2P4RA

Structural basis for a novel interaction between aip4 and beta-pix
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2p4rA00
1U5SA 2C0TA 1QLYA 3U23A 3I35A 1UG1A 1AZGB 2CH4A 1NYFA 1MV3A 2ABLA 3H0FA 3VS6A 2X3WD 2KR3A 2AK5A 1UGVA 4J9FA 4RTVA 2EVRA 2KBTA 2FRYA 4AG2C 1ZBJA 4LE9A 1PNJA 3SHWA 2RN8A 4OMLA 2ECZA 1B3QA 1H92A 4RTTA 2EYYA 4JPBW 3VS3A 2DVJA 4D8KA 2CREA 3O5ZA 1M3BA 1WA7A 2RPNA 2BZXA 4OMMA 3VS4A 3PE0A 2AKLA 1HD3A 1K9AA 1PKSA 2JM9A 2D0NA 3VS1A 4IIOA 1AWJA 2RNAA 1JQQA 4JZ4A 5IHIA 1YWOA 4J9EA 1NG2A 4X1VA 3UATA 2MCNA 2JS0A 2O88A 1X2KA 2LMJA 1QCFA 2K79A 2LNHB 2DLPA 1UUEA 1AD5A 2MOXA 1YWPA 1UHCA 2KE9A 3RBBB 3NGPA 2CH4W 3NHNA 4F14A 2W0ZA 1EFNA 1GRIA 2ED0A 2RMOA 2DL5A 3VS2A 2BZYA 1WIEA 2D8JA 1S1NA 3VRYA 1H3HA 1PRMC 1H8KA 1GCQC 1SHFA 2GTJA 1M3CA 1NLPC 1YN8A 2EKHA 1WXBA 2OJ2A 2DE0X 2NUZA 1UECA 4GLMA 1GCQA 2LP5A 1E6HA 1SRMA 2W10A 2ROTA 1SSHA 3EG0A 2KEAA 2FPDA 2YUPA 1NEBA 4KRTA 4IIMA 4CC7A 3R6NA 2GBQA 1GCPA 1JXOA 4OMNA 2E5KA 1X6GA 3M0TA 1ZLMA 2HDAA 1K76A 1G83A 1CKAA 4RUGA 2BTTA 3TSZA 1OOTA 2PNIA 1UDLA 2A08A 4GBQA 2G6FX 2KXDA 2RQRA 4CC4B 4QT7A 4JJCA 2J06A 2EYZA 5ECAA 1U3OA 1ZX6A 1B07A 2CT3A 2FO0A 1QKWA 4AFQC 2FRWA 1X27A 2DX1A 1X6BA 2DYBA 1PWTA 1FMKA 1BK2A 2J6OA 4Z8AA 1M3AA 2M0YA 1SEMA 1I1JA 2DBMA 2LZ6B 2YUQA 1E7OA 1PKTA 4J9CA 4OMQA 5GJWB 2ED1A 2KRNA 3REAB 1K0XA 2KGTA 1KSWA 3C0CA 4D8DA 1TUCA 1RLPC 2YSQA 4F16A 1VYVA 1M30A 2HCKA 2JTEA 3IQLA 4OMPA 2CDTA 2FPEA 1NM7A 2YUOA 2KROA 4HVWA 2SRCA 3GBQA 3NPFA 2O2OA 2KYBA 1JU5C 3FJ5A 5IXBA 1VA7A 1KFZA 2EQIA 2LJ3A 1CKBA 3SEMA 1AWOA 1BB9A 2BZ8A 2L3PA 2J05A 1BU1A 1WYXA 1K1ZA 2JT4A 1RLQC 4Y92A 4J9HA 2CUDA 2DNUA 5GJVB 1NLOC 3H0HA 5EC7A 3PVLA 2EW3A 4F17A 4AG1C 2D1XA 4LNPA 2F2XA 2V1RA 1X43A 2EPDA 4J9IA 2AZVA 2M51A 3EGUA 1AZEA 3KFVA 5IH2A 1JXMA 1A0NB 1Z9ZA 3UA6A 1ZUUA 3M0UA 2K9GA 2H8HA 1YCSB 2MIOA 1WXUA 4RTZA 2V1QA 1MUZA 2DMOA 2EGEA 2FG0A 2L3QA 1AWWA 2YDLA 1WX6A 4EIKA 2KYMA 3VRZA 3UF4A 2HEQA 2GNCA 1TUDA 2LJ1A 4R0KA 1WI7A 4ZNXA 2K7AA 1TG0A 2I0NA 4M4ZA 4DEXA 2P4RA 1X69A 3QWXX 1WLPB 4HCKA 3ULRB 3EG2A 2IIMA 2GQIA 5FWCA 3LH5A 1AWXA 1AVZC 2X3XD 4WCIA 2HSPA 1M27C 1Y0MA 1UTIA 2L0AA 2LQNA 1WXTA 2FPFA 1UJ0A 1ZUYA 3VS7A 2PZ1A 4J9GA 1XOVA 1NYGA 1GBRA 2RQUA 2OAWA 3NMZC 1VYTA 1RUWA 1SRLA 3A98A 1KIKA 2CT4A 4CC3A 4LN2A 2CUBA 2J6FA 2GTOA 2J7IA 2JM8A 2DILA 3H0IA 2XMFA 1Y57A 2ESWA 2O9VA 2K3BA 4CC2A 4RTYA 1UE9A 2CSQA 2DJQA 3VS5A 1UJYA 3EHQA 1HJDA 1Z9QA 1OV3A 2DBKA 4E6RA 1IO6A 2L2PA 3REBB 1FYNA 4RTXA 2K6DA 2EYXA 4Z88A 1OPLA 2A36A 4AFSC 4RTUA 5HCKA 1SPKA 1GBQA 2LQWA 2JMCA 2EYWA 3TSWA 2EGCA 2F2VA 3I9QA 1PHTA 3UA7A 1U06A 2ENMA 2KT8A 2D8HA 1SHGA 3EHRA 2JXBA 3I5RA 2YUNA 5I22A 3QWYA 1GL5A 2AZSA 1T3SA 4LUEA 2FEIA 5FWBA 4J9BA 1OEBA 1CSKA 3TVTA 4Z89A 2AKKA 1J3TA 1UFFA 2DL8A 5FW9A 2DM1A 1M8MA 1ABOA 2KRSA 3M0PA 4OMOA 1ZUKA 1WDXA 2JS2A 2LJ0A 3CQTA 2O9SA 1WFWA 1RI9A 2GGRA 4HVVA 1X2QA 4AFUC 4HXJA 1MV0B 2DL7A 1QWFA 2DL4A 1V1CA 4JJBA 2VKNA 3JV3A 1G2BA 2C0IA 2LX7A 2DF6A 3VS0A 1GFCA 1QKXA 2DA9A 3H41A 1AEYA 4ORZA 2K2MA 1LCKA 5IHNA 1K4US 1N5ZA 4K11A 1JO8A 2OI3A 4J9DA 2C0OA 2EGAA 2DL3A 3M0QA 4DEYA 2HBWA 1ARKA 5L23A 1E6GA 2KRMA 2RF0A 1UHFA 1HSQA 2DRKA 1VYUA 1YNZA 1ABQA 2B86A 1JEGA 4RTWA 2RQWA 3M0SA 2KT1A 5IHKA 3I5SA 4ESRA 1YP5A 2SEMA 2J6KA 2F2WA 1GFDA 1KJWA 2A37A 1ZSGA 3M0RA 4LUDA 2RQTA 4AFZC 1AOJA 1T0JA 3ZL7C 2L3SA 2VWFA 1W6XA 2RQVA 4JJDA 1W1FA 1T0HA 2PTKA 3RNJA 1OPKA 1BBZA 2ROLA 2JW4A 2KXCA 2YT6A 5I11A 5IXFA 4HVUA 2JMAA 2QDLA 1K0SA 1W70A 2CSIA 2KNBB 1I0CA 2NWMA 3PVQA 2EBPA 2DRMA 1QWEA 2LCSA 3EG3A 1I07A 4FSSA 4JZ3A 3EG1A 1NEGA 4A63B 2VVKA 3THKA 2O31A 2A28A 1PRLC 1T3LA
chains in the Genus database with same CATH superfamily
1U5SA 3S3NA 1UG1A 1PD1A 4FW2A 2CH4A 1NYFA 5I21A 2E65A 4M78F 1MV3A 2HMAA 3H0FA 3RKYA 3VS6A 1Q81U 2KR3A 4RTVA 2MMPA 2HQXA 4X9CA 3JCMg 4J6XA 2ECZA 1XQHA 4C5GA 1R77A 2CZ0B 4OMMA 2CZ6B 2BZXA 1SF9A 3H9NA 1JBMA 2BE9B 1K9AA 4M7AB 2HL3A 1Q82C 2MPXC 4D6WA 2JJ9A 2XDPA 4IIOA 1AWJA 4N4GA 3CCQT 5A0LA 2QQAA 1JQQA 3DLLA 4J9EA 5DLOA 3JB9G 3M54A 4X1VA 5FU7B 1X6OA 1VQOT 3GPLA 2KVQG 2DTHA 4J7IA 3ZBDA 2VXEA 2LNHB 3SWNC 3OYCA 1YWPA 3OYJA 1C0MA 1Q86U 2OTLT 4DOVA 2QXFA 4BE1A 4E2FB 2BKDN 3DLMA 2VASA 3QSUA 2DXTA 1H8KA 3L1AA 4KULA 3CCQQ 1MMAA 2A0FB 4EMKC 3EH1A 1HK9A 1RI0A 3CMAQ 2V8JA 2VB6A 1VQOQ 1D3BA 2NUZA 1K8AR 4JRKA 2HQEA 5AYFA 3MEWA 3PNWC 1FWZA 4EMKA 1YJNQ 2ROTA 2LX9A 2OTLQ 3INZA 2HQHA 4C8QB 3JCMb 3V7RA 3MKDA 3HRSA 2WACA 3CC2T 3TEEA 4C92E 1VQMT 5CAIA 2DO3A 1VIFA 2PNIA 4QQGA 3N5BB 2L5QA 4BDZA 4QVDA 2VV5A 3BW1A 4AFQC 1X27A 3CCLT 4HT8A 5J39A 4FL6A 2HKNA 3O8VA 1Q95G 4A4FA 1F1BB 2BIVA 3OS1A 2DBMA 3CC2Q 3FDRA 3I55A 1VQMQ 3CCSA 2ED1A 3S3MA 1K0XA 2KGTA 3C0CA 4B6MA 5GANj 4D8DA 3EGXB 4QW2A 1BIAA 1IXDA 4F16A 1M30A 1D0XA 2K5IA 1UGSB 2DJZA 2CDTA 1NM7A 2KROA 4HVWA 1KQSP 3JB9J 3D7SB 3GBQA 3NPFA 3CCUA 3CCLQ 2CP7A 1KFZA 2QASA 4M78E 2DERA 5GANh 2JTFA 4JDSA 2DXUA 5DLQE 3G7ZA 2BZ8A 3CCJT 4OF1A 1BU1A 3RMQA 3OYKA 3EH2A 4PJMA 2QGGA 4M75C 1K1ZA 3G6ET 1IHWA 2OTJT 4Y92A 4J9HA 4RCBA 1WHMA 2E6NA 5LJ3d 3H0HA 3PVLA 1GXIE 4C8QC 2F2XA 2V1RA 1BI1A 3X20B 1JXMA 5LJ5d 1BCOA 1Q82U 2E64A 4IURA 1S72T 2K3XA 4RTZA 2PVGB 1KQSA 5LJ3f 1MUZA 2OAUA 3CCJQ 4M7AF 2L89A 1VQKT 1AWWA 3C12A 1YI2T 2WSFE 3QDRB 4DBHA 5CKBA 4FCYA 4WTOB 3G6EQ 2OTJQ 5LJ5f 2I0NA 2XHCA 1QP2A 4OMFB 4M4ZA 1X69A 2E10A 1WLPB 1Y7XA 2K57A 1OZ3A 4HCKA 2FVUA 4EMGA 1AWXA 3JAME 3GIBA 1AVZC 4IUVA 2V8IA 2DD4A 2L0AA 4FT4A 5GAN6 2HBPA 1S72Q 4J9GA 4A4EA 2LDMA 1YCYA 4J83A 3OYAA 1GBRA 1YI2Q 1VQ9A 3OBWA 3WVEB 4B9WA 1KIKA 1QVPA 4OGCA 4LN2A 1WJRA 3JCMJ 1VQ5T 2J6FA 1Q81R 2DILA 2GF7A 5KYXA 1PM3A 3OYHA 3HSBA 2O9VA 2K3BA 3G71A 4M75F 1LNXA 1N8RR 1VQPQ 3G1JA 5GAMj 1UJYA 4DOWA 1HJDA 4YTLA 4KH0B 4XTWA 4C8QF 1JRIA 3PIOA 2E3IA 3JB9I 2ZPEB 3ZEHA 3FC3A 3PIPA 1SPKA 2XK0A 2JMCA 1ZA1B 1OU9A 1MNDA 1VQ5Q 2F2VA 3I9QA 1PHTA 3UA7A 1U06A 1WPYA 2QQBA 2JXBA 3QWYA 4KH1B 2FHDA 1T3SA 2RJCA 5GAOl 5I2SA 2AKKA 2LVMA 4OGEA 1ABOA 4A4HA 4PK4A 4PJJA 2KQWA 2CP2A 2LJ0A 3OYLA 3CQTA 4FIBA 2JOYA 1V76A 1WFWA 2IPOB 1YITT 3CCET 4AFUC 3Q1JA 3A8MB 1KQSS 1M1KC 8AT1B 2NUPA 2VGNA 1MV0B 1M2VB 2DL7A 2R5AA 1QWFA 2DL4A 