2P4RA

Structural basis for a novel interaction between aip4 and beta-pix
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2p4rA00
1G83A 4J9FA 3PVLA 1K1ZA 1K9AA 1Y57A 4EIKA 4AG2C 3QWYA 4OMPA 2RPNA 1KIKA 1U5SA 5L23A 2HSPA 2LJ1A 5FW9A 5GJWB 2ABLA 4F14A 2JMAA 1GFDA 2NWMA 1RLQC 3PVQA 5FWCA 4JJDA 4RTVA 3M0SA 2ED0A 2AKKA 2F2XA 4GBQA 2JXBA 2FPDA 2J6FA 3UA7A 1ARKA 3H0HA 2KRMA 4J9CA 1NEGA 1NLOC 1BB9A 1WYXA 1QKWA 1E6GA 2I0NA 3NGPA 4CC7A 2K7AA 1H3HA 2K3BA 2L3SA 2J05A 4D8DA 2E5KA 2EYWA 4QT7A 3VS3A 1JXMA 1OPKA 1NG2A 2AZVA 4FSSA 4DEYA 1QWEA 1M30A 3LH5A 2ENMA 2LMJA 2FEIA 3REBB 3A98A 4JZ3A 3PE0A 2DL3A 1UJYA 1HSQA 2J7IA 4OMMA 1V1CA 2FRYA 4CC4B 1AVZC 2DVJA 3I5RA 4HVUA 2F2VA 1SPKA 2FPFA 2DM1A 2ECZA 4HVVA 1GCPA 3EG3A 1EFNA 1OOTA 2BTTA 3EG2A 1W6XA 3EHRA 3GBQA 2KXCA 1AD5A 2W10A 3IQLA 2AKLA 1KSWA 5IHNA 4RTWA 3VS2A 1K0XA 2CT4A 1YWOA 1WA7A 2C0OA 3VS0A 1YP5A 1Z9ZA 2RNAA 3M0QA 2K6DA 3VS4A 3TSWA 3SEMA 1JQQA 2CH4W 2LP5A 5HCKA 1AZEA 1QLYA 5EC7A 3I9QA 2CDTA 2L2PA 1IO6A 1UHFA 2KRNA 1VYTA 1CKAA 2L3PA 1NEBA 1SEMA 2BZ8A 2SRCA 2GNCA 1B07A 4Z88A 2KEAA 1Y0MA 2EQIA 1XOVA 1QWFA 2A37A 1I0CA 3VS6A 4M4ZA 1VYVA 4F16A 2EYXA 3I35A 2V1QA 2DRMA 4RTXA 1AWXA 3CQTA 2KNBB 4ESRA 4R0KA 3EG0A 1AWJA 2YUOA 2K79A 3EGUA 3VRZA 4J9HA 2DL8A 1GCQA 2GGRA 1WFWA 3KFVA 1YCSB 1RI9A 2H8HA 1WIEA 1I1JA 2JMCA 2KBTA 2DRKA 2JM8A 2LJ3A 1WXUA 2RMOA 2O9SA 2PTKA 2EGCA 1HJDA 2FG0A 1TUCA 1UUEA 1AOJA 2AK5A 5I11A 4LN2A 1KFZA 2O31A 5FWBA 2EYZA 3UA6A 3M0UA 1H8KA 1X2QA 1T0JA 2A36A 1VA7A 1X6BA 1X2KA 2HEQA 4RUGA 1K4US 3NHNA 2O9VA 3UATA 3TSZA 2FO0A 2CUDA 3R6NA 2CSQA 2QDLA 4J9BA 1PRMC 1WXBA 2L0AA 2RQRA 1PNJA 2HBWA 2X3XD 2JS2A 4IIOA 2KE9A 1N5ZA 5IH2A 1OEBA 2V1RA 1PHTA 1X6GA 3H0IA 1PKTA 1RUWA 2KROA 4LNPA 1OV3A 3REAB 1TG0A 3VRYA 1NYFA 1JEGA 2JS0A 2YUPA 1M3BA 1LCKA 1E6HA 1HD3A 1AZGB 2DA9A 5IXFA 2K2MA 1WXTA 2KXDA 1UE9A 4X1VA 4AFQC 3RBBB 1JO8A 3VS7A 2OAWA 1W1FA 1QCFA 2RQVA 1UGVA 4Z8AA 3EG1A 1FMKA 1E7OA 1WI7A 2DNUA 2DMOA 2MIOA 2O88A 1K0SA 4RTTA 1NM7A 1U06A 2DJQA 1W70A 1ABQA 3M0PA 2LZ6B 2J06A 1UFFA 3THKA 2PZ1A 1NYGA 2A28A 3I5SA 1GRIA 2YDLA 1SSHA 4J9EA 4RTUA 3H41A 1ZUYA 2DX1A 2RN8A 4HVWA 1AWWA 2LQNA 1J3TA 1JXOA 3H0FA 2CH4A 2DL4A 2B86A 1UDLA 4K11A 2YSQA 3ZL7C 1MUZA 2DBMA 1KJWA 4F17A 2DYBA 2JM9A 4RTYA 1X69A 2A08A 1G2BA 1M3CA 1UHCA 1PWTA 2KRSA 1UG1A 2AZSA 3M0TA 2P4RA 3FJ5A 2HDAA 1SRLA 1VYUA 2VVKA 3ULRB 2JTEA 2HCKA 2LJ0A 4D8KA 5I22A 5IXBA 2KGTA 1BBZA 3RNJA 2PNIA 1UJ0A 1JU5C 4LUEA 1GFCA 1X27A 1H92A 4DEXA 3EHQA 4CC3A 1T3LA 2DLPA 4IIMA 1B3QA 1ABOA 1A0NB 2RQWA 2C0TA 2D1XA 4AFUC 1FYNA 3TVTA 2KT8A 2JW4A 3UF4A 4CC2A 3SHWA 1I07A 4AFSC 2MCNA 2CSIA 2J6OA 1UECA 2KT1A 4HXJA 2FRWA 2EW3A 4OMLA 1ZLMA 1T0HA 2YUQA 2YUNA 4ORZA 1ZSGA 1S1NA 2DF6A 2KYBA 4KRTA 4A63B 2MOXA 1U3OA 1ZUUA 1TUDA 2EGAA 2BZXA 4JJBA 2VKNA 1M8MA 3QWXX 1Z9QA 4J9DA 3NPFA 1GBQA 2ROTA 2DILA 1SRMA 4AFZC 1MV3A 1ZUKA 2CREA 2EKHA 