2P4RA

Structural basis for a novel interaction between aip4 and beta-pix
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
b'SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
molecule tags Ligase
source organism Rattus norvegicus
publication title A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
pubmed doi rcsb
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2p4rA00
1GCQC 2A28A 1MV0B 1NEBA 2ED0A 1SRLA 2P4RA 1GRIA 2ECZA 5GJWB 2CUBA 3KFVA 1WXUA 2AZVA 3H0FA 3PVQA 3PE0A 4AFSC 2DX1A 1T0JA 2RMOA 3TSWA 1KIKA 1B07A 4X1VA 3M0TA 2O88A 2FPDA 1NEGA 1AVZC 1VYTA 5FW9A 2K3BA 2JT4A 1WA7A 2GBQA 3UA6A 2C0OA 3M0RA 4J9GA 1WLPB 1WX6A 2DF6A 4K11A 1AZGB 2DM1A 4RTXA 5ECAA 1MV3A 2RQWA 1VYVA 3H41A 4DEYA 1SSHA 1NM7A 3M0PA 3I5RA 5L23A 3VS6A 3QWYA 4F16A 2EW3A 2JS0A 1K76A 2LMJA 3O5ZA 2LNHB 4AFUC 3VRZA 2CREA 4JJDA 2GTJA 2DL4A 2L3QA 2CH4A 2K9GA 1XOVA 2DL3A 2ENMA 3EG2A 2IIMA 2KXDA 3H0IA 1A0NB 3LH5A 1ZBJA 2EQIA 1KSWA 2LX7A 2CSIA 2L2PA 2EYYA 1LCKA 1QCFA 2J6OA 3VS1A 2MOXA 1YNZA 2EGAA 2KBTA 4OMNA 2DILA 3NGPA 4OMLA 1H8KA 2RQRA 2J05A 3QWXX 1Y57A 1YN8A 2SRCA 1BK2A 2DL7A 4FSSA 2HSPA 4J9HA 2LJ1A 1OV3A 2FPFA 1FYNA 1GBRA 1QLYA 3UA7A 1ZLMA 3CQTA 2EGCA 2ROTA 4RTTA 3SHWA 1UJYA 5IXBA 4ZNXA 2H8HA 4RTYA 1RLPC 2K79A 4CC7A 3VRYA 1GBQA 2L0AA 4J9FA 2JMAA 2DBKA 1OPKA 3FJ5A 2NUZA 2C0TA 1M3CA 2EPDA 2FRYA 4LUEA 1Z9ZA 2HEQA 2ED1A 1JU5C 2E5KA 1VA7A 1J3TA 4JZ3A 1YP5A 4IIOA 4OMPA 3EGUA 1UJ0A 3EHRA 1N5ZA 2V1RA 2GGRA 2VVKA 2JTEA 2LJ3A 4AG2C 1SHFA 2G6FX 4OMQA 4WCIA 4JPBW 2VKNA 3SEMA 2DL8A 2CH4W 2FEIA 2EGEA 3IQLA 1K0XA 4IIMA 3EG1A 1QWFA 1AOJA 2BZ8A 4RTVA 2FO0A 1UUEA 2JS2A 2DA9A 2LQWA 1M3AA 1T3LA 5FWBA 1X6BA 3EG3A 2W0ZA 3JV3A 2KYBA 4RTUA 4GLMA 5IH2A 5EC7A 2YSQA 1CKAA 1RLQC 2YUNA 2DVJA 2O31A 4DEXA 1RI9A 1WI7A 2LQNA 2D8HA 1YCSB 1X43A 1I1JA 2OJ2A 2CSQA 3NMZC 1BB9A 2KEAA 4J9EA 4Y92A 2PTKA 1YWOA 5I22A 2EKHA 2I0NA 1PNJA 2KXCA 1KFZA 1UE9A 2NWMA 2PNIA 1PWTA 1OPLA 4E6RA 1H3HA 2LJ0A 2DL5A 2C0IA 2AKLA 1SRMA 1UECA 1T0HA 5I11A 3PVLA 2OAWA 1X69A 2FRWA 2D8JA 2DJQA 2KYMA 1ZX6A 2W10A 2XMFA 2JM9A 2J7IA 1JO8A 4F17A 3VS2A 2DNUA 2X3WD 1JQQA 4ESRA 2RQUA 1S1NA 2DLPA 2RQVA 1GCPA 1U5SA 4R0KA 2YUOA 4M4ZA 1K9AA 1ZSGA 2A36A 2RQTA 4CC4B 2X3XD 1PKSA 3THKA 4F14A 2F2WA 5IXFA 2KRMA 2RN8A 4LNPA 2JXBA 1KJWA 1AD5A 1NLPC 2SEMA 2EYZA 4EIKA 1CSKA 3TVTA 1PHTA 2GTOA 3TSZA 2V1QA 1HSQA 1ABOA 2VWFA 1K4US 2RPNA 1M8MA 2J6FA 2L3PA 1WIEA 2RF0A 4JJBA 4RTWA 2A08A 1M30A 2KROA 2MIOA 1AWWA 5IHIA 2YUQA 2O2OA 2DMOA 4RTZA 3H0HA 4LN2A 2DE0X 2BTTA 3M0SA 2RNAA 1SHGA 1NLOC 5FWCA 3REAB 2F2VA 1GFCA 1UHCA 2DBMA 2HCKA 1X2KA 1OEBA 2GQIA 2O9VA 2EVRA 4CC2A 1H92A 3I9QA 4OMOA 1W70A 4KRTA 4OMMA 4J9IA 1FMKA 1W6XA 3VS7A 2EYWA 2M51A 2JMCA 4A63B 1K0SA 1WXBA 3R6NA 1HJDA 5GJVB 2JW4A 1QKWA 1GFDA 1W1FA 1WYXA 2CT4A 1U06A 2M0YA 1EFNA 4D8KA 1T3SA 3RBBB 1JXOA 2KE9A 1QWEA 2FPEA 4Z88A 3VS4A 2JM8A 1WDXA 1ARKA 2K7AA 1G83A 2KRSA 4HVUA 4HVVA 2LCSA 1X6GA 1UFFA 3ZL7C 1RUWA 1Y0MA 2PZ1A 1E6GA 2D1XA 2ROLA 1YWPA 1UTIA 4D8DA 1AWXA 4ORZA 1SPKA 2LP5A 2EBPA 1ABQA 1JXMA 2MCNA 3UATA 1IO6A 1I0CA 3NHNA 4HCKA 2K6DA 4LE9A 4HXJA 4Z8AA 1PRMC 3ULRB 2KT1A 1U3OA 4JZ4A 2ESWA 3M0QA 2J6KA 4AFZC 1K1ZA 2QDLA 1ZUKA 1VYUA 4RUGA 1HD3A 2D0NA 4HVWA 2ABLA 4J9DA 1NYGA 1AEYA 1TG0A 4GBQA 2YT6A 2OI3A 2YUPA 3C0CA 1X2QA 1X27A 5IHNA 2BZYA 1M3BA 1PRLC 2DYBA 2HBWA 1AZEA 2F2XA 2L3SA 2O9SA 3VS3A 4AG1C 1JEGA 1WXTA 1B3QA 4J9BA 2A37A 2KGTA 1BBZA 3U23A 1Z9QA 5HCKA 3REBB 1UDLA 4AFQC 1TUCA 2AZSA 2CDTA 2GNCA 1UG1A 4LUDA 1ZUYA 2KT8A 1TUDA 2EYXA 1CKBA 4JJCA 1GL5A 2LZ6B 3VS5A 2AK5A 2DRKA 2KR3A 3EHQA 1GCQA 3VS0A 1WFWA 1E7OA 1AWJA 2J06A 1NYFA 2HDAA 5IHKA 4J9CA 1E6HA 1NG2A 1BU1A 1PKTA 2DRMA 3NPFA 3A98A 2B86A 2KNBB 2FG0A 1OOTA 1UHFA 1ZUUA 3RNJA 2BZXA 4QT7A 3UF4A 3I5SA 2CUDA 2KRNA 3EG0A 1QKXA 1M27C 4Z89A 1I07A 1UGVA 1V1CA 3GBQA 1MUZA 2YDLA 2CT3A 1SEMA 2AKKA 1AWOA 3M0UA 3I35A 2K2MA 4CC3A 1G2BA
chains in the Genus database with same CATH superfamily
3A8OB 3C4SA 1UGSB 2DO3A 3QIIA 5CKDA 4XU3A 1Q86U 2F1LA 2DPPB 2CUBA 4C5EA 1XTDA 1ZQ1A 3H0FA 4EDUA 1M2VA 4M77D 2RMOA 1M5Q1 2LRQA 2K57A 4J5YA 2KQWA 2O88A 3MKDA 3RERA 1AVZC 1H3ZA 2FZGB 2RI2A 1WA7A 2GBQA 1D3BA 3LLRA 2ZAEA 5GAN3 2C0OA 3M0RA 4J9GA 1WLPB 1WX6A 4K11A 2JOYA 4QQGA 1Q7YR 3FJPA 1AZGB 3DLMA 1TU0B 1VYVA 4GLKA 2KK4A 4M78G 2X51A 5A0DA 5GAN4 2KVQG 5I2MA 3QWYA 3FDRA 5KYWB 3M58A 2DXBA 3VKIA 3O5ZA 1U1TA 2CREA 4JJDA 3JB9G 2OTJA 1X6OA 2DL3A 3EG2A 2IIMA 2KXDA 3HPWA 3LYIA 5J39A 3CCQQ 4II1A 2EQJA 3CCRQ 1X01A 1LCKA 1JRIA 4ATOA 3INZA 3PMTA 4M7AA 4PJOD 1TXQA 2X4WA 2XG8D 5LJ5d 2KBTA 4OMNA 2DILA 3NGPA 1AHJB 1K8AC 3JCMP 2YRCA 1H8KA 4FW2A 3LWHA 3QWXX 1YCYA 2QEXA 3G6ET 2JTFA 1Q86R 4FSSA 2OTLT 5FRNA 2AIRB 3PT9A 1FYNA 2EQMA 4NS5A 1GBRA 1XJWB 4M7DE 1KQSP 3CQTA 2EGCA 2QYZA 2GF7A 5IXBA 4ZNXA 2OTJQ 2ATCB 2MF2A 3JCMe 3CXCS 3ER0A 1KK7A 2JMAA 2DBKA 1I4K1 2FRYA 4ZGDB 4LUEA 1VQ9Q 1WHHA 3OBYA 1K9MC 2ED1A 2VASA 3CMEQ 4M7DC 1J3TA 2K5LA 1YP5A 1M1GA 3EHRA 1KQ1A 2JTEA 2LJ3A 1BKBA 1SHFA 2NUPA 2EQUA 2RJEA 1FX7A 4OMQA 4WCIA 4MZPA 3G6EA 2CH4W 2FEIA 4OB3B 5KCOA 2EGEA 4KT0E 4DBHA 1KG1A 1FXXA 2NUPB 2GFAA 3EG1A 5GAOr 4P5NA 1MGQA 5GAOp 1O75A 1Y96B 2HAXA 1YJWA 3DKMA 3A8GB 1BI1A 4XK8E 4OB0B 3SFMA 2R5AA 1X6BA 2RHUA 3EG3A 5IH2A 2MWOA 1YFNA 1VQOT 3C12A 4DEXA 1LNXA 4MMLA 1RI9A 3MEAA 1WI7A 1YCSB 1QVPA 3JSCA 4M7AD 2QXFA 1I1JA 2DYIA 2OJ2A 3G71A 5CKFA 3NMZC 4J8OA 2KI7A 4Y92A 4V2SA 2L89A 2FZCB 3QKJA 2EKHA 2DIQA 2KXCA 1YHQQ 2NWMA 3RKXA 1PWTA 3CC2T 4E6RA 5FROA 1VQ5Q 2C0IA 1ZHIA 1V76A 2OAWA 2XDPA 3QJYA 2FRWA 2DJQA 4O5VA 2PVOB 2X9HA 1ZX6A 2XMFA 4EMHA 2NYSA 1NZ9A 2JM9A 4M7AE 4JRIA 4BE0A 3JCMJ 1JO8A 1QCOA 2FB7A 2X3WD 4IKFA 3EGXB 1XNIA 2RQVA 1U5SA 1LOJA 2YUOA 4M4ZA 3JCMQ 2D9TA 1ZA2B 1W2BS 3TREA 2QQRA 4IUVA 3SWNA 3M5AA 3CCJT 2RQTA 1I5OB 2KMTA 3THKA 4F14A 2F2WA 3OS5A 4C8QC 1YHQA 4BB7A 3BY7A 4EIKA 2JTMA 1PHTA 1BCOA 3CEYA 3TSZA 4M77G 5CQYA 1K4US 4QW2A 1SSFA 4MZTA 2RF0A 4C0GA 4JJBA 1TWBA 5KE2A 1AWWA 1RL2A 2DMOA 3H6ZA 1N8RR 1SKUB 2DE0X 4NL3A 1N8RC 2BTTA 1C6VX 1MMAA 1VQ8Q 5DLOA 2X35A 4BI8B 2P0QA 1M9SA 1R0BG 4FT2A 1SF9A 2F2VA 2KDSA 1MHNA 3OS1A 1X2KA 4CC2A 2EVRA 5GANd 2BIVA 1H92A 2VC8A 5LJ5f 5FU6B 4E7JA 