIA 5HKCA 2NWMA 1M1KR 2IPOB 2Y90A 1PG5B 2OAWA 1KQ2A 2EGEA 4HCCA 4LDVA 2DIGA 4XTXA 5GAMf 3CPWP 3G6EA 3CCMQ 3MHXA 4ZGDB 3EG9A 2A0FB 5KYWB 4M78D 4E6RA 1AOJA 3H0IA 2HSEB 3CCET 4M7AE 2HNIA 1WXUA 2J05A 3KUFA 1AWWA 4RTYA 1KJWA 2YLCA 5I2MA 1IHWA 1MHNA 4BI3A 2LRQA 4J7IA 2RHIA 1ZHIA 3CQTA 3SDZA 1VQMA 1QVFS 3VYGA 3OYFA 1UG1A 2DRKA 1RI0A 4DEXA 1VYVA 2DERA 1HD3A 2QG9B 4F14A 5FU6B 4M7DD 2FL7A 2HAXA 4C8QB 4CC3A 2CZ0B 5KE2A 2PZ1A 1PWTA 2JTEA 2LNVA 2KT8A 1NZ9A 3EHRA 3CEYA 2L3RA 2XK0A 2K57A 4DBHA 4OVAA 5LJ3j 2ZGWA 3KBGA 1BBZA 1X27A 3REBB 1QMCA 4OMQA 2P84A 2XHCA 3CC7Q 1C6VX 1Q86C 1VQKQ 1JXMA 1WHJA 4PFPA 1M2VA 4LD9K 2KAFA 1I5LA 1LPLA 2HMAA 1YHQQ 2CYZB 3A8GB 4RCCA 1G3YA 3CD6Q 2FVUA 2PVDB 2PVGB 4FIBA 2W0ZA 3KFVA 1K4US 2DF6A 2XDPA 4EPCA 4OB1B 1KSWA 1EZZB 1B7TA 5GMKh 1VQOA 3F70A 2L3PA 3KXTA 4RTVA 5J3BA 2FPEA 1VA7A 4ELZC 4FYWB 1T3SA 5GMKj 5GMKl 3UT1A 3I56Q 2KE9A 3CCVT 4F16A 4DBRA 1Q81C 2P4RA 3LWHA 2PTKA 3PVLA 1YI2A 3CCUA 2RA2A 2DVJA 3OSSC 4KGZB 3JAME 2KDSA 4C0FA 2DMOA 1X75C 3INZA 3O8VA 2CKKA 3L2UA 1T0HA 4Z88A 1YCYA 4A4HA 2X4WA 3QZ5B 4N0AC 3CC4Q 4AMCA 1S72Q 2LMJA 1FYNA 4M78E 2M0YA 1WJQA 5KYYB 2JM9A 1RAGB 5J26A 2DYBA 1IREB 1OEBA 4Y91A 4PJOB 2ZPGB 1KK7A 3DLLA 2RK2A 2OTJA 4JRIA 4DA4A 4ZN3A 2CUDA 2VVKA 4Y92A 3SWNB 5IHIA 4C92D 3G4SQ 2QA4T 3VJPA 1YHQT 2OTLA 4ORZA 1YN8A 2KR3A 1RLQC 5GAN4 4M75E 2LQKA 2ED0A 3FC3A 2DL8A 3LWIA 2A36A 4RMOA 2YHTA 5CAIA 3NFCA 2RJFA 4LDYA 3MEAA 2K3YA 2LQWA 3TU4K 1LJOA 5GANf 1YJWT 1Y57A 1M2VB 3PNWC 3GIBA 2SEMA 2QQRA 1XTDA 1VQMT 3VS5A 1PRLC 1WHLA 2VYTA 4C8QG 4FYYB 2DBMA 2FYKA 3RKYA 2DTHA 1RUWA 1BU1A 2LP5A 2E64A 3G7ZA 3NGPA 1CKAA 1JEGA 4LN2A 1YCSB 4N0AA 3QO3A 1VQLT 2C0TA 2RN8A 2CP5A 1YFNA 3EG2A 3EAEA 3M59A 1KC8C 9ATCB 4E7JA 2YUQA 3FDRA 1OV3A 1I0CA 1PNJA 2HL5C 8ATCB 1LNXA 3JCMV 1IXDA 1IRXA 3VS2A 1SEMA 3MJXA 4PJLA 4M7AG 3FEOA 2E5QA 3L2RA 3OA6A 1UDLA 3O5ZA 1A0NB 4Y28E 3CC2Q 4BB7A 3CCMT 2DEQA 5LJ3f 2E6ZA 3QPHA 2VGMA 4R56A 4P5NA 2VUBA 3OBWA 1GBRA 3CC7A 2D0NA 1FXXA 3CCUT 5GMKe 2MAMA 2FRYA 1KD1R 1YNZA 1PKSA 2LQNA 4AFZC 4JJCA 2F2VA 1K8AR 3EG1A 4CRIA 4DEYA 2GFUA 2XD0A 3OYYA 1XNIA 1OOTA 1VQKA 2FZCB 3C95A 5EG2A 1G3WA 1W6XA 5GAN8 3T9NA 2M02A 4HVUA 2D1XA 3CPFA 2ZZDA 1SRMA 2HKQB 1R0BG 1M4ZA 2GGRA 8AT1B 1YJWA 4C8QE 4E7ZA 5I22A 3P8HA 4RUGA 2DILA 3J7AF 4LDXA 1UGPB 2MYSA 1YJNT 2QQAA 1Z9QA 2RF0A 2XG8D 3PIOA 1OZ2A 1K9AA 3M4GA 3M58A 1Q81R 2X4XA 4D8KA 4HXJA 2Y4XA 2R57A 1UHFA 4XQ3A 1BYMA 4Z02A 2KGTA 3D7SB 1XJWB 2GFAA 3MP6A 5IXBA 1MMNA 5FWBA 1YJ9A 5GAN3 1R77A 3CC4A 2KVQG 3UWNA 1Q86U 2MF2A 4BD3A 1JJ2S 1K0SA 3WVEB 1H8KA 1SSHA 2CDTA 3CBOA 3QDFA 1N5ZA 4O6JA 5AT1B 1FMWA 1YITT 4M78C 2EJFA 5KYYA 4FCYA 1YITQ 4M7DE 1D1AA 4J9EA 4Q5WA 1BI0A 5L8RE 1M1KC 1Q82R 4XK8E 1GRIA 1K73C 4A4FA 3JCMg 1IGQA 1RAFB 1VQ4T 1WYXA 3CCQT 1KHIA 4GLKA 1EFNA 3FJ5A 2DETA 1QWFA 3I56A 3UF4A 1N8RU 2EQKA 1R0CB 1VQ6Q 3MEWA 5LL6S 1G2BA 3CPWA 4PLIA 3M0PA 2X3WD 4M78G 2YRCA 2YXYA 2ZPEB 2VXEA 3MKDA 4FW1A 4M77E 2NUTA 2RHXA 5KYUB 1YJNQ 3VU3C 4PKCC 4IUVA 3QJYA 2PNIA 3BFMA 1YJNA 4JDSA 2FPFA 2KRSA 3M4YA 1WXTA 4MMKA 1UTIA 3PTAA 3VV0A 1N6AA 1HK9A 4XU1A 3RBBB 1YWPA 3BY7A 1QWEA 1M90U 3OYIA 4M7AC 2HD0A 3CCRA 4XTVA 5CR2A 3JCMJ 3JCMP 4CC7A 3JCMf 2RB6A 4ELYC 3CCJQ 3QYHB 3GP8A 3I55Q 3FIFA 1I4K1 4KULA 2X3XD 3RUXA 4A4GA 2NYSA 4J9GA 4JZ4A 3LX7A 2HDAA 5GANe 1Q86R 3THKA 5CK9A 1PKTA 1WIEA 2RHYA 4C5EA 4NS5A 2HSPA 2FG0A 2MI6A 2WSEE 4F7UE 1UGRB 3CMEA 3GNGA 2C0IA 1ZSZC 2FHDA 2E41A 5FU7C 3DKMA 1C0MA 1NJIC 3P8BB 4CC2A 2ED1A 4JRKA 3UPUA 2CGHA 2EYYA 2E65A 1RAEB 3BE3A 5LJ5e 1UGQB 1GFCA 3CBMA 3OS1A 4JLIA 2B86A 5LJ3e 4FT4A 4JS5A 2QDYB 1YIJT 1BK2A 1YHQA 2LCSA 2A3LA 1D1BA 1N9RA 2HQXA 4QT7A 4PJOA 5I2SA 1VQPA 2RHUA 1VUBA 4KH0B 1MNEA 1RAHB 4OMNA 1VQ5A 1JB0E 3A8HB 1I8FA 2EQJA 4M77F 4QQDA 1V1CA 2COZA 3QZ9B 4K11A 2DNUA 4IKFA 3OYBA 1YI2Q 2EFIA 3OB9A 3CCSA 2LC4A 1KD1U 1VQ5Q 3GOXA 2IG0A 4OGEA 1Z9ZA 2B8AA 3NTIA 2IVWA 2EGCA 3P8DA 3QBYA 2XDDA 3M56A 5A0DA 2K5IA 1X6OA 3DB4A 3CMET 4HA8A 2LT4A 1K76A 2EIFA 1N27A 4M75F 1TH7A 4PFOA 4M7DF 2LVMA 3RKXA 3OS2A 2RQWA 4E7LA 3JCMe 5DLOA 3PMTA 1UUEA 2RM4A 2DEUA 2MMPA 4OMFB 3G6ET 2G6FX 5GAOr 4BI8B 2HCKA 1KG1A 2F5KA 4GY5A 1GCQA 3LLRA 1KQSS 3NHNA 1OX9A 4ANJA 3L2ZA 2X4JA 2GTJA 3TREA 2CT4A 1QCNA 1QVPA 1VQ4Q 5EC7A 2OTJT 2ECZA 5GAOq 4M7DC 3HFOA 3SHWA 3CCRT 4C5IA 2HBWA 3VS0A 3TCJA 5IN1A 4RG8A 4PJNA 4FYVB 1D3BB 3SWNC 2ENMA 2CSIA 3V8JA 2QEXQ 2DPPB 3JRZA 2QXFA 3VS6A 4C0DB 4LD6A 1WPYA 2CP2A 2CZ7B 4OGCA 1JQQA 1B3QA 2CT3A 2JS0A 4IUTA 4PJMA 1KC8R 2JS2A 1M2OA 3NMZC 4LDWA 5GAMh 3H41A 1I81A 1K73R 1NBEB 3C4SA 4EMKB 4E7HA 3FB9A 3H0HA 2CUBA 5GJVB 4OP0A 3FRNA 2CP0A 2RHZA 2NUTB 1OZ3A 1SPKA 2DL5A 2KEAA 2BZ8A 4PNOA 1EX4A 3C0CA 2D8JA 4FL6A 4KT0E 1E6GA 1P92A 1VIEA 2ZPHB 1UGVA 3CC4T 3L42A 4EMGA 4NL3A 3GBQA 2L3QA 2DL7A 4M75B 4J5YA 1JU5C 1WHMA 2E12A 2C0OA 2RI3A 3JB9I 1PSFA 2ZPFB 1VQPT 3GF5A 2JTFA 3JB9D 3G71T 2RMOA 1B34A 3M54A 2HL3A 4LUDA 5GANg 1YIJA 3A8MB 2PU9B 2KMTA 4C8QC 3ER0A 4JJNK 4X34A 1MMDA 4QVDA 2VC8A 4DQ2A 1E7OA 5HK3A 2P0QA 3PFSA 1IZ6A 5ECAA 3NTHA 1AWOA 4FM4B 1VIFA 2DA9A 4XU3A 4RCBA 4KUDK 1ZLMA 2LCLA 4XAXB 4YTLA 5D6YA 4QVZA 2VASA 2YRDA 2WACA 4C8QF 2QEXA 1VQKT 1N9SA 1IO6A 3JCMb 1HJDA 4C8QA 4M77G 3HFNA 1VQ9A 3I5SA 4C92C 4C92B 4C0GA 3URGA 1K9MU 2KNBB 4E2FB 2F69A 4JS4A 1X6GA 2LJ0A 4J9DA 2V26A 2EQUA 3ZL7C 1WJRA 3HRUA 1ZBJA 5LJ5f 2K7AA 2EGAA 2ESWA 1H641 2L89A 4J9FA 2V8JA 1WQ7A 3V8LA 4J6WA 2ZPIB 3UA7A 2EBPA 4LNPA 2CS7A 2YSQA 1XQHA 1YIJQ 1YJ9T 1I07A 4ME7A 2BKDN 2QA4Q 1VQ5T 1WQWA 2O88A 2LX7A 1RAAB 