2NUTA 4JJBA 3JV3A 5KYYB 2X4XA 3H41A 4GY5A 2QQ9A 3OYBA 1LCKA 2X4JA 3G4ST 2K3YA 2FZGB 2O01E 2C0OA 4V2SA 4DEYA 3QJYA 2CS7A 2M9UA 4E7SA 1VQNT 1E6GA 4J7FA 1M90R 2H3EB 3CCEQ 1ABQA 4RTWA 2KT1A 1FX7A 5IHKA 3UDCA 1VQLT 4M77C 2DZCA 1WJQA 2SEMA 4BB7A 1G5VA 1ZSGA 2EJFA 4M7AE 2PUOB 2LT1A 4XTUA 2XKOC 2RQTA 1IRXA 1T0JA 3G4SQ 2ZPBB 2R5MA 3CC7A 4XU3A 2L3SA 2CGHA 1K9MC 3HRTA 1WHHA 2KAFA 1R8OB 3JB9D 1BBZA 1NJIC 2CP5A 2KXCA 5I11A 4MDXA 3M56A 2CSIA 2KNBB 4ZN1A 2RHZA 3PVQA 2DRMA 3C94A 3EG3A 1I07A 1EZZB 4FSSA 1VQLQ 4JZ3A 4PJOB 2Y4YA 4C92C 4EMHA 3LWIA 3NTHA 3THKA 3JCMP 1I5LA 3VRZA 1YBYA 2QI2A 4QKUA 3U23A 4XK8E 3PGGA 3QBYA 5GMKl 4DBRA 1RAFB 4M75G 4C92A 5GANd 3AHUA 3I56T 2EJGA 1UGVA 1SKUB 4J9FA 3QZ9B 4M75E 4C0DB 1ZBJA 1PNJA 1ZQ1A 3SHWA 3FJPA 4C8QE 3M55A 1IB8A 2EYYA 1RL2A 3VS3A 5GANf 4J5YA 3PE0A 3RIRA 4C92D 5KH6A 2RNAA 2FL7A 2PQWA 4M77F 2CP0A 1YJ9T 1Q82R 4ZN3A 2ZPHB 4Y91A 3P8BB 3I56Q 2RJEA 1UGRB 3BFMA 1NPPA 1X2KA 2K79A 2ATCB 2K2VA 4UC4A 2KE9A 3RBBB 2GCXA 3NHNA 4F14A 2VXFA 1K73R 1GRIA 4M78A 1N27A 3VS2A 3PMIA 3GNFB 3VRYA 1H3HA 4FYVB 2RD1A 2P84A 1GCQC 4P5NA 1M1KU 3P8HA 1YJ9Q 2GTJA 1WHGA 1NLPC 1WXBA 2OJ2A 3CD6Q 4HT9A 3L2UA 2Z0WA 3EFOA 1GCQA 1E6HA 1G8XA 4M78D 1KG1A 2DZ9A 2JVVA 3EG0A 4L59A 4BD3A 4XU0A 2FPDA 1NEBA 3LLRA 4NOYA 4BI8B 3TQ7P 3OSVA 3ASKA 3X28B 4A4GA 2E5KA 1X6GA 3M0TA 1G83A 1CKAA 1OOTA 3VYGA 5CQXA 3OYIA 3TU4K 3CMEQ 2KSSA 2A08A 1VOMA 4C5IA 2G6FX 4KUIA 3I55T 4QT7A 4JJCA 3CCST 2QTXA 2ZZDA 1FMVA 2EYZA 5ECAA 1U3OA 1ZX6A 2AIRB 2DX1A 5GAMd 4HCCA 3A8LB 3MP6A 3J81E 4PFZA 4XTYA 1M3AA 1K9MU 4DBQA 1I1JA 4XTXA 2YUQA 2E4HA 4JRPA 1BYMA 2QK0A 4J9CA 3BE3A 4OMQA 5GJWB 1NJIU 2KY9A 4C0ZA 1N6AA 1YJWA 5M9OA 1UB4A 2R58A 5GAMf 4C0GA 2YSQA 3OYEA 3I55Q 1P92A 3OY9A 1VQ4A 3CCSQ 1KD1C 4OMPA 1PCXA 2Y90A 4IUTA 2V8KA 1M8VA 5J3BA 4DBFA 2KDSA 1FXXA 2KYBA 1TXQA 5IXBA 4PJOF 2HL5C 2EQIA 2EQJA 2J05A 4PJLA 3RR6A 3NTKA 1WYXA 1VQ7A 3JCMh 5GJVB 3M53A 1NLOC 1Y96A 2M16A 4VUBA 4AG1C 1BI3A 4M77G 1I81A 3CCRA 2MAMA 4X9DA 1V29B 1XTDA 4J9IA 5D6YA 3A5ZB 5GAOp 3OS0A 3H6ZA 5KCOA 3PT9A 5IH2A 4M77E 3SWNA 1ZUUA 2K9GA 3CEYA 3HKSA 4X34A 5CKEA 4F7UB 5GMKi 2L3RA 2DMOA 2DIQA 2DFUA 2JUFA 1W4SA 2HKQB 1I4K1 2KYMA 3V8LA 1TUDA 2B8AA 4R0KA 2K7AA 3E2UA 4IKFA 1YHQA 1SG5A 3J7AF 2VYTA 5FWCA 4C92G 2RHUA 2COYA 4ZGEB 2EWNA 3QZ5B 1Y0MA 4C5HA 4C0FA 3VUBA 5HY6A 3G71T 1WXTA 1EX4A 4RKUE 2FPFA 3QKJA 1UJ0A 1ZUYA 2PZ1A 3MO8A 1KQ2A 3MCAB 5C0MA 1H641 1NYGA 3A1PA 2RQUA 4ME7A 2XDBA 4DA4A 3NMZC 1SRLA 2QTVA 4M7AC 3AT1B 3HFNA 4M7DB 1WJSA 2F1LA 4KGXB 3VV0A 2CUBA 2A3LA 2J7IA 4ELZC 3CXCP 2ESWA 5FU7C 4CC2A 5HK0A 3LX7A 4M7AA 3EHQA 2QA4T 3G71Q 3OQ5A 5CQYA 3L2ZA 5GAOq 4RTXA 1OPLA 4QQ6A 4BE2A 3OYMA 2X51A 2XI9A 4AMCA 1RAIB 4RTUA 4M78G 2LQWA 2DEUA 4M7AD 2DAQA 2LT4A 2CP6A 2KT8A 2D8HA 3I5RA 2YUNA 1D1BA 1KQ1A 4LDYA 5GMKe 3TCJA 3ZFJA 1J3TA 3CXCA 1M8MA 2YHTA 4OMOA 2QA4Q 4LDUA 4E7JA 1WDXA 2JS2A 2RI5A 4FM4B 4MZMA 3L42A 1M1GA 3QIIA 1B34A 4QQDA 4ATOA 1KD1U 2I2LA 4B9XA 4M75A 1WNLA 3OYGA 1V1CA 2DEQA 2VKNA 4J8OA 2EQMA 5FLXE 4PJOE 1NPRA 3OSSC 4BI3A 3BDUA 3KXTA 1D0ZA 2ZAEA 3FRNA 4ORZA 1AT1B 3LW5E 1KC8C 4C8QA 5IHNA 3CCMT 5GAOm 2LC4A 4KT0E 1QVGP 5A2QE 3CCQA 3CC7T 2HBWA 2LTOA 1ARKA 2RF0A 3CMAA 4M75D 4R55A 5KYWB 5HKCA 2R57A 1VYUA 3WXMB 3QO3A 1U1SA 2X35A 4C8QD 5L8RE 3OYFA 3OYNA 1YJNA 3MEAA 2F5KA 1AHJB 2A37A 2P0QA 3M0RA 4LUDA 7AT1B 3FLGA 1U1TA 1C6VX 1AOJA 5KYNA 3CCMQ 1VQKQ 2DYIA 3PTAA 3ZL7C 1Y71A 2VWFA 2RQVA 2H3JA 3F70A 4KGVB 3JCMW 3H8ZA 3EGXA 3RNJA 1NZ9A 3RERA 5GAOr 3C4SA 2ROLA 1QVGA 2IG0A 3V7CA 3S3OA 2QDLA 2EBPA 1D0YA 1D1AA 2LCSA 1NJIR 1TSFA 3KUFA 1X01A 1O75A 5GAOn 1OYXA 5AT1B 3EGDB 2LNVA 4A63B 1VQ8A 3UT1A 2DK3A 1PRLC 4TVRA 1T3LA 4LDXA 2C06A 1QLYA 2Y4XA 1MMNA 3I35A 1LOJA 1VQMA 4J6YA 2VGMA 2ABLA 3LWHA 3GP8A 2AT1B 3CXCS 2G3RA 2EVRA 2KBTA 3RKXA 4BY6B 2FRYA 3MJXA 2X4WA 4LE9A 3JCMd 2QEXT 1H92A 1BI0A 5GAN7 3CCLA 1PSEA 4E6RA 2DVJA 4D8KA 3O5ZA 3M9QA 3VS4A 1M1FA 2AKLA 3CCVT 1Q86R 3HHTB 1HD3A 3C95A 1YIJT 1PKSA 4FT2A 3TREA 4L6V5 2D0NA 3VS1A 1OULA 1I5OB 2O4XA 5IHIA 5GMKm 1NG2A 3JCMf 3R6OA 3X24B 1ACMB 5CO7A 2MCNA 2JS0A 2YLBA 5KCHA 3JCMQ 3CBMA 1QCFA 3SB2A 5KYUB 4Q5WA 2DLPA 4MZTA 1UUEA 2MOXA 4WF2A 1UHCA 2QEXQ 3NGPA 2CH4W 3KBGA 2W0ZA 1EFNA 5GAN8 5DY9A 2ED0A 2MI6A 3OW2P 1WIEA 3CCVQ 1S1NA 1YIJQ 1YITQ 3OMCA 3CCJA 2K4YA 4R56A 3ER0A 3MP8A 2DXBA 2RHYA 2ZGWA 1RACB 3G6EA 1JB0E 5CK9A 1RAAB 1YN8A 4M7AG 1UECA 2MF2A 2F5TX 5C6SA 3SFMA 2XIDA 1QVGS 1KC8U 2W10A 1C1AA 2KI7A 1Q7YC 3EG9B 2VUBA 2CKKA 2DD5A 2YUPA 4M77A 4IIMA 4CC7A 1VQNQ 1GCPA 1ZLMA 4E7IA 1K76A 1YI2A 3NFCA 1R0BG 5D6WA 3UWNA 3TSZA 3OW2A 4JRIA 4E7HA 3NTIA 4ELYC 1ZSZB 4GBQA 2RQRA 2KXDA 1OI1A 5LJ3e 1FMWA 1UGQB 2J06A 1YJWT 5KE3A 1IREB 2CT3A 2WSEE 2FO0A 4M77D 4MZPA 1VQ4T 2RK2A 2FRWA 1BIBA 2QDYB 1X6BA 1UEBA 3CBOA 1VQPA 3M4GA 4ANJA 1FMKA 1N8RC 3E1SA 3OYDA 4F7UE 5LJ5e 5IN1A 2J6OA 2M0YA 5HK3A 1SEMA 1RADB 1PKTA 4RMOA 2IVWA 3MHXA 5J26A 2KRNA 3REAB 2LRQA 4KUDK 1QP3A 4XU1A 4C8QG 2V26A 3VKIA 5KYYA 3MPUB 2DTIA 3QPHA 2HCKA 1VQ7T 4EDUA 2JTEA 4RG8A 1YJWQ 2FPEA 2YUOA 2SRCA 4E7ZA 1KD1R 4LXCA 2O2OA 3FJ5A 1VA7A 3MEVA 2JNGA 4PKCC 2LJ3A 3SEMA 5GAN4 2MK5A 1BB9A 1AWOA 2L3PA 4F04B 3VYHB 4PLIA 3GOXA 1DJ7B 1NE8A 2OX7A 4PL6A 2JT4A 4M7DE 4A4KA 4CI0C 5LJ3g 4IUPA 2CUDA 4JRQA 2JTMA 3BY7A 1HXDA 5EC7A 1VQ7Q 2EW3A 2F69A 3HPWA 4F17A 2D1XA 2COZA 3OS2A 2E5QA 2LQ8A 2AZVA 3URGA 2M51A 2D6FA 5LJ3j 5LJ5g 1AZEA 3KFVA 1YHQT 1NBEB 4NL2A 3UA6A 3LYIA 3M0UA 1YCSB 2YRCA 2V1QA 2EGEA 2FG0A 2L3QA 4A54A 4XU2A 4PJOC 1IZ6A 2YDLA 1M90C 1WX6A 3CCEA 4EIKA 2K5LA 2QQSA 5LJ3h 2E41A 2HEQA 2GNCA 4J6WA 3RUXA 2LJ1A 2P0PA 2RO0A 1TUGB 4ZNXA 3OW2S 1TG0A 1MNEA 4PJOA 3QWXX 1VQ6A 3ULRB 2GQIA 3FIFA 2HSPA 4WCIA 1G3WA 2XD0A 1VIEA 1YHQQ 4C0DC 3G4SA 2LQNA 4IUQA 4JS4A 3CPWP 2HNIA 4QVZA 4DQ2A 3VUZA 2RH2A 2LCCA 1RUWA 2ZPIB 1YFNA 4HKEA 4PJOD 4CC3A 3QYHB 4XTZA 1JJ2P 1D3BB 1QCNA 4OB1B 1Q7YU 2XMFA 2QG9B 2LQKA 1Y57A 4RTYA 3CCUT 1UE9A 4EMKB 2CSQA 3CC4A 1Z9QA 1OV3A 2DBKA 1IO6A 1Y07A 4KGZB 3M57A 4BI4A 1M5Q1 4Z88A 4XTVA 2A36A 2DETA 3CPWA 2CP3A 1EIFA 5HCKA 1GBQA 4RG2A 2EYWA 3M59A 2EGCA 4IUUA 1PSFA 5CKDA 2FZCB 2D0QB 3QYGB 1N8RU 1GL5A 3CCUQ 1JJ2A 5FWBA 4J9BA 4FYWB 