2SEMA 1WLPB 2D0NA 3NMZC 1UTIA 3VS5A 2JT4A 2GQIA 1BK2A 1BU1A 2ROLA 5IHIA 4LUDA 2XMFA 2CUBA 4Z89A 3U23A 5ECAA 3C0CA 2ED1A 2EPDA 2LX7A 1OPLA 2D8JA 1ZX6A 3JV3A 1YWPA 2RQUA 2J6KA 1SHGA 1PRLC 2M51A 2X3WD 1WDXA 1WX6A 2M0YA 2EGEA 4GLMA 4RTZA 1T3SA 1PKSA 5IHKA 2O2OA 2DBKA 2DE0X 4Y92A 1K76A 1QKXA 2CT3A 2W0ZA 1M3AA 2NUZA 1GL5A 2RQTA 4JPBW 4JZ4A 3M0RA 2FPEA 1CKBA 2L3QA 2IIMA 2D8HA 2LNHB 2OI3A 4LE9A 2BZYA 1RLPC 2ESWA 4OMQA 1SHFA 1MV0B 1X43A 2DL7A 4J9IA 4OMNA 4HCKA 4AG1C 1YNZA 2VWFA 1GCQC 5GJVB 1GBRA 1CSKA 2KYMA 2C0IA 3VS1A 1ZBJA 2G6FX 1YN8A 2EVRA 2DL5A 2F2WA 3O5ZA 2EBPA 4J9GA 2K9GA 2GTOA 2EYYA 4ZNXA 4OMOA 2LQWA 2GTJA 4JJCA 2LCSA 1AEYA 1AWOA 2GBQA 4E6RA 2RF0A 2KR3A 4WCIA 2YT6A 1NLPC 2OJ2A 1M27C
chains in the Genus database with same CATH superfamily
1M90C 1YJWT 1K1ZA 1K73U 1YI2T 4EIKA 2Z0WA 2RPNA 4P5NA 3CC4T 1KIKA 2JNGA 5FU6B 2HSPA 4A4EA 5DM7R 2K4YA 1DJ7B 2K57A 4N0AC 2FL7A 5GANe 4JJDA 2F2XA 2ZGWA 4FCYA 3JCMb 3HTRA 2FPDA 3CCMA 1IREB 2NYSA 4J9CA 1M90U 1WYXA 1VOMA 3M5AA 2DAQA 4N4GA 2YRCA 1E6GA 2I0NA 4CC7A 1VQKT 1ZSZB 3CCVT 2EFIA 4D8DA 4F7UB 1QCNA 2V8KA 2XI9A 2ZPBB 3CCLA 4OB1B 3A8MB 3C12A 5KYNA 4X34A 1TTHB 2AZVA 2EJFA 3M53A 1QWEA 1U1SA 3EAEA 5FRNA 3CPFA 2ENMA 2YLBA 3PE0A 2DL3A 1EZZB 2QA4T 1S72Q 1HSQA 1OQKA 3JCMX 1GXIE 5CAIA 1AVZC 3RDVA 4KUIA 2FPFA 1TUGB 4HVVA 5GMKh 1KC8C 4XTVA 3H9NA 2BTTA 1OOTA 1W6XA 3G4SA 3QDRB 1WZOA 1YWOA 1R0BG 4C92G 2ZPIB 1ZBXA 2ZCFB 4N4HA 2PQWA 2K6DA 3OBWA 3SEMA 3V8KA 4F7UA 5HCKA 1QLYA 3HRTA 1IO6A 1WHJA 1VYTA 2L3PA 1SEMA 2P0KA 1Y96B 2BZ8A 4Z88A 4E7LA 2LTOA 2CZ7B 4B6MA 2DD5A 1XOVA 2Y4YA 2A37A 1I0CA 3VS6A 3QJYA 4C5EA 2A0FB 3EFOA 1YITQ 2V1QA 3CBMA 1OU9A 5D6YA 1QQJA 4RTXA 3LWHA 1KG1A 1K8AU 2X4JA 4R0KA 3EG0A 4M77B 2DTHA 2K79A 3EGUA 4J9HA 2DL8A 1D0YA 3QSUA 1YCSB 1RI9A 2H8HA 5C6SA 2DRKA 4OP0A 5DY9A 2E6NA 3R6OA 1HJDA 4E7IA 5I11A 5FWBA 3UA6A 2A3LA 1X2QA 5A0DA 5KYWA 5GANj 5CQXA 1UGSB 2E10A 2VXFA 1ACMB 3M9QA 4EMHA 2CUDA 3MO8A 3DLMA 2DPPB 1PNJA 3PGGA 1YFNA 1KC8U 3I55Q 2V1RA 3OYHA 1YBYA 2KROA 5GAMe 5AT1B 1HK9A 3V8JA 2QQSA 2HBPA 2JS0A 2IPOB 1M3BA 5GAOp 2XDBA 4AFQC 3V7SA 1EIFA 4HCCA 2DK3A 4V2SA 2NUPA 2OAWA 1VUBA 4C0ZA 4C8QG 1WI7A 2RA2A 2DFUA 1VQ9A 1U06A 4M75C 3G4ST 2PZ1A 3BDLA 4XTXA 2DXTA 3QG1A 3OS2A 1G3WA 3I5SA 1VQLQ 4J9EA 2CP7A 1EX4A 2RN8A 1JBMA 4PJOD 5GAN4 3G71T 3E2UA 2DL4A 2YSQA 1MUZA 4C0DB 5KYYB 1YJWA 1YJNA 3JB9D 2DBMA 1XNIA 1QVGP 3KXTA 1K9MR 4M78E 1MNDA 2DYBA 5FU6C 2JM9A 5M9OA 2A08A 3VYHB 3SFMA 1WNLA 5A2QE 3OYIA 3G6EA 2M9UA 1N8RC 2P4RA 2HDAA 2RO0A 3ULRB 3LWIA 3A8OB 4C5GA 5GAN5 3FJPA 4F7UG 3CCUT 4HCZA 4KULA 2PNIA 1UJ0A 2O01E 3PNWC 4C92F 5HK3A 1K9MC 2DLPA 1NPRA 4AFUC 2DXUA 1Q7YR 3MEUA 1VQ6A 1VIEA 4GLKA 2JW4A 4M75G 1OZ2A 1WJSA 2R57A 2LT4A 4M77F 1X75C 4PJOE 3SHWA 4M77G 4M7AG 1I07A 3S3NA 3A8HB 2O4XB 2KT1A 3GOXA 4OMLA 1ZLMA 3CCQQ 2YUQA 3JSCA 4PKCC 4PJMA 2KYBA 1D3BB 4M7DE 2BE9B 4A63B 2X4XA 