2KY9A 2SRCA 1WX6A 2LDMA 2JJ9A 3Q1JA 1NJIU 2K2VA 4M75C 1W2BA 1U5SA 1SHGA 3I5RA 1O75A 2QGFB 4PLLA 1NEBA 2VV5A 3M55A 5KCHA 2D8HA 4JRQA 1YBYA 1YP5A 3VRZA 3HSBA 1UECA 2FRWA 3X25B 2AZSA 3CMAQ 1U1SA 3M0TA 1SSFA 3M0QA 1B07A 2KRMA 1VQNA 3EGXA 2LCCA 2M51A 2JVVA 4M7AA 4FU6A 1K0XA 2KYMA 4NOYA 1D0XA 4AG2C 4JLGA 2QQSA 1HYOA 1VQ9T 5HK0A 4C5GA 2VGNA 1O9SA 1NYGA 5C6SA 3EFOA 2LZ6B 3QKJA 2EJ9A 1G3TA 1MNDA 2ZAEA 1G8XA 4AFQC 5LJ3h 3MEUA 2GTOA 5GMKm 2DO3A 3U23A 3OYMA 1AEYA 1ZSGA 2WSCE 1K9MR 2OTJQ 2L2PA 1WDXA 1S72T 2OTLT 5IAYA 1NM7A 4MDXA 1U06A 2D9TA 4X1VA 1X01A 5C0MA 1NE8A 1ZSZA 1X6BA 4RTWA 5CIUA 2QI2A 3OY9A 1JO8A 1VYUA 4LE9A 1VQ7A 2L8DA 3ZEHA 1JJ2P 2DJQA 5I11A 2DJZA 4OB0B 5GAN7 4F7UB 2JW4A 1PM3A 1BI2A 1G3SA 3VS7A 5FU6C 2MIOA 2JZ2A 3EGDB 3QDRB 2QDLA 1U1TA 5CKBA 2EPDA 3BW1A 4J6XA 4M75G 1RI9A 2QQBA 5GAMd 4PK4A 3FLGA 1WJSA 1PSEA 3CCQA 1YI2T 3HRTA 3E2UA 2K9GA 2FEIA 2JXBA 4M75A 4PJOD 4JJDA 3OQ5A 3OYCA 2KQWA 1WGSA 1Y96A 4DOVA 4ZTFA 1WLPB 1H92A 2F1LA 2LNHB 4HT8A 3LYIA 4RKUE 2Z0WA 4OMMA 2LT1A 3PT9A 5D6XA 1NJIR 4OMLA 1VQ6T 5KH6A 4A53A 1T3LA 4B9WA 4HT9A 1IB8A 3X26B 3G71Q 1AHJB 2L3SA 4M77A 1I5OB 1UB4A 3CCSQ 5GAMg 2P0PA 3A8LB 3S3NA 3CCST 1TU0B 1K73U 2RJCA 4PJOF 3G4SA 4WF2A 2OTLQ 4BACA 1QCOA 1JXOA 1OQKA 3N5BB 1K1ZA 4BI4A 3CMAA 5LJ5g 2GQVA 3M5AA 4F7UG 3PMIA 4M4ZA 2AHJB 2O01E 1M3CA 3EHQA 2DE0X 2EYQA 2C06A 5GAMj 2QGGA 2LJ3A 1MGQA 4C92A 2DXCA 4VUBA 1OX8A 4KH1B 1ZA2B 1XOVA 1SRLA 3DLMA 3QHSA 4J9HA 2R58A 1Y96B 3JCMQ 2RK1A 2NLUA 2KYBA 2MOXA 4M77D 4PJJA 3JSCA 4KGVB 2ROLA 2V1QA 1VYTA 2F2WA 4QQ6A 2E6NA 2O9SA 4IUUA 2YRVA 4EDUA 1WHHA 2MK5A 3AHUA 3OS0A 4A4KA 5CQXA 1CKBA 2O4XB 1V29B 2V8IA 1ZUKA 4MZTA 1Y07A 1F1BB 3E19A 2YUOA 2JMCA 2GNCA 4E7IA 3UDCA 3CBPA 1VQOT 3C94A 1VQNQ 3RESA 5CKDA 2NUPA 2DD4A 1JBMA 3LGLA 3JB9F 4N4IA 5GAN5 5FU7B 1D09B 1JRIA 3CCMA 5IHNA 4M78F 2E5KA 2QK0A 1YJ9Q 1Q82C 4RTZA 4M78B 4ESRA 3OYEA 3ZBDA 1TUGB 4KGXB 3LH0A 3EG3A 3TEEA 5GANj 2BE7D 2BE9B 1TWBA 3X28B 2DX1A 1LCKA 1IGUA 4BDYA 1Q7YC 4A63B 2DIQA 2DZ9A 1W2BP 4C0ZA 1NPRA 1MUZA 1WHKA 2DTOA 3M9QA 1VQ4A 3S6WA 1OPKA 3H6ZA 1U3OA 1GBQA 2H3JA 4J83A 2O4XA 2YT6A 2P4TA 5KYNA 2XICA 2V8KA 2PUOB 2ZPBB 2K6DA 1PCXA 3I35A 1LOJA 2JOYA 3R6NA 2PUKB 2O2OA 3TSZA 2R5MA 1BI1A 2FZKB 1Y7XA 1UGSB 2DAQA 3GPLA 3PGGA 4KRTA 1X69A 2KROA 4KUIA 2QYZA 3OW2P 2CSQA 5DLQE 1MMAA 2JMAA 3EFRA 4J7FA 1Q7YR 2E70A 3FJPA 2NUZA 2F5TX 2HZYA 3OYNA 5M9OA 2QA4A 4OMPA 2AZVA 3QYGB 4IUQA 5LJ3g 5LJ5d 2CREA 1M3AA 2YLBA 3DB3A 2AIRB 3OMCA 2QASA 3CMAT 2RPNA 2YUPA 4EIKA 5A0GA 2LJ1A 1ARKA 1OI1A 4L5GA 4OB2B 2VB6A 2LTOA 4FSSA 2CH4W 2RI2A 2CH4A 4M75D 1ZUUA 3OYHA 2I2LA 3I55T 3M0SA 3J80E 1FMKA 2EQIA 4OB3B 2E10A 1M8MA 1M1GA 3EFOB 3CCEQ 2A7YA 1S1NA 5I21A 2O31A 3G6EQ 1NPPA 2J6OA 2FO0A 1UJ0A 2XI9A 3OSVA 3MP1A 3RR6A 2IIMA 4RTTA 1KD1C 2K2MA 2KBTA 4M7AD 4XU2A 1EIFA 3CCRQ 2RNAA 4ZGEB 4D6WA 4Z89A 2DFUA 2K5FA 3RNJA 1QP3A 1FX7A 3HHTB 5KE3A 2ATCB 3X20B 1WI7A 5GJWB 3JB9G 2M9UA 5FRMA 2EYXA 1K8AU 3JCMX 1VQNT 2RQVA 3SFMA 1Q81U 4OF1A 1TXQA 4ZNXA 2O9VA 4LDUA 2JN0A 1QLYA 4RG2A 5FLXE 4HCZA 4PFZA 4M7AF 2DL4A 1SHFA 4E47A 3RMSA 4HCKA 2K4YA 3A98A 4ZN1A 3VUBA 2X9HA 4E7KA 1E6HA 4J8OA 2ROTA 2K3BA 1QKWA 4C8QD 3RDVA 1W4SA 5GAOp 3ASKA 2K79A 4BY6B 2PQWA 1OPLA 2GQIA 4IIOA 1RL2A 5HY6A 2GBQA 4FT2A 2GF7A 2MWOA 3G4ST 5GAN6 3ME9A 3SD4A 1X2QA 3L2VA 4PJOC 1I1JA 4FYXB 5IXFA 1M5Q1 4AFSC 1BI3A 4C92G 5HCKA 2QTVA 4DOWA 2CZ1B 4Z8AA 1QW1A 1QKXA 1M90C 1D0ZA 4JUVA 1ZQ1A 3PIPA 2YUNA 3JB9H 1M27C 2L0AA 2QTXA 1UHCA 3VKIA 5D7UA 3EGUA 3M53A 2GCXA 3J81E 3H8ZA 1VQPQ 1UFFA 4HCBA 2DLPA 1QVFA 3WVDB 2DL3A 1SKUB 1D3BA 3CCQQ 4C0DC 1AD5A 1VQ8A 2QQ9A 4GBQA 5GAOn 1NEGA 5CCAA 4J9BA 2FZGB 2XIDA 4ATOA 5CQYA 2XMFA 1DJ7B 4XTUA 4XU0A 1W1FA 4PJOG 3CXCS 1PC0A 2JTMA 3LW5E 3QUIA 1BB9A 5FWCA 4BUGA 1IHVA 1Q95G 3OW2A 2EW3A 1PHTA 4PJOE 3C12A 3QJ6A 4J9CA 4J6YA 2AK5A 5KYXB 5LJ5h 4ZTJA 4FW2A 1M90R 3JCMW 3MCAB 1QVGA 4HKEA 1H3HA 3HRSA 2FPDA 4X9CA 3AT1B 1MV0B 3HP9A 3CMEQ 2J6KA 5DY9A 1OU8A 3EG0A 1TS9A 1RABB 4HVWA 2HBPA 3CCLQ 4ZGJB 1H3ZA 4HVVA 2A37A 4JJBA 3A8OB 3CCLA 4XTZA 1UJYA 3VS1A 1TTHB 2BTTA 1N8RC 4FSXA 3SB2A 1OU9A 1BCMA 2LQ8A 3A1PA 1ABQA 1QP2A 4QKUA 7AT1B 1RAIB 2MCNA 4A4EA 1FMVA 1M1KU 1OULA 1RADB 2OJ2A 4MZPA 5GAMe 1GXIE 1T0JA 4M7AB 1Y0MA 2EVRA 2W10A 5A2QE 2KSSA 5GANh 4M7DB 2BZYA 3L1AA 1BIBA 2DVEA 5GANd 3TVTA 4EMKC 2CZ6B 1YJWQ 2EQMA 1VQLA 4IUPA 1N8RR 1AT1B 1B34B 3TSWA 2DD5A 3CCJT 1X2KA 1HSQA 3L2WA 2DKGA 2DXTA 3JCMd 2HQHA 2D6FA 2X51A 3CCEA 3REAB 1U8RA 4LUEA 2ABLA 4AT1B 3OYGA 3CCVA 3UATA 3EG9B 4MDWA 1X43A 4QQGA 5KYWA 4GLMA 1ZA1B 2EWNA 2KT1A 2DM1A 2X4YA 1TSFA 5AYFA 1K8AC 4R0KA 2RQTA 3PE0A 3E9GA 4V2SA 4AFUC 1WA7A 2P0KA 2WSFE 3GNFB 2XKOC 4PL6A 4LXCA 2AKLA 1K9MC 1G83A 4M7DA 5FROA 3BDLA 2KXCA 1KC8U 3EH2A 4AG1C 1WFWA 2DK3A 3OBYA 1AZEA 4N4GA 2MPXC 5CVIA 3X24B 4BDZA 3MEVA 3RERA 2A08A 1V76A 5J39A 2E3HA 2PVOB 4EMHA 1PD0A 2X35A 1GL5A 1VQ8Q 2A28A 1KQSA 2YDLA 2JM8A 1VQ8T 3GLXA 4R55A 1S72A 1W70A 1W2BS 1HXDA 3SEMA 1UE9A 2DYIA 3OYLA 2HQEA 3OMGA 4BE1A 4RTUA 2EKOA 4DBFA 2EJGA 4E7SA 3CCVQ 1Y71A 3META 4A54A 5GAOl 1ZBXA 4II1A 1CSKA 4UC4A 3JB9J 5D6WA 1YITA 2AT1B 2VKNA 3ZFJA 3OYJA 1PRMC 1NG2A 1G5VA 1ZUYA 5KYXA 4O5VA 2DXBA 2E4HA 2L5QA 2V1RA 1TUCA 1WNLA 3EH1A 4M7DG 1C1AA 2J7IA 4RTXA 1BCOA 3G1JA 2DTIA 3JCMh 4JRPA 1QVGP 3OYAA 4OMOA 2KI7A 2R5AA 3RKWA 1AWXA 1WXBA 1GFDA 5KCOA 1VOMA 3CC7T 1GCQC 4M77B 2CP7A 3IQLA 2RO0A 3E1SA 2OX7A 4BE0A 2JT4A 1YWOA 2AKKA 2EAYA 3CD6T 4CI0C 2EYWA 1KHCA 2EYZA 1VQ7T 2RH2A 3V7RA 3VUZA 3I9QA 1Q7YU 3CXCP 4WTOB 1ABOA 1BIAA 3JCMc 3VS3A 4F7UF 2Y4YA 3CCLT 2ZCFB 2KXDA 2BZXA 1PD1A 4L6V5 3NTKA 3I56T