1CSKA 1WGSA 2DL8A 1UGPB 2RI3A 5CIUA 1XNIA 5FRNA 3CPFA 2X4YA 2YWWA 2YLCA 5FU6B 2DXCA 2GGRA 1TU0B 4HVVA 3A8GB 3I56A 1B7TA 4FSXA 4LDVA 1G3SA 5A0GA 3EAEA 4N0AC 1R0CB 5D6XA 3L2RA 3CMAT 2RM4A 1U8RA 2DF6A 3VS0A 1GFCA 1QKXA 1BI2A 1KK7A 2QGFB 2E1HA 2FYKA 3HRUA 2EQUA 2QAZA 1K73C 1YJNT 4N0AA 3GF5A 1MMGA 2D9TA 2RI2A 2JN0A 4K11A 1JO8A 1KC8R 4J9DA 2EGAA 3M0QA 4OB3B 1I8FA 5IAYA 2DVEA 2YRDA 5L23A 2KRMA 2NYSA 5GANe 1YJ9A 1VQ9T 4ZTFA 2GFUA 4HCBA 3SD4A 2LCLA 3BDLA 1YNZA 3CD6A 5GAN3 1ZA2B 4EPCA 1JEGA 1QVFP 2RQWA 3M0SA 3I5SA 1B34B 1TTHB 3M5AA 1YP5A 2F2WA 1QMCA 4O5VA 1W2BP 1KJWA 3LH0A 4M75B 3EFRA 2ZPFB 4AFZC 5KE2A 3MEUA 3VU3C 2M1HA 1VQ8T 1D09B 1W6XA 4OB0B 1M90U 2PTKA 3QHSA 4BUGA 1OPKA 1H3ZA 3CMEA 1VQ9Q 2YT6A 1OU8A 4HVUA 4Z02A 4NL3A 2JMAA 2AHJB 2JZ2A 1K0SA 2NWMA 1I0CA 2NLUA 1SSFA 1QWEA 2A7YA 3CPWS 4E47A 5CKHA 3EFSA 1NEGA 3HFOA 5FU6C 1QVFA 5IT9E 2O31A 4AT1B 1BKBA 2C0TA 1W2BA 3PFSA 4BDYA 2XU8A 4PJNA 1VQ8Q 1AZGB 1WHJA 1JJ2S 5GANg 3X25B 3UPUA 2X3WD 2AK5A 2WSCE 4JLIA 2BUDA 3OB9A 1N9SA 1OQKA 2MWOA 3SDZA 2HSEB 4AG2C 4LD9K 4NS5A 1G3TA 2RN8A 4OMLA 4ZTJA 3RMSA 6AT1B 3J80E 1B3QA 5KYXB 2EIFA 4RTTA 4JPBW 3V8KA 2CREA 1M3BA 1WA7A 2RPNA 1WQWA 4F7UA 2JM9A 2PVOB 5FROA 2E12A 2CYZB 5GAN5 4PJOG 4JZ4A 1YWOA 3UATA 4JUVA 3OMGA 1M1KR 1N9RA 2MWPA 2DKGA 1LPLA 2O88A 2LMJA 2YRVA 3OS5A 2KK4A 1AD5A 1RAHB 5FRMA 1MGQA 5GAMe 1IGUA 4M7DC 2RMOA 2DIGA 2DL5A 2EKOA 2BZYA 2D8JA 3QXEB 3LGFA 1PRMC 3QDFA 1VQOA 2DTOA 1K8AC 1SHFA 4M7DA 1M3CA 2EKHA 2DE0X 1OZ2A 2VC8A 2O4XB 2NUPB 5A0DA 1X75C 4GLMA 1RAEB 2LP5A 2OTLA 2NUTB 1SRMA 3A8HB 1K73U 3S6WA 3V7SA 1SSHA 2FB7A 2KEAA 4KRTA 5GMKj 4OVAA 1Q7YR 3R6NA 1VQPT 4F7UF 2GBQA 3CC7Q 1JXOA 3DB3A 1K9MR 2RB6A 2P0KA 4OMNA 3V8JA 4M7DD 2HDAA 1QVFS 4RUGA 1OX8A 2BTTA 2EFIA 3A8OB 4LD6A 1PG5B 2K5FA 1UDLA 2KMTA 1W2BS 3QUIA 1PC0A 4CC4B 3CBPA 3JB9H 5GMKh 4FU6A 1B07A 2XICA 1QKWA 3FEOA 2HAXA 5GAMg 2DYBA 1PWTA 2GFAA 1BK2A 3CC2A 3L2QA 4Z8AA 2HD0A 2LZ6B 4PFPA 1E7OA 3QG1A 2PU9B 3GLXA 5D7UA 4M77B 1KSWA 1TUCA 4M7DF 1RLPC 3JCMX 1VYVA 4C5EA 3RKWA 3IQLA 1VUBA 3DKMA 5GAMh 4XQ3A 2BE7D 4II1A 1JU5C 9ATCB 4GLKA 5DM7R 1HYOA 3MP1A 1CKBA 2QA4A 4XAXB 5CR2A 4N4IA 3VJPA 2MYSA 5KYWA 4KBMB 1RLQC 4C92B 2M02A 2EYQA 2DNUA 4JJNK 1MHNA 4JLGA 4OP0A 2RJDA 4LNPA 1X43A 2EPDA 3RESA 3M4YA 1PD0A 3EGUA 4L5GA 1VQ6T 1A0NB 1Z9ZA 4PLLA 2H8HA 3OA6A 2MIOA 1WXUA 5I2MA 2OTJA 3JRZA 1OX9A 3UF4A 1D1CA 1WQ7A 1M9SA 4BACA 2XDDA 2ZCFB 2M0OA 1WI7A 2QQRA 2RHXA 1RABB 1XJWB 4PFOA 4DEXA 2P4RA 3EGDA 3EG2A 2IIMA 1O9SA 4BE0A 3LH5A 4QVCA 1S72A 2QYZA 2X3XD 2E6ZA 1M27C 4MMKA 1UTIA 4BY6C 3CCMA 1VQ6Q 1VQKA 2EJ9A 3PMTA 3VS7A 1XOVA 2P4TA 4M78B 3CC4T 1K8AU 1LVKA 2YXYA 2OAWA 1VYTA 4ZGJB 3A98A 4E7KA 2CT4A 1Q81C 4F7UG 2X9HA 2GTOA 1LJOA 2JM8A 3H0IA 1KHIA 4FYXB 3JCMc 3EFOB 4A53A 4MMLA 2CZ7B 3L2WA 2DJQA 3VS5A 2L8DA 3L2VA 3META 1IGQA 1QQJA 3JSCA 3E9FA 2L2PA 5LL6S 1M2VA 3HTRA 3REBB 3CC4Q 1FYNA 2K6DA 2EYXA 3T9NA 1WZOA 4AFSC 5CCAA 1VQ5A 2ZPGB 3X26B 8ATCB 5KYUA 1WHLA 1VQ4Q 3WVDB 3TSWA 4Y28E 2ENMA 3CCRT 1IHVA 1WHKA 1SHGA 3EHRA 3JCMV 3LGLA 5I22A 2AZSA 3JB9F 4LUEA 2FEIA 4M7DG 1OEBA 3TVTA 4Z89A 1Q86C 2RHIA 1UFFA 3OBYA 2PVDB 5FW9A 2DM1A 4PNOA 2KRSA 3M0PA 3GNGA 1ZUKA 2XG8D 4N4HA 2O9SA 1RI9A 1TOVA 1X2QA 4OB2B 2RA2A 4HXJA 5CVIA 4FW1A 2RK1A 1G3YA 2CZ1B 3RDVA 1G2BA 2C0IA 2LX7A 5GAN2 3CD6T 3EG9A 2DA9A 2QEXA 3CCRQ 4M78C 1M4ZA 3HP9A 1AEYA 1ZSZC 2FZKB 2K2MA 1TS9A 2PUKB 1K4US 5CKFA 1N5ZA 1RAGB 2DPPB 3CCVA 3HL8A 5LJ5j 1YIJA 1YITA 2EAYA 4MDWA 2OI3A 2DL3A 4FYYB 1ZBXA 2HZYA 1ZSZA 1UHFA 1HSQA 2COWA 2DRKA 3M58A 4E7LA 4LDWA 3E9GA 1QCOA 4C92F 2B86A 3CMET 2EQKA 1TWBA 4CRIA 1Y96B 5LJ5h 3JCMe 2GQVA 3E19A 2E3HA 4ESRA 2J6KA 1GFDA 4JS5A 1TH7A 3FB9A 1QW1A 1BCMA 4RCCA 1VQNA 3SWNB 3QJ6A 4HCZA 3OYYA 4JJDA 1W1FA 3ME9A 1T0HA 1M2OA 4O6JA 2RJFA 2JW4A 1MMDA 5IXFA 1VQLA 1W70A 1ZHIA 1KHCA 3DB4A 3P8DA 3EG1A 4HA8A 2VVKA 4ZGDB 2A28A 5EG2A 2E70A
chains in the Genus database with same CATH topology
1U5SA 2C0TA 1QLYA 3U23A 3I35A 1UG1A 1AZGB 2CH4A 1NYFA 1MV3A 2ABLA 3H0FA 3VS6A 2X3WD 2KR3A 2AK5A 1UGVA 4J9FA 4RTVA 2EVRA 2KBTA 2FRYA 4AG2C 1ZBJA 4LE9A 1PNJA 3SHWA 2RN8A 4OMLA 2ECZA 1B3QA 1H92A 4RTTA 2EYYA 4JPBW 3VS3A 2DVJA 4D8KA 2CREA 3O5ZA 1M3BA 1WA7A 2RPNA 2BZXA 4OMMA 3VS4A 3PE0A 2AKLA 1HD3A 1K9AA 1PKSA 2JM9A 2D0NA 3VS1A 4IIOA 1AWJA 2RNAA 1JQQA 4JZ4A 5IHIA 1YWOA 4J9EA 1NG2A 4X1VA 3UATA 2MCNA 2JS0A 2O88A 1X2KA 2LMJA 1QCFA 2K79A 2LNHB 2DLPA 1UUEA 1AD5A 2MOXA 1YWPA 1UHCA 2KE9A 3RBBB 3NGPA 2CH4W 3NHNA 4F14A 2W0ZA 1EFNA 1GRIA 2ED0A 2RMOA 2DL5A 3VS2A 2BZYA 1WIEA 2D8JA 1S1NA 3VRYA 1H3HA 1PRMC 1H8KA 1GCQC 1SHFA 2GTJA 1M3CA 1NLPC 1YN8A 2EKHA 1WXBA 2OJ2A 2DE0X 2NUZA 1UECA 4GLMA 1GCQA 2LP5A 1E6HA 1SRMA 2W10A 2ROTA 1SSHA 3EG0A 2KEAA 2FPDA 2YUPA 1NEBA 4KRTA 4IIMA 4CC7A 3R6NA 2GBQA 1GCPA 1JXOA 4OMNA 2E5KA 1X6GA 3M0TA 1ZLMA 2HDAA 1K76A 1G83A 1CKAA 4RUGA 2BTTA 3TSZA 1OOTA 2PNIA 1UDLA 2A08A 4GBQA 2G6FX 2KXDA 2RQRA 4CC4B 4QT7A 4JJCA 2J06A 2EYZA 5ECAA 1U3OA 1ZX6A 1B07A 2CT3A 2FO0A 1QKWA 4AFQC 2FRWA 1X27A 2DX1A 1X6BA 2DYBA 1PWTA 1FMKA 1BK2A 2J6OA 4Z8AA 1M3AA 2M0YA 1SEMA 1I1JA 2DBMA 2LZ6B 2YUQA 1E7OA 1PKTA 4J9CA 4OMQA 5GJWB 2ED1A 2KRNA 3REAB 1K0XA 2KGTA 1KSWA 3C0CA 4D8DA 1TUCA 1RLPC 2YSQA 4F16A 1VYVA 1M30A 2HCKA 2JTEA 3IQLA 4OMPA 2CDTA 2FPEA 1NM7A 2YUOA 2KROA 4HVWA 2SRCA 3GBQA 3NPFA 2O2OA 2KYBA 1JU5C 3FJ5A 5IXBA 1VA7A 1KFZA 2EQIA 2LJ3A 1CKBA 3SEMA 1AWOA 1BB9A 2BZ8A 2L3PA 2J05A 1BU1A 1WYXA 1K1ZA 2JT4A 1RLQC 4Y92A 4J9HA 2CUDA 2DNUA 5GJVB 1NLOC 3H0HA 5EC7A 3PVLA 2EW3A 4F17A 4AG1C 2D1XA 4LNPA 2F2XA 2V1RA 1X43A 2EPDA 4J9IA 2AZVA 2M51A 3EGUA 1AZEA 3KFVA 5IH2A 1JXMA 1A0NB 1Z9ZA 3UA6A 1ZUUA 3M0UA 2K9GA 2H8HA 1YCSB 2MIOA 1WXUA 4RTZA 2V1QA 1MUZA 2DMOA 2EGEA 2FG0A 2L3QA 1AWWA 2YDLA 1WX6A 4EIKA 2KYMA 3VRZA 3UF4A 2HEQA 2GNCA 1TUDA 2LJ1A 4R0KA 1WI7A 4ZNXA 2K7AA 1TG0A 2I0NA 4M4ZA 4DEXA 2P4RA 1X69A 3QWXX 1WLPB 4HCKA 3ULRB 3EG2A 2IIMA 2GQIA 5FWCA 3LH5A 1AWXA 1AVZC 2X3XD 4WCIA 2HSPA 1M27C 1Y0MA 1UTIA 2L0AA 2LQNA 1WXTA 2FPFA 1UJ0A 1ZUYA 3VS7A 2PZ1A 4J9GA 1XOVA 1NYGA 1GBRA 2RQUA 2OAWA 3NMZC 1VYTA 1RUWA 1SRLA 3A98A 1KIKA 2CT4A 4CC3A 4LN2A 2CUBA 2J6FA 2GTOA 2J7IA 2JM8A 