1U3OA 4L5GA 3H6ZA 3N5BB 3M56A 2E70A 4JJBA 2EQMA 1M8MA 3CBOA 3L2QA 3RESA 2MF2A 3QWXX 1Z9QA 3E19A 3NPFA 4ELZC 2ROTA 4XU3A 4AFZC 1YHQQ 2D0NA 1UTIA 1U8RA 2LVMA 1Q86C 4WTOB 1VQ6T 2XKOC 2XMFA 2CUBA 4Z89A 3EG9B 3OYYA 1OU8A 3BE3A 3LGFA 2QTXA 3GPLA 3TCJA 2COZA 2QQRA 5GAN2 2J6KA 1I8FA 1SHGA 3P8BB 3CCUA 1G3TA 2DD4A 2M51A 4FT4A 4GLMA 2RK2A 2F1LA 1G8XA 2LQ8A 5IHKA 2DVEA 4Y91A 1FMWA 3VYGA 2PVOB 4E7HA 3TU4K 2EIFA 1I81A 4JDSA 4BE0A 2OI3A 2LNHB 3MPUB 1NPPA 3X28B 4XU1A 2PVDB 2ESWA 3CXCP 1OX8A 3HRSA 1MV0B 1X43A 2DL7A 3G71A 1YJNQ 4JS4A 2RHUA 2M0OA 3UPUA 1YIJQ 2OTLT 4KT0E 2OTJA 1YNZA 2VWFA 2EAYA 2KYMA 3VS1A 4VUBA 1TOVA 2F2WA 3AT1B 4NS5A 1VQLA 2QASA 1VQMT 1IB8A 1AWOA 2KR3A 4WCIA 2DYIA 2JZ2A 3HPWA 3I56T 1FX7A 3OYLA 3HHTB 1M27C 4PJOF 3RKWA 3MJXA 3PVLA 1VQ4Q 3FB9A 1QVFS 4PJOB 4BD3A 3JB9G 4O6JA 3H8ZA 1PM3A 3WVEB 2JUFA 4XU0A 4OGCA 5GJWB 2EYQA 4F14A 1VQ5Q 5FWCA 1M90R 3MEAA 4O5VA 3M0SA 2ED0A 4GBQA 4JRQA 1VQ5A 5LJ3e 3UA7A 3MEVA 4PFZA 1OZ3A 3CCJT 3A1PA 3OW2P 3EFOB 2XHCA 5CKBA 1VQ8T 5DLQE 2QEXQ 1O9SA 1KD1C 1QKWA 4MMKA 1YI2Q 2KDSA 2MI6A 2L3SA 1AHJB 1QP2A 2EYWA 3VS3A 1JXMA 2AHJB 4FSSA 2D6FA 1M30A 3WVDB 3A98A 3SB2A 5GMKj 4FT2A 1ZHIA 3RR6A 1VQ8Q 3HL8A 3X24B 2FHDA 3I55A 3HP9A 1V1CA 4C8QE 2LCLA 1SG5A 2DVJA 1KD1U 2F2VA 3PMIA 1NE8A 2DM1A 2ECZA 4C8QD 2KVQG 1GCPA 5CKHA 1EFNA 5EG2A 3EG2A 5KYXB 3EHRA 5D6WA 3GBQA 2KXCA 1AD5A 2W10A 3CMAQ 5GAN8 1VQMQ 2DIGA 5IHNA 1KSWA 2X51A 1WA7A 3WXMB 2WSFE 3CMAA 3JCMQ 1MGQA 3CCRQ 1D0XA 4PLIA 5LJ3d 3AHUA 1O75A 1JQQA 2LP5A 3OS0A 5KYUA 1AZEA 1LVKA 3LX7A 5EC7A 3I9QA 9ATCB 3L1AA 1UHFA 3PIOA 2KY9A 2HD0A 3MP8A 1S72A 1FMVA 4JRIA 1N8RR 5GANh 2SRCA 2GNCA 3ASKA 4C8QB 1ZSZC 4M75E 4E7KA 2CP6A 2EQKA 1I5OB 5LJ3g 5KCOA 4FIBA 1VQ9T 4BUGA 4F16A 4M75D 4OVAA 2OTLQ 3I35A 5LJ3f 1OULA 1OI1A 2WACA 4ESRA 5KCHA 2YUOA 4M75F 3KFVA 1R77A 4C8QC 1RACB 1RI0A 4BE2A 3NTHA 2KBTA 2JM8A 4M7DF 2RMOA 3PFSA 5J39A 2EGCA 2FG0A 2ZPFB 4LXCA 4XK8E 4LN2A 2PU9B 4FM4B 1VA7A 8ATCB 2HEQA 4RUGA 2YHTA 1IHVA 4EDUA 5LJ3j 1VQKA 4HKEA 3UATA 2HSEB 3QHSA 3R6NA 2CSQA 1RADB 1UGQB 2QDLA 1N9SA 4FL6A 1QCOA 4J5YA 1TS9A 2L0AA 3CC2A 2HBWA 3O8VA 2JS2A 4DA4A 4IIOA 2KE9A 3OS1A 1N5ZA 2FZKB 1Q82C 1UGRB 2HMAA 3I55T 4M7AA 2DEUA 4N0AA 1X6GA 1OV3A 2P0PA 4C92B 1TG0A 3VUBA 3VRYA 1NYFA 5IN1A 3SDZA 4WF2A 1E6HA 1HD3A 1AZGB 3CC4A 4NL3A 5GMKe 1WXTA 3JCMh 4E7ZA 1UE9A 1QVFP 4LDWA 2KQWA 4DBQA 3P8DA 3DKMA 3VU3C 1WQWA 1TXQA 2O4XA 4ZN3A 3CMAT 4B9XA 3EG1A 1FMKA 1RAHB 5GAMj 4M78A 2DMOA 2MIOA 4GY5A 4RCBA 1Q7YC 4J6YA 2O88A 1YJ9T 3CCJA 3OYEA 3MKDA 1VQOA 3CCMQ 3M0PA 1N6AA 1IRXA 5C0MA 3JCMP 3QZ5B 3THKA 3HRUA 2A28A 2V8IA 1WJQA 1HYOA 1GRIA 2VC8A 2YDLA 4RTUA 1PSEA 1ZUYA 3CCEA 4HVWA 2MAMA 1J3TA 2XU8A 1UB4A 2DIQA 3C4SA 3ZL7C 2FZCB 2YRDA 2ZAEA 4BI8B 1M2OA 3GNGA 1C0MA 2CGHA 3QPHA 4LD6A 3LGLA 1ZQ1A 2VGMA 3M0TA 3GIBA 2C06A 1V76A 3DB4A 5D6XA 1VQLT 3X26B 1RAEB 3EH2A 3CCSQ 2VVKA 1VYUA 2QEXA 