chains in the Genus database with same CATH topology
2J6OA 2FO0A 2FRYA 1YNZA 1UJ0A 1PKSA 1TG0A 1IO6A 2LQNA 4AFZC 4JJCA 1HJDA 3UA6A 2F2VA 2IIMA 4RTTA 3EG1A 2K2MA 2VWFA 2KBTA 3VS4A 2DBKA 4DEYA 3PVQA 1OOTA 2RNAA 1W6XA 4Z89A 1NYFA 3I5SA 3RNJA 2KNBB 4HVUA 5FW9A 2D1XA 1WI7A 2OI3A 3M0UA 5GJWB 1X6GA 1SRMA 2LJ0A 1QCFA 4J9DA 3ZL7C 2EYXA 2GGRA 1ZBJA 1TUDA 2RQVA 2K7AA 2EGAA 2ESWA 3QWYA 4J9FA 5L23A 5I22A 4J9IA 4ZNXA 2O9VA 4RUGA 3UA7A 2EBPA 3H0FA 4LNPA 2DILA 1QLYA 2YSQA 3LH5A 1I07A 1NLPC 2DL4A 1SHFA 4HCKA 2O88A 2LX7A 1Z9QA 3A98A 2SRCA 1WX6A 2RF0A 4F17A 1K9AA 1GCPA 1E6HA 2ROTA 1U5SA 2K3BA 1SHGA 1QKWA 3I5RA 4D8KA 4HXJA 1NEBA 1UHFA 1RLPC 2K79A 2D8HA 2DRMA 1AVZC 1OPLA 2HEQA 2KGTA 1MV3A 2GQIA 4IIOA 2GBQA 1M3BA 1YP5A 3VRZA 5IXBA 5FWBA 1UECA 2FRWA 2F2XA 2AZSA 3M0TA 4JPBW 1K0SA 1X2QA 4IIMA 3M0QA 1B07A 2KRMA 3JV3A 1H8KA 1SSHA 2CDTA 1I1JA 5IXFA 2M51A 2J06A 1K0XA 1AZGB 2KYMA 4AFSC 1N5ZA 4AG2C 5HCKA 4Z8AA 1QKXA 1NLOC 1AWJA 1NYGA 2YUNA 4J9EA 1M27C 2LZ6B 2L0AA 3VRYA 1KFZA 1UHCA 3EGUA 4AFQC 1GRIA 2GTOA 1UFFA 3ULRB 2DLPA 3QWXX 3U23A 1WYXA 1EFNA 1M30A 3FJ5A 2DL3A 1QWFA 3UF4A 1AEYA 1ZSGA 2EKHA 4CC4B 1AD5A 2L2PA 4GBQA 1G2BA 1WDXA 3NPFA 1NEGA 3M0PA 4J9BA 2X3WD 1NM7A 5IH2A 1U06A 1ZX6A 4X1VA 2XMFA 1X6BA 4RTWA 2J6FA 1W1FA 2PNIA 1BB9A 2I0NA 4JZ3A 1KIKA 5FWCA 1JO8A 1VYUA 4LE9A 1J3TA 2FPFA 2DJQA 5IHKA 4D8DA 2KRSA 5I11A 1WXTA 1UTIA 2EW3A 2KRNA 1PHTA 3RBBB 2JW4A 1YWPA 2H8HA 4J9CA 2AK5A 3VS7A 1QWEA 2RQUA 2MIOA 3M0RA 2QDLA 2RQRA 4WCIA 2EPDA 2NWMA 4CC7A 1RI9A 2OAWA 2EGEA 2K9GA 2X3XD 2FEIA 2JXBA 1H3HA 2FPDA 4J9GA 4JZ4A 1MV0B 4JJDA 2HDAA 3THKA 2J6KA 1PKTA 1WIEA 3EG0A 1WLPB 2HSPA 2FG0A 1H92A 2LNHB 4HVWA 4E6RA 1AOJA 3H0IA 4OMMA 1WXUA 2J05A 4HVVA 4OMLA 2A37A 1AWWA 4RTYA 2C0IA 4JJBA 1KJWA 1UJYA 1T3LA 3VS1A 3CQTA 2BTTA 1UG1A 2DRKA 4CC2A 2ED1A 4DEXA 2L3SA 1VYVA 2EYYA 1HD3A 4F14A 4CC3A 1GFCA 1ABQA 2B86A 2PZ1A 1PWTA 2JTEA 2KT8A 2MCNA 1JXOA 1BK2A 1K1ZA 3EHRA 2OJ2A 2LCSA 1T0JA 4QT7A 1Y0MA 2EVRA 2W10A 4M4ZA 2BZYA 4OMNA 1M3CA 3EHQA 2DE0X 3TVTA 1BBZA 1X27A 3REBB 2LJ3A 4OMQA 1V1CA 4K11A 2DNUA 1JXMA 1XOVA 1SRLA 4J9HA 3TSWA 1Z9ZA 2KYBA 2EGCA 2MOXA 1X2KA 1HSQA 2ROLA 2V1QA 1VYTA 2W0ZA 3KFVA 2F2WA 1K4US 2O9SA 2DF6A 1K76A 1KSWA 3REAB 2L3PA 4LUEA 2RQWA 4RTVA 2ABLA 2FPEA 1UUEA 1VA7A 3UATA 1X43A 1CKBA 4GLMA 1T3SA 2G6FX 1ZUKA 2KE9A 4F16A 2KT1A 2YUOA 2JMCA 2DM1A 2GNCA 2HCKA 1GCQA 2P4RA 3NHNA 2PTKA 4R0KA 3PVLA 2RQTA 3PE0A 2DVJA 4AFUC 1WA7A 2GTJA 2CT4A 2DMOA 5EC7A 1T0HA 2AKLA 1G83A 4Z88A 2ECZA 3SHWA 2KXCA 2HBWA 3VS0A 5IHNA 4AG1C 1WFWA 2E5KA 2LMJA 1FYNA 1AZEA 4RTZA 2M0YA 2ENMA 2CSIA 4ESRA 2JM9A 2DYBA 3VS6A 2A08A 1OEBA 1JQQA 2CT3A 1B3QA 2JS0A 3EG3A 1GL5A 2JS2A 2A28A 2CUDA 2YDLA 2JM8A 2VVKA 2DX1A 3NMZC 4Y92A 5IHIA 1LCKA 3H41A 1W70A 4ORZA 1YN8A 2KR3A 1RLQC 3SEMA 4A63B 1UE9A 3H0HA 2ED0A 1MUZA 2CUBA 2DL8A 2A36A 5GJVB 1OPKA 4RTUA 1U3OA 1GBQA 2YT6A 2LQWA 1SPKA 2DL5A 2KEAA 1Y57A 2BZ8A 2SEMA 2K6DA 3I35A 3R6NA 3VS5A 1PRLC 3C0CA 2O2OA 2DBMA 1CSKA 3TSZA 2D8JA 2VKNA 1RUWA 1BU1A 2LP5A 4KRTA 1E6GA 1PRMC 1X69A 1NG2A 2KROA 1ZUYA 3NGPA 1UGVA 2CSQA 2V1RA 1CKAA 1TUCA 1JEGA 2JMAA 4LN2A 3GBQA 1YCSB 2L3QA 2DL7A 1JU5C 2J7IA 2NUZA 2C0TA 4RTXA 2RN8A 3EG2A 2C0OA 4OMOA 4OMPA 2AZVA 1AWXA 1WXBA 2YUQA 2CREA 1GFDA 1M3AA 1GCQC 1OV3A 2RMOA 1I0CA 1PNJA 3IQLA 4LUDA 2RPNA 2YUPA 2JT4A 1YWOA 2AKKA 4EIKA 2LJ1A 1ARKA 2EYWA 3VS2A 1SEMA 2EYZA 1E7OA 1UDLA 3O5ZA 5ECAA 1A0NB 3I9QA 4FSSA 2CH4W 1AWOA 2CH4A 1ABOA 1ZUUA 2DA9A 3M0SA 3VS3A 1FMKA 2EQIA 1M8MA 2KXDA 1ZLMA 1GBRA 2BZXA 1S1NA 2D0NA 2O31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6O A;  2FO0 A;  2FRY A;  1YNZ A;  1UJ0 A;  1PKS A;  1TG0 A;  1IO6 A;  2LQN A;  4AFZ C;  4JJC A;  1HJD A;  3UA6 A;  2F2V A;  2IIM A;  4RTT A;  3EG1 A;  2K2M A;  2VWF A;  2KBT A;  3VS4 A;  2DBK A;  4DEY A;  3PVQ A;  1OOT A;  2RNA A;  1W6X A;  4Z89 A;  1NYF A;  3I5S A;  3RNJ A;  2KNB B;  4HVU A;  5FW9 A;  2D1X A;  1WI7 A;  2OI3 A;  3M0U A;  5GJW B;  1X6G A;  1SRM A;  2LJ0 A;  1QCF A;  4J9D A;  3ZL7 C;  2EYX A;  2GGR A;  1ZBJ A;  1TUD A;  2RQV A;  2K7A A;  2EGA A;  2ESW A;  3QWY A;  4J9F A;  5L23 A;  5I22 A;  4J9I A;  4ZNX A;  2O9V A;  4RUG A;  3UA7 A;  2EBP A;  3H0F A;  4LNP A;  2DIL A;  1QLY A;  2YSQ A;  3LH5 A;  1I07 A;  1NLP C;  2DL4 A;  1SHF A;  4HCK A;  2O88 A;  2LX7 A;  1Z9Q A;  3A98 A;  2SRC A;  1WX6 A;  2RF0 A;  4F17 A;  1K9A A;  1GCP A;  1E6H A;  2ROT A;  1U5S A;  2K3B A;  1SHG A;  1QKW A;  3I5R A;  4D8K A;  4HXJ A;  1NEB A;  1UHF A;  1RLP C;  2K79 A;  2D8H A;  2DRM A;  1AVZ C;  1OPL A;  2HEQ A;  2KGT A;  1MV3 A;  2GQI A;  4IIO A;  2GBQ A;  1M3B A;  1YP5 A;  3VRZ A;  5IXB A;  5FWB A;  1UEC A;  2FRW A;  2F2X A;  2AZS A;  3M0T A;  4JPB W;  1K0S A;  1X2Q A;  4IIM A;  3M0Q A;  1B07 A;  2KRM A;  3JV3 A;  1H8K A;  1SSH A;  2CDT A;  1I1J A;  5IXF A;  2M51 A;  2J06 A;  1K0X A;  1AZG B;  2KYM A;  4AFS C;  1N5Z A;  4AG2 C;  5HCK A;  4Z8A A;  1QKX A;  1NLO C;  1AWJ A;  1NYG A;  2YUN A;  4J9E A;  1M27 C;  2LZ6 B;  2L0A A;  3VRY A;  1KFZ A;  1UHC A;  3EGU A;  4AFQ C;  1GRI A;  2GTO A;  1UFF A;  3ULR B;  2DLP A;  3QWX X;  3U23 A;  1WYX A;  1EFN A;  1M30 A;  3FJ5 A;  2DL3 A;  1QWF A;  3UF4 A;  1AEY A;  1ZSG A;  2EKH A;  4CC4 B;  1AD5 A;  2L2P A;  4GBQ A;  1G2B A;  1WDX A;  3NPF A;  1NEG A;  3M0P A;  4J9B A;  2X3W D;  1NM7 A;  5IH2 A;  1U06 A;  1ZX6 A;  4X1V A;  2XMF A;  1X6B A;  4RTW