2DILA 3H0IA 2XMFA 1Y57A 2ESWA 2O9VA 2K3BA 4CC2A 4RTYA 1UE9A 2CSQA 2DJQA 3VS5A 1UJYA 3EHQA 1HJDA 1Z9QA 1OV3A 2DBKA 4E6RA 1IO6A 2L2PA 3REBB 1FYNA 4RTXA 2K6DA 2EYXA 4Z88A 1OPLA 2A36A 4AFSC 4RTUA 5HCKA 1SPKA 1GBQA 2LQWA 2JMCA 2EYWA 3TSWA 2EGCA 2F2VA 3I9QA 1PHTA 3UA7A 1U06A 2ENMA 2KT8A 2D8HA 1SHGA 3EHRA 2JXBA 3I5RA 2YUNA 5I22A 3QWYA 1GL5A 2AZSA 1T3SA 4LUEA 2FEIA 5FWBA 4J9BA 1OEBA 1CSKA 3TVTA 4Z89A 2AKKA 1J3TA 1UFFA 2DL8A 5FW9A 2DM1A 1M8MA 1ABOA 2KRSA 3M0PA 4OMOA 1ZUKA 1WDXA 2JS2A 2LJ0A 3CQTA 2O9SA 1WFWA 1RI9A 2GGRA 4HVVA 1X2QA 4AFUC 4HXJA 1MV0B 2DL7A 1QWFA 2DL4A 1V1CA 4JJBA 2VKNA 3JV3A 1G2BA 2C0IA 2LX7A 2DF6A 3VS0A 1GFCA 1QKXA 2DA9A 3H41A 1AEYA 4ORZA 2K2MA 1LCKA 5IHNA 1K4US 1N5ZA 4K11A 1JO8A 2OI3A 4J9DA 2C0OA 2EGAA 2DL3A 3M0QA 4DEYA 2HBWA 1ARKA 5L23A 1E6GA 2KRMA 2RF0A 1UHFA 1HSQA 2DRKA 1VYUA 1YNZA 1ABQA 2B86A 1JEGA 4RTWA 2RQWA 3M0SA 2KT1A 5IHKA 3I5SA 4ESRA 1YP5A 2SEMA 2J6KA 2F2WA 1GFDA 1KJWA 2A37A 1ZSGA 3M0RA 4LUDA 2RQTA 4AFZC 1AOJA 1T0JA 3ZL7C 2L3SA 2VWFA 1W6XA 2RQVA 4JJDA 1W1FA 1T0HA 2PTKA 3RNJA 1OPKA 1BBZA 2ROLA 2JW4A 2KXCA 2YT6A 5I11A 5IXFA 4HVUA 2JMAA 2QDLA 1K0SA 1W70A 2CSIA 2KNBB 1I0CA 2NWMA 3PVQA 2EBPA 2DRMA 1QWEA 2LCSA 3EG3A 1I07A 4FSSA 4JZ3A 3EG1A 1NEGA 4A63B 2VVKA 3THKA 2O31A 2A28A 1PRLC 1T3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5S A;  2C0T A;  1QLY A;  3U23 A;  3I35 A;  1UG1 A;  1AZG B;  2CH4 A;  1NYF A;  1MV3 A;  2ABL A;  3H0F A;  3VS6 A;  2X3W D;  2KR3 A;  2AK5 A;  1UGV A;  4J9F A;  4RTV A;  2EVR A;  2KBT A;  2FRY A;  4AG2 C;  1ZBJ A;  4LE9 A;  1PNJ A;  3SHW A;  2RN8 A;  4OML A;  2ECZ A;  1B3Q A;  1H92 A;  4RTT A;  2EYY A;  4JPB W;  3VS3 A;  2DVJ A;  4D8K A;  2CRE A;  3O5Z A;  1M3B A;  1WA7 A;  2RPN A;  2BZX A;  4OMM A;  3VS4 A;  3PE0 A;  2AKL A;  1HD3 A;  1K9A A;  1PKS A;  2JM9 A;  2D0N A;  3VS1 A;  4IIO A;  1AWJ A;  2RNA A;  1JQQ A;  4JZ4 A;  5IHI A;  1YWO A;  4J9E A;  1NG2 A;  4X1V A;  3UAT A;  2MCN A;  2JS0 A;  2O88 A;  1X2K A;  2LMJ A;  1QCF A;  2K79 A;  2LNH B;  2DLP A;  1UUE A;  1AD5 A;  2MOX A;  1YWP A;  1UHC A;  2KE9 A;  3RBB B;  3NGP A;  2CH4 W;  3NHN A;  4F14 A;  2W0Z A;  1EFN A;  1GRI A;  2ED0 A;  2RMO A;  2DL5 A;  3VS2 A;  2BZY A;  1WIE A;  2D8J A;  1S1N A;  3VRY A;  1H3H A;  1PRM C;  1H8K A;  1GCQ C;  1SHF A;  2GTJ A;  1M3C A;  1NLP C;  1YN8 A;  2EKH A;  1WXB A;  2OJ2 A;  2DE0 X;  2NUZ A;  1UEC A;  4GLM A;  1GCQ A;  2LP5 A;  1E6H A;  1SRM A;  2W10 A;  2ROT A;  1SSH A;  3EG0 A;  2KEA A;  2FPD A;  2YUP A;  1NEB A;  4KRT A;  4IIM A;  4CC7 A;  3R6N A;  2GBQ A;  1GCP A;  1JXO A;  4OMN A;  2E5K A;  1X6G A;  3M0T A;  1ZLM A;  2HDA A;  1K76 A;  1G83 A;  1CKA A;  4RUG A;  2BTT A;  3TSZ A;  1OOT A;  2PNI A;  1UDL A;  2A08 A;  4GBQ A;  2G6F X;  2KXD A;  2RQR A;  4CC4 B;  4QT7 A;  4JJC A;  2J06 A;  2EYZ A;  5ECA A;  1U3O A;  1ZX6 A;  1B07 A;  2CT3 A;  2FO0 A;  1QKW A;  4AFQ C;  2FRW A;  1X27 A;  2DX1 A;  1X6B A;  2DYB A;  1PWT A;  1FMK A;  1BK2 A;  2J6O A;  4Z8A A;  1M3A A;  2M0Y A;  1SEM A;  1I1J A;  2DBM A;  2LZ6 B;  2YUQ A;  1E7O A;  1PKT A;  4J9C A;  4OMQ A;  5GJW B;  2ED1 A;  2KRN A;  3REA B;  1K0X A;  2KGT A;  1KSW A;  3C0C A;  4D8D A;  1TUC A;  1RLP C;  2YSQ A;  4F16 A;  1VYV A;  1M30 A;  2HCK A;  2JTE A;  3IQL A;  4OMP A;  2CDT A;  2FPE A;  1NM7 A;  2YUO A;  2KRO A;  4HVW A;  2SRC A;  3GBQ A;  3NPF A;  2O2O A;  2KYB A;  1JU5 C;  3FJ5 A;  5IXB A;  1VA7 A;  1KFZ A;  2EQI A;  2LJ3 A;  1CKB A;  3SEM A;  1AWO A;  1BB9 A;  2BZ8 A;  2L3P A;  2J05 A;  1BU1 A;  1WYX A;  1K1Z A;  2JT4 A;  1RLQ C;  4Y92 A;  4J9H A;  2CUD A;  2DNU A;  5GJV B;  1NLO C;  3H0H A;  5EC7 A;  3PVL A;  2EW3 A;  4F17 A;  4AG1 C;  2D1X A;  4LNP A;  2F2X A;  2V1R A;  1X43 A;  2EPD A;  4J9I A;  2AZV A;  2M51 A;  3EGU A;  1AZE A;  3KFV A;  5IH2 A;  1JXM A;  1A0N B;  1Z9Z A;  3UA6 A;  1ZUU A;  3M0U A;  2K9G A;  2H8H A;  1YCS B;  2MIO A;  1WXU A;  4RTZ A;  2V1Q A;  1MUZ A;  2DMO A;  2EGE A;  2FG0 A;  2L3Q A;  1AWW A;  2YDL A;  1WX6 A;  4EIK A;  2KYM A;  3VRZ A;  3UF4 A;  2HEQ A;  2GNC A;  1TUD A;  2LJ1 A;  4R0K A;  1WI7 A;  4ZNX A;  2K7A A;  1TG0 A;  2I0N A;  4M4Z A;  4DEX A;  2P4R A;  1X69 A;  3QWX X;  1WLP B;  4HCK A;  3ULR B;  3EG2 A;  2IIM A;  2GQI A;  5FWC A;  3LH5 A;  1AWX A;  1AVZ C;  2X3X D;  4WCI A;  2HSP A;  1M27 C;  1Y0M A;  1UTI A;  2L0A A;  2LQN A;  1WXT A;  2FPF A;  1UJ0 A;  1ZUY A;  3VS7 A;  2PZ1 A;  4J9G A;  1XOV A;  1NYG A;  1GBR A;  2RQU A;  2OAW A;  3NMZ C;  1VYT A;  1RUW A;  1SRL A;  3A98 A;  1KIK A;  2CT4 A;  4CC3 A;  4LN2 A;  2CUB A;  2J6F A;  2GTO A;  2J7I A;  2JM8 A;  2DIL A;  3H0I A;  2XMF A;  1Y57 A;  2ESW A;  2O9V A;  2K3B A;  4CC2 A;  4RTY A;  1UE9 A;  2CSQ A;  2DJQ A;  3VS5 A;  1UJY A;  3EHQ A;  1HJD A;  1Z9Q A;  1OV3 A;  2DBK A;  4E6R A;  1IO6 A;  2L2P A;  3REB B;  1FYN A;  4RTX A;  2K6D A;  2EYX A;  4Z88 A;  1OPL A;  2A36 A;  4AFS C;  4RTU A;  5HCK A;  1SPK A;  1GBQ A;  2LQW A;  2JMC A;  2EYW A;  3TSW A;  2EGC A;  2F2V A;  3I9Q A;  1PHT A;  3UA7 A;  1U06 A;  2ENM A;  2KT8 A;  2D8H A;  1SHG A;  3EHR A;  2JXB A;  3I5R A;  2YUN A;  5I22 A;  3QWY A;  1GL5 A;  2AZS A;  1T3S A;  4LUE A;  2FEI A;  5FWB A;  4J9B A;  1OEB A;  1CSK A;  3TVT A;  4Z89 A;  2AKK A;  1J3T A;  1UFF A;  2DL8 A;  5FW9 A;  2DM1 A;  1M8M A;  1ABO A;  2KRS A;  3M0P A;  4OMO A;  1ZUK A;  1WDX A;  2JS2 A;  2LJ0 A;  3CQT A;  2O9S A;  1WFW A;  1RI9 A;  2GGR A;  4HVV A;  1X2Q A;  4AFU C;  4HXJ A;  1MV0 B;  2DL7 A;  1QWF A;  2DL4 A;  1V1C A;  4JJB A;  2VKN A;  3JV3 A;  1G2B A;  2C0I A;  2LX7 A;  2DF6 A;  3VS0 A;  1GFC A;  1QKX A;  2DA9 A;  3H41 A;  1AEY A;  4ORZ A;  2K2M A;  1LCK A;  5IHN A;  1K4U S;  1N5Z A;  4K11 A;  1JO8 A;  2OI3 A;  4J9D A;  2C0O A;  2EGA A;  2DL3 A;  3M0Q A;  4DEY A;  2HBW A;  1ARK A;  5L23 A;  1E6G A;  2KRM A;  2RF0 A;  1UHF A;  1HSQ A;  2DRK A;  1VYU A;  1YNZ A;  1ABQ A;  2B86 A;  1JEG A;  4RTW A;  2RQW A;  3M0S A;  2KT1 A;  5IHK A;  3I5S A;  4ESR A;  1YP5 A;  2SEM A;  2J6K A;  2F2W A;  1GFD A;  1KJW A;  2A37 A;  1ZSG A;  3M0R A;  4LUD A;  2RQT A;  4AFZ C;  1AOJ A;  1T0J A;  3ZL7 C;  2L3S A;  2VWF A;  1W6X A;  2RQV A;  4JJD A;  1W1F A;  1T0H A;  2PTK A;  3RNJ A;  1OPK A;  1BBZ A;  2ROL A;  2JW4 A;  2KXC A;  2YT6 A;  5I11 A;  5IXF A;  4HVU A;  2JMA A;  2QDL A;  1K0S A;  1W70 A;  2CSI A;  2KNB B;  1I0C A;  2NWM A;  3PVQ A;  2EBP A;  2DRM A;  1QWE A;  2LCS A;  3EG3 A;  1I07 A;  4FSS A;  4JZ3 A;  3EG1 A;  1NEG A;  4A63 B;  2VVK A;  3THK A;  2O31 A;  2A28 A;  1PRL C;  1T3L A; 