2VB6A 3CC7Q 2HCKA 3QZ9B 4HCBA 1Y07A 2LJ0A 4C5HA 4D8KA 5I22A 3CBPA 4EMGA 1BBZA 4LUEA 3LW5E 1VQ5T 2OTLA 1H92A 2QA4A 3V7CA 3OSVA 2YXYA 2LDMA 3QYHB 2DJZA 3X20B 4IIMA 4JLIA 3L2WA 2JJ9A 2RQWA 1BI0A 3E9FA 3RKYA 4JRPA 1K9MU 4MZMA 2EKOA 3TVTA 1MMNA 1VQ4T 3UF4A 3RMQA 2MK5A 3JB9F 2MCNA 2CSIA 2J6OA 1MHNA 2FRWA 5FLXE 3G6EQ 6AT1B 2FB7A 2HQXA 2EJ9A 4J6WA 3PTAA 2ZPEB 1M1KC 3FC3A 2MOXA 3V7RA 2BZXA 3FDRA 3NTKA 4J7IA 1M2VB 2MPXC 4KBMB 1N8RU 2COYA 4BDYA 1ZA2B 2DILA 2XDPA 1SRMA 1ZUKA 4R55A 2CREA 2SEMA 4JJNK 3ME9A 2B8AA 1WLPB 1SKUB 2BUDA 3VS5A 2JT4A 1B34B 1BU1A 3M4GA 3QDFA 2HKQB 3HFOA 1BIBA 2AIRB 3M58A 4PFPA 1WQ7A 2P4TA 4EMKA 3CPWA 3JV3A 1KQ2A 3OYCA 1Q81U 2QXFA 3OYNA 1RAIB 2X3WD 1M1FA 1WDXA 1WX6A 2QQAA 2EGEA 1MMGA 3URGA 1T3SA 2RH2A 2WSCE 1PKSA 2RHXA 2DBKA 4NL2A 1SSFA 1JRIA 3SWNC 2DE0X 4ZGJB 4Y92A 1K76A 1QKXA 2COWA 2CT3A 2W0ZA 1M3AA 1GL5A 1KHIA 4MDXA 2RQTA 5FU7C 1VQPT 1OX9A 2QTVA 2CKKA 1CKBA 1V29B 2GQVA 5LJ5d 2RHYA 4M75A 3OB9A 4OMNA 4AG1C 2E41A 5GAN6 4A4HA 5GJVB 1GBRA 1CSKA 2G6FX 2EVRA 4DBHA 3O5ZA 2MWPA 2LC4A 4J9GA 2EYYA 4QVZA 4ZNXA 1KQSA 1HXDA 3GF5A 2LCSA 5IAYA 1BI1A 4PJNA 4EPCA 4KGVB 2RF0A 3G7ZA 1YJ9A 3OYDA 3M54A 2OJ2A 1VQ7T 3JCMW 1X01A 1G83A 1YJNT 2BKDN 2HL5C 2QI2A 5GAMh 2XD0A 2K5IA 3ZEHA 1SF9A 5HK0A 2GFAA 1U5SA 3PMTA 2LJ1A 2X35A 5FW9A 5LJ5g 1W2BP 5CCAA 3FLGA 5KE3A 4RTVA 3SD4A 2AKKA 1VQ7Q 3NTIA 5A0GA 2JXBA 4C8QF 2J6FA 2VUBA 1NZ9A 2WSEE 1ARKA 2E65A 3H0HA 4BACA 2KRMA 3J7AF 1NEGA 2QA4Q 4M77A 4M75B 1BB9A 1VQNQ 1K73C 1IHWA 3HFNA 3NGPA 1H3HA 2K7AA 3G6ET 3G1JA 2K3BA 1M5Q1 2E5KA 4M7DC 3M59A 1BCOA 4QT7A 3M57A 1UGPB 1OPKA 1NG2A 2VGNA 4DEYA 1VQOQ 2RB6A 3EFSA 3LH5A 4M77D 2LMJA 3FRNA 2FEIA 4PJOC 3S3MA 3TEEA 3CD6A 1UJYA 1KQSP 4PLLA 1YIJT 3CMEA 4II1A 4OMMA 2FRYA 4CC4B 4MZTA 4LDVA 4HVUA 1K73R 3EGXA 1XTDA 4LD9K 1VIFA 3INZA 3OYBA 1FXXA 4UC4A 3VJPA 4DOVA 2AKLA 4D6WA 4RTWA 2CT4A 4RCCA 2RI2A 1I5LA 5CQYA 1YP5A 2JTMA 2RNAA 3CCJQ 3CCRT 4C0GA 2CZ1B 3VS4A 1PCXA 3TSWA 2ZPHB 1S72T 4A53A 4DBRA 5GANd 2HZYA 2CDTA 2L2PA 3RKXA 4BE1A 1NEBA 4Y28E 2A7YA 1VQ6Q 2KEAA 4Z02A 5CIUA 3Q1JA 4J7FA 5KE2A 1VYVA 4MDWA 4MMLA 4E47A 2OX7A 1D1BA 1PC0A 1JJ2P 3BFMA 2EYXA 3VKIA 5GANg 1WHLA 2Y4XA 3QO3A 5GANf 2KNBB 1VQNA 3JB9I 4QKUA 1AWJA 2PUOB 3OYGA 4XAXB 3VRZA 1TH7A 4C92E 2KAFA 1WIEA 2JMCA 4LDYA 1B7TA 2PTKA 2QK0A 4E2FB 1UUEA 2E5QA 4Q5WA 2O31A 3MCAB 1T0JA 1VQ9Q 2RJFA 2A36A 4JUVA 2LX9A 1NJIU 1K4US 2L89A 3CCQA 3NHNA 3E1SA 2O9VA 2FO0A 5LJ5f 4J9BA 3QIIA 5LJ5j 1W2BA 5CK9A 2RQRA 2R5MA 5GMKi 1KK7A 2E12A 5LJ5e 2DERA 3CMET 1OEBA 1JB0E 4F04B 4YTLA 1AT1B 4EMKC 1PHTA 2NLUA 5CKFA 3H0IA 3RUXA 8AT1B 4LNPA 3ZFJA 1JEGA 1UEBA 2YUPA 2XDDA 3E9GA 1LCKA 2DA9A 1NJIC 2K2MA 1MNEA 3CCLQ 2GFUA 4FW2A 3T9NA 3META 3RBBB 2MYSA 2ATCB 3CCRA 3J81E 2DXCA 3A8GB 1QCFA 4KGZB 3L2UA 5GAOm 1UGVA 4Z8AA 5I21A 2CS7A 4XU2A 4M77E 2K5LA 3CCMT 2RHZA 1NM7A 4L59A 1ABQA 1P92A 2LZ6B 1RAGB 1MMDA 1UFFA 