A;  2J6F A;  1W1F A;  2PNI A;  1BB9 A;  2I0N A;  4JZ3 A;  1KIK A;  5FWC A;  1JO8 A;  1VYU A;  4LE9 A;  1J3T A;  2FPF A;  2DJQ A;  5IHK A;  4D8D A;  2KRS A;  5I11 A;  1WXT A;  1UTI A;  2EW3 A;  2KRN A;  1PHT A;  3RBB B;  2JW4 A;  1YWP A;  2H8H A;  4J9C A;  2AK5 A;  3VS7 A;  1QWE A;  2RQU A;  2MIO A;  3M0R A;  2QDL A;  2RQR A;  4WCI A;  2EPD A;  2NWM A;  4CC7 A;  1RI9 A;  2OAW A;  2EGE A;  2K9G A;  2X3X D;  2FEI A;  2JXB A;  1H3H A;  2FPD A;  4J9G A;  4JZ4 A;  1MV0 B;  4JJD A;  2HDA A;  3THK A;  2J6K A;  1PKT A;  1WIE A;  3EG0 A;  1WLP B;  2HSP A;  2FG0 A;  1H92 A;  2LNH B;  4HVW A;  4E6R A;  1AOJ A;  3H0I A;  4OMM A;  1WXU A;  2J05 A;  4HVV A;  4OML A;  2A37 A;  1AWW A;  4RTY A;  2C0I A;  4JJB A;  1KJW A;  1UJY A;  1T3L A;  3VS1 A;  3CQT A;  2BTT A;  1UG1 A;  2DRK A;  4CC2 A;  2ED1 A;  4DEX A;  2L3S A;  1VYV A;  2EYY A;  1HD3 A;  4F14 A;  4CC3 A;  1GFC A;  1ABQ A;  2B86 A;  2PZ1 A;  1PWT A;  2JTE A;  2KT8 A;  2MCN A;  1JXO A;  1BK2 A;  1K1Z A;  3EHR A;  2OJ2 A;  2LCS A;  1T0J A;  4QT7 A;  1Y0M A;  2EVR A;  2W10 A;  4M4Z A;  2BZY A;  4OMN A;  1M3C A;  3EHQ A;  2DE0 X;  3TVT A;  1BBZ A;  1X27 A;  3REB B;  2LJ3 A;  4OMQ A;  1V1C A;  4K11 A;  2DNU A;  1JXM A;  1XOV A;  1SRL A;  4J9H A;  3TSW A;  1Z9Z A;  2KYB A;  2EGC A;  2MOX A;  1X2K A;  1HSQ A;  2ROL A;  2V1Q A;  1VYT A;  2W0Z A;  3KFV A;  2F2W A;  1K4U S;  2O9S A;  2DF6 A;  1K76 A;  1KSW A;  3REA B;  2L3P A;  4LUE A;  2RQW A;  4RTV A;  2ABL A;  2FPE A;  1UUE A;  1VA7 A;  3UAT A;  1X43 A;  1CKB A;  4GLM A;  1T3S A;  2G6F X;  1ZUK A;  2KE9 A;  4F16 A;  2KT1 A;  2YUO A;  2JMC A;  2DM1 A;  2GNC A;  2HCK A;  1GCQ A;  2P4R A;  3NHN A;  2PTK A;  4R0K A;  3PVL A;  2RQT A;  3PE0 A;  2DVJ A;  4AFU C;  1WA7 A;  2GTJ A;  2CT4 A;  2DMO A;  5EC7 A;  1T0H A;  2AKL A;  1G83 A;  4Z88 A;  2ECZ A;  3SHW A;  2KXC A;  2HBW A;  3VS0 A;  5IHN A;  4AG1 C;  1WFW A;  2E5K A;  2LMJ A;  1FYN A;  1AZE A;  4RTZ A;  2M0Y A;  2ENM A;  2CSI A;  4ESR A;  2JM9 A;  2DYB A;  3VS6 A;  2A08 A;  1OEB A;  1JQQ A;  2CT3 A;  1B3Q A;  2JS0 A;  3EG3 A;  1GL5 A;  2JS2 A;  2A28 A;  2CUD A;  2YDL A;  2JM8 A;  2VVK A;  2DX1 A;  3NMZ C;  4Y92 A;  5IHI A;  1LCK A;  3H41 A;  1W70 A;  4ORZ A;  1YN8 A;  2KR3 A;  1RLQ C;  3SEM A;  4A63 B;  1UE9 A;  3H0H A;  2ED0 A;  1MUZ A;  2CUB A;  2DL8 A;  2A36 A;  5GJV B;  1OPK A;  4RTU A;  1U3O A;  1GBQ A;  2YT6 A;  2LQW A;  1SPK A;  2DL5 A;  2KEA A;  1Y57 A;  2BZ8 A;  2SEM A;  2K6D A;  3I35 A;  3R6N A;  3VS5 A;  1PRL C;  3C0C A;  2O2O A;  2DBM A;  1CSK A;  3TSZ A;  2D8J A;  2VKN A;  1RUW A;  1BU1 A;  2LP5 A;  4KRT A;  1E6G A;  1PRM C;  1X69 A;  1NG2 A;  2KRO A;  1ZUY A;  3NGP A;  1UGV A;  2CSQ A;  2V1R A;  1CKA A;  1TUC A;  1JEG A;  2JMA A;  4LN2 A;  3GBQ A;  1YCS B;  2L3Q A;  2DL7 A;  1JU5 C;  2J7I A;  2NUZ A;  2C0T A;  4RTX A;  2RN8 A;  3EG2 A;  2C0O A;  4OMO A;  4OMP A;  2AZV A;  1AWX A;  1WXB A;  2YUQ A;  2CRE A;  1GFD A;  1M3A A;  1GCQ C;  1OV3 A;  2RMO A;  1I0C A;  1PNJ A;  3IQL A;  4LUD A;  2RPN A;  2YUP A;  2JT4 A;  1YWO A;  2AKK A;  4EIK A;  2LJ1 A;  1ARK A;  2EYW A;  3VS2 A;  1SEM A;  2EYZ A;  1E7O A;  1UDL A;  3O5Z A;  5ECA A;  1A0N B;  3I9Q A;  4FSS A;  2CH4 W;  1AWO A;  2CH4 A;  1ABO A;  1ZUU A;  2DA9 A;  3M0S A;  3VS3 A;  1FMK A;  2EQI A;  1M8M A;  2KXD A;  1ZLM A;  1GBR A;  2BZX A;  1S1N A;  2D0N A;  2O31 A; 
#chains in the Genus database with same CATH topology
 4L59 A;  2OAU A;  2HKN A;  4XTW A;  1TG0 A;  5LJ3 d;  1QVF P;  1VQO Q;  3V7S A;  3UA6 A;  3MO8 A;  3RMQ A;  1VQ9 Q;  2VWF A;  5KYU A;  3VS4 A;  2DBK A;  1Q82 U;  4C5H A;  1LVK A;  3PVQ A;  4F7U A;  5A0L A;  4QVC A;  1RAC B;  2XU8 A;  3CC2 A;  3OS5 A;  1NYF A;  4XTY A;  5GAN 2;  5FW9 A;  3E9F A;  3MPU B;  3S3M A;  2COY A;  3HTR A;  2OI3 A;  3M0U A;  1QCF A;  2XDB A;  1MMG A;  1WZO A;  2DXU A;  4MML A;  1TUD A;  3OYD A;  2FB7 A;  2COW A;  3QWY A;  5L23 A;  4J9I A;  3TQ7 P;  3CXC A;  3H0F A;  2RJE A;  3L2Q A;  5CKH A;  4DBQ A;  3LH5 A;  4N4H A;  1NLP C;  2RI5 A;  3CD6 A;  2DZC A;  3M57 A;  2K5L A;  5DM7 R;  4F17 A;  4NL2 A;  4IUR A;  4TVR A;  1GCP A;  3EGX B;  3G71 A;  2CP3 A;  1VQL Q;  3V8K A;  5LJ5 j;  3WXM B;  5GAO m;  3OYK A;  2M16 A;  2H3E B;  5CKF A;  1RLP C;  4BY6 C;  3R6O A;  4M78 A;  2DRM A;  1AVZ C;  2HEQ A;  2JNG A;  1M1F A;  1MV3 A;  3H9N A;  1M3B A;  3HKS A;  3MP8 A;  1VQM Q;  2F2X A;  1TOV A;  1R8O B;  1WHG A;  4JPB W;  3EGD A;  3LGF A;  4IIM A;  5CO7 A;  3JV3 A;  4QW2 A;  1BKB A;  2J06 A;  1AZG B;  4B9X A;  2G3R A;  5GMK i;  5FRN A;  3HPW A;  2RJD A;  4EMK A;  3S3O A;  1VQ6 A;  1SF9 A;  1NLO C;  2JUF A;  1AWJ A;  3CC2 T;  2VXF A;  3QXE B;  1JJ2 A;  3SWN A;  1OYX A;  1M8V A;  3HL8 A;  2D0Q B;  3VRY A;  1KFZ A;  2RD1 A;  4B6M A;  2CP6 A;  1ZSZ B;  3V7C A;  4M77 C;  1QQJ A;  3RIR A;  3ULR B;  2E3I A;  3QWX X;  3OW2 S;  1KQS P;  1KQ1 A;  1D1C A;  1M30 A;  1M9S A;  4BE2 A;  2QEX T;  2EKH A;  4CC4 B;  2M0O A;  3NPF A;  2BUD A;  1FWZ A;  5IH2 A;  4KBM B;  1ZX6 A;  2KK4 A;  3I55 A;  4C92 F;  3CPW S;  5IT9 E;  2K3X A;  3CCJ A;  2J6F A;  2M1H A;  2NUP B;  2BIV A;  2MWP A;  2I0N A;  4JZ3 A;  5CKE A;  6AT1 B;  1KIK A;  4X9D A;  2E1H A;  3VYH B;  2LX9 A;  1J3T A;  5IHK A;  3BDU A;  4D8D A;  1QVG S;  2YWW A;  3EFS A;  2KRN A;  3CCU Q;  1SG5 A;  3QII A;  3QG1 A;  4MZM A;  3A5Z B;  1D0Y A;  4C92 E;  3QSU A;  2H8H A;  4F04 B;  1ACM B;  1VQ7 Q;  2QAZ A;  2RQU A;  3M0R A;  1UEB