3HFOA 1W6XA 3X26B 5KYNA 2JMCA 3OYAA 2K5IA 1HJDA 4BE1A 1QKWA 1GFDA 1W1FA 2M0YA 4C92B 1EFNA 2Z0WA 2QQ9A 3RBBB 4D8KA 3OYEA 2KE9A 2YLCA 2FPEA 2JM8A 1KC8R 1VQKQ 5CIUA 3DB3A 3SWNB 1M4ZA 2COYA 4HVUA 1O9SA 4PJOG 4J7FA 2BKDN 1VQ8A 2D6FA 1UFFA 1WHGA 3JCMb 5GAOn 4PJOF 2PZ1A 4BD3A 1G5VA 3OYFA 2O01E 1E6GA 5C6SA 2YXYA 3V8JA 2LP5A 3GNFB 2HQXA 4HCKA 2FZKB 3OS0A 4HXJA 1RAHB 1PRMC 2LQ8A 3M0QA 2J6KA 4AFZC 1ZUKA 4DOWA 3S3NA 1DJ7B 1N9SA 1Q86C 3L2VA 5KYXB 5GAMe 1TG0A 2YT6A 2OI3A 3O8VA 2E12A 2YUPA 1QVFP 2MK5A 2RJDA 3TQ7P 2HD0A 3EGDB 4IURA 2KAFA 2VGMA 1VQ7A 5KYXA 2EJFA 2PUKB 1WXTA 2E70A 1VUBA 1K9MU 3CBMA 4M75B 4J9BA 2A37A 2LVMA 4C5GA 5GAMg 2EKOA 1YITT 4XTZA 3A8LB 4L5GA 3REBB 1Y7XA 3V7RA 4R55A 4M77F 1UG1A 3EFOA 4LUDA 2XHCA 3VYGA 1KC8U 3SWNC 1GL5A 1M8VA 3J80E 1VQKT 1VIEA 2RM4A 2H3JA 1WFWA 3M57A 1AWJA 5LJ3d 2HDAA 5LJ3g 2CZ1B 1BU1A 1VQ6A 4HA8A 1UB4A 4KH0B 3NPFA 3A98A 1OU8A 4KUIA 2B86A 5I21A 3EH2A 1K8AU 2FG0A 3RNJA 2K4YA 4QT7A 3I5SA 5GAN8 2M16A 1UGVA 1V1CA 2EQKA 2LT1A 2CT3A 1SEMA 4O6JA 3I35A 3A8MB 1D3BB 1GCQC 2ZPFB 2ED0A 1SRLA 2P4RA 1GRIA 3V8LA 1WXUA 2EJGA 1HYOA 4AFSC 3TSWA 1T0JA 1MNDA 3M0TA 2CKKA 3QDFA 4LDYA 2A3LA 1VYTA 2MMPA 2WSCE 1VIFA 4RG2A 3UA6A 2CZ0B 2M1HA 4EMGA 3FC3A 2DM1A 1MV3A 2RQWA 4N4HA 2X4YA 4DEYA 3G4SQ 4M78C 3PGGA 3OA6A 3UDCA 1QW1A 3M9QA 2CP3A 5KE3A 3I5RA 5L23A 3VS6A 4BI3A 3HSBA 2EW3A 2MAMA 5CVIA 2E3HA 2ZPIB 3ZFJA 2LNHB 4AFUC 3OYNA 2DKGA 2GTJA 3A1PA 3NFCA 5A0GA 2LT4A 1XOVA 2LNVA 3ZBDA 5GAMf 5D6XA 2QGGA 3RESA 2LX7A 2B8AA 2QTVA 1WHKA 2EYQA 1RAIB 3OSSC 1YJNA 3CBOA 2MPXC 5AYFA 3T9NA 1BI0A 3VS1A 4C8QE 3CMAQ 4FYYB 1Q7YC 3VJPA 4B9XA 3G7ZA 4A54A 3X28B 4ZGJB 2J05A 1Y57A 4BDYA 3L1AA 4Q5WA 5GANh 1JJ2A 2CP2A 3QYGB 3UA7A 1ZLMA 2R57A 5CQXA 3SHWA 1UJYA 3G71Q 3FIFA 1W2BA 1QP2A 2H3EB 4RTYA 4BI4A 5A0LA 4CC7A 3CCSA 4N4GA 2QA4Q 3CCST 4J9FA 2JZ2A 3VYHB 5GAN2 1IHWA 1M3CA 2E64A 2HQHA 2CGHA 2HBPA 3S6WA 4MMKA 4X9CA 3MJXA 1JU5C 4HCCA 4M7DG 4ZN3A 1VA7A 4JZ3A 4PK4A 1X75C 3LW5E 2V1RA 1HXDA 3QZ9B 2ZCFB 1VQOQ 1QP3A 3EG9A 3I56A 4ZTFA 2IPOB 3CCVT 4N0AA 1C0MA 1AOJA 1D1CA 4RTVA 1KHIA 2RB6A 1M1KC 3V7SA 4E7SA 4X34A 1VQ6Q 1M3AA 3GLXA 2HNIA 2M0OA 4JLIA 3GIBA 2HSEB 4DBQA 2W0ZA 5DY9A 4RTUA 1QMCA 2YRVA 4GLMA 1VQ9A 2RA2A 4CRIA 1M1FA 5EC7A 3F70A 4QQDA 3RMQA 1CKAA 1RLQC 4PJLA 3JRZA 3VU3C 3R6OA 2DVJA 2E4HA 3L42A 3CPWS 3TEEA 2LQNA 2ZPBB 1X43A 2KEAA 3OYIA 4J9EA 2QK0A 4M77E 2DAQA 5I22A 3PTAA 5L8RE 1KQ2A 4M7DB 1PNJA 1KFZA 1JJ2S 2QA4T 3Q1JA 3MPUB 4F04B 3QO3A 4TVRA 5CKEA 1OULA 5GMKm 3CCQA 2AKLA 4EMKA 1SRMA 1VQLQ 1T0HA 3WVEB 4LDVA 3H8ZA 7AT1B 5I11A 5GANg 2D8JA 2BE9B 3CCLT 4X9DA 3JCMX 3FB9A 3OW2P 2W10A 4C8QA 4M7DF 2VB6A 1G3YA 2HQEA 2J7IA 1F1BB 1YBYA 2RK1A 3CD6A 2DNUA 5LJ5h 2RQUA 2RI5A 5CR2A 1VQ4A 1K9AA 1M90C 1PKSA 4DA4A 1OX8A 4M7AG 2QGFB 5IXFA 3CPWA 2KRMA 4F7UB 3JAME 2RN8A 4LNPA 2JXBA 1OYXA 1NLPC 3E19A 1VQMA 4PLIA 3PFSA 3FEOA 1VQ5A 1KHCA 2V1QA 1ABOA 2DTOA 1M8MA 2J6FA 2ZPGB 1WIEA 1D1BA 4ZN1A 4EMKB 2DEUA 4RTWA 2A08A 1M30A 3V7CA 2D0QB 2MIOA 5IHIA 3CC7A 4RTZA 1QVFS 2RNAA 1SHGA 1NLOC 1TH7A 3G71T 2COZA 3CCQT 1Y71A 3CC7T 3OYKA 4C0DC 4KUDK 5CO7A 4LD9K 2BUDA 1W70A 4OMMA 3OYBA 2YLBA 2DTHA 3CCJA 5LJ3j 1RAFB 2DFUA 1M2OA 3CCSQ 2QA4A 1K0SA 2LX9A 2RHIA 1B34A 2PVGB 5GJVB 2F69A 2HKQB 3LGLA 4M78F 1QVGA 1QWEA 3P8BB 4Z88A 5GAMh 2P0PA 1WDXA 1ARKA 1G83A 3CD6Q 1MNEA 4PFOA 4JLGA 2YHTA 1X6GA 3EFSA 2D1XA 3VUZA 1N8RU 1YWPA 3CC4Q 1AWXA 4ORZA 2Y4YA 2EBPA 2MCNA 1IO6A 4FT4A 3NHNA 2K6DA 4JS5A 2RHYA 3ULRB 2DEQA 1U3OA 1VQMQ 2DJZA 4M7DA 3JCMh 4IUUA 1YHQT 1YJ9A 1AEYA 1PCXA 4L6V5 1YJNT 4A4GA 3EFRA 1RI0A 1X2QA 3X24B 2BZYA 6AT1B 1BI3A 3P8DA 1M3BA 4OVAA 3CMAT 2DYBA 1K73C 1IXDA 5HKCA 1AZEA 1YI2Q 4J6XA 2O9SA 1ACMB 3VS3A 4AG1C 1JEGA 1PG5B 1PD1A 5GAN7 3G4ST 2QEXQ 2OTLA 1Q81U 4JRKA 4PJJA 1WJQA 3PMIA 5HCKA 3JB9I 1UDLA 4AFQC 4LD6A 3CBPA 4BDZA 3GPLA 1TUDA 1CKBA 4DQ2A 2LZ6B 2RJFA 5A2QE 2AK5A 3EHQA 2VXEA 3VS0A 1VQLA 4J9CA 1E6HA 4OB2B 2DRMA 4M75E 1FWZA 3I55T 5LL6S 2HKNA 2QQSA 1UHFA 1VQ7Q 4ELYC 3UF4A 1U1SA 3EG0A 1QKXA 4Z89A 4NL2A 3GBQA 4E7KA 1PSFA 1KQSS 1OU9A 1NJIR 5HY6A 3M0UA 3HP9A 4CC3A 1Q81C 3MCAB 1IB8A 1YJ9Q 5GAOq 1MV0B 1NEBA 3URGA 1LJOA 3RKWA 2ECZA 5GJWB 5LJ3f 2AZVA 5KCHA 3PVQA 3PE0A 3HL8A 1RAAB 4R56A 4X1VA 4C92C 2JJ9A 3JB9J 2HL3A 3OYJA 3CC7Q 5FW9A 2JT4A 3CCEQ 5D6WA 2K5FA 5KYUB 4LXCA 2COWA 1YJ9T 4ANJA 3J81E 1MMNA 5KH6A 1R77A 1SSHA 1JB0E 2K3YA 1NM7A 3AHUA 3M0PA 4Y91A 3CCRT 1YITA 3CXCA 1VQOA 4F16A 3I56Q 2JS0A 3OYDA 1PD0A 2LMJA 5CK9A 4C0FA 4IUTA 3VRZA 3OBWA 2ZGWA 2L3QA 2CH4A 2FYKA 2K9GA 3GNGA 3OYYA 1GXIE 5KYWA 1NPRA 2ENMA 2RHZA 3E2UA 3L2UA 3I55Q 3H0IA 9ATCB 5J3BA 1ZBJA 4EPCA 1KSWA 2RHXA 3AT1B 2CSIA 2L5QA 2ZZDA 4B9WA 5GANe 1QCFA 2J6OA 2O4XB 2MOXA 4M78A 4HCZA 2XK0A 4OGEA 1W4SA 4DBFA 2KY9A 4M75C 3G4SA 1YN8A 1OQKA 1BK2A 1WQ7A 2DL7A 2HSPA 4J9HA 2LJ1A 3PIPA 1OV3A 3BDUA 2FPFA 2OX7A 5J26A 3KXTA 1S72A 3OMGA 2PUOB 3HRTA 2ROTA 2LCLA 3OYLA 1WGSA 3CCVQ 4E7IA 3QBYA 4C8QB 1YI2T 2H8HA 3MP1A 2K79A 1IGUA 3VRYA 3EFOB 1GBQA 3OSVA 1Q82U 4AT1B 2DXTA 1RAGB 4B6MA 1OPKA 2I2LA 2NUZA 2EPDA 1YIJQ 1YI2A 2HEQA 2A0FB 4JDSA 3PNWC 2E5KA 1RACB 3QG1A 2QI2A 4OMPA 3EGUA 4IUQA 2GGRA 2VVKA 4AG2C 1TSFA 4FW1A 4DOVA 1M90U 3CPFA 2QQAA 1R8OB 4JPBW 1VQ4Q 2DL8A 3IQLA 2DETA 2KSSA 3C95A 2OAUA 3ASKA 1QCNA 4FU6A 3FRNA 1QWFA 3M4YA 4HCBA 1UUEA 2JS2A 2DA9A 3QSUA 2LQWA 5FWBA 1T3LA 1VQ4T 3CCLA 2GQVA 2QG9B 2DK3A 2KYBA 3JV3A 4PL6A 1BIAA 1B7TA 3PIOA 2K2VA 2YUNA 1V29B 1VQPQ 2E65A 4M7DD 4ELZC 3WVDB 3ZEHA 2K3XA 4PFPA 3X25B 1R0CB 1S72T 3CCVA 2P0KA 4Z02A 3JCMd 4BY6B 1YWOA 1BIBA 3LH0A 1BI2A 1Q82R 2R58A 4A4HA 5HK0A 2PNIA 3E9GA 4C92D 1VQ5T 4BE2A 4FIBA 2X4XA 1YIJA 4M7AF 4KULA 3RMSA 4UC4A 1X69A 4QVZA 2QDYB 4A53A 5IN1A 2XICA 3JB9D 4C0ZA 4MZMA 1I81A 2E5QA 5GMKe 3HRUA 2QQBA 4KH1B 8ATCB 4AMCA 1JQQA 4ESRA 2DERA 4PJOE 2XD0A 1G3SA 3X20B 1IHVA 3E1SA 4JRQA 3G1JA 1Q82C 4GY5A 1OI1A 4KGZB 2YWWA 3EAEA 1VQNA 2X3XD 4N4IA 4QKUA 5AT1B 4M7AC 1I8FA 4J6WA 3RDVA 1ZSZA 3OYGA 1CSKA 3CCLQ 2IG0A 3TVTA 4BUGA 2GTOA 1WHJA 1HSQA 2VWFA 2PQWA 2L3PA 5GAMd 1ZSZB 4QQ6A 3HRSA 5KYYA 2CP7A 3H0HA 4LN2A 5GMKh 1VQPT 3M0SA 2HMAA 3N5BB 4M75D 3L2QA 3CCUT 3VV0A 1NJIC 3META 1Y07A 1IREB 2DZCA 5D6YA 2DBMA 2HCKA 1OEBA 2GQIA 