1QVPA 3C95A 5GAN7 1NYGA 2K5FA 4DQ2A 3V8LA 5I2SA 3EGDA 4R56A 3H41A 2KI7A 2RI3A 2ZZDA 2M16A 4IUPA 1AWWA 2VYTA 1YIJA 2EQJA 2OTJQ 2CH4A 2QG9B 4RG2A 2B86A 1UDLA 4K11A 2PUKB 2M02A 2K2VA 2YRVA 1KJWA 1VQ7A 1H3ZA 1X69A 1G2BA 1UHCA 4FSXA 4XTYA 1PWTA 2KRSA 1UG1A 2AZSA 3FJ5A 4N4IA 2E3IA 4BB7A 1C6VX 4C92D 2JTEA 2QQBA 1OYXA 1D0ZA 1Y96A 3VUZA 2CP0A 4PNOA 2KGTA 3RNJA 2HQHA 1JU5C 3VV0A 1GFCA 1X27A 3CD6Q 3OYKA 1G5VA 3MP6A 1WJRA 1A0NB 5GAMf 1M8VA 2IVWA 4M77C 3OMCA 5GAMg 3OA6A 7AT1B 4ZTFA 4AFSC 4HT9A 4M7DA 2EW3A 1D09B 3EGDB 1ZSGA 1FWZA 2E6ZA 4AT1B 4KRTA 3L2VA 3UT1A 2NUTA 4PJOA 5LL6S 1Y7XA 1ZUUA 1TUDA 3HKSA 2X4WA 3OW2S 2EGAA 2RM4A 3JCMf 4A4KA 2AT1B 1YCYA 4J9DA 4C92A 1GBQA 3JCMg 3JB9J 4PJJA 1TWBA 1MV3A 2R5AA 2EKHA 3CPWS 3NMZC 3QUIA 3GP8A 1NBEB 1QMCA 2GQIA 1NJIR 1BK2A 5IHIA 2ROLA 1RL2A 2HKNA 1JJ2A 2CZ0B 5GAOl 1BI3A 3U23A 3OBYA 3C0CA 2RJDA 2EPDA 2LX7A 2XG8D 1OPLA 2D8JA 3I56A 5FU7B 3PIPA 3QBYA 3C94A 1VQMA 3X25B 5CR2A 1K8AC 3OS5A 4ZGDB 3CCEQ 1QVGA 1KC8R 4JS5A 4C5IA 3CCUQ 2O2OA 5IT9E 3S6WA 3G71Q 2L5QA 2NUZA 1KHCA 3GNFB 4J83A 2FPEA 2L3QA 3EH1A 2D8HA 3M55A 3TREA 2LNVA 1M1KR 1SHFA 1YJWQ 3OYJA 2DZ9A 4J9IA 3P8HA 3J80E 2MWOA 4PFOA 2P84A 3JCMV 4CI0C 3JB9H 3CC7T 4QQ6A 1YN8A 3JAME 1IZ6A 4EMKB 4A4GA 2LCCA 5KYXA 5GAN3 1M4ZA 2K9GA 2GTOA 1K8AR 2H3EB 2GTJA 2LQWA 1AEYA 3BW1A 4PJLA 3OY9A 5GMKl 1D1CA 1ZSZA 4J6XA 1NLPC 4FYYB 4FYWB 2DEQA 4BDZA 2X9HA 4J9FA 2KSSA 4ME7A 2VV5A 3FEOA 4OMFB 1WHKA 4M78F 3LLRA 2ZPGB 1K9AA 3A8LB 1Y57A 4IUVA 1LNXA 1D3BA 4AG2C 3D7SB 3UDCA 3QWYA 2YWWA 4OMPA 3CCSA 1U1TA 2Y90A 3CPWP 3JRZA 5L23A 4C8QA 2ABLA 1RAAB 2JMAA 1GFDA 2NWMA 1BI2A 1RLQC 3PVQA 2DZCA 2FZGB 1IXDA 3EG9A 1Q82U 1PD0A 2HL3A 1WHMA 2QDYB 4QVCA 3OYAA 4LDXA 1D1AA 4M7AF 1NLOC 2X4YA 4M7DG 4M7AB 4QQGA 1XQHA 3JCMd 4MZPA 3CCQT 2J05A 2CP2A 1QP3A 3BDUA 5I2MA 4PJOG 3DLLA 2VASA 2QGFB 2RK1A 3CXCA 1M2VA 3REBB 4JZ3A 2XIDA 3MHXA 2YLCA 3KUFA 4ZTJA 2J7IA 4CRIA 3CCET 4LDUA 1Y71A 3I5RA 1B34A 1SPKA 2CZ6B 1VQNT 4QQDA 5GAMd 2RJEA 3EG3A 1KQSS 4KUDK 3OSSC 1Q81R 3BY7A 4A4FA 1N27A 1LJOA 4PL6A 1I4K1 1VQOT 3IQLA 3VS2A 1K0XA 5GAOq 1M1KU 2C0OA 3VS0A 4B9WA 1IGUA 2KMTA 1Z9ZA 1Q82R 3M0QA 2E1HA 3OYFA 1TSFA 2E3HA 2K3XA 2CH4W 4KH1B 4A54A 3A5ZB 4TVRA 2KRNA 1CKAA 1B07A 1Y0MA 2EQIA 2QQ9A 5GAOr 1QWFA 4M4ZA 4AMCA 4NOYA 1BYMA 5HKCA 4BY6B 1Q81C 2XK0A 3CC2T 2DRMA 1AWXA 3M4YA 2PVGB 3CQTA 3QKJA 2DKGA 4PK4A 4F7UF 1M9SA 1GCQA 2G3RA 5J26A 2GGRA 1WFWA 2RI5A 4KH0B 1I1JA 3ZBDA 2LJ3A 1WXUA 2O9SA 2JN0A 3CD6T 1TUCA 3RMSA 3JCMJ 1AOJA 2AK5A 3CEYA 1KFZA 4BY6C 2EYZA 1G3YA 3M0UA 1H8KA 4M7DD 4F7UE 3I56Q 1X6BA 1X2KA 4XQ3A 1LPLA 4C92C 4QVDA 1WGSA 2CYZB 3CCVA 4ELYC 1F1BB 3TSZA 4FYXB 3OQ5A 4OB2B 1PRMC 1WXBA 1VQKQ 2X3XD 1ZA1B 4FYVB 2HAXA 4E7SA 5IH2A 3CMEQ 4M7DB 1YJ9Q 4RG8A 5AYFA 1PKTA 1RUWA 5GMKm 2HQEA 1W4SA 3REAB 3CC2Q 2F5KA 1BCMA 5A0LA 5IXFA 4J8OA 2KXDA 5GAOn 5KYUB 4X1VA 2H3JA 2GF7A 1JO8A 3VS7A 5FRMA 1Q86U 