A;  2RQR A;  4WCI A;  5HKC A;  2NWM A;  1M1K R;  2IPO B;  2Y90 A;  1PG5 B;  2OAW A;  1KQ2 A;  2EGE A;  4HCC A;  4LDV A;  2DIG A;  4XTX A;  5GAM f;  3CPW P;  3G6E A;  3CCM Q;  3MHX A;  4ZGD B;  3EG9 A;  2A0F B;  5KYW B;  4M78 D;  4E6R A;  1AOJ A;  3H0I A;  2HSE B;  3CCE T;  4M7A E;  2HNI A;  1WXU A;  2J05 A;  3KUF A;  1AWW A;  4RTY A;  1KJW A;  2YLC A;  5I2M A;  1IHW A;  1MHN A;  4BI3 A;  2LRQ A;  4J7I A;  2RHI A;  1ZHI A;  3CQT A;  3SDZ A;  1VQM A;  1QVF S;  3VYG A;  3OYF A;  1UG1 A;  2DRK A;  1RI0 A;  4DEX A;  1VYV A;  2DER A;  1HD3 A;  2QG9 B;  4F14 A;  5FU6 B;  4M7D D;  2FL7 A;  2HAX A;  4C8Q B;  4CC3 A;  2CZ0 B;  5KE2 A;  2PZ1 A;  1PWT A;  2JTE A;  2LNV A;  2KT8 A;  1NZ9 A;  3EHR A;  3CEY A;  2L3R A;  2XK0 A;  2K57 A;  4DBH A;  4OVA A;  5LJ3 j;  2ZGW A;  3KBG A;  1BBZ A;  1X27 A;  3REB B;  1QMC A;  4OMQ A;  2P84 A;  2XHC A;  3CC7 Q;  1C6V X;  1Q86 C;  1VQK Q;  1JXM A;  1WHJ A;  4PFP A;  1M2V A;  4LD9 K;  2KAF A;  1I5L A;  1LPL A;  2HMA A;  1YHQ Q;  2CYZ B;  3A8G B;  4RCC A;  1G3Y A;  3CD6 Q;  2FVU A;  2PVD B;  2PVG B;  4FIB A;  2W0Z A;  3KFV A;  1K4U S;  2DF6 A;  2XDP A;  4EPC A;  4OB1 B;  1KSW A;  1EZZ B;  1B7T A;  5GMK h;  1VQO A;  3F70 A;  2L3P A;  3KXT A;  4RTV A;  5J3B A;  2FPE A;  1VA7 A;  4ELZ C;  4FYW B;  1T3S A;  5GMK j;  5GMK l;  3UT1 A;  3I56 Q;  2KE9 A;  3CCV T;  4F16 A;  4DBR A;  1Q81 C;  2P4R A;  3LWH A;  2PTK A;  3PVL A;  1YI2 A;  3CCU A;  2RA2 A;  2DVJ A;  3OSS C;  4KGZ B;  3JAM E;  2KDS A;  4C0F A;  2DMO A;  1X75 C;  3INZ A;  3O8V A;  2CKK A;  3L2U A;  1T0H A;  4Z88 A;  1YCY A;  4A4H A;  2X4W A;  3QZ5 B;  4N0A C;  3CC4 Q;  4AMC A;  1S72 Q;  2LMJ A;  1FYN A;  4M78 E;  2M0Y A;  1WJQ A;  5KYY B;  2JM9 A;  1RAG B;  5J26 A;  2DYB A;  1IRE B;  1OEB A;  4Y91 A;  4PJO B;  2ZPG B;  1KK7 A;  3DLL A;  2RK2 A;  2OTJ A;  4JRI A;  4DA4 A;  4ZN3 A;  2CUD A;  2VVK A;  4Y92 A;  3SWN B;  5IHI A;  4C92 D;  3G4S Q;  2QA4 T;  3VJP A;  1YHQ T;  2OTL A;  4ORZ A;  1YN8 A;  2KR3 A;  1RLQ C;  5GAN 4;  4M75 E;  2LQK A;  2ED0 A;  3FC3 A;  2DL8 A;  3LWI A;  2A36 A;  4RMO A;  2YHT A;  5CAI A;  3NFC A;  2RJF A;  4LDY A;  3MEA A;  2K3Y A;  2LQW A;  3TU4 K;  1LJO A;  5GAN f;  1YJW T;  1Y57 A;  1M2V B;  3PNW C;  3GIB A;  2SEM A;  2QQR A;  1XTD A;  1VQM T;  3VS5 A;  1PRL C;  1WHL A;  2VYT A;  4C8Q G;  4FYY B;  2DBM A;  2FYK A;  3RKY A;  2DTH A;  1RUW A;  1BU1 A;  2LP5 A;  2E64 A;  3G7Z A;  3NGP A;  1CKA A;  1JEG A;  4LN2 A;  1YCS B;  4N0A A;  3QO3 A;  1VQL T;  2C0T A;  2RN8 A;  2CP5 A;  1YFN A;  3EG2 A;  3EAE A;  3M59 A;  1KC8 C;  9ATC B;  4E7J A;  2YUQ A;  3FDR A;  1OV3 A;  1I0C A;  1PNJ A;  2HL5 C;  8ATC B;  1LNX A;  3JCM V;  1IXD A;  1IRX A;  3VS2 A;  1SEM A;  3MJX A;  4PJL A;  4M7A G;  3FEO A;  2E5Q A;  3L2R A;  3OA6 A;  1UDL A;  3O5Z A;  1A0N B;  4Y28 E;  3CC2 Q;  4BB7 A;  3CCM T;  2DEQ A;  5LJ3 f;  2E6Z A;  3QPH A;  2VGM A;  4R56 A;  4P5N A;  2VUB A;  3OBW A;  1GBR A;  3CC7 A;  2D0N A;  1FXX A;  3CCU T;  5GMK e;  2MAM A;  2FRY A;  1KD1 R;  1YNZ A;  1PKS A;  2LQN A;  4AFZ C;  4JJC A;  2F2V A;  1K8A R;  3EG1 A;  4CRI A;  4DEY A;  2GFU A;  2XD0 A;  3OYY A;  1XNI A;  1OOT A;  1VQK A;  2FZC B;  3C95 A;  5EG2 A;  1G3W A;  1W6X A;  5GAN 8;  3T9N A;  2M02 A;  4HVU A;  2D1X A;  3CPF A;  2ZZD A;  1SRM A;  2HKQ B;  1R0B G;  1M4Z A;  2GGR A;  8AT1 B;  1YJW A;  4C8Q E;  4E7Z A;  5I22 A;  3P8H A;  4RUG A;  2DIL A;  3J7A F;  4LDX A;  1UGP B;  2MYS A;  1YJN T;  2QQA A;  1Z9Q A;  2RF0 A;  2XG8 D;  3PIO A;  1OZ2 A;  1K9A A;  3M4G A;  3M58 A;  1Q81 R;  2X4X A;  4D8K A;  4HXJ A;  2Y4X A;  2R57 A;  1UHF A;  4XQ3 A;  1BYM A;  4Z02 A;  2KGT A;  3D7S B;  1XJW B;  2GFA A;  3MP6 A;  5IXB A;  1MMN A;  5FWB A;  1YJ9 A;  5GAN 3;  1R77 A;  3CC4 A;  2KVQ G;  3UWN A;  1Q86 U;  2MF2 A;  4BD3 A;  1JJ2 S;  1K0S A;  3WVE B;  1H8K A;  1SSH A;  2CDT A;  3CBO A;  3QDF A;  1N5Z A;  4O6J A;  5AT1 B;  1FMW A;  1YIT T;  4M78 C;  2EJF A;  5KYY A;  4FCY A;  1YIT Q;  4M7D E;  1D1A A;  4J9E A;  4Q5W A;  1BI0 A;  5L8R E;  1M1K C;  1Q82 R;  4XK8 E;  1GRI A;  1K73 C;  4A4F A;  3JCM g;  1IGQ A;  1RAF B;  1VQ4 T;  1WYX A;  3CCQ T;  1KHI A;  4GLK A;  1EFN A;  3FJ5 A;  2DET A;  1QWF A;  3I56 A;  3UF4 A;  1N8R U;  2EQK A;  1R0C B;  1VQ6 Q;  3MEW A;  5LL6 S;  1G2B A;  3CPW A;  4PLI A;  3M0P A;  2X3W D;  4M78 G;  2YRC A;  2YXY A;  2ZPE B;  2VXE A;  3MKD A;  4FW1 A;  4M77 E;  2NUT A;  2RHX A;  5KYU B;  1YJN Q;  3VU3 C;  4PKC C;  4IUV A;  3QJY A;  2PNI A;  3BFM A;  1YJN A;  4JDS A;  2FPF A;  2KRS A;  3M4Y A;  1WXT A;  4MMK A;  1UTI A;  3PTA A;  3VV0 A;  1N6A A;  1HK9 A;  4XU1 A;  3RBB B;  1YWP A;  3BY7 A;  1QWE A;  1M90 U;  3OYI A;  4M7A C;  2HD0 A;  3CCR A;  4XTV A;  5CR2 A;  3JCM J;  3JCM P;  4CC7 A;  3JCM f;  2RB6 A;  4ELY C;  3CCJ Q;  3QYH B;  3GP8 A;  3I55 Q;  3FIF A;  1I4K 1;  4KUL A;  2X3X D;  3RUX A;  4A4G A;  2NYS A;  4J9G A;  4JZ4 A;  3LX7 A;  2HDA A;  5GAN e;  1Q86 R;  3THK A;  5CK9 A;  1PKT A;  1WIE A;  2RHY A;  4C5E A;  4NS5 A;  2HSP A;  2FG0 A;  2MI6 A;  2WSE E;  4F7U E;  1UGR B;  3CME A;  3GNG A;  2C0I A;  1ZSZ C;  2FHD A;  2E41 A;  5FU7 C;  3DKM A;  1C0M A;  1NJI C;  3P8B B;  4CC2 A;  2ED1 A;  4JRK A;  3UPU A;  2CGH A;  2EYY A;  2E65 A;  1RAE B;  3BE3 A;  5LJ5 e;  1UGQ B;  1GFC A;  3CBM A;  3OS1 A;  4JLI A;  2B86 A;  5LJ3 e;  4FT4 A;  4JS5 A;  2QDY B;  1YIJ T;  1BK2 A;  1YHQ A;  2LCS A;  2A3L A;  1D1B A;  1N9R A;  2HQX A;  