#chains in the Genus database with same CATH topology
 1U5S A;  3S3N A;  1UG1 A;  1PD1 A;  4FW2 A;  2CH4 A;  1NYF A;  5I21 A;  2E65 A;  4M78 F;  1MV3 A;  2HMA A;  3H0F A;  3RKY A;  3VS6 A;  1Q81 U;  2KR3 A;  4RTV A;  2MMP A;  2HQX A;  4X9C A;  3JCM g;  4J6X A;  2ECZ A;  1XQH A;  4C5G A;  1R77 A;  2CZ0 B;  4OMM A;  2CZ6 B;  2BZX A;  1SF9 A;  3H9N A;  1JBM A;  2BE9 B;  1K9A A;  4M7A B;  2HL3 A;  1Q82 C;  2MPX C;  4D6W A;  2JJ9 A;  2XDP A;  4IIO A;  1AWJ A;  4N4G A;  3CCQ T;  5A0L A;  2QQA A;  1JQQ A;  3DLL A;  4J9E A;  5DLO A;  3JB9 G;  3M54 A;  4X1V A;  5FU7 B;  1X6O A;  1VQO T;  3GPL A;  2KVQ G;  2DTH A;  4J7I A;  3ZBD A;  2VXE A;  2LNH B;  3SWN C;  3OYC A;  1YWP A;  3OYJ A;  1C0M A;  1Q86 U;  2OTL T;  4DOV A;  2QXF A;  4BE1 A;  4E2F B;  2BKD N;  3DLM A;  2VAS A;  3QSU A;  2DXT A;  1H8K A;  3L1A A;  4KUL A;  3CCQ Q;  1MMA A;  2A0F B;  4EMK C;  3EH1 A;  1HK9 A;  1RI0 A;  3CMA Q;  2V8J A;  2VB6 A;  1VQO Q;  1D3B A;  2NUZ A;  1K8A R;  4JRK A;  2HQE A;  5AYF A;  3MEW A;  3PNW C;  1FWZ A;  4EMK A;  1YJN Q;  2ROT A;  2LX9 A;  2OTL Q;  3INZ A;  2HQH A;  4C8Q B;  3JCM b;  3V7R A;  3MKD A;  3HRS A;  2WAC A;  3CC2 T;  3TEE A;  4C92 E;  1VQM T;  5CAI A;  2DO3 A;  1VIF A;  2PNI A;  4QQG A;  3N5B B;  2L5Q A;  4BDZ A;  4QVD A;  2VV5 A;  3BW1 A;  4AFQ C;  1X27 A;  3CCL T;  4HT8 A;  5J39 A;  4FL6 A;  2HKN A;  3O8V A;  1Q95 G;  4A4F A;  1F1B B;  2BIV A;  3OS1 A;  2DBM A;  3CC2 Q;  3FDR A;  3I55 A;  1VQM Q;  3CCS A;  2ED1 A;  3S3M A;  1K0X A;  2KGT A;  3C0C A;  4B6M A;  5GAN j;  4D8D A;  3EGX B;  4QW2 A;  1BIA A;  1IXD A;  4F16 A;  1M30 A;  1D0X A;  2K5I A;  1UGS B;  2DJZ A;  2CDT A;  1NM7 A;  2KRO A;  4HVW A;  1KQS P;  3JB9 J;  3D7S B;  3GBQ A;  3NPF A;  3CCU A;  3CCL Q;  2CP7 A;  1KFZ A;  2QAS A;  4M78 E;  2DER A;  5GAN h;  2JTF A;  4JDS A;  2DXU A;  5DLQ E;  3G7Z A;  2BZ8 A;  3CCJ T;  4OF1 A;  1BU1 A;  3RMQ A;  3OYK A;  3EH2 A;  4PJM A;  2QGG A;  4M75 C;  1K1Z A;  3G6E T;  1IHW A;  2OTJ T;  4Y92 A;  4J9H A;  4RCB A;  1WHM A;  2E6N A;  5LJ3 d;  3H0H A;  3PVL A;  1GXI E;  4C8Q C;  2F2X A;  2V1R A;  1BI1 A;  3X20 B;  1JXM A;  5LJ5 d;  1BCO A;  1Q82 U;  2E64 A;  4IUR A;  1S72 T;  2K3X A;  4RTZ A;  2PVG B;  1KQS A;  5LJ3 f;  1MUZ A;  2OAU A;  3CCJ Q;  4M7A F;  2L89 A;  1VQK T;  1AWW A;  3C12 A;  1YI2 T;  2WSF E;  3QDR B;  4DBH A;  5CKB A;  4FCY A;  4WTO B;  3G6E Q;  2OTJ Q;  5LJ5 f;  2I0N A;  2XHC A;  1QP2 A;  4OMF B;  4M4Z A;  1X69 A;  2E10 A;  1WLP B;  1Y7X A;  2K57 A;  1OZ3 A;  4HCK A;  2FVU A;  4EMG A;  1AWX A;  3JAM E;  3GIB A;  1AVZ C;  4IUV A;  2V8I A;  2DD4 A;  2L0A A;  4FT4 A;  5GAN 6;  2HBP A;  1S72 Q;  4J9G A;  4A4E A;  2LDM A;  1YCY A;  4J83 A;  3OYA A;  1GBR A;  1YI2 Q;  1VQ9 A;  3OBW A;  3WVE B;  4B9W A;  1KIK A;  1QVP A;  4OGC A;  4LN2 A;  1WJR A;  3JCM J;  1VQ5 T;  2J6F A;  1Q81 R;  2DIL A;  2GF7 A;  5KYX A;  1PM3 A;  3OYH A;  3HSB A;  2O9V A;  2K3B A;  3G71 A;  4M75 F;  1LNX A;  1N8R R;  1VQP Q;  3G1J A;  5GAM j;  1UJY A;  4DOW A;  1HJD A;  4YTL A;  4KH0 B;  4XTW A;  4C8Q F;  1JRI A;  3PIO A;  2E3I A;  3JB9 I;  2ZPE B;  3ZEH A;  3FC3 A;  3PIP A;  1SPK A;  2XK0 A;  2JMC A;  1ZA1 B;  1OU9 A;  1MND A;  1VQ5 Q;  2F2V A;  3I9Q A;  1PHT A;  3UA7 A;  1U06 A;  1WPY A;  2QQB A;  2JXB A;  3QWY A;  4KH1 B;  2FHD A;  1T3S A;  2RJC A;  5GAO l;  5I2S A;  2AKK A;  2LVM A;  4OGE A;  1ABO A;  4A4H A;  4PK4 A;  4PJJ A;  2KQW A;  2CP2 A;  2LJ0 A;  3OYL A;  3CQT A;  4FIB A;  2JOY A;  1V76 A;  1WFW A;  2IPO B;  1YIT T;  3CCE T;  4AFU C;  3Q1J A;  3A8M B;  1KQS S;  1M1K C;  8AT1 B;  2NUP A;  2VGN A;  1MV0 B;  1M2V B;  2DL7 A;  2R5A A;  1QWF A;  2DL4 A;  2NUT A;  4JJB A;  3JV3 A;  5KYY B;  2X4X A;  3H41 A;  4GY5 A;  2QQ9 A;  3OYB A;  1LCK A;  2X4J A;  3G4S T;  2K3Y A;  2FZG B;  2O01 E;  2C0O A;  4V2S A;  4DEY A;  3QJY A;  2CS7 A;  2M9U A;  4E7S A;  1VQN T;  1E6G A;  4J7F A;  1M90 R;  2H3E B;  3CCE Q;  1ABQ A;  4RTW A;  2KT1 A;  1FX7 A;  5IHK A;  3UDC A;  1VQL T;  4M77 C;  2DZC A;  1WJQ A;  2SEM A;  4BB7 A;  1G5V A;  1ZSG A;  2EJF A;  4M7A E;  2PUO B;  2LT1 A;  4XTU A;  2XKO C;  2RQT A;  1IRX A;  1T0J A;  3G4S Q;  2ZPB B;  2R5M A;  3CC7 A;  4XU3 A;  2L3S A;  2CGH A;  1K9M C;  3HRT A;  1WHH A;  2KAF A;  1R8O B;  3JB9 D;  1BBZ A;  1NJI C;  2CP5 A;  2KXC A;  5I11 A;  4MDX A;  3M56 A;  2CSI A;  2KNB B;  4ZN1 A;  2RHZ A;  3PVQ A;  2DRM A;  3C94 A;  3EG3 A;  1I07 A;  1EZZ B;  4FSS A;  1VQL Q;  4JZ3 A;  4PJO B;  2Y4Y A;  4C92 C;  4EMH A;  3LWI A;  3NTH A;  3THK A;  3JCM P;  1I5L A;  3VRZ A;  1YBY A;  2QI2 A;  4QKU A;  3U23 A;  4XK8 E;  3PGG A;  3QBY A;  5GMK l;  4DBR A;  1RAF B;  4M75 G;  4C92 A;  5GAN d;  3AHU A;  3I56 T;  2EJG A;  1UGV A;  1SKU B;  4J9F A;  3QZ9 B;  4M75 E;  4C0D B;  1ZBJ A;  1PNJ A;  1ZQ1 A;  3SHW A;  3FJP A;  4C8Q E;  3M55 A;  1IB8 A;  2EYY A;  1RL2 A;  3VS3 A;  5GAN f;  4J5Y A;  3PE0 A;  3RIR A;  4C92 D;  5KH6 A;  2RNA A;  2FL7 A;  2PQW A;  4M77 F;  2CP0 A;  1YJ9 T;  1Q82 R;  4ZN3 A;  2ZPH B;  4Y91 A;  3P8B B;  3I56 Q;  2RJE A;  1UGR B;  3BFM A;  1NPP A;  1X2K A;  2K79 A;  2ATC B;  2K2V A;  4UC4 A;  2KE9 A;  3RBB B;  2GCX A;  3NHN A;  4F14 A;  2VXF A;  1K73 R;  1GRI A;  4M78 A;  1N27 A;  3VS2 A;  3PMI A;  3GNF B;  3VRY A;  1H3H A;  4FYV B;  2RD1 A;  2P84 A;  1GCQ C;  4P5N A;  1M1K U;  3P8H A;  1YJ9 Q;  2GTJ A;  1WHG A;  1NLP C;  1WXB A;  2OJ2 A;  3CD6 Q;  4HT9 A;  3L2U A;  2Z0W A;  3EFO A;  1GCQ A;  1E6H A;  1G8X A;  4M78 D;  1KG1 A;  2DZ9 A;  2JVV A;  3EG0 A;  4L59 A;  4BD3 A;  4XU0 A;  2FPD A;  1NEB A;  3LLR A;  4NOY A;  4BI8 B;  3TQ7 P;  3OSV A;  3ASK A;  