2OTLQ 3CC2A 3UT1A 3RR6A 2XKOC 2WSEE 3I9QA 3G6EQ 3RUXA 3CMET 4OMOA 2NUTB 2PU9B 4J9IA 2E1HA 1FMKA 3VS7A 3QPHA 2EYWA 4A63B 1WXBA 5DLQE 4C8QD 2E10A 2JW4A 3MEVA 2CT4A 4PJNA 2P84A 1T3SA 3OQ5A 1KD1R 4BACA 2JNGA 1OZ2A 3CCRA 3EGXA 4C8QF 4RMOA 5LJ3e 3CCMQ 2KRSA 1NPPA 3NTHA 1TOVA 5M9OA 5CCAA 3GP8A 1Y0MA 1YJWT 3L2WA 3KUFA 1UTIA 4ME7A 1Q95G 4FYVB 1I0CA 3QUIA 2KT1A 2FVUA 4OGCA 4JZ4A 2ESWA 2QDLA 4RUGA 1D1AA 1K73R 2E6NA 2JN0A 4J9DA 3OW2A 2RI3A 1NYGA 3CC4T 4F7UE 4PKCC 3TU4K 4FSXA 3CXCP 3NTKA 3BDLA 1OZ3A 5LJ5j 3CMAA 1KQSA 3M53A 1VQPA 2L3SA 2IVWA 3L2ZA 4IUPA 2DXUA 3CPWP 3LGFA 1B3QA 3CC2Q 3DB4A 5GMKi 4PJOA 1QVFA 2KGTA 4HKEA 3D7SB 1TUCA 2AZSA 2CDTA 2GNCA 4F7UG 2CS7A 1ZUYA 2KT8A 4Y28E 1KD1C 2EYXA 1WNLA 3MO8A 4E7LA 4QVDA 2QTXA 1MMGA 3VS5A 3OYCA 3JB9F 4FM4B 2KR3A 4QVCA 2NUTA 1NYFA 5IHKA 2E3IA 2Y4XA 4EMKC 5IAYA 3M59A 3CCMA 1VQ6T 3CMEA 1G3TA 3OW2S 3EGDA 3P8HA 3MEWA 2MI6A 3WXMB 2BZXA 4ZGEB 5D7UA 1D0YA 2VGNA 1K73U 1M27C 1I07A 3CCUA 3JB9H 1MUZA 5GAMj 4C0DB 1YIJT 3E9FA 4M78E 3OMCA 3JCMW 4FYWB 1NE8A 1N27A 1Q81R 2A28A 2RD1A 3CCJQ 1UGQB 4M77A 3KFVA 3M56A 1PSEA 4FL6A 4XU1A 2DX1A 1KIKA 1B07A 2E41A 2EWNA 2LCCA 4C92G 2FPDA 4A4FA 4JJNK 1NEGA 2M02A 2K3BA 2AT1B 2AHJB 1VQNT 4C5IA 3QXEB 4XU0A 1M2VB 2DF6A 1OX9A 4MDWA 3DLLA 4RTXA 4PJMA 5ECAA 3H41A 3CCUQ 4J7IA 1AT1B 1WHLA 1UGPB 1QVGP 2Y90A 1QVGS 1EIFA 1K76A 2ZPHB 4XTUA 2XDBA 1FMVA 3QJ6A 2XU8A 2DL4A 3CCMT 5FRMA 2V8KA 1A0NB 3LH5A 2EQIA 4XU2A 4XTXA 2HZYA 4PNOA 2L2PA 2EYYA 1QQJA 3OYMA 1WJSA 3MP6A 1HK9A 1ZA1B 1YNZA 2DTIA 2EAYA 3HFNA 4XTWA 4E7ZA 2EGAA 4OMLA 2BE7D 3SDZA 4M75G 2RQRA 4PFZA 3I56T 3ME9A 2SRCA 5KYUA 4FYXB 4RKUE 4N0AC 2ZPEB 1JJ2P 1WPYA 2PVDB 1QLYA 2VXFA 4RTTA 5DM7R 1XQHA 4RG8A 1RLPC 1YJWQ 1JBMA 3JCMV 4C5HA 2L0AA 2VUBA 2M9UA 3FJ5A 3S3MA 2C0TA 1KD1U 1M1KR 1WJRA 1Z9ZA 4VUBA 1LPLA 5C0MA 3BW1A 4IIOA 1UJ0A 4L59A 1N5ZA 3CD6T 1Q7YU 2DVEA 2G6FX 5LJ3h 4XAXB 3SEMA 1Y96A 2VKNA 3UPUA 4J83A 1BYMA 4C92E 4OMFB 3CCET 1K0XA 3UWNA 2CP0A 2NLUA 4IIMA 1PC0A 5FU6C 2YRDA 2BZ8A 3FLGA 3BE3A 3RKYA 2FO0A 2CZ7B 2RO0A 4WF2A 2DZ9A 5LJ5e 1PM3A 2FL7A 4KGXB 2WSFE 3MHXA 2DD5A 3QZ5B 4OF1A 4NOYA 1EZZB 2GFUA 2YSQA 2CYZB 4OP0A 3JCMg 2R5MA 2O31A 5IT9E 1C1AA 3M54A 3CC4A 2O4XA 4XQ3A 1VQ9T 1WZOA 2D8HA 3EG9B 2QAZA 2VV5A 2CSQA 1BB9A 1K9MR 1H641 2PTKA 1M90R 3OS2A 1RABB 2I0NA 1UE9A 1OPLA 1H3HA 2LJ0A 2DL5A 3KBGA 3I55A 5KYYB 2F5KA 1BCMA 2MWPA 5CKBA 3OY9A 1I5LA 1UECA 2LDMA 1B34B 3PVLA 3M4GA 5GANj 3CCEA 1YJNQ 2JUFA 3A8HB 3QDRB 2KYMA 5GAOm 3C94A 4CI0C 4M75A 1WQWA 2V26A 3OB9A 4E2FB 4F17A 2F5TX 3VS2A 1TS9A 1S1NA 2DLPA 3H9NA 3QHSA 5LJ5g 1GCPA 2V8JA 2A7YA 2P4TA 4R0KA 1VQLT 3JCMf 1ZSGA 4WTOB 2A36A 4CC4B 1VOMA 1D0ZA 4FCYA 1S72Q 4MDXA 4C8QG 3V8KA 2JVVA 1KJWA 8AT1B 1AD5A 2SEMA 2EYZA 3BFMA 4M77C 2RPNA 4JS4A 2WACA 1VQKA 3MP8A 5FU7C 2KROA 1KC8C 2YUQA 2O2OA 4F7UA 2LC4A 4BY6C 5FWCA 1LVKA 4JUVA 3REAB 4D6WA 1TUGB 2EFIA 4XTVA 1GFCA 4F7UF 1IRXA 1UHCA 2RH2A 2O9VA 2XI9A 1TTHB 4C92A 4E47A 4KRTA 1P92A 1WHMA 1FMWA 1MMDA 3S3OA 1IGQA 1VQ7T 2M51A 4XTYA 3R6NA 3VUBA 1WYXA 1U06A 2DIGA 3LWIA 1JXOA 4M78D 4LDXA 3TCJA 5GAOl 3VS4A 5I2SA 3GF5A 2GCXA 2K7AA 2RK2A 4A4KA 1ZBXA 4PLLA 5GAN5 4KBMB 3J7AF 4PJOC 1NBEB 4HVVA 2LCSA 2G3RA 3ZL7C 1G3WA 4RCCA 1RUWA 3A5ZB 3M55A 4JRPA 3QYHB 2ROLA 4D8DA 2CP6A 1YITQ 1SPKA 4M77B 2DXCA 2FHDA 1ABQA 3UATA 1JXMA 2L8DA 3JCMc 2LTOA 4Z8AA 4LE9A 1ZSZC 1N9RA 4E7HA 3HKSA 2X4JA 2OTJT 5FU7B 1K1ZA 1VYUA 2HL5C 4M75F 1HD3A 2D0NA 4HVWA 2ABLA 3HTRA 1D0XA 5GMKl 1W2BP 2CZ6B 1RADB 4GBQA 4J6YA 4HT8A 2XDDA 3C0CA 3NTIA 5IHNA 1X27A 1SG5A 5GANf 1PRLC 2HBWA 2VYTA 4HT9A 2E6ZA 2F2XA 3LX7A 5EG2A 2V8IA 4RCBA 1VQMT 2QEXT 4ZTJA 5FLXE 4LDUA 5CAIA 1BBZA 2EIFA 3U23A 1NJIU 1Z9QA 5GAN6 3HHTB 5HK3A 4YTLA 2L3RA 1EX4A 2QASA 4M7AB 1VQNQ 4KGVB 1K8AR 4JJCA 4PJOB 2MYSA 3SB2A 2DRKA 4M78B 4DBRA 1GCQA 2LQKA 4A4EA 1D09B 1E7OA 2J06A 3OYHA 1NG2A 1VQ8T 4OB1B 1PKTA 1M1KU 2EJ9A 2KNBB 4C92F 3MEUA 1OOTA 1ZUUA 3RIRA 2CP5A 1U8RA 3L2RA 2DD4A 5GMKj 2CUDA 2KRNA 1IZ6A 2RJCA 1UGRB 1UEBA 2XIDA 3SD4A 4LDWA 2YDLA 2C06A 1N6AA 5CKHA 2AKKA 1RAEB 1AWOA 1G8XA 3GOXA 2K2MA 1G2BA 3EH1A
chains in the Genus database with same CATH topology
1GCQC 2A28A 1MV0B 1NEBA 2ED0A 1SRLA 2P4RA 1GRIA 2ECZA 5GJWB 2CUBA 3KFVA 1WXUA 2AZVA 3H0FA 3PVQA 3PE0A 4AFSC 2DX1A 1T0JA 2RMOA 3TSWA 1KIKA 1B07A 4X1VA 3M0TA 2O88A 2FPDA 1NEGA 1AVZC 1VYTA 5FW9A 2K3BA 2JT4A 1WA7A 2GBQA 3UA6A 2C0OA 3M0RA 4J9GA 1WLPB 1WX6A 2DF6A 4K11A 1AZGB 2DM1A 4RTXA 5ECAA 1MV3A 2RQWA 1VYVA 3H41A 4DEYA 1SSHA 1NM7A 3M0PA 3I5RA 5L23A 3VS6A 3QWYA 4F16A 2EW3A 2JS0A 1K76A 2LMJA 3O5ZA 2LNHB 4AFUC 3VRZA 2CREA 4JJDA 2GTJA 2DL4A 2L3QA 2CH4A 2K9GA 1XOVA 2DL3A 2ENMA 3EG2A 2IIMA 2KXDA 3H0IA 1A0NB 3LH5A 1ZBJA 2EQIA 1KSWA 2LX7A 2CSIA 2L2PA 2EYYA 1LCKA 1QCFA 2J6OA 3VS1A 2MOXA 1YNZA 2EGAA 2KBTA 4OMNA 2DILA 3NGPA 4OMLA 1H8KA 2RQRA 2J05A 3QWXX 1Y57A 1YN8A 2SRCA 1BK2A 2DL7A 4FSSA 2HSPA 4J9HA 2LJ1A 1OV3A 2FPFA 1FYNA 1GBRA 1QLYA 3UA7A 1ZLMA 3CQTA 2EGCA 2ROTA 4RTTA 3SHWA 1UJYA 5IXBA 4ZNXA 2H8HA 4RTYA 1RLPC 2K79A 4CC7A 3VRYA 1GBQA 2L0AA 4J9FA 2JMAA 2DBKA 1OPKA 3FJ5A 2NUZA 2C0TA 1M3CA 2EPDA 2FRYA 4LUEA 1Z9ZA 2HEQA 2ED1A 1JU5C 2E5KA 1VA7A 1J3TA 4JZ3A 1YP5A 4IIOA 4OMPA 3EGUA 1UJ0A 3EHRA 1N5ZA 2V1RA 2GGRA 2VVKA 2JTEA 2LJ3A 4AG2C 1SHFA 2G6FX 4OMQA 4WCIA 4JPBW 2VKNA 3SEMA 2DL8A 2CH4W 2FEIA 2EGEA 3IQLA 1K0XA 4IIMA 3EG1A 1QWFA 1AOJA 2BZ8A 4RTVA 2FO0A 1UUEA 2JS2A 2DA9A 2LQWA 1M3AA 1T3LA 5FWBA 1X6BA 3EG3A 2W0ZA 3JV3A 2KYBA 4RTUA 4GLMA 5IH2A 5EC7A 2YSQA 1CKAA 1RLQC 2YUNA 2DVJA 2O31A 4DEXA 1RI9A 1WI7A 2LQNA 2D8HA 1YCSB 1X43A 1I1JA 2OJ2A 2CSQA 3NMZC 1BB9A 2KEAA 4J9EA 4Y92A 2PTKA 1YWOA 5I22A 2EKHA 2I0NA 1PNJA 2KXCA 1KFZA 1UE9A 2NWMA 2PNIA 1PWTA 1OPLA 4E6RA 1H3HA 2LJ0A 2DL5A 2C0IA 2AKLA 1SRMA 1UECA 1T0HA 5I11A 3PVLA 2OAWA 1X69A 2FRWA 2D8JA 2DJQA 2KYMA 1ZX6A 2W10A 2XMFA 2JM9A 2J7IA 1JO8A 4F17A 3VS2A 2DNUA 2X3WD 1JQQA 4ESRA 2RQUA 1S1NA 2DLPA 2RQVA 1GCPA 1U5SA 4R0KA 2YUOA 4M4ZA 1K9AA 1ZSGA 2A36A 2RQTA 4CC4B 2X3XD 1PKSA 3THKA 4F14A 2F2WA 5IXFA 2KRMA 2RN8A 4LNPA 2JXBA 1KJWA 1AD5A 1NLPC 2SEMA 2EYZA 4EIKA 1CSKA 3TVTA 1PHTA 2GTOA 3TSZA 2V1QA 1HSQA 1ABOA 2VWFA 1K4US 2RPNA 1M8MA 2J6FA 2L3PA 1WIEA 2RF0A 4JJBA 