4QT7 A;  4PJO A;  5I2S A;  1VQP A;  2RHU A;  1VUB A;  4KH0 B;  1MNE A;  1RAH B;  4OMN A;  1VQ5 A;  1JB0 E;  3A8H B;  1I8F A;  2EQJ A;  4M77 F;  4QQD A;  1V1C A;  2COZ A;  3QZ9 B;  4K11 A;  2DNU A;  4IKF A;  3OYB A;  1YI2 Q;  2EFI A;  3OB9 A;  3CCS A;  2LC4 A;  1KD1 U;  1VQ5 Q;  3GOX A;  2IG0 A;  4OGE A;  1Z9Z A;  2B8A A;  3NTI A;  2IVW A;  2EGC A;  3P8D A;  3QBY A;  2XDD A;  3M56 A;  5A0D A;  2K5I A;  1X6O A;  3DB4 A;  3CME T;  4HA8 A;  2LT4 A;  1K76 A;  2EIF A;  1N27 A;  4M75 F;  1TH7 A;  4PFO A;  4M7D F;  2LVM A;  3RKX A;  3OS2 A;  2RQW A;  4E7L A;  3JCM e;  5DLO A;  3PMT A;  1UUE A;  2RM4 A;  2DEU A;  2MMP A;  4OMF B;  3G6E T;  2G6F X;  5GAO r;  4BI8 B;  2HCK A;  1KG1 A;  2F5K A;  4GY5 A;  1GCQ A;  3LLR A;  1KQS S;  3NHN A;  1OX9 A;  4ANJ A;  3L2Z A;  2X4J A;  2GTJ A;  3TRE A;  2CT4 A;  1QCN A;  1QVP A;  1VQ4 Q;  5EC7 A;  2OTJ T;  2ECZ A;  5GAO q;  4M7D C;  3HFO A;  3SHW A;  3CCR T;  4C5I A;  2HBW A;  3VS0 A;  3TCJ A;  5IN1 A;  4RG8 A;  4PJN A;  4FYV B;  1D3B B;  3SWN C;  2ENM A;  2CSI A;  3V8J A;  2QEX Q;  2DPP B;  3JRZ A;  2QXF A;  3VS6 A;  4C0D B;  4LD6 A;  1WPY A;  2CP2 A;  2CZ7 B;  4OGC A;  1JQQ A;  1B3Q A;  2CT3 A;  2JS0 A;  4IUT A;  4PJM A;  1KC8 R;  2JS2 A;  1M2O A;  3NMZ C;  4LDW A;  5GAM h;  3H41 A;  1I81 A;  1K73 R;  1NBE B;  3C4S A;  4EMK B;  4E7H A;  3FB9 A;  3H0H A;  2CUB A;  5GJV B;  4OP0 A;  3FRN A;  2CP0 A;  2RHZ A;  2NUT B;  1OZ3 A;  1SPK A;  2DL5 A;  2KEA A;  2BZ8 A;  4PNO A;  1EX4 A;  3C0C A;  2D8J A;  4FL6 A;  4KT0 E;  1E6G A;  1P92 A;  1VIE A;  2ZPH B;  1UGV A;  3CC4 T;  3L42 A;  4EMG A;  4NL3 A;  3GBQ A;  2L3Q A;  2DL7 A;  4M75 B;  4J5Y A;  1JU5 C;  1WHM A;  2E12 A;  2C0O A;  2RI3 A;  3JB9 I;  1PSF A;  2ZPF B;  1VQP T;  3GF5 A;  2JTF A;  3JB9 D;  3G71 T;  2RMO A;  1B34 A;  3M54 A;  2HL3 A;  4LUD A;  5GAN g;  1YIJ A;  3A8M B;  2PU9 B;  2KMT A;  4C8Q C;  3ER0 A;  4JJN K;  4X34 A;  1MMD A;  4QVD A;  2VC8 A;  4DQ2 A;  1E7O A;  5HK3 A;  2P0Q A;  3PFS A;  1IZ6 A;  5ECA A;  3NTH A;  1AWO A;  4FM4 B;  1VIF A;  2DA9 A;  4XU3 A;  4RCB A;  4KUD K;  1ZLM A;  2LCL A;  4XAX B;  4YTL A;  5D6Y A;  4QVZ A;  2VAS A;  2YRD A;  2WAC A;  4C8Q F;  2QEX A;  1VQK T;  1N9S A;  1IO6 A;  3JCM b;  1HJD A;  4C8Q A;  4M77 G;  3HFN A;  1VQ9 A;  3I5S A;  4C92 C;  4C92 B;  4C0G A;  3URG A;  1K9M U;  2KNB B;  4E2F B;  2F69 A;  4JS4 A;  1X6G A;  2LJ0 A;  4J9D A;  2V26 A;  2EQU A;  3ZL7 C;  1WJR A;  3HRU A;  1ZBJ A;  5LJ5 f;  2K7A A;  2EGA A;  2ESW A;  1H64 1;  2L89 A;  4J9F A;  2V8J A;  1WQ7 A;  3V8L A;  4J6W A;  2ZPI B;  3UA7 A;  2EBP A;  4LNP A;  2CS7 A;  2YSQ A;  1XQH A;  1YIJ Q;  1YJ9 T;  1I07 A;  4ME7 A;  2BKD N;  2QA4 Q;  1VQ5 T;  1WQW A;  2O88 A;  2LX7 A;  1RAA B;  2KY9 A;  2SRC A;  1WX6 A;  2LDM A;  2JJ9 A;  3Q1J A;  1NJI U;  2K2V A;  4M75 C;  1W2B A;  1U5S A;  1SHG A;  3I5R A;  1O75 A;  2QGF B;  4PLL A;  1NEB A;  2VV5 A;  3M55 A;  5KCH A;  2D8H A;  4JRQ A;  1YBY A;  1YP5 A;  3VRZ A;  3HSB A;  1UEC A;  2FRW A;  3X25 B;  2AZS A;  3CMA Q;  1U1S A;  3M0T A;  1SSF A;  3M0Q A;  1B07 A;  2KRM A;  1VQN A;  3EGX A;  2LCC A;  2M51 A;  2JVV A;  4M7A A;  4FU6 A;  1K0X A;  2KYM A;  4NOY A;  1D0X A;  4AG2 C;  4JLG A;  2QQS A;  1HYO A;  1VQ9 T;  5HK0 A;  4C5G A;  2VGN A;  1O9S A;  1NYG A;  5C6S A;  3EFO A;  2LZ6 B;  3QKJ A;  2EJ9 A;  1G3T A;  1MND A;  2ZAE A;  1G8X A;  4AFQ C;  5LJ3 h;  3MEU A;  2GTO A;  5GMK m;  2DO3 A;  3U23 A;  3OYM A;  1AEY A;  1ZSG A;  2WSC E;  1K9M R;  2OTJ Q;  2L2P A;  1WDX A;  1S72 T;  2OTL T;  5IAY A;  1NM7 A;  4MDX A;  1U06 A;  2D9T A;  4X1V A;  1X01 A;  5C0M A;  1NE8 A;  1ZSZ A;  1X6B A;  4RTW A;  5CIU A;  2QI2 A;  3OY9 A;  1JO8 A;  1VYU A;  4LE9 A;  1VQ7 A;  2L8D A;  3ZEH A;  1JJ2 P;  2DJQ A;  5I11 A;  2DJZ A;  4OB0 B;  5GAN 7;  4F7U B;  2JW4 A;  1PM3 A;  1BI2 A;  1G3S A;  3VS7 A;  5FU6 C;  2MIO A;  2JZ2 A;  3EGD B;  3QDR B;  2QDL A;  1U1T A;  5CKB A;  2EPD A;  3BW1 A;  4J6X A;  4M75 G;  1RI9 A;  2QQB A;  5GAM d;  4PK4 A;  3FLG A;  1WJS A;  1PSE A;  3CCQ A;  1YI2 T;  3HRT A;  3E2U A;  2K9G A;  2FEI A;  2JXB A;  4M75 A;  4PJO D;  4JJD A;  3OQ5 A;  3OYC A;  2KQW A;  1WGS A;  1Y96 A;  4DOV A;  4ZTF A;  1WLP B;  1H92 A;  2F1L A;  2LNH B;  4HT8 A;  3LYI A;  4RKU E;  2Z0W A;  4OMM A;  2LT1 A;  3PT9 A;  5D6X A;  1NJI R;  4OML A;  1VQ6 T;  5KH6 A;  4A53 A;  1T3L A;  4B9W A;  4HT9 A;  1IB8 A;  3X26 B;  3G71 Q;  1AHJ B;  2L3S A;  4M77 A;  1I5O B;  1UB4 A;  3CCS Q;  5GAM g;  2P0P A;  3A8L B;  3S3N A;  3CCS T;  1TU0 B;  1K73 U;  2RJC A;  4PJO F;  3G4S A;  4WF2 A;  2OTL Q;  4BAC A;  1QCO A;  1JXO A;  1OQK A;  3N5B B;  1K1Z A;  4BI4 A;  3CMA A;  5LJ5 g;  2GQV A;  3M5A A;  4F7U G;  3PMI A;  4M4Z A;  2AHJ B;  2O01 E;  1M3C A;  3EHQ A;  2DE0 X;  2EYQ A;  2C06 A;  5GAM j;  2QGG A;  2LJ3 A;  1MGQ A;  4C92 A;  2DXC A;  4VUB A;  1OX8 A;  4KH1 B;  1ZA2 B;  1XOV A;  1SRL A;  3DLM A;  3QHS A;  4J9H A;  2R58 A;  1Y96 B;  3JCM Q;  2RK1 A;  2NLU A;  2KYB A;  2MOX A;  4M77 D;  4PJJ A;  3JSC A;  4KGV B;  2ROL A;  2V1Q A;  1VYT A;  2F2W A;  4QQ6 A;  2E6N A;  2O9S A;  4IUU A;  2YRV A;  4EDU A;  1WHH A;  2MK5 A;  3AHU A;  3OS0 A;  4A4K A;  5CQX A;  1CKB A;  2O4X B;  1V29 B;  2V8I A;  1ZUK A;  4MZT A;  1Y07 A;  1F1B B;  3E19 A;  2YUO A;  2JMC A;  2GNC A;  4E7I A;  3UDC A;  3CBP A;  1VQO T;  3C94 A;  1VQN Q;  3RES A;  5CKD A;  2NUP A;  2DD4 A;  1JBM A;  3LGL A;  3JB9 F;  4N4I A;  5GAN 5;  5FU7 B;  