3X28 B;  4A4G A;  2E5K A;  1X6G A;  3M0T A;  1G83 A;  1CKA A;  1OOT A;  3VYG A;  5CQX A;  3OYI A;  3TU4 K;  3CME Q;  2KSS A;  2A08 A;  1VOM A;  4C5I A;  2G6F X;  4KUI A;  3I55 T;  4QT7 A;  4JJC A;  3CCS T;  2QTX A;  2ZZD A;  1FMV A;  2EYZ A;  5ECA A;  1U3O A;  1ZX6 A;  2AIR B;  2DX1 A;  5GAM d;  4HCC A;  3A8L B;  3MP6 A;  3J81 E;  4PFZ A;  4XTY A;  1M3A A;  1K9M U;  4DBQ A;  1I1J A;  4XTX A;  2YUQ A;  2E4H A;  4JRP A;  1BYM A;  2QK0 A;  4J9C A;  3BE3 A;  4OMQ A;  5GJW B;  1NJI U;  2KY9 A;  4C0Z A;  1N6A A;  1YJW A;  5M9O A;  1UB4 A;  2R58 A;  5GAM f;  4C0G A;  2YSQ A;  3OYE A;  3I55 Q;  1P92 A;  3OY9 A;  1VQ4 A;  3CCS Q;  1KD1 C;  4OMP A;  1PCX A;  2Y90 A;  4IUT A;  2V8K A;  1M8V A;  5J3B A;  4DBF A;  2KDS A;  1FXX A;  2KYB A;  1TXQ A;  5IXB A;  4PJO F;  2HL5 C;  2EQI A;  2EQJ A;  2J05 A;  4PJL A;  3RR6 A;  3NTK A;  1WYX A;  1VQ7 A;  3JCM h;  5GJV B;  3M53 A;  1NLO C;  1Y96 A;  2M16 A;  4VUB A;  4AG1 C;  1BI3 A;  4M77 G;  1I81 A;  3CCR A;  2MAM A;  4X9D A;  1V29 B;  1XTD A;  4J9I A;  5D6Y A;  3A5Z B;  5GAO p;  3OS0 A;  3H6Z A;  5KCO A;  3PT9 A;  5IH2 A;  4M77 E;  3SWN A;  1ZUU A;  2K9G A;  3CEY A;  3HKS A;  4X34 A;  5CKE A;  4F7U B;  5GMK i;  2L3R A;  2DMO A;  2DIQ A;  2DFU A;  2JUF A;  1W4S A;  2HKQ B;  1I4K 1;  2KYM A;  3V8L A;  1TUD A;  2B8A A;  4R0K A;  2K7A A;  3E2U A;  4IKF A;  1YHQ A;  1SG5 A;  3J7A F;  2VYT A;  5FWC A;  4C92 G;  2RHU A;  2COY A;  4ZGE B;  2EWN A;  3QZ5 B;  1Y0M A;  4C5H A;  4C0F A;  3VUB A;  5HY6 A;  3G71 T;  1WXT A;  1EX4 A;  4RKU E;  2FPF A;  3QKJ A;  1UJ0 A;  1ZUY A;  2PZ1 A;  3MO8 A;  1KQ2 A;  3MCA B;  5C0M A;  1H64 1;  1NYG A;  3A1P A;  2RQU A;  4ME7 A;  2XDB A;  4DA4 A;  3NMZ C;  1SRL A;  2QTV A;  4M7A C;  3AT1 B;  3HFN A;  4M7D B;  1WJS A;  2F1L A;  4KGX B;  3VV0 A;  2CUB A;  2A3L A;  2J7I A;  4ELZ C;  3CXC P;  2ESW A;  5FU7 C;  4CC2 A;  5HK0 A;  3LX7 A;  4M7A A;  3EHQ A;  2QA4 T;  3G71 Q;  3OQ5 A;  5CQY A;  3L2Z A;  5GAO q;  4RTX A;  1OPL A;  4QQ6 A;  4BE2 A;  3OYM A;  2X51 A;  2XI9 A;  4AMC A;  1RAI B;  4RTU A;  4M78 G;  2LQW A;  2DEU A;  4M7A D;  2DAQ A;  2LT4 A;  2CP6 A;  2KT8 A;  2D8H A;  3I5R A;  2YUN A;  1D1B A;  1KQ1 A;  4LDY A;  5GMK e;  3TCJ A;  3ZFJ A;  1J3T A;  3CXC A;  1M8M A;  2YHT A;  4OMO A;  2QA4 Q;  4LDU A;  4E7J A;  1WDX A;  2JS2 A;  2RI5 A;  4FM4 B;  4MZM A;  3L42 A;  1M1G A;  3QII A;  1B34 A;  4QQD A;  4ATO A;  1KD1 U;  2I2L A;  4B9X A;  4M75 A;  1WNL A;  3OYG A;  1V1C A;  2DEQ A;  2VKN A;  4J8O A;  2EQM A;  5FLX E;  4PJO E;  1NPR A;  3OSS C;  4BI3 A;  3BDU A;  3KXT A;  1D0Z A;  2ZAE A;  3FRN A;  4ORZ A;  1AT1 B;  3LW5 E;  1KC8 C;  4C8Q A;  5IHN A;  3CCM T;  5GAO m;  2LC4 A;  4KT0 E;  1QVG P;  5A2Q E;  3CCQ A;  3CC7 T;  2HBW A;  2LTO A;  1ARK A;  2RF0 A;  3CMA A;  4M75 D;  4R55 A;  5KYW B;  5HKC A;  2R57 A;  1VYU A;  3WXM B;  3QO3 A;  1U1S A;  2X35 A;  4C8Q D;  5L8R E;  3OYF A;  3OYN A;  1YJN A;  3MEA A;  2F5K A;  1AHJ B;  2A37 A;  2P0Q A;  3M0R A;  4LUD A;  7AT1 B;  3FLG A;  1U1T A;  1C6V X;  1AOJ A;  5KYN A;  3CCM Q;  1VQK Q;  2DYI A;  3PTA A;  3ZL7 C;  1Y71 A;  2VWF A;  2RQV A;  2H3J A;  3F70 A;  4KGV B;  3JCM W;  3H8Z A;  3EGX A;  3RNJ A;  1NZ9 A;  3RER A;  5GAO r;  3C4S A;  2ROL A;  1QVG A;  2IG0 A;  3V7C A;  3S3O A;  2QDL A;  2EBP A;  1D0Y A;  1D1A A;  2LCS A;  1NJI R;  1TSF A;  3KUF A;  1X01 A;  1O75 A;  5GAO n;  1OYX A;  5AT1 B;  3EGD B;  2LNV A;  4A63 B;  1VQ8 A;  3UT1 A;  2DK3 A;  1PRL C;  4TVR A;  1T3L A;  4LDX A;  2C06 A;  1QLY A;  2Y4X A;  1MMN A;  3I35 A;  1LOJ A;  1VQM A;  4J6Y A;  2VGM A;  2ABL A;  3LWH A;  3GP8 A;  2AT1 B;  3CXC S;  2G3R A;  2EVR A;  2KBT A;  3RKX A;  4BY6 B;  2FRY A;  3MJX A;  2X4W A;  4LE9 A;  3JCM d;  2QEX T;  1H92 A;  1BI0 A;  5GAN 7;  3CCL A;  1PSE A;  4E6R A;  2DVJ A;  4D8K A;  3O5Z A;  3M9Q A;  3VS4 A;  1M1F A;  2AKL A;  3CCV T;  1Q86 R;  3HHT B;  1HD3 A;  3C95 A;  1YIJ T;  1PKS A;  4FT2 A;  3TRE A;  4L6V 5;  2D0N A;  3VS1 A;  1OUL A;  1I5O B;  2O4X A;  5IHI A;  5GMK m;  1NG2 A;  3JCM f;  3R6O A;  3X24 B;  1ACM B;  5CO7 A;  2MCN A;  2JS0 A;  2YLB A;  5KCH A;  3JCM Q;  3CBM A;  1QCF A;  3SB2 A;  5KYU B;  4Q5W A;  2DLP A;  4MZT A;  1UUE A;  2MOX A;  4WF2 A;  1UHC A;  2QEX Q;  3NGP A;  2CH4 W;  3KBG A;  2W0Z A;  1EFN A;  5GAN 8;  5DY9 A;  2ED0 A;  2MI6 A;  3OW2 P;  1WIE A;  3CCV Q;  1S1N A;  1YIJ Q;  1YIT Q;  3OMC A;  3CCJ A;  2K4Y A;  4R56 A;  3ER0 A;  3MP8 A;  2DXB A;  2RHY A;  2ZGW A;  1RAC B;  3G6E A;  1JB0 E;  5CK9 A;  1RAA B;  1YN8 A;  4M7A G;  1UEC A;  2MF2 A;  2F5T X;  5C6S A;  3SFM A;  2XID A;  1QVG S;  1KC8 U;  2W10 A;  1C1A A;  2KI7 A;  1Q7Y C;  3EG9 B;  2VUB A;  2CKK A;  2DD5 A;  2YUP A;  4M77 A;  4IIM A;  4CC7 A;  1VQN Q;  1GCP A;  1ZLM A;  4E7I A;  1K76 A;  1YI2 A;  3NFC A;  1R0B G;  5D6W A;  3UWN A;  3TSZ A;  3OW2 A;  4JRI A;  4E7H A;  3NTI A;  4ELY C;  1ZSZ B;  4GBQ A;  2RQR A;  2KXD A;  1OI1 A;  5LJ3 e;  1FMW A;  1UGQ B;  2J06 A;  1YJW T;  5KE3 A;  1IRE B;  2CT3 A;  2WSE E;  2FO0 A;  4M77 D;  4MZP A;  1VQ4 T;  2RK2 A;  2FRW A;  1BIB A;  2QDY B;  1X6B A;  1UEB A;  3CBO A;  1VQP A;  3M4G A;  4ANJ A;  1FMK A;  1N8R C;  3E1S A;  3OYD A;  4F7U E;  5LJ5 e;  5IN1 A;  2J6O A;  2M0Y A;  5HK3 A;  1SEM A;  1RAD B;  1PKT A;  4RMO A;  2IVW A;  3MHX A;  5J26 A;  2KRN A;  3REA B;  2LRQ A;  4KUD K;  1QP3 A;  4XU1 A;  4C8Q G;  2V26 A;  3VKI A;  5KYY A;  3MPU B;  2DTI A;  3QPH A;  2HCK A;  1VQ7 T;  4EDU A;  2JTE A;  4RG8 A;  1YJW Q;  2FPE A;  2YUO A;  2SRC A;  4E7Z A;  1KD1 R;  4LXC A;  2O2O A;  3FJ5 A;  1VA7 A;  3MEV A;  2JNG A;  4PKC C;  2LJ3 A;  3SEM A;  5GAN 4;  2MK5 A;  1BB9 A;  1AWO A;  2L3P A;  4F04 B;  3VYH B;  4PLI A;  3GOX A;  1DJ7 B;  1NE8 A;  2OX7 A;  4PL6 A;  2JT4 A;  4M7D E;  4A4K A;  4CI0 C;  5LJ3 g;  4IUP A;  2CUD A;  4JRQ A;  2JTM A;  3BY7 A;  1HXD A;  5EC7 A;  1VQ7 Q;  2EW3 A;  2F69 A;  3HPW A;  4F17 A;  2D1X A;  2COZ A;  3OS2 A;  2E5Q A;  2LQ8 A;  2AZV A;  3URG A;  2M51 A;  2D6F A;  5LJ3 j;  5LJ5 g;  1AZE A;  3KFV A;  1YHQ T;  1NBE B;  4NL2 A;  3UA6 A;  