4RTWA 2A08A 1M30A 2KROA 2MIOA 1AWWA 5IHIA 2YUQA 2O2OA 2DMOA 4RTZA 3H0HA 4LN2A 2DE0X 2BTTA 3M0SA 2RNAA 1SHGA 1NLOC 5FWCA 3REAB 2F2VA 1GFCA 1UHCA 2DBMA 2HCKA 1X2KA 1OEBA 2GQIA 2O9VA 2EVRA 4CC2A 1H92A 3I9QA 4OMOA 1W70A 4KRTA 4OMMA 4J9IA 1FMKA 1W6XA 3VS7A 2EYWA 2M51A 2JMCA 4A63B 1K0SA 1WXBA 3R6NA 1HJDA 5GJVB 2JW4A 1QKWA 1GFDA 1W1FA 1WYXA 2CT4A 1U06A 2M0YA 1EFNA 4D8KA 1T3SA 3RBBB 1JXOA 2KE9A 1QWEA 2FPEA 4Z88A 3VS4A 2JM8A 1WDXA 1ARKA 2K7AA 1G83A 2KRSA 4HVUA 4HVVA 2LCSA 1X6GA 1UFFA 3ZL7C 1RUWA 1Y0MA 2PZ1A 1E6GA 2D1XA 2ROLA 1YWPA 1UTIA 4D8DA 1AWXA 4ORZA 1SPKA 2LP5A 2EBPA 1ABQA 1JXMA 2MCNA 3UATA 1IO6A 1I0CA 3NHNA 4HCKA 2K6DA 4LE9A 4HXJA 4Z8AA 1PRMC 3ULRB 2KT1A 1U3OA 4JZ4A 2ESWA 3M0QA 2J6KA 4AFZC 1K1ZA 2QDLA 1ZUKA 1VYUA 4RUGA 1HD3A 2D0NA 4HVWA 2ABLA 4J9DA 1NYGA 1AEYA 1TG0A 4GBQA 2YT6A 2OI3A 2YUPA 3C0CA 1X2QA 1X27A 5IHNA 2BZYA 1M3BA 1PRLC 2DYBA 2HBWA 1AZEA 2F2XA 2L3SA 2O9SA 3VS3A 4AG1C 1JEGA 1WXTA 1B3QA 4J9BA 2A37A 2KGTA 1BBZA 3U23A 1Z9QA 5HCKA 3REBB 1UDLA 4AFQC 1TUCA 2AZSA 2CDTA 2GNCA 1UG1A 4LUDA 1ZUYA 2KT8A 1TUDA 2EYXA 1CKBA 4JJCA 1GL5A 2LZ6B 3VS5A 2AK5A 2DRKA 2KR3A 3EHQA 1GCQA 3VS0A 1WFWA 1E7OA 1AWJA 2J06A 1NYFA 2HDAA 5IHKA 4J9CA 1E6HA 1NG2A 1BU1A 1PKTA 2DRMA 3NPFA 3A98A 2B86A 2KNBB 2FG0A 1OOTA 1UHFA 1ZUUA 3RNJA 2BZXA 4QT7A 3UF4A 3I5SA 2CUDA 2KRNA 3EG0A 1QKXA 1M27C 4Z89A 1I07A 1UGVA 1V1CA 3GBQA 1MUZA 2YDLA 2CT3A 1SEMA 2AKKA 1AWOA 3M0UA 3I35A 2K2MA 4CC3A 1G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCQ C;  2A28 A;  1MV0 B;  1NEB A;  2ED0 A;  1SRL A;  2P4R A;  1GRI A;  2ECZ A;  5GJW B;  2CUB A;  3KFV A;  1WXU A;  2AZV A;  3H0F A;  3PVQ A;  3PE0 A;  4AFS C;  2DX1 A;  1T0J A;  2RMO A;  3TSW A;  1KIK A;  1B07 A;  4X1V A;  3M0T A;  2O88 A;  2FPD A;  1NEG A;  1AVZ C;  1VYT A;  5FW9 A;  2K3B A;  2JT4 A;  1WA7 A;  2GBQ A;  3UA6 A;  2C0O A;  3M0R A;  4J9G A;  1WLP B;  1WX6 A;  2DF6 A;  4K11 A;  1AZG B;  2DM1 A;  4RTX A;  5ECA A;  1MV3 A;  2RQW A;  1VYV A;  3H41 A;  4DEY A;  1SSH A;  1NM7 A;  3M0P A;  3I5R A;  5L23 A;  3VS6 A;  3QWY A;  4F16 A;  2EW3 A;  2JS0 A;  1K76 A;  2LMJ A;  3O5Z A;  2LNH B;  4AFU C;  3VRZ A;  2CRE A;  4JJD A;  2GTJ A;  2DL4 A;  2L3Q A;  2CH4 A;  2K9G A;  1XOV A;  2DL3 A;  2ENM A;  3EG2 A;  2IIM A;  2KXD A;  3H0I A;  1A0N B;  3LH5 A;  1ZBJ A;  2EQI A;  1KSW A;  2LX7 A;  2CSI A;  2L2P A;  2EYY A;  1LCK A;  1QCF A;  2J6O A;  3VS1 A;  2MOX A;  1YNZ A;  2EGA A;  2KBT A;  4OMN A;  2DIL A;  3NGP A;  4OML A;  1H8K A;  2RQR A;  2J05 A;  3QWX X;  1Y57 A;  1YN8 A;  2SRC A;  1BK2 A;  2DL7 A;  4FSS A;  2HSP A;  4J9H A;  2LJ1 A;  1OV3 A;  2FPF A;  1FYN A;  1GBR A;  1QLY A;  3UA7 A;  1ZLM A;  3CQT A;  2EGC A;  2ROT A;  4RTT A;  3SHW A;  1UJY A;  5IXB A;  4ZNX A;  2H8H A;  4RTY A;  1RLP C;  2K79 A;  4CC7 A;  3VRY A;  1GBQ A;  2L0A A;  4J9F A;  2JMA A;  2DBK A;  1OPK A;  3FJ5 A;  2NUZ A;  2C0T A;  1M3C A;  2EPD A;  2FRY A;  4LUE A;  1Z9Z A;  2HEQ A;  2ED1 A;  1JU5 C;  2E5K A;  1VA7 A;  1J3T A;  4JZ3 A;  1YP5 A;  4IIO A;  4OMP A;  3EGU A;  1UJ0 A;  3EHR A;  1N5Z A;  2V1R A;  2GGR A;  2VVK A;  2JTE A;  2LJ3 A;  4AG2 C;  1SHF A;  2G6F X;  4OMQ A;  4WCI A;  4JPB W;  2VKN A;  3SEM A;  2DL8 A;  2CH4 W;  2FEI A;  2EGE A;  3IQL A;  1K0X A;  4IIM A;  3EG1 A;  1QWF A;  1AOJ A;  2BZ8 A;  4RTV A;  2FO0 A;  1UUE A;  2JS2 A;  2DA9 A;  2LQW A;  1M3A A;  1T3L A;  5FWB A;  1X6B A;  3EG3 A;  2W0Z A;  3JV3 A;  2KYB A;  4RTU A;  4GLM A;  5IH2 A;  5EC7 A;  2YSQ A;  1CKA A;  1RLQ C;  2YUN A;  2DVJ A;  2O31 A;  4DEX A;  1RI9 A;  1WI7 A;  2LQN A;  2D8H A;  1YCS B;  1X43 A;  1I1J A;  2OJ2 A;  2CSQ A;  3NMZ C;  1BB9 A;  2KEA A;  4J9E A;  4Y92 A;  2PTK A;  1YWO A;  5I22 A;  2EKH A;  2I0N A;  1PNJ A;  2KXC A;  1KFZ A;  1UE9 A;  2NWM A;  2PNI A;  1PWT A;  1OPL A;  4E6R A;  1H3H A;  2LJ0 A;  2DL5 A;  2C0I A;  2AKL A;  1SRM A;  1UEC A;  1T0H A;  5I11 A;  3PVL A;  2OAW A;  1X69 A;  2FRW A;  2D8J A;  2DJQ A;  2KYM A;  1ZX6 A;  2W10 A;  2XMF A;  2JM9 A;  2J7I A;  1JO8 A;  4F17 A;  3VS2 A;  2DNU A;  2X3W D;  1JQQ A;  4ESR A;  2RQU A;  1S1N A;  2DLP A;  2RQV A;  1GCP A;  1U5S A;  4R0K A;  2YUO A;  4M4Z A;  1K9A A;  1ZSG A;  2A36 A;  2RQT A;  4CC4 B;  2X3X D;  1PKS A;  3THK A;  4F14 A;  2F2W A;  5IXF A;  2KRM A;  2RN8 A;  4LNP A;  2JXB A;  1KJW A;  1AD5 A;  1NLP C;  2SEM A;  2EYZ A;  4EIK A;  1CSK A;  3TVT A;  1PHT A;  2GTO A;  3TSZ A;  2V1Q A;  1HSQ A;  1ABO A;  2VWF A;  1K4U S;  2RPN A;  1M8M A;  2J6F A;  2L3P A;  1WIE A;  2RF0 A;  4JJB A;  4RTW A;  2A08 A;  1M30 A;  2KRO A;  2MIO A;  1AWW A;  5IHI A;  2YUQ A;  2O2O A;  2DMO A;  4RTZ A;  3H0H A;  4LN2 A;  2DE0 X;  2BTT A;  3M0S A;  2RNA A;  1SHG A;  1NLO C;  5FWC A;  3REA B;  2F2V A;  1GFC A;  1UHC A;  2DBM A;  2HCK A;  1X2K A;  1OEB A;  2GQI A;  2O9V A;  2EVR A;  4CC2 A;  1H92 A;  3I9Q A;  4OMO A;  1W70 A;  4KRT A;  4OMM A;  4J9I A;  1FMK A;  1W6X A;  3VS7 A;  2EYW A;  2M51 A;  2JMC A;  4A63 B;  1K0S A;  1WXB A;  3R6N A;  1HJD A;  5GJV B;  2JW4 A;  1QKW A;  1GFD A;  1W1F A;  1WYX A;  2CT4 A;  1U06 A;  2M0Y A;  1EFN A;  4D8K A;  1T3S A;  3RBB B;  1JXO A;  2KE9 A;  1QWE A;  2FPE A;  4Z88 A;  3VS4 A;  2JM8 A;  1WDX A;  1ARK A;  2K7A A;  1G83 A;  2KRS A;  4HVU A;  4HVV A;  2LCS A;  1X6G A;  1UFF A;  3ZL7 C;  1RUW A;  1Y0M A;  2PZ1 A;  1E6G A;  2D1X A;  2ROL A;  1YWP A;  1UTI A;  4D8D A;  1AWX A;  4ORZ A;  1SPK A;  2LP5 A;  2EBP A;  1ABQ A;  1JXM A;  2MCN A;  3UAT A;  1IO6 A;  1I0C A;  3NHN A;  4HCK A;  2K6D A;  4LE9 A;  4HXJ A;  4Z8A A;  1PRM C;  3ULR B;  2KT1 A;  1U3O A;  4JZ4 A;  2ESW A;  3M0Q A;  2J6K A;  4AFZ C;  1K1Z A;  2QDL A;  1ZUK A;  1VYU A;  4RUG A;  1HD3 A;  2D0N A;  4HVW A;  2ABL A;  4J9D A;  1NYG A;  1AEY A;  1TG0 A;  4GBQ A;  2YT6 A;  2OI3 A;  2YUP A;  3C0C A;  1X2Q A;  1X27 A;  5IHN A;  2BZY A;  1M3B A;  1PRL C;  2DYB A;  2HBW A;  1AZE A;  2F2X A;  2L3S A;  2O9S A;  3VS3 A;  4AG1 C;  1JEG A;  1WXT A;  1B3Q A;  4J9B A;  2A37 A;  2KGT A;  1BBZ A;  3U23 A;  1Z9Q A;  5HCK A;  3REB B;  1UDL A;  4AFQ C;  1TUC A;  2AZS A;  2CDT A;  2GNC A;  1UG1 A;  4LUD A;  1ZUY A;  2KT8 A;  1TUD A;  2EYX A;  1CKB A;  4JJC A;  1GL5 A;  2LZ6 B;  3VS5 A;  2AK5 A;  2DRK A;  2KR3 A;  3EHQ A;  1GCQ A;  3VS0 A;  1WFW A;  1E7O A;  1AWJ A;  2J06 A;  1NYF A;  2HDA A;  5IHK A;  4J9C A;  1E6H A;  1NG2 A;  1BU1 A;  1PKT A;  2DRM A;  3NPF A;  3A98 A;  2B86 A;  2KNB B;  2FG0 A;  1OOT A;  1UHF A;  1ZUU A;  3RNJ A;  2BZX A;  4QT7 A;  3UF4 A;  3I5S A;  2CUD A;  2KRN A;  3EG0 A;  1QKX A;  1M27 C;  4Z89 A;  1I07 A;  1UGV A;  1V1C A;  3GBQ A;  1MUZ A;  2YDL A;  2CT3 A;  1SEM A;  2AKK A;  1AWO A;  3M0U A;  3I35 A;  2K2M A;  4CC3 A;  1G2B A; 