1D09 B;  1JRI A;  3CCM A;  5IHN A;  4M78 F;  2E5K A;  2QK0 A;  1YJ9 Q;  1Q82 C;  4RTZ A;  4M78 B;  4ESR A;  3OYE A;  3ZBD A;  1TUG B;  4KGX B;  3LH0 A;  3EG3 A;  3TEE A;  5GAN j;  2BE7 D;  2BE9 B;  1TWB A;  3X28 B;  2DX1 A;  1LCK A;  1IGU A;  4BDY A;  1Q7Y C;  4A63 B;  2DIQ A;  2DZ9 A;  1W2B P;  4C0Z A;  1NPR A;  1MUZ A;  1WHK A;  2DTO A;  3M9Q A;  1VQ4 A;  3S6W A;  1OPK A;  3H6Z A;  1U3O A;  1GBQ A;  2H3J A;  4J83 A;  2O4X A;  2YT6 A;  2P4T A;  5KYN A;  2XIC A;  2V8K A;  2PUO B;  2ZPB B;  2K6D A;  1PCX A;  3I35 A;  1LOJ A;  2JOY A;  3R6N A;  2PUK B;  2O2O A;  3TSZ A;  2R5M A;  1BI1 A;  2FZK B;  1Y7X A;  1UGS B;  2DAQ A;  3GPL A;  3PGG A;  4KRT A;  1X69 A;  2KRO A;  4KUI A;  2QYZ A;  3OW2 P;  2CSQ A;  5DLQ E;  1MMA A;  2JMA A;  3EFR A;  4J7F A;  1Q7Y R;  2E70 A;  3FJP A;  2NUZ A;  2F5T X;  2HZY A;  3OYN A;  5M9O A;  2QA4 A;  4OMP A;  2AZV A;  3QYG B;  4IUQ A;  5LJ3 g;  5LJ5 d;  2CRE A;  1M3A A;  2YLB A;  3DB3 A;  2AIR B;  3OMC A;  2QAS A;  3CMA T;  2RPN A;  2YUP A;  4EIK A;  5A0G A;  2LJ1 A;  1ARK A;  1OI1 A;  4L5G A;  4OB2 B;  2VB6 A;  2LTO A;  4FSS A;  2CH4 W;  2RI2 A;  2CH4 A;  4M75 D;  1ZUU A;  3OYH A;  2I2L A;  3I55 T;  3M0S A;  3J80 E;  1FMK A;  2EQI A;  4OB3 B;  2E10 A;  1M8M A;  1M1G A;  3EFO B;  3CCE Q;  2A7Y A;  1S1N A;  5I21 A;  2O31 A;  3G6E Q;  1NPP A;  2J6O A;  2FO0 A;  1UJ0 A;  2XI9 A;  3OSV A;  3MP1 A;  3RR6 A;  2IIM A;  4RTT A;  1KD1 C;  2K2M A;  2KBT A;  4M7A D;  4XU2 A;  1EIF A;  3CCR Q;  2RNA A;  4ZGE B;  4D6W A;  4Z89 A;  2DFU A;  2K5F A;  3RNJ A;  1QP3 A;  1FX7 A;  3HHT B;  5KE3 A;  2ATC B;  3X20 B;  1WI7 A;  5GJW B;  3JB9 G;  2M9U A;  5FRM A;  2EYX A;  1K8A U;  3JCM X;  1VQN T;  2RQV A;  3SFM A;  1Q81 U;  4OF1 A;  1TXQ A;  4ZNX A;  2O9V A;  4LDU A;  2JN0 A;  1QLY A;  4RG2 A;  5FLX E;  4HCZ A;  4PFZ A;  4M7A F;  2DL4 A;  1SHF A;  4E47 A;  3RMS A;  4HCK A;  2K4Y A;  3A98 A;  4ZN1 A;  3VUB A;  2X9H A;  4E7K A;  1E6H A;  4J8O A;  2ROT A;  2K3B A;  1QKW A;  4C8Q D;  3RDV A;  1W4S A;  5GAO p;  3ASK A;  2K79 A;  4BY6 B;  2PQW A;  1OPL A;  2GQI A;  4IIO A;  1RL2 A;  5HY6 A;  2GBQ A;  4FT2 A;  2GF7 A;  2MWO A;  3G4S T;  5GAN 6;  3ME9 A;  3SD4 A;  1X2Q A;  3L2V A;  4PJO C;  1I1J A;  4FYX B;  5IXF A;  1M5Q 1;  4AFS C;  1BI3 A;  4C92 G;  5HCK A;  2QTV A;  4DOW A;  2CZ1 B;  4Z8A A;  1QW1 A;  1QKX A;  1M90 C;  1D0Z A;  4JUV A;  1ZQ1 A;  3PIP A;  2YUN A;  3JB9 H;  1M27 C;  2L0A A;  2QTX A;  1UHC A;  3VKI A;  5D7U A;  3EGU A;  3M53 A;  2GCX A;  3J81 E;  3H8Z A;  1VQP Q;  1UFF A;  4HCB A;  2DLP A;  1QVF A;  3WVD B;  2DL3 A;  1SKU B;  1D3B A;  3CCQ Q;  4C0D C;  1AD5 A;  1VQ8 A;  2QQ9 A;  4GBQ A;  5GAO n;  1NEG A;  5CCA A;  4J9B A;  2FZG B;  2XID A;  4ATO A;  5CQY A;  2XMF A;  1DJ7 B;  4XTU A;  4XU0 A;  1W1F A;  4PJO G;  3CXC S;  1PC0 A;  2JTM A;  3LW5 E;  3QUI A;  1BB9 A;  5FWC A;  4BUG A;  1IHV A;  1Q95 G;  3OW2 A;  2EW3 A;  1PHT A;  4PJO E;  3C12 A;  3QJ6 A;  4J9C A;  4J6Y A;  2AK5 A;  5KYX B;  5LJ5 h;  4ZTJ A;  4FW2 A;  1M90 R;  3JCM W;  3MCA B;  1QVG A;  4HKE A;  1H3H A;  3HRS A;  2FPD A;  4X9C A;  3AT1 B;  1MV0 B;  3HP9 A;  3CME Q;  2J6K A;  5DY9 A;  1OU8 A;  3EG0 A;  1TS9 A;  1RAB B;  4HVW A;  2HBP A;  3CCL Q;  4ZGJ B;  1H3Z A;  4HVV A;  2A37 A;  4JJB A;  3A8O B;  3CCL A;  4XTZ A;  1UJY A;  3VS1 A;  1TTH B;  2BTT A;  1N8R C;  4FSX A;  3SB2 A;  1OU9 A;  1BCM A;  2LQ8 A;  3A1P A;  1ABQ A;  1QP2 A;  4QKU A;  7AT1 B;  1RAI B;  2MCN A;  4A4E A;  1FMV A;  1M1K U;  1OUL A;  1RAD B;  2OJ2 A;  4MZP A;  5GAM e;  1GXI E;  1T0J A;  4M7A B;  1Y0M A;  2EVR A;  2W10 A;  5A2Q E;  2KSS A;  5GAN h;  4M7D B;  2BZY A;  3L1A A;  1BIB A;  2DVE A;  5GAN d;  3TVT A;  4EMK C;  2CZ6 B;  1YJW Q;  2EQM A;  1VQL A;  4IUP A;  1N8R R;  1AT1 B;  1B34 B;  3TSW A;  2DD5 A;  3CCJ T;  1X2K A;  1HSQ A;  3L2W A;  2DKG A;  2DXT A;  3JCM d;  2HQH A;  2D6F A;  2X51 A;  3CCE A;  3REA B;  1U8R A;  4LUE A;  2ABL A;  4AT1 B;  3OYG A;  3CCV A;  3UAT A;  3EG9 B;  4MDW A;  1X43 A;  4QQG A;  5KYW A;  4GLM A;  1ZA1 B;  2EWN A;  2KT1 A;  2DM1 A;  2X4Y A;  1TSF A;  5AYF A;  1K8A C;  4R0K A;  2RQT A;  3PE0 A;  3E9G A;  4V2S A;  4AFU C;  1WA7 A;  2P0K A;  2WSF E;  3GNF B;  2XKO C;  4PL6 A;  4LXC A;  2AKL A;  1K9M C;  1G83 A;  4M7D A;  5FRO A;  3BDL A;  2KXC A;  1KC8 U;  3EH2 A;  4AG1 C;  1WFW A;  2DK3 A;  3OBY A;  1AZE A;  4N4G A;  2MPX C;  5CVI A;  3X24 B;  4BDZ A;  3MEV A;  3RER A;  2A08 A;  1V76 A;  5J39 A;  2E3H A;  2PVO B;  4EMH A;  1PD0 A;  2X35 A;  1GL5 A;  1VQ8 Q;  2A28 A;  1KQS A;  2YDL A;  2JM8 A;  1VQ8 T;  3GLX A;  4R55 A;  1S72 A;  1W70 A;  1W2B S;  1HXD A;  3SEM A;  1UE9 A;  2DYI A;  3OYL A;  2HQE A;  3OMG A;  4BE1 A;  4RTU A;  2EKO A;  4DBF A;  2EJG A;  4E7S A;  3CCV Q;  1Y71 A;  3MET A;  4A54 A;  5GAO l;  1ZBX A;  4II1 A;  1CSK A;  4UC4 A;  3JB9 J;  5D6W A;  1YIT A;  2AT1 B;  2VKN A;  3ZFJ A;  3OYJ A;  1PRM C;  1NG2 A;  1G5V A;  1ZUY A;  5KYX A;  4O5V A;  2DXB A;  2E4H A;  2L5Q A;  2V1R A;  1TUC A;  1WNL A;  3EH1 A;  4M7D G;  1C1A A;  2J7I A;  4RTX A;  1BCO A;  3G1J A;  2DTI A;  3JCM h;  4JRP A;  1QVG P;  3OYA A;  4OMO A;  2KI7 A;  2R5A A;  3RKW A;  1AWX A;  1WXB A;  1GFD A;  5KCO A;  1VOM A;  3CC7 T;  1GCQ C;  4M77 B;  2CP7 A;  3IQL A;  2RO0 A;  3E1S A;  2OX7 A;  4BE0 A;  2JT4 A;  1YWO A;  2AKK A;  2EAY A;  3CD6 T;  4CI0 C;  2EYW A;  1KHC A;  2EYZ A;  1VQ7 T;  2RH2 A;  3V7R A;  3VUZ A;  3I9Q A;  1Q7Y U;  3CXC P;  4WTO B;  1ABO A;  1BIA A;  3JCM c;  3VS3 A;  4F7U F;  2Y4Y A;  3CCL T;  2ZCF B;  2KXD A;  2BZX A;  1PD1 A;  4L6V 5;  3NTK A;  3I56 T; 