3LYI A;  3M0U A;  1YCS B;  2YRC A;  2V1Q A;  2EGE A;  2FG0 A;  2L3Q A;  4A54 A;  4XU2 A;  4PJO C;  1IZ6 A;  2YDL A;  1M90 C;  1WX6 A;  3CCE A;  4EIK A;  2K5L A;  2QQS A;  5LJ3 h;  2E41 A;  2HEQ A;  2GNC A;  4J6W A;  3RUX A;  2LJ1 A;  2P0P A;  2RO0 A;  1TUG B;  4ZNX A;  3OW2 S;  1TG0 A;  1MNE A;  4PJO A;  3QWX X;  1VQ6 A;  3ULR B;  2GQI A;  3FIF A;  2HSP A;  4WCI A;  1G3W A;  2XD0 A;  1VIE A;  1YHQ Q;  4C0D C;  3G4S A;  2LQN A;  4IUQ A;  4JS4 A;  3CPW P;  2HNI A;  4QVZ A;  4DQ2 A;  3VUZ A;  2RH2 A;  2LCC A;  1RUW A;  2ZPI B;  1YFN A;  4HKE A;  4PJO D;  4CC3 A;  3QYH B;  4XTZ A;  1JJ2 P;  1D3B B;  1QCN A;  4OB1 B;  1Q7Y U;  2XMF A;  2QG9 B;  2LQK A;  1Y57 A;  4RTY A;  3CCU T;  1UE9 A;  4EMK B;  2CSQ A;  3CC4 A;  1Z9Q A;  1OV3 A;  2DBK A;  1IO6 A;  1Y07 A;  4KGZ B;  3M57 A;  4BI4 A;  1M5Q 1;  4Z88 A;  4XTV A;  2A36 A;  2DET A;  3CPW A;  2CP3 A;  1EIF A;  5HCK A;  1GBQ A;  4RG2 A;  2EYW A;  3M59 A;  2EGC A;  4IUU A;  1PSF A;  5CKD A;  2FZC B;  2D0Q B;  3QYG B;  1N8R U;  1GL5 A;  3CCU Q;  1JJ2 A;  5FWB A;  4J9B A;  4FYW B;  1CSK A;  1WGS A;  2DL8 A;  1UGP B;  2RI3 A;  5CIU A;  1XNI A;  5FRN A;  3CPF A;  2X4Y A;  2YWW A;  2YLC A;  5FU6 B;  2DXC A;  2GGR A;  1TU0 B;  4HVV A;  3A8G B;  3I56 A;  1B7T A;  4FSX A;  4LDV A;  1G3S A;  5A0G A;  3EAE A;  4N0A C;  1R0C B;  5D6X A;  3L2R A;  3CMA T;  2RM4 A;  1U8R A;  2DF6 A;  3VS0 A;  1GFC A;  1QKX A;  1BI2 A;  1KK7 A;  2QGF B;  2E1H A;  2FYK A;  3HRU A;  2EQU A;  2QAZ A;  1K73 C;  1YJN T;  4N0A A;  3GF5 A;  1MMG A;  2D9T A;  2RI2 A;  2JN0 A;  4K11 A;  1JO8 A;  1KC8 R;  4J9D A;  2EGA A;  3M0Q A;  4OB3 B;  1I8F A;  5IAY A;  2DVE A;  2YRD A;  5L23 A;  2KRM A;  2NYS A;  5GAN e;  1YJ9 A;  1VQ9 T;  4ZTF A;  2GFU A;  4HCB A;  3SD4 A;  2LCL A;  3BDL A;  1YNZ A;  3CD6 A;  5GAN 3;  1ZA2 B;  4EPC A;  1JEG A;  1QVF P;  2RQW A;  3M0S A;  3I5S A;  1B34 B;  1TTH B;  3M5A A;  1YP5 A;  2F2W A;  1QMC A;  4O5V A;  1W2B P;  1KJW A;  3LH0 A;  4M75 B;  3EFR A;  2ZPF B;  4AFZ C;  5KE2 A;  3MEU A;  3VU3 C;  2M1H A;  1VQ8 T;  1D09 B;  1W6X A;  4OB0 B;  1M90 U;  2PTK A;  3QHS A;  4BUG A;  1OPK A;  1H3Z A;  3CME A;  1VQ9 Q;  2YT6 A;  1OU8 A;  4HVU A;  4Z02 A;  4NL3 A;  2JMA A;  2AHJ B;  2JZ2 A;  1K0S A;  2NWM A;  1I0C A;  2NLU A;  1SSF A;  1QWE A;  2A7Y A;  3CPW S;  4E47 A;  5CKH A;  3EFS A;  1NEG A;  3HFO A;  5FU6 C;  1QVF A;  5IT9 E;  2O31 A;  4AT1 B;  1BKB A;  2C0T A;  1W2B A;  3PFS A;  4BDY A;  2XU8 A;  4PJN A;  1VQ8 Q;  1AZG B;  1WHJ A;  1JJ2 S;  5GAN g;  3X25 B;  3UPU A;  2X3W D;  2AK5 A;  2WSC E;  4JLI A;  2BUD A;  3OB9 A;  1N9S A;  1OQK A;  2MWO A;  3SDZ A;  2HSE B;  4AG2 C;  4LD9 K;  4NS5 A;  1G3T A;  2RN8 A;  4OML A;  4ZTJ A;  3RMS A;  6AT1 B;  3J80 E;  1B3Q A;  5KYX B;  2EIF A;  4RTT A;  4JPB W;  3V8K A;  2CRE A;  1M3B A;  1WA7 A;  2RPN A;  1WQW A;  4F7U A;  2JM9 A;  2PVO B;  5FRO A;  2E12 A;  2CYZ B;  5GAN 5;  4PJO G;  4JZ4 A;  1YWO A;  3UAT A;  4JUV A;  3OMG A;  1M1K R;  1N9R A;  2MWP A;  2DKG A;  1LPL A;  2O88 A;  2LMJ A;  2YRV A;  3OS5 A;  2KK4 A;  1AD5 A;  1RAH B;  5FRM A;  1MGQ A;  5GAM e;  1IGU A;  4M7D C;  2RMO A;  2DIG A;  2DL5 A;  2EKO A;  2BZY A;  2D8J A;  3QXE B;  3LGF A;  1PRM C;  3QDF A;  1VQO A;  2DTO A;  1K8A C;  1SHF A;  4M7D A;  1M3C A;  2EKH A;  2DE0 X;  1OZ2 A;  2VC8 A;  2O4X B;  2NUP B;  5A0D A;  1X75 C;  4GLM A;  1RAE B;  2LP5 A;  2OTL A;  2NUT B;  1SRM A;  3A8H B;  1K73 U;  3S6W A;  3V7S A;  1SSH A;  2FB7 A;  2KEA A;  4KRT A;  5GMK j;  4OVA A;  1Q7Y R;  3R6N A;  1VQP T;  4F7U F;  2GBQ A;  3CC7 Q;  1JXO A;  3DB3 A;  1K9M R;  2RB6 A;  2P0K A;  4OMN A;  3V8J A;  4M7D D;  2HDA A;  1QVF S;  4RUG A;  1OX8 A;  2BTT A;  2EFI A;  3A8O B;  4LD6 A;  1PG5 B;  2K5F A;  1UDL A;  2KMT A;  1W2B S;  3QUI A;  1PC0 A;  4CC4 B;  3CBP A;  3JB9 H;  5GMK h;  4FU6 A;  1B07 A;  2XIC A;  1QKW A;  3FEO A;  2HAX A;  5GAM g;  2DYB A;  1PWT A;  2GFA A;  1BK2 A;  3CC2 A;  3L2Q A;  4Z8A A;  2HD0 A;  2LZ6 B;  4PFP A;  1E7O A;  3QG1 A;  2PU9 B;  3GLX A;  5D7U A;  4M77 B;  1KSW A;  1TUC A;  4M7D F;  1RLP C;  3JCM X;  1VYV A;  4C5E A;  3RKW A;  3IQL A;  1VUB A;  3DKM A;  5GAM h;  4XQ3 A;  2BE7 D;  4II1 A;  1JU5 C;  9ATC B;  4GLK A;  5DM7 R;  1HYO A;  3MP1 A;  1CKB A;  2QA4 A;  4XAX B;  5CR2 A;  4N4I A;  3VJP A;  2MYS A;  5KYW A;  4KBM B;  1RLQ C;  4C92 B;  2M02 A;  2EYQ A;  2DNU A;  4JJN K;  1MHN A;  4JLG A;  4OP0 A;  2RJD A;  4LNP A;  1X43 A;  2EPD A;  3RES A;  3M4Y A;  1PD0 A;  3EGU A;  4L5G A;  1VQ6 T;  1A0N B;  1Z9Z A;  4PLL A;  2H8H A;  3OA6 A;  2MIO A;  1WXU A;  5I2M A;  2OTJ A;  3JRZ A;  1OX9 A;  3UF4 A;  1D1C A;  1WQ7 A;  1M9S A;  4BAC A;  2XDD A;  2ZCF B;  2M0O A;  1WI7 A;  2QQR A;  2RHX A;  1RAB B;  1XJW B;  4PFO A;  4DEX A;  2P4R A;  3EGD A;  3EG2 A;  2IIM A;  1O9S A;  4BE0 A;  3LH5 A;  4QVC A;  1S72 A;  2QYZ A;  2X3X D;  2E6Z A;  1M27 C;  4MMK A;  1UTI A;  4BY6 C;  3CCM A;  1VQ6 Q;  1VQK A;  2EJ9 A;  3PMT A;  3VS7 A;  1XOV A;  2P4T A;  4M78 B;  3CC4 T;  1K8A U;  1LVK A;  2YXY A;  2OAW A;  1VYT A;  4ZGJ B;  3A98 A;  4E7K A;  2CT4 A;  1Q81 C;  4F7U G;  2X9H A;  2GTO A;  1LJO A;  2JM8 A;  3H0I A;  1KHI A;  4FYX B;  3JCM c;  3EFO B;  4A53 A;  4MML A;  2CZ7 B;  3L2W A;  2DJQ A;  3VS5 A;  2L8D A;  3L2V A;  3MET A;  1IGQ A;  1QQJ A;  3JSC A;  3E9F A;  2L2P A;  5LL6 S;  1M2V A;  3HTR A;  3REB B;  3CC4 Q;  1FYN A;  2K6D A;  2EYX A;  3T9N A;  1WZO A;  4AFS C;  5CCA A;  1VQ5 A;  2ZPG B;  3X26 B;  8ATC B;  5KYU A;  1WHL A;  1VQ4 Q;  3WVD B;  3TSW A;  4Y28 E;  2ENM A;  3CCR T;  1IHV A;  1WHK A;  1SHG A;  3EHR A;  3JCM V;  3LGL A;  5I22 A;  2AZS A;  3JB9 F;  4LUE A;  2FEI A;  4M7D G;  1OEB A;  3TVT A;  4Z89 A;  1Q86 C;  2RHI A;  1UFF A;  3OBY A;  2PVD B;  5FW9 A;  2DM1 A;  4PNO A;  2KRS A;  3M0P A;  3GNG A;  1ZUK A;  2XG8 D;  4N4H A;  2O9S A;  1RI9 A;  1TOV A;  1X2Q A;  4OB2 B;  2RA2 A;  4HXJ A;  5CVI A;  4FW1 A;  2RK1 A;  1G3Y A;  2CZ1 B;  3RDV A;  1G2B A;  2C0I A;  2LX7 A;  5GAN 2;  3CD6 T;  3EG9 A;  2DA9 A;  2QEX A;  3CCR Q;  4M78 C;  1M4Z A;  3HP9 A;  1AEY A;  1ZSZ C;  2FZK B;  2K2M A;  1TS9 A;  2PUK B;  1K4U S;  5CKF A;  1N5Z A;  1RAG B;  2DPP B;  3CCV A;  3HL8 A;  5LJ5 j;  1YIJ A;  1YIT A;  2EAY A;  4MDW A;  2OI3 A;  2DL3 A;  4FYY B;  1ZBX A;  2HZY A;  1ZSZ A;  1UHF A;  1HSQ A;  2COW A;  2DRK A;  3M58 A;  4E7L A;  4LDW A;  3E9G A;  1QCO A;  4C92 F;  2B86 A;  3CME T;  2EQK A;  1TWB A;  4CRI A;  1Y96 B;  5LJ5 h;  3JCM e;  2GQV A;  3E19 A;  2E3H A;  4ESR A;  2J6K A;  1GFD A;  4JS5 A;  1TH7 A;  3FB9 A;  1QW1 A;  1BCM A;  4RCC A;  1VQN A;  3SWN B;  3QJ6 A;  4HCZ A;  3OYY A;  4JJD A;  1W1F A;  3ME9 A;  1T0H A;  1M2O A;  4O6J A;  2RJF A;  2JW4 A;  1MMD A;  5IXF A;  1VQL A;  1W70 A;  1ZHI A;  1KHC A;  3DB4 A;  3P8D A;  3EG1 A;  4HA8 A;  2VVK A;  4ZGD B;  2A28 A;  5EG2 A;  2E70 A; 