#chains in the Genus database with same CATH topology
 3A8O B;  3C4S A;  1UGS B;  2DO3 A;  3QII A;  5CKD A;  4XU3 A;  1Q86 U;  2F1L A;  2DPP B;  2CUB A;  4C5E A;  1XTD A;  1ZQ1 A;  3H0F A;  4EDU A;  1M2V A;  4M77 D;  2RMO A;  1M5Q 1;  2LRQ A;  2K57 A;  4J5Y A;  2KQW A;  2O88 A;  3MKD A;  3RER A;  1AVZ C;  1H3Z A;  2FZG B;  2RI2 A;  1WA7 A;  2GBQ A;  1D3B A;  3LLR A;  2ZAE A;  5GAN 3;  2C0O A;  3M0R A;  4J9G A;  1WLP B;  1WX6 A;  4K11 A;  2JOY A;  4QQG A;  1Q7Y R;  3FJP A;  1AZG B;  3DLM A;  1TU0 B;  1VYV A;  4GLK A;  2KK4 A;  4M78 G;  2X51 A;  5A0D A;  5GAN 4;  2KVQ G;  5I2M A;  3QWY A;  3FDR A;  5KYW B;  3M58 A;  2DXB A;  3VKI A;  3O5Z A;  1U1T A;  2CRE A;  4JJD A;  3JB9 G;  2OTJ A;  1X6O A;  2DL3 A;  3EG2 A;  2IIM A;  2KXD A;  3HPW A;  3LYI A;  5J39 A;  3CCQ Q;  4II1 A;  2EQJ A;  3CCR Q;  1X01 A;  1LCK A;  1JRI A;  4ATO A;  3INZ A;  3PMT A;  4M7A A;  4PJO D;  1TXQ A;  2X4W A;  2XG8 D;  5LJ5 d;  2KBT A;  4OMN A;  2DIL A;  3NGP A;  1AHJ B;  1K8A C;  3JCM P;  2YRC A;  1H8K A;  4FW2 A;  3LWH A;  3QWX X;  1YCY A;  2QEX A;  3G6E T;  2JTF A;  1Q86 R;  4FSS A;  2OTL T;  5FRN A;  2AIR B;  3PT9 A;  1FYN A;  2EQM A;  4NS5 A;  1GBR A;  1XJW B;  4M7D E;  1KQS P;  3CQT A;  2EGC A;  2QYZ A;  2GF7 A;  5IXB A;  4ZNX A;  2OTJ Q;  2ATC B;  2MF2 A;  3JCM e;  3CXC S;  3ER0 A;  1KK7 A;  2JMA A;  2DBK A;  1I4K 1;  2FRY A;  4ZGD B;  4LUE A;  1VQ9 Q;  1WHH A;  3OBY A;  1K9M C;  2ED1 A;  2VAS A;  3CME Q;  4M7D C;  1J3T A;  2K5L A;  1YP5 A;  1M1G A;  3EHR A;  1KQ1 A;  2JTE A;  2LJ3 A;  1BKB A;  1SHF A;  2NUP A;  2EQU A;  2RJE A;  1FX7 A;  4OMQ A;  4WCI A;  4MZP A;  3G6E A;  2CH4 W;  2FEI A;  4OB3 B;  5KCO A;  2EGE A;  4KT0 E;  4DBH A;  1KG1 A;  1FXX A;  2NUP B;  2GFA A;  3EG1 A;  5GAO r;  4P5N A;  1MGQ A;  5GAO p;  1O75 A;  1Y96 B;  2HAX A;  1YJW A;  3DKM A;  3A8G B;  1BI1 A;  4XK8 E;  4OB0 B;  3SFM A;  2R5A A;  1X6B A;  2RHU A;  3EG3 A;  5IH2 A;  2MWO A;  1YFN A;  1VQO T;  3C12 A;  4DEX A;  1LNX A;  4MML A;  1RI9 A;  3MEA A;  1WI7 A;  1YCS B;  1QVP A;  3JSC A;  4M7A D;  2QXF A;  1I1J A;  2DYI A;  2OJ2 A;  3G71 A;  5CKF A;  3NMZ C;  4J8O A;  2KI7 A;  4Y92 A;  4V2S A;  2L89 A;  2FZC B;  3QKJ A;  2EKH A;  2DIQ A;  2KXC A;  1YHQ Q;  2NWM A;  3RKX A;  1PWT A;  3CC2 T;  4E6R A;  5FRO A;  1VQ5 Q;  2C0I A;  1ZHI A;  1V76 A;  2OAW A;  2XDP A;  3QJY A;  2FRW A;  2DJQ A;  4O5V A;  2PVO B;  2X9H A;  1ZX6 A;  2XMF A;  4EMH A;  2NYS A;  1NZ9 A;  2JM9 A;  4M7A E;  4JRI A;  4BE0 A;  3JCM J;  1JO8 A;  1QCO A;  2FB7 A;  2X3W D;  4IKF A;  3EGX B;  1XNI A;  2RQV A;  1U5S A;  1LOJ A;  2YUO A;  4M4Z A;  3JCM Q;  2D9T A;  1ZA2 B;  1W2B S;  3TRE A;  2QQR A;  4IUV A;  3SWN A;  3M5A A;  3CCJ T;  2RQT A;  1I5O B;  2KMT A;  3THK A;  4F14 A;  2F2W A;  3OS5 A;  4C8Q C;  1YHQ A;  4BB7 A;  3BY7 A;  4EIK A;  2JTM A;  1PHT A;  1BCO A;  3CEY A;  3TSZ A;  4M77 G;  5CQY A;  1K4U S;  4QW2 A;  1SSF A;  4MZT A;  2RF0 A;  4C0G A;  4JJB A;  1TWB A;  5KE2 A;  1AWW A;  1RL2 A;  2DMO A;  3H6Z A;  1N8R R;  1SKU B;  2DE0 X;  4NL3 A;  1N8R C;  2BTT A;  1C6V X;  1MMA A;  1VQ8 Q;  5DLO A;  2X35 A;  4BI8 B;  2P0Q A;  1M9S A;  1R0B G;  4FT2 A;  1SF9 A;  2F2V A;  2KDS A;  1MHN A;  3OS1 A;  1X2K A;  4CC2 A;  2EVR A;  5GAN d;  2BIV A;  1H92 A;  2VC8 A;  5LJ5 f;  5FU6 B;  4E7J A;  3HFO A;  1W6X A;  3X26 B;  5KYN A;  2JMC A;  3OYA A;  2K5I A;  1HJD A;  4BE1 A;  1QKW A;  1GFD A;  1W1F A;  2M0Y A;  4C92 B;  1EFN A;  2Z0W A;  2QQ9 A;  3RBB B;  4D8K A;  3OYE A;  2KE9 A;  2YLC A;  2FPE A;  2JM8 A;  1KC8 R;  1VQK Q;  5CIU A;  3DB3 A;  3SWN B;  1M4Z A;  2COY A;  4HVU A;  1O9S A;  4PJO G;  4J7F A;  2BKD N;  1VQ8 A;  2D6F A;  1UFF A;  1WHG A;  3JCM b;  5GAO n;  4PJO F;  2PZ1 A;  4BD3 A;  1G5V A;  3OYF A;  2O01 E;  1E6G A;  5C6S A;  2YXY A;  3V8J A;  2LP5 A;  3GNF B;  2HQX A;  4HCK A;  2FZK B;  3OS0 A;  4HXJ A;  1RAH B;  1PRM C;  2LQ8 A;  3M0Q A;  2J6K A;  4AFZ C;  1ZUK A;  4DOW A;  3S3N A;  1DJ7 B;  1N9S A;  1Q86 C;  3L2V A;  5KYX B;  5GAM e;  1TG0 A;  2YT6 A;  2OI3 A;  3O8V A;  2E12 A;  2YUP A;  1QVF P;  2MK5 A;  2RJD A;  3TQ7 P;  2HD0 A;  3EGD B;  4IUR A;  2KAF A;  2VGM A;  1VQ7 A;  5KYX A;  2EJF A;  2PUK B;  1WXT A;  2E70 A;  1VUB A;  1K9M U;  3CBM A;  4M75 B;  4J9B A;  2A37 A;  2LVM A;  4C5G A;  5GAM g;  2EKO A;  1YIT T;  4XTZ A;  3A8L B;  4L5G A;  3REB B;  1Y7X A;  3V7R A;  4R55 A;  4M77 F;  1UG1 A;  3EFO A;  4LUD A;  2XHC A;  3VYG A;  1KC8 U;  3SWN C;  1GL5 A;  1M8V A;  3J80 E;  1VQK T;  1VIE A;  2RM4 A;  2H3J A;  1WFW A;  3M57 A;  1AWJ A;  5LJ3 d;  2HDA A;  5LJ3 g;  2CZ1 B;  1BU1 A;  1VQ6 A;  4HA8 A;  1UB4 A;  4KH0 B;  3NPF A;  3A98 A;  1OU8 A;  4KUI A;  2B86 A;  5I21 A;  3EH2 A;  1K8A U;  2FG0 A;  3RNJ A;  2K4Y A;  4QT7 A;  3I5S A;  5GAN 8;  2M16 A;  1UGV A;  1V1C A;  2EQK A;  2LT1 A;  2CT3 A;  1SEM A;  4O6J A;  3I35 A;  3A8M B;  1D3B B;  1GCQ C;  2ZPF B;  2ED0 A;  1SRL A;  2P4R A;  1GRI A;  3V8L A;  1WXU A;  2EJG A;  1HYO A;  4AFS C;  3TSW A;  1T0J A;  1MND A;  3M0T A;  2CKK A;  3QDF A;  4LDY A;  2A3L A;  1VYT A;  2MMP A;  2WSC E;  1VIF A;  4RG2 A;  3UA6 A;  2CZ0 B;  2M1H A;  4EMG A;  3FC3 A;  2DM1 A;  1MV3 A;  2RQW A;  4N4H A;  2X4Y A;  4DEY A;  3G4S Q;  4M78 C;  3PGG A;  3OA6 A;  3UDC A;  1QW1 A;  3M9Q A;  2CP3 A;  5KE3 A;  3I5R A;  5L23 A;  3VS6 A;  4BI3 A;  3HSB A;  2EW3 A;  2MAM A;  5CVI A;  2E3H A;  2ZPI B;  3ZFJ A;  2LNH B;  4AFU C;  3OYN A;  2DKG A;  2GTJ A;  3A1P A;  3NFC A;  5A0G A;  2LT4 A;  1XOV A;  2LNV A;  3ZBD A;  5GAM