2EQUA 2MMPA 4BI4A 2E64A 1W1FA 3PT9A 2NUTB 5LJ3h 2RQVA 3EGXB 3MP1A 1VQ8A 1E7OA 2DNUA 1K0SA 4RTTA 2OAUA 2DJQA 1W70A 3EFRA 3RIRA 4M7AE 3TQ7P 1YITT 2BE7D 2JOYA 4XTUA 2J06A 2CP5A 5CVIA 2LQKA 1KQ1A 2KK4A 2M1HA 2F5TX 4FW1A 1SSHA 2L8DA 4OF1A 2DX1A 4ZGEB 2LQNA 3QYGB 1JXOA 4HT8A 2F69A 3H0FA 4ANJA 4ATOA 4DOWA 3SWNA 5KH6A 2IG0A 1VQPQ 1PSFA 2QGGA 5KYWB 1Q7YU 4RKUE 4F17A 1RABB 2LRQA 4RTYA 2GCXA 1M3CA 2RD1A 2DXBA 4OGEA 1WPYA 4X9CA 4ZN1A 1SRLA 1WHHA 2DTIA 4OB0B 1N9RA 4C0FA 4M78G 3S3OA 5IXBA 1XJWB 4X9DA 1BIAA 5DLOA 2OTJT 2I2LA 4DEXA 1TU0B 2LT1A 3EHQA 2DO3A 2K3YA 4CC3A 3L2RA 1T3LA 4M78D 4DBFA 3G4SQ 1R0CB 4L6V5 1B3QA 1ABOA 2JTFA 2C0TA 2D1XA 5CO7A 5HY6A 1FYNA 2KT8A 4QW2A 3CCLT 3CCST 2BIVA 4IUQA 3SWNB 3QJ6A 1MMAA 4CC2A 1G3SA 4C0DC 1JJ2S 1UECA 4HXJA 2R58A 2CP3A 1T0HA 3CCVQ 2YUNA 4ORZA 4M7AC 1S1NA 2NUPB 2DF6A 2D9TA 3UWNA 5FROA 2EJGA 4IURA 1W2BS 1LOJA 2FYKA 4M7AD 2VKNA 1QW1A 5J3BA 4RMOA 3HSBA 2P0QA 1PG5B 4XTWA 4IUUA 2VXEA 1QVFA 3OW2A 2EWNA 3CC7A 3GLXA 1Q86R 3ER0A 2DETA 3OYMA 4M78B 3QXEB 2L3RA 1VQ4A 3CC4Q 1YI2A 3NFCA 2E4HA 1PD1A 4LUDA 1BKBA 4M78C 5D7UA 3JCMc 2V26A 5CKEA 5ECAA 2ED1A 3L2ZA 5CKDA 5KYYA 5L8RE 4KGXB 1ZX6A 1YWPA 2RQUA 4OB3B 1PRLC 2M0YA 4RTZA 4FU6A 2QEXT 1RAFB 4JLGA 1Q95G 1YHQA 3CXCS 3DB3A 4E7JA 4XTZA 3LYIA 4IKFA 1M1GA 2QYZA 4HA8A 4JPBW 2D0QB 2RHIA 4JZ4A 3M0RA 3KBGA 3OMGA 2IIMA 3FIFA 4LE9A 3MEWA 2BZYA 1RLPC 1X6OA 2RJCA 1R8OB 4OMQA 3JCMe 4BI3A 1VQPA 3RERA 3L42A 2HNIA 1H641 2XICA 1QVGS 4HCKA 1GCQC 2C0IA 4JRKA 1ZBJA 1YHQT 1C1AA 3LH0A 2DL5A 2FVUA 1KD1R 2V8JA 4IUTA 2EBPA 4OMOA 4JJCA 1YITA 2QAZA 2DTOA 2GBQA 1IGQA 4E6RA 3F70A 5LJ5h 1WHGA 2YT6A 2JVVA
chains in the Genus database with same CATH topology
1G83A 4J9FA 3PVLA 1K1ZA 1K9AA 1Y57A 4EIKA 4AG2C 3QWYA 4OMPA 2RPNA 1KIKA 1U5SA 5L23A 2HSPA 2LJ1A 5FW9A 5GJWB 2ABLA 4F14A 2JMAA 1GFDA 2NWMA 1RLQC 3PVQA 5FWCA 4JJDA 4RTVA 3M0SA 2ED0A 2AKKA 2F2XA 4GBQA 2JXBA 2FPDA 2J6FA 3UA7A 1ARKA 3H0HA 2KRMA 4J9CA 1NEGA 1NLOC 1BB9A 1WYXA 1QKWA 1E6GA 2I0NA 3NGPA 4CC7A 2K7AA 1H3HA 2K3BA 2L3SA 2J05A 4D8DA 2E5KA 2EYWA 4QT7A 3VS3A 1JXMA 1OPKA 1NG2A 2AZVA 4FSSA 4DEYA 1QWEA 1M30A 3LH5A 2ENMA 2LMJA 2FEIA 3REBB 3A98A 4JZ3A 3PE0A 2DL3A 1UJYA 1HSQA 2J7IA 4OMMA 1V1CA 2FRYA 4CC4B 1AVZC 2DVJA 3I5RA 4HVUA 2F2VA 1SPKA 2FPFA 2DM1A 2ECZA 4HVVA 1GCPA 3EG3A 1EFNA 1OOTA 2BTTA 3EG2A 1W6XA 3EHRA 3GBQA 2KXCA 1AD5A 2W10A 3IQLA 2AKLA 1KSWA 5IHNA 4RTWA 3VS2A 1K0XA 2CT4A 1YWOA 1WA7A 2C0OA 3VS0A 1YP5A 1Z9ZA 2RNAA 3M0QA 2K6DA 3VS4A 3TSWA 3SEMA 1JQQA 2CH4W 2LP5A 5HCKA 1AZEA 1QLYA 5EC7A 3I9QA 2CDTA 2L2PA 1IO6A 1UHFA 2KRNA 1VYTA 1CKAA 2L3PA 1NEBA 1SEMA 2BZ8A 2SRCA 2GNCA 1B07A 4Z88A 2KEAA 1Y0MA 2EQIA 1XOVA 1QWFA 2A37A 1I0CA 3VS6A 4M4ZA 1VYVA 4F16A 2EYXA 3I35A 2V1QA 2DRMA 4RTXA 1AWXA 3CQTA 2KNBB 4ESRA 4R0KA 3EG0A 1AWJA 2YUOA 2K79A 3EGUA 3VRZA 4J9HA 2DL8A 1GCQA 2GGRA 1WFWA 3KFVA 1YCSB 1RI9A 2H8HA 1WIEA 