#chains in the Genus database with same CATH homology
 1U5S A;  2C0T A;  1QLY A;  3U23 A;  3I35 A;  1UG1 A;  1AZG B;  2CH4 A;  1NYF A;  1MV3 A;  2ABL A;  3H0F A;  3VS6 A;  2X3W D;  2KR3 A;  2AK5 A;  1UGV A;  4J9F A;  4RTV A;  2EVR A;  2KBT A;  2FRY A;  4AG2 C;  1ZBJ A;  4LE9 A;  1PNJ A;  3SHW A;  2RN8 A;  4OML A;  2ECZ A;  1B3Q A;  1H92 A;  4RTT A;  2EYY A;  4JPB W;  3VS3 A;  2DVJ A;  4D8K A;  2CRE A;  3O5Z A;  1M3B A;  1WA7 A;  2RPN A;  2BZX A;  4OMM A;  3VS4 A;  3PE0 A;  2AKL A;  1HD3 A;  1K9A A;  1PKS A;  2JM9 A;  2D0N A;  3VS1 A;  4IIO A;  1AWJ A;  2RNA A;  1JQQ A;  4JZ4 A;  5IHI A;  1YWO A;  4J9E A;  1NG2 A;  4X1V A;  3UAT A;  2MCN A;  2JS0 A;  2O88 A;  1X2K A;  2LMJ A;  1QCF A;  2K79 A;  2LNH B;  2DLP A;  1UUE A;  1AD5 A;  2MOX A;  1YWP A;  1UHC A;  2KE9 A;  3RBB B;  3NGP A;  2CH4 W;  3NHN A;  4F14 A;  2W0Z A;  1EFN A;  1GRI A;  2ED0 A;  2RMO A;  2DL5 A;  3VS2 A;  2BZY A;  1WIE A;  2D8J A;  1S1N A;  3VRY A;  1H3H A;  1PRM C;  1H8K A;  1GCQ C;  1SHF A;  2GTJ A;  1M3C A;  1NLP C;  1YN8 A;  2EKH A;  1WXB A;  2OJ2 A;  2DE0 X;  2NUZ A;  1UEC A;  4GLM A;  1GCQ A;  2LP5 A;  1E6H A;  1SRM A;  2W10 A;  2ROT A;  1SSH A;  3EG0 A;  2KEA A;  2FPD A;  2YUP A;  1NEB A;  4KRT A;  4IIM A;  4CC7 A;  3R6N A;  2GBQ A;  1GCP A;  1JXO A;  4OMN A;  2E5K A;  1X6G A;  3M0T A;  1ZLM A;  2HDA A;  1K76 A;  1G83 A;  1CKA A;  4RUG A;  2BTT A;  3TSZ A;  1OOT A;  2PNI A;  1UDL A;  2A08 A;  4GBQ A;  2G6F X;  2KXD A;  2RQR A;  4CC4 B;  4QT7 A;  4JJC A;  2J06 A;  2EYZ A;  5ECA A;  1U3O A;  1ZX6 A;  1B07 A;  2CT3 A;  2FO0 A;  1QKW A;  4AFQ C;  2FRW A;  1X27 A;  2DX1 A;  1X6B A;  2DYB A;  1PWT A;  1FMK A;  1BK2 A;  2J6O A;  4Z8A A;  1M3A A;  2M0Y A;  1SEM A;  1I1J A;  2DBM A;  2LZ6 B;  2YUQ A;  1E7O A;  1PKT A;  4J9C A;  4OMQ A;  5GJW B;  2ED1 A;  2KRN A;  3REA B;  1K0X A;  2KGT A;  1KSW A;  3C0C A;  4D8D A;  1TUC A;  1RLP C;  2YSQ A;  4F16 A;  1VYV A;  1M30 A;  2HCK A;  2JTE A;  3IQL A;  4OMP A;  2CDT A;  2FPE A;  1NM7 A;  2YUO A;  2KRO A;  4HVW A;  2SRC A;  3GBQ A;  3NPF A;  2O2O A;  2KYB A;  1JU5 C;  3FJ5 A;  5IXB A;  1VA7 A;  1KFZ A;  2EQI A;  2LJ3 A;  1CKB A;  3SEM A;  1AWO A;  1BB9 A;  2BZ8 A;  2L3P A;  2J05 A;  1BU1 A;  1WYX A;  1K1Z A;  2JT4 A;  1RLQ C;  4Y92 A;  4J9H A;  2CUD A;  2DNU A;  5GJV B;  1NLO C;  3H0H A;  5EC7 A;  3PVL A;  2EW3 A;  4F17 A;  4AG1 C;  2D1X A;  4LNP A;  2F2X A;  2V1R A;  1X43 A;  2EPD A;  4J9I A;  2AZV A;  2M51 A;  3EGU A;  1AZE A;  3KFV A;  5IH2 A;  1JXM A;  1A0N B;  1Z9Z A;  3UA6 A;  1ZUU A;  3M0U A;  2K9G A;  2H8H A;  1YCS B;  2MIO A;  1WXU A;  4RTZ A;  2V1Q A;  1MUZ A;  2DMO A;  2EGE A;  2FG0 A;  2L3Q A;  1AWW A;  2YDL A;  1WX6 A;  4EIK A;  2KYM A;  3VRZ A;  3UF4 A;  2HEQ A;  2GNC A;  1TUD A;  2LJ1 A;  4R0K A;  1WI7 A;  4ZNX A;  2K7A A;  1TG0 A;  2I0N A;  4M4Z A;  4DEX A;  2P4R A;  1X69 A;  3QWX X;  1WLP B;  4HCK A;  3ULR B;  3EG2 A;  2IIM A;  2GQI A;  5FWC A;  3LH5 A;  1AWX A;  1AVZ C;  2X3X D;  4WCI A;  2HSP A;  1M27 C;  1Y0M A;  1UTI A;  2L0A A;  2LQN A;  1WXT A;  2FPF A;  1UJ0 A;  1ZUY A;  3VS7 A;  2PZ1 A;  4J9G A;  1XOV A;  1NYG A;  1GBR A;  2RQU A;  2OAW A;  3NMZ C;  1VYT A;  1RUW A;  1SRL A;  3A98 A;  1KIK A;  2CT4 A;  4CC3 A;  4LN2 A;  2CUB A;  2J6F A;  2GTO A;  2J7I A;  2JM8 A;  2DIL A;  3H0I A;  2XMF A;  1Y57 A;  2ESW A;  2O9V A;  2K3B A;  4CC2 A;  4RTY A;  1UE9 A;  2CSQ A;  2DJQ A;  3VS5 A;  1UJY A;  3EHQ A;  1HJD A;  1Z9Q A;  1OV3 A;  2DBK A;  4E6R A;  1IO6 A;  2L2P A;  3REB B;  1FYN A;  4RTX A;  2K6D A;  2EYX A;  4Z88 A;  1OPL A;  2A36 A;  4AFS C;  4RTU A;  5HCK A;  1SPK A;  1GBQ A;  2LQW A;  2JMC A;  2EYW A;  3TSW A;  2EGC A;  2F2V A;  3I9Q A;  1PHT A;  3UA7 A;  1U06 A;  2ENM A;  2KT8 A;  2D8H A;  1SHG A;  3EHR A;  2JXB A;  3I5R A;  2YUN A;  5I22 A;  3QWY A;  1GL5 A;  2AZS A;  1T3S A;  4LUE A;  2FEI A;  5FWB A;  4J9B A;  1OEB A;  1CSK A;  3TVT A;  4Z89 A;  2AKK A;  1J3T A;  1UFF A;  2DL8 A;  5FW9 A;  2DM1 A;  1M8M A;  1ABO A;  2KRS A;  3M0P A;  4OMO A;  1ZUK A;  1WDX A;  2JS2 A;  2LJ0 A;  3CQT A;  2O9S A;  1WFW A;  1RI9 A;  2GGR A;  4HVV A;  1X2Q A;  4AFU C;  4HXJ A;  1MV0 B;  2DL7 A;  1QWF A;  2DL4 A;  1V1C A;  4JJB A;  2VKN A;  3JV3 A;  1G2B A;  2C0I A;  2LX7 A;  2DF6 A;  3VS0 A;  1GFC A;  1QKX A;  2DA9 A;  3H41 A;  1AEY A;  4ORZ A;  2K2M A;  1LCK A;  5IHN A;  1K4U S;  1N5Z A;  4K11 A;  1JO8 A;  2OI3 A;  4J9D A;  2C0O A;  2EGA A;  2DL3 A;  3M0Q A;  4DEY A;  2HBW A;  1ARK A;  5L23 A;  1E6G A;  2KRM A;  2RF0 A;  1UHF A;  1HSQ A;  2DRK A;  1VYU A;  1YNZ A;  1ABQ A;  2B86 A;  1JEG A;  4RTW A;  2RQW A;  3M0S A;  2KT1 A;  5IHK A;  3I5S A;  4ESR A;  1YP5 A;  2SEM A;  2J6K A;  2F2W A;  1GFD A;  1KJW A;  2A37 A;  1ZSG A;  3M0R A;  4LUD A;  2RQT A;  4AFZ C;  1AOJ A;  1T0J A;  3ZL7 C;  2L3S A;  2VWF A;  1W6X A;  2RQV A;  4JJD A;  1W1F A;  1T0H A;  2PTK A;  3RNJ A;  1OPK A;  1BBZ A;  2ROL A;  2JW4 A;  2KXC A;  2YT6 A;  5I11 A;  5IXF A;  4HVU A;  2JMA A;  2QDL A;  1K0S A;  1W70 A;  2CSI A;  2KNB B;  1I0C A;  2NWM A;  3PVQ A;  2EBP A;  2DRM A;  1QWE A;  2LCS A;  3EG3 A;  1I07 A;  4FSS A;  4JZ3 A;  3EG1 A;  1NEG A;  4A63 B;  2VVK A;  3THK A;  2O31 A;  2A28 A;  1PRL C;  1T3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...