f;  5D6X A;  2QGG A;  3RES A;  2LX7 A;  2B8A A;  2QTV A;  1WHK A;  2EYQ A;  1RAI B;  3OSS C;  1YJN A;  3CBO A;  2MPX C;  5AYF A;  3T9N A;  1BI0 A;  3VS1 A;  4C8Q E;  3CMA Q;  4FYY B;  1Q7Y C;  3VJP A;  4B9X A;  3G7Z A;  4A54 A;  3X28 B;  4ZGJ B;  2J05 A;  1Y57 A;  4BDY A;  3L1A A;  4Q5W A;  5GAN h;  1JJ2 A;  2CP2 A;  3QYG B;  3UA7 A;  1ZLM A;  2R57 A;  5CQX A;  3SHW A;  1UJY A;  3G71 Q;  3FIF A;  1W2B A;  1QP2 A;  2H3E B;  4RTY A;  4BI4 A;  5A0L A;  4CC7 A;  3CCS A;  4N4G A;  2QA4 Q;  3CCS T;  4J9F A;  2JZ2 A;  3VYH B;  5GAN 2;  1IHW A;  1M3C A;  2E64 A;  2HQH A;  2CGH A;  2HBP A;  3S6W A;  4MMK A;  4X9C A;  3MJX A;  1JU5 C;  4HCC A;  4M7D G;  4ZN3 A;  1VA7 A;  4JZ3 A;  4PK4 A;  1X75 C;  3LW5 E;  2V1R A;  1HXD A;  3QZ9 B;  2ZCF B;  1VQO Q;  1QP3 A;  3EG9 A;  3I56 A;  4ZTF A;  2IPO B;  3CCV T;  4N0A A;  1C0M A;  1AOJ A;  1D1C A;  4RTV A;  1KHI A;  2RB6 A;  1M1K C;  3V7S A;  4E7S A;  4X34 A;  1VQ6 Q;  1M3A A;  3GLX A;  2HNI A;  2M0O A;  4JLI A;  3GIB A;  2HSE B;  4DBQ A;  2W0Z A;  5DY9 A;  4RTU A;  1QMC A;  2YRV A;  4GLM A;  1VQ9 A;  2RA2 A;  4CRI A;  1M1F A;  5EC7 A;  3F70 A;  4QQD A;  3RMQ A;  1CKA A;  1RLQ C;  4PJL A;  3JRZ A;  3VU3 C;  3R6O A;  2DVJ A;  2E4H A;  3L42 A;  3CPW S;  3TEE A;  2LQN A;  2ZPB B;  1X43 A;  2KEA A;  3OYI A;  4J9E A;  2QK0 A;  4M77 E;  2DAQ A;  5I22 A;  3PTA A;  5L8R E;  1KQ2 A;  4M7D B;  1PNJ A;  1KFZ A;  1JJ2 S;  2QA4 T;  3Q1J A;  3MPU B;  4F04 B;  3QO3 A;  4TVR A;  5CKE A;  1OUL A;  5GMK m;  3CCQ A;  2AKL A;  4EMK A;  1SRM A;  1VQL Q;  1T0H A;  3WVE B;  4LDV A;  3H8Z A;  7AT1 B;  5I11 A;  5GAN g;  2D8J A;  2BE9 B;  3CCL T;  4X9D A;  3JCM X;  3FB9 A;  3OW2 P;  2W10 A;  4C8Q A;  4M7D F;  2VB6 A;  1G3Y A;  2HQE A;  2J7I A;  1F1B B;  1YBY A;  2RK1 A;  3CD6 A;  2DNU A;  5LJ5 h;  2RQU A;  2RI5 A;  5CR2 A;  1VQ4 A;  1K9A A;  1M90 C;  1PKS A;  4DA4 A;  1OX8 A;  4M7A G;  2QGF B;  5IXF A;  3CPW A;  2KRM A;  4F7U B;  3JAM E;  2RN8 A;  4LNP A;  2JXB A;  1OYX A;  1NLP C;  3E19 A;  1VQM A;  4PLI A;  3PFS A;  3FEO A;  1VQ5 A;  1KHC A;  2V1Q A;  1ABO A;  2DTO A;  1M8M A;  2J6F A;  2ZPG B;  1WIE A;  1D1B A;  4ZN1 A;  4EMK B;  2DEU A;  4RTW A;  2A08 A;  1M30 A;  3V7C A;  2D0Q B;  2MIO A;  5IHI A;  3CC7 A;  4RTZ A;  1QVF S;  2RNA A;  1SHG A;  1NLO C;  1TH7 A;  3G71 T;  2COZ A;  3CCQ T;  1Y71 A;  3CC7 T;  3OYK A;  4C0D C;  4KUD K;  5CO7 A;  4LD9 K;  2BUD A;  1W70 A;  4OMM A;  3OYB A;  2YLB A;  2DTH A;  3CCJ A;  5LJ3 j;  1RAF B;  2DFU A;  1M2O A;  3CCS Q;  2QA4 A;  1K0S A;  2LX9 A;  2RHI A;  1B34 A;  2PVG B;  5GJV B;  2F69 A;  2HKQ B;  3LGL A;  4M78 F;  1QVG A;  1QWE A;  3P8B B;  4Z88 A;  5GAM h;  2P0P A;  1WDX A;  1ARK A;  1G83 A;  3CD6 Q;  1MNE A;  4PFO A;  4JLG A;  2YHT A;  1X6G A;  3EFS A;  2D1X A;  3VUZ A;  1N8R U;  1YWP A;  3CC4 Q;  1AWX A;  4ORZ A;  2Y4Y A;  2EBP A;  2MCN A;  1IO6 A;  4FT4 A;  3NHN A;  2K6D A;  4JS5 A;  2RHY A;  3ULR B;  2DEQ A;  1U3O A;  1VQM Q;  2DJZ A;  4M7D A;  3JCM h;  4IUU A;  1YHQ T;  1YJ9 A;  1AEY A;  1PCX A;  4L6V 5;  1YJN T;  4A4G A;  3EFR A;  1RI0 A;  1X2Q A;  3X24 B;  2BZY A;  6AT1 B;  1BI3 A;  3P8D A;  1M3B A;  4OVA A;  3CMA T;  2DYB A;  1K73 C;  1IXD A;  5HKC A;  1AZE A;  1YI2 Q;  4J6X A;  2O9S A;  1ACM B;  3VS3 A;  4AG1 C;  1JEG A;  1PG5 B;  1PD1 A;  5GAN 7;  3G4S T;  2QEX Q;  2OTL A;  1Q81 U;  4JRK A;  4PJJ A;  1WJQ A;  3PMI A;  5HCK A;  3JB9 I;  1UDL A;  4AFQ C;  4LD6 A;  3CBP A;  4BDZ A;  3GPL A;  1TUD A;  1CKB A;  4DQ2 A;  2LZ6 B;  2RJF A;  5A2Q E;  2AK5 A;  3EHQ A;  2VXE A;  3VS0 A;  1VQL A;  4J9C A;  1E6H A;  4OB2 B;  2DRM A;  4M75 E;  1FWZ A;  3I55 T;  5LL6 S;  2HKN A;  2QQS A;  1UHF A;  1VQ7 Q;  4ELY C;  3UF4 A;  1U1S A;  3EG0 A;  1QKX A;  4Z89 A;  4NL2 A;  3GBQ A;  4E7K A;  1PSF A;  1KQS S;  1OU9 A;  1NJI R;  5HY6 A;  3M0U A;  3HP9 A;  4CC3 A;  1Q81 C;  3MCA B;  1IB8 A;  1YJ9 Q;  5GAO q;  1MV0 B;  1NEB A;  3URG A;  1LJO A;  3RKW A;  2ECZ A;  5GJW B;  5LJ3 f;  2AZV A;  5KCH A;  3PVQ A;  3PE0 A;  3HL8 A;  1RAA B;  4R56 A;  4X1V A;  4C92 C;  2JJ9 A;  3JB9 J;  2HL3 A;  3OYJ A;  3CC7 Q;  5FW9 A;  2JT4 A;  3CCE Q;  5D6W A;  2K5F A;  5KYU B;  4LXC A;  2COW A;  1YJ9 T;  4ANJ A;  3J81 E;  1MMN A;  5KH6 A;  1R77 A;  1SSH A;  1JB0 E;  2K3Y A;  1NM7 A;  3AHU A;  3M0P A;  4Y91 A;  3CCR T;  1YIT A;  3CXC A;  1VQO A;  4F16 A;  3I56 Q;  2JS0 A;  3OYD A;  1PD0 A;  2LMJ A;  5CK9 A;  4C0F A;  4IUT A;  3VRZ A;  3OBW A;  2ZGW A;  2L3Q A;  2CH4 A;  2FYK A;  2K9G A;  3GNG A;  3OYY A;  1GXI E;  5KYW A;  1NPR A;  2ENM A;  2RHZ A;  3E2U A;  3L2U A;  3I55 Q;  3H0I A;  9ATC B;  5J3B A;  1ZBJ A;  4EPC A;  1KSW A;  2RHX A;  3AT1 B;  2CSI A;  2L5Q A;  2ZZD A;  4B9W A;  5GAN e;  1QCF A;  2J6O A;  2O4X B;  2MOX A;  4M78 A;  4HCZ A;  2XK0 A;  4OGE A;  1W4S A;  4DBF A;  2KY9 A;  4M75 C;  3G4S A;  1YN8 A;  1OQK A;  1BK2 A;  1WQ7 A;  2DL7 A;  2HSP A;  4J9H A;  2LJ1 A;  3PIP A;  1OV3 A;  3BDU A;  2FPF A;  2OX7 A;  5J26 A;  3KXT A;  1S72 A;  3OMG A;  2PUO B;  3HRT A;  2ROT A;  2LCL A;  3OYL A;  1WGS A;  3CCV Q;  4E7I A;  3QBY A;  4C8Q B;  1YI2 T;  2H8H A;  3MP1 A;  2K79 A;  1IGU A;  3VRY A;  3EFO B;  1GBQ A;  3OSV A;  1Q82 U;  4AT1 B;  2DXT A;  1RAG B;  4B6M A;  1OPK A;  2I2L A;  2NUZ A;  2EPD A;  1YIJ Q;  1YI2 A;  2HEQ A;  2A0F B;  4JDS A;  3PNW C;  2E5K A;  1RAC B;  3QG1 A;  2QI2 A;  4OMP A;  3EGU A;  4IUQ A;  2GGR A;  2VVK A;  4AG2 C;  1TSF A;  4FW1 A;  4DOV A;  1M90 U;  3CPF A;  2QQA A;  1R8O B;  4JPB W;  1VQ4 Q;  2DL8 A;  3IQL A;  2DET A;  2KSS A;  3C95 A;  2OAU A;  3ASK A;  1QCN A;  4FU6 A;  3FRN A;  1QWF A;  3M4Y A;  4HCB A;  1UUE A;  2JS2 A;  2DA9 A;  3QSU A;  2LQW A;  5FWB A;  1T3L A;  1VQ4 T;  3CCL A;  2GQV A;  2QG9 B;  2DK3 A;  2KYB A;  3JV3 A;  4PL6 A;  1BIA A;  1B7T A;  3PIO A;  2K2V A;  2YUN A;  1V29 B;  1VQP Q;  2E65 A;  4M7D D;  4ELZ C;  3WVD B;  3ZEH A;  2K3X A;  4PFP A;  3X25 B;  1R0C B;  1S72 T;  3CCV A;  2P0K A;  4Z02 A;  3JCM d;  4BY6 B;  1YWO A;  1BIB A;  3LH0 A;  1BI2 A;  1Q82 R;  2R58 A;  4A4H A;  5HK0 A;  2PNI A;  3E9G A;  4C92 D;  1VQ5 T;  4BE2 A;  