#chains in the Genus database with same CATH homology
 2J6O A;  2FO0 A;  2FRY A;  1YNZ A;  1UJ0 A;  1PKS A;  1TG0 A;  1IO6 A;  2LQN A;  4AFZ C;  4JJC A;  1HJD A;  3UA6 A;  2F2V A;  2IIM A;  4RTT A;  3EG1 A;  2K2M A;  2VWF A;  2KBT A;  3VS4 A;  2DBK A;  4DEY A;  3PVQ A;  1OOT A;  2RNA A;  1W6X A;  4Z89 A;  1NYF A;  3I5S A;  3RNJ A;  2KNB B;  4HVU A;  5FW9 A;  2D1X A;  1WI7 A;  2OI3 A;  3M0U A;  5GJW B;  1X6G A;  1SRM A;  2LJ0 A;  1QCF A;  4J9D A;  3ZL7 C;  2EYX A;  2GGR A;  1ZBJ A;  1TUD A;  2RQV A;  2K7A A;  2EGA A;  2ESW A;  3QWY A;  4J9F A;  5L23 A;  5I22 A;  4J9I A;  4ZNX A;  2O9V A;  4RUG A;  3UA7 A;  2EBP A;  3H0F A;  4LNP A;  2DIL A;  1QLY A;  2YSQ A;  3LH5 A;  1I07 A;  1NLP C;  2DL4 A;  1SHF A;  4HCK A;  2O88 A;  2LX7 A;  1Z9Q A;  3A98 A;  2SRC A;  1WX6 A;  2RF0 A;  4F17 A;  1K9A A;  1GCP A;  1E6H A;  2ROT A;  1U5S A;  2K3B A;  1SHG A;  1QKW A;  3I5R A;  4D8K A;  4HXJ A;  1NEB A;  1UHF A;  1RLP C;  2K79 A;  2D8H A;  2DRM A;  1AVZ C;  1OPL A;  2HEQ A;  2KGT A;  1MV3 A;  2GQI A;  4IIO A;  2GBQ A;  1M3B A;  1YP5 A;  3VRZ A;  5IXB A;  5FWB A;  1UEC A;  2FRW A;  2F2X A;  2AZS A;  3M0T A;  4JPB W;  1K0S A;  1X2Q A;  4IIM A;  3M0Q A;  1B07 A;  2KRM A;  3JV3 A;  1H8K A;  1SSH A;  2CDT A;  1I1J A;  5IXF A;  2M51 A;  2J06 A;  1K0X A;  1AZG B;  2KYM A;  4AFS C;  1N5Z A;  4AG2 C;  5HCK A;  4Z8A A;  1QKX A;  1NLO C;  1AWJ A;  1NYG A;  2YUN A;  4J9E A;  1M27 C;  2LZ6 B;  2L0A A;  3VRY A;  1KFZ A;  1UHC A;  3EGU A;  4AFQ C;  1GRI A;  2GTO A;  1UFF A;  3ULR B;  2DLP A;  3QWX X;  3U23 A;  1WYX A;  1EFN A;  1M30 A;  3FJ5 A;  2DL3 A;  1QWF A;  3UF4 A;  1AEY A;  1ZSG A;  2EKH A;  4CC4 B;  1AD5 A;  2L2P A;  4GBQ A;  1G2B A;  1WDX A;  3NPF A;  1NEG A;  3M0P A;  4J9B A;  2X3W D;  1NM7 A;  5IH2 A;  1U06 A;  1ZX6 A;  4X1V A;  2XMF A;  1X6B A;  4RTW A;  2J6F A;  1W1F A;  2PNI A;  1BB9 A;  2I0N A;  4JZ3 A;  1KIK A;  5FWC A;  1JO8 A;  1VYU A;  4LE9 A;  1J3T A;  2FPF A;  2DJQ A;  5IHK A;  4D8D A;  2KRS A;  5I11 A;  1WXT A;  1UTI A;  2EW3 A;  2KRN A;  1PHT A;  3RBB B;  2JW4 A;  1YWP A;  2H8H A;  4J9C A;  2AK5 A;  3VS7 A;  1QWE A;  2RQU A;  2MIO A;  3M0R A;  2QDL A;  2RQR A;  4WCI A;  2EPD A;  2NWM A;  4CC7 A;  1RI9 A;  2OAW A;  2EGE A;  2K9G A;  2X3X D;  2FEI A;  2JXB A;  1H3H A;  2FPD A;  4J9G A;  4JZ4 A;  1MV0 B;  4JJD A;  2HDA A;  3THK A;  2J6K A;  1PKT A;  1WIE A;  3EG0 A;  1WLP B;  2HSP A;  2FG0 A;  1H92 A;  2LNH B;  4HVW A;  4E6R A;  1AOJ A;  3H0I A;  4OMM A;  1WXU A;  2J05 A;  4HVV A;  4OML A;  2A37 A;  1AWW A;  4RTY A;  2C0I A;  4JJB A;  1KJW A;  1UJY A;  1T3L A;  3VS1 A;  3CQT A;  2BTT A;  1UG1 A;  2DRK A;  4CC2 A;  2ED1 A;  4DEX A;  2L3S A;  1VYV A;  2EYY A;  1HD3 A;  4F14 A;  4CC3 A;  1GFC A;  1ABQ A;  2B86 A;  2PZ1 A;  1PWT A;  2JTE A;  2KT8 A;  2MCN A;  1JXO A;  1BK2 A;  1K1Z A;  3EHR A;  2OJ2 A;  2LCS A;  1T0J A;  4QT7 A;  1Y0M A;  2EVR A;  2W10 A;  4M4Z A;  2BZY A;  4OMN A;  1M3C A;  3EHQ A;  2DE0 X;  3TVT A;  1BBZ A;  1X27 A;  3REB B;  2LJ3 A;  4OMQ A;  1V1C A;  4K11 A;  2DNU A;  1JXM A;  1XOV A;  1SRL A;  4J9H A;  3TSW A;  1Z9Z A;  2KYB A;  2EGC A;  2MOX A;  1X2K A;  1HSQ A;  2ROL A;  2V1Q A;  1VYT A;  2W0Z A;  3KFV A;  2F2W A;  1K4U S;  2O9S A;  2DF6 A;  1K76 A;  1KSW A;  3REA B;  2L3P A;  4LUE A;  2RQW A;  4RTV A;  2ABL A;  2FPE A;  1UUE A;  1VA7 A;  3UAT A;  1X43 A;  1CKB A;  4GLM A;  1T3S A;  2G6F X;  1ZUK A;  2KE9 A;  4F16 A;  2KT1 A;  2YUO A;  2JMC A;  2DM1 A;  2GNC A;  2HCK A;  1GCQ A;  2P4R A;  3NHN A;  2PTK A;  4R0K A;  3PVL A;  2RQT A;  3PE0 A;  2DVJ A;  4AFU C;  1WA7 A;  2GTJ A;  2CT4 A;  2DMO A;  5EC7 A;  1T0H A;  2AKL A;  1G83 A;  4Z88 A;  2ECZ A;  3SHW A;  2KXC A;  2HBW A;  3VS0 A;  5IHN A;  4AG1 C;  1WFW A;  2E5K A;  2LMJ A;  1FYN A;  1AZE A;  4RTZ A;  2M0Y A;  2ENM A;  2CSI A;  4ESR A;  2JM9 A;  2DYB A;  3VS6 A;  2A08 A;  1OEB A;  1JQQ A;  2CT3 A;  1B3Q A;  2JS0 A;  3EG3 A;  1GL5 A;  2JS2 A;  2A28 A;  2CUD A;  2YDL A;  2JM8 A;  2VVK A;  2DX1 A;  3NMZ C;  4Y92 A;  5IHI A;  1LCK A;  3H41 A;  1W70 A;  4ORZ A;  1YN8 A;  2KR3 A;  1RLQ C;  3SEM A;  4A63 B;  1UE9 A;  3H0H A;  2ED0 A;  1MUZ A;  2CUB A;  2DL8 A;  2A36 A;  5GJV B;  1OPK A;  4RTU A;  1U3O A;  1GBQ A;  2YT6 A;  2LQW A;  1SPK A;  2DL5 A;  2KEA A;  1Y57 A;  2BZ8 A;  2SEM A;  2K6D A;  3I35 A;  3R6N A;  3VS5 A;  1PRL C;  3C0C A;  2O2O A;  2DBM A;  1CSK A;  3TSZ A;  2D8J A;  2VKN A;  1RUW A;  1BU1 A;  2LP5 A;  4KRT A;  1E6G A;  1PRM C;  1X69 A;  1NG2 A;  2KRO A;  1ZUY A;  3NGP A;  1UGV A;  2CSQ A;  2V1R A;  1CKA A;  1TUC A;  1JEG A;  2JMA A;  4LN2 A;  3GBQ A;  1YCS B;  2L3Q A;  2DL7 A;  1JU5 C;  2J7I A;  2NUZ A;  2C0T A;  4RTX A;  2RN8 A;  3EG2 A;  2C0O A;  4OMO A;  4OMP A;  2AZV A;  1AWX A;  1WXB A;  2YUQ A;  2CRE A;  1GFD A;  1M3A A;  1GCQ C;  1OV3 A;  2RMO A;  1I0C A;  1PNJ A;  3IQL A;  4LUD A;  2RPN A;  2YUP A;  2JT4 A;  1YWO A;  2AKK A;  4EIK A;  2LJ1 A;  1ARK A;  2EYW A;  3VS2 A;  1SEM A;  2EYZ A;  1E7O A;  1UDL A;  3O5Z A;  5ECA A;  1A0N B;  3I9Q A;  4FSS A;  2CH4 W;  1AWO A;  2CH4 A;  1ABO A;  1ZUU A;  2DA9 A;  3M0S A;  3VS3 A;  1FMK A;  2EQI A;  1M8M A;  2KXD A;  1ZLM A;  1GBR A;  2BZX A;  1S1N A;  2D0N A;  2O31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...