1I1JA 2JMCA 2KBTA 2DRKA 2JM8A 2LJ3A 1WXUA 2RMOA 2O9SA 2PTKA 2EGCA 1HJDA 2FG0A 1TUCA 1UUEA 1AOJA 2AK5A 5I11A 4LN2A 1KFZA 2O31A 5FWBA 2EYZA 3UA6A 3M0UA 1H8KA 1X2QA 1T0JA 2A36A 1VA7A 1X6BA 1X2KA 2HEQA 4RUGA 1K4US 3NHNA 2O9VA 3UATA 3TSZA 2FO0A 2CUDA 3R6NA 2CSQA 2QDLA 4J9BA 1PRMC 1WXBA 2L0AA 2RQRA 1PNJA 2HBWA 2X3XD 2JS2A 4IIOA 2KE9A 1N5ZA 5IH2A 1OEBA 2V1RA 1PHTA 1X6GA 3H0IA 1PKTA 1RUWA 2KROA 4LNPA 1OV3A 3REAB 1TG0A 3VRYA 1NYFA 1JEGA 2JS0A 2YUPA 1M3BA 1LCKA 1E6HA 1HD3A 1AZGB 2DA9A 5IXFA 2K2MA 1WXTA 2KXDA 1UE9A 4X1VA 4AFQC 3RBBB 1JO8A 3VS7A 2OAWA 1W1FA 1QCFA 2RQVA 1UGVA 4Z8AA 3EG1A 1FMKA 1E7OA 1WI7A 2DNUA 2DMOA 2MIOA 2O88A 1K0SA 4RTTA 1NM7A 1U06A 2DJQA 1W70A 1ABQA 3M0PA 2LZ6B 2J06A 1UFFA 3THKA 2PZ1A 1NYGA 2A28A 3I5SA 1GRIA 2YDLA 1SSHA 4J9EA 4RTUA 3H41A 1ZUYA 2DX1A 2RN8A 4HVWA 1AWWA 2LQNA 1J3TA 1JXOA 3H0FA 2CH4A 2DL4A 2B86A 1UDLA 4K11A 2YSQA 3ZL7C 1MUZA 2DBMA 1KJWA 4F17A 2DYBA 2JM9A 4RTYA 1X69A 2A08A 1G2BA 1M3CA 1UHCA 1PWTA 2KRSA 1UG1A 2AZSA 3M0TA 2P4RA 3FJ5A 2HDAA 1SRLA 1VYUA 2VVKA 3ULRB 2JTEA 2HCKA 2LJ0A 4D8KA 5I22A 5IXBA 2KGTA 1BBZA 3RNJA 2PNIA 1UJ0A 1JU5C 4LUEA 1GFCA 1X27A 1H92A 4DEXA 3EHQA 4CC3A 1T3LA 2DLPA 4IIMA 1B3QA 1ABOA 1A0NB 2RQWA 2C0TA 2D1XA 4AFUC 1FYNA 3TVTA 2KT8A 2JW4A 3UF4A 4CC2A 3SHWA 1I07A 4AFSC 2MCNA 2CSIA 2J6OA 1UECA 2KT1A 4HXJA 2FRWA 2EW3A 4OMLA 1ZLMA 1T0HA 2YUQA 2YUNA 4ORZA 1ZSGA 1S1NA 2DF6A 2KYBA 4KRTA 4A63B 2MOXA 1U3OA 1ZUUA 1TUDA 2EGAA 2BZXA 4JJBA 2VKNA 1M8MA 3QWXX 1Z9QA 4J9DA 3NPFA 1GBQA 2ROTA 2DILA 1SRMA 4AFZC 1MV3A 1ZUKA 2CREA 2EKHA 2SEMA 1WLPB 2D0NA 3NMZC 1UTIA 3VS5A 2JT4A 2GQIA 1BK2A 1BU1A 2ROLA 5IHIA 4LUDA 2XMFA 2CUBA 4Z89A 3U23A 5ECAA 3C0CA 2ED1A 2EPDA 2LX7A 1OPLA 2D8JA 1ZX6A 3JV3A 1YWPA 2RQUA 2J6KA 1SHGA 1PRLC 2M51A 2X3WD 1WDXA 1WX6A 2M0YA 2EGEA 4GLMA 4RTZA 1T3SA 1PKSA 5IHKA 2O2OA 2DBKA 2DE0X 4Y92A 1K76A 1QKXA 2CT3A 2W0ZA 1M3AA 2NUZA 1GL5A 2RQTA 4JPBW 4JZ4A 3M0RA 2FPEA 1CKBA 2L3QA 2IIMA 2D8HA 2LNHB 2OI3A 4LE9A 2BZYA 1RLPC 2ESWA 4OMQA 1SHFA 1MV0B 1X43A 2DL7A 4J9IA 4OMNA 4HCKA 4AG1C 1YNZA 2VWFA 1GCQC 5GJVB 1GBRA 1CSKA 2KYMA 2C0IA 3VS1A 1ZBJA 2G6FX 1YN8A 2EVRA 2DL5A 2F2WA 3O5ZA 2EBPA 4J9GA 2K9GA 2GTOA 2EYYA 4ZNXA 4OMOA 2LQWA 2GTJA 4JJCA 2LCSA 1AEYA 1AWOA 2GBQA 4E6RA 2RF0A 2KR3A 4WCIA 2YT6A 1NLPC 2OJ2A 1M27C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G83 A;  4J9F A;  3PVL A;  1K1Z A;  1K9A A;  1Y57 A;  4EIK A;  4AG2 C;  3QWY A;  4OMP A;  2RPN A;  1KIK A;  1U5S A;  5L23 A;  2HSP A;  2LJ1 A;  5FW9 A;  5GJW B;  2ABL A;  4F14 A;  2JMA A;  1GFD A;  2NWM A;  1RLQ C;  3PVQ A;  5FWC A;  4JJD A;  4RTV A;  3M0S A;  2ED0 A;  2AKK A;  2F2X A;  4GBQ A;  2JXB A;  2FPD A;  2J6F A;  3UA7 A;  1ARK A;  3H0H A;  2KRM A;  4J9C A;  1NEG A;  1NLO C;  1BB9 A;  1WYX A;  1QKW A;  1E6G A;  2I0N A;  3NGP A;  4CC7 A;  2K7A A;  1H3H A;  2K3B A;  2L3S A;  2J05 A;  4D8D A;  2E5K