4FIB A;  2X4X A;  1YIJ A;  4M7A F;  4KUL A;  3RMS A;  4UC4 A;  1X69 A;  4QVZ A;  2QDY B;  4A53 A;  5IN1 A;  2XIC A;  3JB9 D;  4C0Z A;  4MZM A;  1I81 A;  2E5Q A;  5GMK e;  3HRU A;  2QQB A;  4KH1 B;  8ATC B;  4AMC A;  1JQQ A;  4ESR A;  2DER A;  4PJO E;  2XD0 A;  1G3S A;  3X20 B;  1IHV A;  3E1S A;  4JRQ A;  3G1J A;  1Q82 C;  4GY5 A;  1OI1 A;  4KGZ B;  2YWW A;  3EAE A;  1VQN A;  2X3X D;  4N4I A;  4QKU A;  5AT1 B;  4M7A C;  1I8F A;  4J6W A;  3RDV A;  1ZSZ A;  3OYG A;  1CSK A;  3CCL Q;  2IG0 A;  3TVT A;  4BUG A;  2GTO A;  1WHJ A;  1HSQ A;  2VWF A;  2PQW A;  2L3P A;  5GAM d;  1ZSZ B;  4QQ6 A;  3HRS A;  5KYY A;  2CP7 A;  3H0H A;  4LN2 A;  5GMK h;  1VQP T;  3M0S A;  2HMA A;  3N5B B;  4M75 D;  3L2Q A;  3CCU T;  3VV0 A;  1NJI C;  3MET A;  1Y07 A;  1IRE B;  2DZC A;  5D6Y A;  2DBM A;  2HCK A;  1OEB A;  2GQI A;  2OTL Q;  3CC2 A;  3UT1 A;  3RR6 A;  2XKO C;  2WSE E;  3I9Q A;  3G6E Q;  3RUX A;  3CME T;  4OMO A;  2NUT B;  2PU9 B;  4J9I A;  2E1H A;  1FMK A;  3VS7 A;  3QPH A;  2EYW A;  4A63 B;  1WXB A;  5DLQ E;  4C8Q D;  2E10 A;  2JW4 A;  3MEV A;  2CT4 A;  4PJN A;  2P84 A;  1T3S A;  3OQ5 A;  1KD1 R;  4BAC A;  2JNG A;  1OZ2 A;  3CCR A;  3EGX A;  4C8Q F;  4RMO A;  5LJ3 e;  3CCM Q;  2KRS A;  1NPP A;  3NTH A;  1TOV A;  5M9O A;  5CCA A;  3GP8 A;  1Y0M A;  1YJW T;  3L2W A;  3KUF A;  1UTI A;  4ME7 A;  1Q95 G;  4FYV B;  1I0C A;  3QUI A;  2KT1 A;  2FVU A;  4OGC A;  4JZ4 A;  2ESW A;  2QDL A;  4RUG A;  1D1A A;  1K73 R;  2E6N A;  2JN0 A;  4J9D A;  3OW2 A;  2RI3 A;  1NYG A;  3CC4 T;  4F7U E;  4PKC C;  3TU4 K;  4FSX A;  3CXC P;  3NTK A;  3BDL A;  1OZ3 A;  5LJ5 j;  3CMA A;  1KQS A;  3M53 A;  1VQP A;  2L3S A;  2IVW A;  3L2Z A;  4IUP A;  2DXU A;  3CPW P;  3LGF A;  1B3Q A;  3CC2 Q;  3DB4 A;  5GMK i;  4PJO A;  1QVF A;  2KGT A;  4HKE A;  3D7S B;  1TUC A;  2AZS A;  2CDT A;  2GNC A;  4F7U G;  2CS7 A;  1ZUY A;  2KT8 A;  4Y28 E;  1KD1 C;  2EYX A;  1WNL A;  3MO8 A;  4E7L A;  4QVD A;  2QTX A;  1MMG A;  3VS5 A;  3OYC A;  3JB9 F;  4FM4 B;  2KR3 A;  4QVC A;  2NUT A;  1NYF A;  5IHK A;  2E3I A;  2Y4X A;  4EMK C;  5IAY A;  3M59 A;  3CCM A;  1VQ6 T;  3CME A;  1G3T A;  3OW2 S;  3EGD A;  3P8H A;  3MEW A;  2MI6 A;  3WXM B;  2BZX A;  4ZGE B;  5D7U A;  1D0Y A;  2VGN A;  1K73 U;  1M27 C;  1I07 A;  3CCU A;  3JB9 H;  1MUZ A;  5GAM j;  4C0D B;  1YIJ T;  3E9F A;  4M78 E;  3OMC A;  3JCM W;  4FYW B;  1NE8 A;  1N27 A;  1Q81 R;  2A28 A;  2RD1 A;  3CCJ Q;  1UGQ B;  4M77 A;  3KFV A;  3M56 A;  1PSE A;  4FL6 A;  4XU1 A;  2DX1 A;  1KIK A;  1B07 A;  2E41 A;  2EWN A;  2LCC A;  4C92 G;  2FPD A;  4A4F A;  4JJN K;  1NEG A;  2M02 A;  2K3B A;  2AT1 B;  2AHJ B;  1VQN T;  4C5I A;  3QXE B;  4XU0 A;  1M2V B;  2DF6 A;  1OX9 A;  4MDW A;  3DLL A;  4RTX A;  4PJM A;  5ECA A;  3H41 A;  3CCU Q;  4J7I A;  1AT1 B;  1WHL A;  1UGP B;  1QVG P;  2Y90 A;  1QVG S;  1EIF A;  1K76 A;  2ZPH B;  4XTU A;  2XDB A;  1FMV A;  3QJ6 A;  2XU8 A;  2DL4 A;  3CCM T;  5FRM A;  2V8K A;  1A0N B;  3LH5 A;  2EQI A;  4XU2 A;  4XTX A;  2HZY A;  4PNO A;  2L2P A;  2EYY A;  1QQJ A;  3OYM A;  1WJS A;  3MP6 A;  1HK9 A;  1ZA1 B;  1YNZ A;  2DTI A;  2EAY A;  3HFN A;  4XTW A;  4E7Z A;  2EGA A;  4OML A;  2BE7 D;  3SDZ A;  4M75 G;  2RQR A;  4PFZ A;  3I56 T;  3ME9 A;  2SRC A;  5KYU A;  4FYX B;  4RKU E;  4N0A C;  2ZPE B;  1JJ2 P;  1WPY A;  2PVD B;  1QLY A;  2VXF A;  4RTT A;  5DM7 R;  1XQH A;  4RG8 A;  1RLP C;  1YJW Q;  1JBM A;  3JCM V;  4C5H A;  2L0A A;  2VUB A;  2M9U A;  3FJ5 A;  3S3M A;  2C0T A;  1KD1 U;  1M1K R;  1WJR A;  1Z9Z A;  4VUB A;  1LPL A;  5C0M A;  3BW1 A;  4IIO A;  1UJ0 A;  4L59 A;  1N5Z A;  3CD6 T;  1Q7Y U;  2DVE A;  2G6F X;  5LJ3 h;  4XAX B;  3SEM A;  1Y96 A;  2VKN A;  3UPU A;  4J83 A;  1BYM A;  4C92 E;  4OMF B;  3CCE T;  1K0X A;  3UWN A;  2CP0 A;  2NLU A;  4IIM A;  1PC0 A;  5FU6 C;  2YRD A;  2BZ8 A;  3FLG A;  3BE3 A;  3RKY A;  2FO0 A;  2CZ7 B;  2RO0 A;  4WF2 A;  2DZ9 A;  5LJ5 e;  1PM3 A;  2FL7 A;  4KGX B;  2WSF E;  3MHX A;  2DD5 A;  3QZ5 B;  4OF1 A;  4NOY A;  1EZZ B;  2GFU A;  2YSQ A;  2CYZ B;  4OP0 A;  3JCM g;  2R5M A;  2O31 A;  5IT9 E;  1C1A A;  3M54 A;  3CC4 A;  2O4X A;  4XQ3 A;  1VQ9 T;  1WZO A;  2D8H A;  3EG9 B;  2QAZ A;  2VV5 A;  2CSQ A;  1BB9 A;  1K9M R;  1H64 1;  2PTK A;  1M90 R;  3OS2 A;  1RAB B;  2I0N A;  1UE9 A;  1OPL A;  1H3H A;  2LJ0 A;  2DL5 A;  3KBG A;  3I55 A;  5KYY B;  2F5K A;  1BCM A;  2MWP A;  5CKB A;  3OY9 A;  1I5L A;  1UEC A;  2LDM A;  1B34 B;  3PVL A;  3M4G A;  5GAN j;  3CCE A;  1YJN Q;  2JUF A;  3A8H B;  3QDR B;  2KYM A;  5GAO m;  3C94 A;  4CI0 C;  4M75 A;  1WQW A;  2V26 A;  3OB9 A;  4E2F B;  4F17 A;  2F5T X;  3VS2 A;  1TS9 A;  1S1N A;  2DLP A;  3H9N A;  3QHS A;  5LJ5 g;  1GCP A;  2V8J A;  2A7Y A;  2P4T A;  4R0K A;  1VQL T;  3JCM f;  1ZSG A;  4WTO B;  2A36 A;  4CC4 B;  1VOM A;  1D0Z A;  4FCY A;  1S72 Q;  4MDX A;  4C8Q G;  3V8K A;  2JVV A;  1KJW A;  8AT1 B;  1AD5 A;  2SEM A;  2EYZ A;  3BFM A;  4M77 C;  2RPN A;  4JS4 A;  2WAC A;  1VQK A;  3MP8 A;  5FU7 C;  2KRO A;  1KC8 C;  2YUQ A;  2O2O A;  4F7U A;  2LC4 A;  4BY6 C;  5FWC A;  1LVK A;  4JUV A;  3REA B;  4D6W A;  1TUG B;  2EFI A;  4XTV A;  1GFC A;  4F7U F;  1IRX A;  1UHC A;  2RH2 A;  2O9V A;  2XI9 A;  1TTH B;  4C92 A;  4E47 A;  4KRT A;  1P92 A;  1WHM A;  1FMW A;  1MMD A;  3S3O A;  1IGQ A;  1VQ7 T;  2M51 A;  4XTY A;  3R6N A;  3VUB A;  1WYX A;  1U06 A;  2DIG A;  3LWI A;  1JXO A;  4M78 D;  4LDX A;  3TCJ A;  5GAO l;  3VS4 A;  5I2S A;  3GF5 A;  2GCX A;  2K7A A;  2RK2 A;  4A4K A;  1ZBX A;  4PLL A;  5GAN 5;  4KBM B;  3J7A F;  4PJO C;  1NBE B;  4HVV A;  2LCS A;  2G3R A;  3ZL7 C;  1G3W A;  4RCC A;  1RUW A;  3A5Z B;  3M55 A;  4JRP A;  3QYH B;  2ROL A;  4D8D A;  2CP6 A;  1YIT Q;  1SPK A;  4M77 B;  2DXC A;  2FHD A;  1ABQ A;  3UAT A;  1JXM A;  2L8D A;  3JCM c;  2LTO A;  4Z8A A;  4LE9 A;  1ZSZ C;  1N9R A;  4E7H A;  3HKS A;  2X4J A;  2OTJ T;  5FU7 B;  1K1Z A;  1VYU A;  2HL5 C;  4M75 F;  1HD3 A;  2D0N A;  4HVW A;  2ABL A;  3HTR A;  1D0X A;  5GMK l;  1W2B P;  2CZ6 B;  1RAD B;  4GBQ A;  4J6Y A;  4HT8 A;  2XDD A;  3C0C A;  3NTI A;  5IHN A;  1X27 A;  1SG5 A;  5GAN f;  1PRL C;  2HBW A;  2VYT A;  4HT9 A;  2E6Z A;  2F2X A;  3LX7 A;  5EG2 A;  2V8I A;  4RCB A;  1VQM T;  2QEX T;  4ZTJ A;  5FLX E;  4LDU A;  5CAI A;  1BBZ A;  2EIF A;  3U23 A;  1NJI U;  1Z9Q A;  5GAN 6;  3HHT B;  5HK3 A;  4YTL A;  2L3R A;  1EX4 A;  2QAS A;  4M7A B;  1VQN Q;  4KGV B;  1K8A R;  4JJC A;  4PJO B;  2MYS A;  3SB2 A;  2DRK A;  4M78 B;  4DBR A;  1GCQ A;  2LQK A;  4A4E A;  1D09 B;  1E7O A;  2J06 A;  3OYH A;  1NG2 A;  1VQ8 T;  4OB1 B;  1PKT A;  1M1K U;  2EJ9 A;  2KNB B;  4C92 F;  3MEU A;  1OOT A;  1ZUU A;  3RIR A;  2CP5 A;  1U8R A;  3L2R A;  2DD4 A;  5GMK j;  2CUD A;  2KRN A;  1IZ6 A;  2RJC A;  1UGR B;  1UEB A;  2XID A;  3SD4 A;  4LDW A;  2YDL A;  2C06 A;  1N6A A;  5CKH A;  2AKK A;  1RAE B;  1AWO A;  1G8X A;  3GOX A;  2K2M A;  1G2B A;  3EH1 A; 
#chains in the Genus database with same CATH homology
 1GCQ C;  2A28 A;  1MV0 B;  1NEB A;  2ED0 A;  1SRL A;  2P4R A;  1GRI A;  2ECZ A;  5GJW B;  2CUB A;  3KFV A;  1WXU A;  2AZV A;  3H0F A;  3PVQ A;  3PE0 A;  4AFS C;  2DX1 A;  1T0J A;  2RMO A;  3TSW A;  1KIK A;  1B07 A;  4X1V A;  3M0T A;  2O88 A;  2FPD A;  1NEG A;  1AVZ C;  1VYT A;  5FW9 A;  2K3B A;  2JT4 A;  1WA7 A;  2GBQ A;  3UA6 A;  2C0O A;  3M0R A;  4J9G A;  1WLP B;  1WX6 A;  2DF6 A;  4K11 A;  1AZG B;  2DM1 A;  4RTX A;  5ECA A;  1MV3 A;  2RQW A;  1VYV A;  3H41 A;  4DEY A;  1SSH A;  1NM7 A;  3M0P A;  3I5R A;  5L23 A;  3VS6 A;  3QWY A;  4F16 A;  2EW3 A;  2JS0 A;  1K76 A;  2LMJ A;  3O5Z A;  2LNH B;  4AFU C;  3VRZ A;  2CRE A;  4JJD A;  2GTJ A;  2DL4 A;  2L3Q A;  2CH4 A;  2K9G A;  1XOV A;  2DL3 A;  2ENM A;  3EG2 A;  2IIM A;  2KXD A;  3H0I A;  1A0N B;  3LH5 A;  1ZBJ A;  2EQI A;  1KSW A;  2LX7 A;  2CSI A;  2L2P A;  2EYY A;  1LCK A;  1QCF A;  2J6O A;  3VS1 A;  2MOX A;  1YNZ A;  2EGA A;  2KBT A;  4OMN A;  2DIL A;  3NGP A;  4OML A;  1H8K A;  2RQR A;  2J05 A;  3QWX X;  1Y57 A;  1YN8 A;  2SRC A;  1BK2 A;  2DL7 A;  4FSS A;  2HSP A;  4J9H A;  2LJ1 A;  1OV3 A;  2FPF A;  1FYN A;  1GBR A;  1QLY A;  3UA7 A;  1ZLM A;  3CQT A;  2EGC A;  2ROT A;  4RTT A;  3SHW A;  1UJY A;  5IXB A;  4ZNX A;  2H8H A;  4RTY A;  1RLP C;  2K79 A;  4CC7 A;  3VRY A;  1GBQ A;  2L0A A;  4J9F A;  2JMA A;  2DBK A;  1OPK A;  3FJ5 A;  2NUZ A;  2C0T A;  1M3C A;  2EPD A;  2FRY A;  4LUE A;  1Z9Z A;  2HEQ A;  2ED1 A;  1JU5 C;  2E5K A;  1VA7 A;  1J3T A;  4JZ3 A;  1YP5 A;  4IIO A;  4OMP A;  3EGU A;  1UJ0 A;  3EHR A;  1N5Z A;  2V1R A;  2GGR A;  2VVK A;  2JTE A;  2LJ3 A;  4AG2 C;  1SHF A;  2G6F X;  4OMQ A;  4WCI A;  4JPB W;  2VKN A;  3SEM A;  2DL8 A;  2CH4 W;  2FEI A;  2EGE A;  3IQL A;  1K0X A;  4IIM A;  3EG1 A;  1QWF A;  1AOJ A;  2BZ8 A;  4RTV A;  2FO0 A;  1UUE A;  2JS2 A;  2DA9 A;  2LQW A;  1M3A A;  1T3L A;  5FWB A;  1X6B A;  3EG3 A;  2W0Z A;  3JV3 A;  2KYB A;  4RTU A;  4GLM A;  5IH2 A;  5EC7 A;  2YSQ A;  1CKA A;  1RLQ C;  2YUN A;  2DVJ A;  2O31 A;  4DEX A;  1RI9 A;  1WI7 A;  2LQN A;  2D8H A;  1YCS B;  1X43 A;  1I1J A;  2OJ2 A;  2CSQ A;  3NMZ C;  1BB9 A;  2KEA A;  4J9E A;  4Y92 A;  2PTK A;  1YWO A;  5I22 A;  2EKH A;  2I0N A;  1PNJ A;  2KXC A;  1KFZ A;  1UE9 A;  2NWM A;  2PNI A;  1PWT A;  1OPL A;  4E6R A;  1H3H A;  2LJ0 A;  2DL5 A;  2C0I A;  2AKL A;  1SRM A;  1UEC A;  1T0H A;  5I11 A;  3PVL A;  2OAW A;  1X69 A;  2FRW A;  2D8J A;  2DJQ A;  2KYM A;  1ZX6 A;  2W10 A;  2XMF A;  2JM9 A;  2J7I A;  1JO8 A;  4F17 A;  3VS2 A;  2DNU A;  2X3W D;  1JQQ A;  4ESR A;  2RQU A;  1S1N A;  2DLP A;  2RQV A;  1GCP A;  1U5S A;  4R0K A;  2YUO A;  4M4Z A;  1K9A A;  1ZSG A;  2A36 A;  2RQT A;  4CC4 B;  2X3X D;  1PKS A;  3THK A;  4F14 A;  2F2W A;  5IXF A;  2KRM A;  2RN8 A;  4LNP A;  2JXB A;  1KJW A;  1AD5 A;  1NLP C;  2SEM A;  2EYZ A;  4EIK A;  1CSK A;  3TVT A;  1PHT A;  2GTO A;  3TSZ A;  2V1Q A;  1HSQ A;  1ABO A;  2VWF A;  1K4U S;  2RPN A;  1M8M A;  2J6F A;  2L3P A;  1WIE A;  2RF0 A;  4JJB A;  4RTW A;  2A08 A;  1M30 A;  2KRO A;  2MIO A;  1AWW A;  5IHI A;  2YUQ A;  2O2O A;  2DMO A;  4RTZ A;  3H0H A;  4LN2 A;  2DE0 X;  2BTT A;  3M0S A;  2RNA A;  1SHG A;  1NLO C;  5FWC A;  3REA B;  2F2V A;  1GFC A;  1UHC A;  2DBM A;  2HCK A;  1X2K A;  1OEB A;  2GQI A;  2O9V A;  2EVR A;  4CC2 A;  1H92 A;  3I9Q A;  4OMO A;  1W70 A;  4KRT A;  4OMM A;  4J9I A;  1FMK A;  1W6X A;  3VS7 A;  2EYW A;  2M51 A;  2JMC A;  4A63 B;  1K0S A;  1WXB A;  3R6N A;  1HJD A;  5GJV B;  2JW4 A;  1QKW A;  1GFD A;  1W1F A;  1WYX A;  2CT4 A;  1U06 A;  2M0Y A;  1EFN A;  4D8K A;  1T3S A;  3RBB B;  1JXO A;  2KE9 A;  1QWE A;  2FPE A;  4Z88 A;  3VS4 A;  2JM8 A;  1WDX A;  1ARK A;  2K7A A;  1G83 A;  2KRS A;  4HVU A;  4HVV A;  2LCS A;  1X6G A;  1UFF A;  3ZL7 C;  1RUW A;  1Y0M A;  2PZ1 A;  1E6G A;  2D1X A;  2ROL A;  1YWP A;  1UTI A;  4D8D A;  1AWX A;  4ORZ A;  1SPK A;  2LP5 A;  2EBP A;  1ABQ A;  1JXM A;  2MCN A;  3UAT A;  1IO6 A;  1I0C A;  3NHN A;  4HCK A;  2K6D A;  4LE9 A;  4HXJ A;  4Z8A A;  1PRM C;  3ULR B;  2KT1 A;  1U3O A;  4JZ4 A;  2ESW A;  3M0Q A;  2J6K A;  4AFZ C;  1K1Z A;  2QDL A;  1ZUK A;  1VYU A;  4RUG A;  1HD3 A;  2D0N A;  4HVW A;  2ABL A;  4J9D A;  1NYG A;  1AEY A;  1TG0 A;  4GBQ A;  2YT6 A;  2OI3 A;  2YUP A;  3C0C A;  1X2Q A;  1X27 A;  5IHN A;  2BZY A;  1M3B A;  1PRL C;  2DYB A;  2HBW A;  1AZE A;  2F2X A;  2L3S A;  2O9S A;  3VS3 A;  4AG1 C;  1JEG A;  1WXT A;  1B3Q A;  4J9B A;  2A37 A;  2KGT A;  1BBZ A;  3U23 A;  1Z9Q A;  5HCK A;  3REB B;  1UDL A;  4AFQ C;  1TUC A;  2AZS A;  2CDT A;  2GNC A;  1UG1 A;  4LUD A;  1ZUY A;  2KT8 A;  1TUD A;  2EYX A;  1CKB A;  4JJC A;  1GL5 A;  2LZ6 B;  3VS5 A;  2AK5 A;  2DRK A;  2KR3 A;  3EHQ A;  1GCQ A;  3VS0 A;  1WFW A;  1E7O A;  1AWJ A;  2J06 A;  1NYF A;  2HDA A;  5IHK A;  4J9C A;  1E6H A;  1NG2 A;  1BU1 A;  1PKT A;  2DRM A;  3NPF A;  3A98 A;  2B86 A;  2KNB B;  2FG0 A;  1OOT A;  1UHF A;  1ZUU A;  3RNJ A;  2BZX A;  4QT7 A;  3UF4 A;  3I5S A;  2CUD A;  2KRN A;  3EG0 A;  1QKX A;  1M27 C;  4Z89 A;  1I07 A;  1UGV A;  1V1C A;  3GBQ A;  1MUZ A;  2YDL A;  2CT3 A;  1SEM A;  2AKK A;  1AWO A;  3M0U A;  3I35 A;  2K2M A;  4CC3 A;  1G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...