A;  2EYW A;  4QT7 A;  3VS3 A;  1JXM A;  1OPK A;  1NG2 A;  2AZV A;  4FSS A;  4DEY A;  1QWE A;  1M30 A;  3LH5 A;  2ENM A;  2LMJ A;  2FEI A;  3REB B;  3A98 A;  4JZ3 A;  3PE0 A;  2DL3 A;  1UJY A;  1HSQ A;  2J7I A;  4OMM A;  1V1C A;  2FRY A;  4CC4 B;  1AVZ C;  2DVJ A;  3I5R A;  4HVU A;  2F2V A;  1SPK A;  2FPF A;  2DM1 A;  2ECZ A;  4HVV A;  1GCP A;  3EG3 A;  1EFN A;  1OOT A;  2BTT A;  3EG2 A;  1W6X A;  3EHR A;  3GBQ A;  2KXC A;  1AD5 A;  2W10 A;  3IQL A;  2AKL A;  1KSW A;  5IHN A;  4RTW A;  3VS2 A;  1K0X A;  2CT4 A;  1YWO A;  1WA7 A;  2C0O A;  3VS0 A;  1YP5 A;  1Z9Z A;  2RNA A;  3M0Q A;  2K6D A;  3VS4 A;  3TSW A;  3SEM A;  1JQQ A;  2CH4 W;  2LP5 A;  5HCK A;  1AZE A;  1QLY A;  5EC7 A;  3I9Q A;  2CDT A;  2L2P A;  1IO6 A;  1UHF A;  2KRN A;  1VYT A;  1CKA A;  2L3P A;  1NEB A;  1SEM A;  2BZ8 A;  2SRC A;  2GNC A;  1B07 A;  4Z88 A;  2KEA A;  1Y0M A;  2EQI A;  1XOV A;  1QWF A;  2A37 A;  1I0C A;  3VS6 A;  4M4Z A;  1VYV A;  4F16 A;  2EYX A;  3I35 A;  2V1Q A;  2DRM A;  4RTX A;  1AWX A;  3CQT A;  2KNB B;  4ESR A;  4R0K A;  3EG0 A;  1AWJ A;  2YUO A;  2K79 A;  3EGU A;  3VRZ A;  4J9H A;  2DL8 A;  1GCQ A;  2GGR A;  1WFW A;  3KFV A;  1YCS B;  1RI9 A;  2H8H A;  1WIE A;  1I1J A;  2JMC A;  2KBT A;  2DRK A;  2JM8 A;  2LJ3 A;  1WXU A;  2RMO A;  2O9S A;  2PTK A;  2EGC A;  1HJD A;  2FG0 A;  1TUC A;  1UUE A;  1AOJ A;  2AK5 A;  5I11 A;  4LN2 A;  1KFZ A;  2O31 A;  5FWB A;  2EYZ A;  3UA6 A;  3M0U A;  1H8K A;  1X2Q A;  1T0J A;  2A36 A;  1VA7 A;  1X6B A;  1X2K A;  2HEQ A;  4RUG A;  1K4U S;  3NHN A;  2O9V A;  3UAT A;  3TSZ A;  2FO0 A;  2CUD A;  3R6N A;  2CSQ A;  2QDL A;  4J9B A;  1PRM C;  1WXB A;  2L0A A;  2RQR A;  1PNJ A;  2HBW A;  2X3X D;  2JS2 A;  4IIO A;  2KE9 A;  1N5Z A;  5IH2 A;  1OEB A;  2V1R A;  1PHT A;  1X6G A;  3H0I A;  1PKT A;  1RUW A;  2KRO A;  4LNP A;  1OV3 A;  3REA B;  1TG0 A;  3VRY A;  1NYF A;  1JEG A;  2JS0 A;  2YUP A;  1M3B A;  1LCK A;  1E6H A;  1HD3 A;  1AZG B;  2DA9 A;  5IXF A;  2K2M A;  1WXT A;  2KXD A;  1UE9 A;  4X1V A;  4AFQ C;  3RBB B;  1JO8 A;  3VS7 A;  2OAW A;  1W1F A;  1QCF A;  2RQV A;  1UGV A;  4Z8A A;  3EG1 A;  1FMK A;  1E7O A;  1WI7 A;  2DNU A;  2DMO A;  2MIO A;  2O88 A;  1K0S A;  4RTT A;  1NM7 A;  1U06 A;  2DJQ A;  1W70 A;  1ABQ A;  3M0P A;  2LZ6 B;  2J06 A;  1UFF A;  3THK A;  2PZ1 A;  1NYG A;  2A28 A;  3I5S A;  1GRI A;  2YDL A;  1SSH A;  4J9E A;  4RTU A;  3H41 A;  1ZUY A;  2DX1 A;  2RN8 A;  4HVW A;  1AWW A;  2LQN A;  1J3T A;  1JXO A;  3H0F A;  2CH4 A;  2DL4 A;  2B86 A;  1UDL A;  4K11 A;  2YSQ A;  3ZL7 C;  1MUZ A;  2DBM A;  1KJW A;  4F17 A;  2DYB A;  2JM9 A;  4RTY A;  1X69 A;  2A08 A;  1G2B A;  1M3C A;  1UHC A;  1PWT A;  2KRS A;  1UG1 A;  2AZS A;  3M0T A;  2P4R A;  3FJ5 A;  2HDA A;  1SRL A;  1VYU A;  2VVK A;  3ULR B;  2JTE A;  2HCK A;  2LJ0 A;  4D8K A;  5I22 A;  5IXB A;  2KGT A;  1BBZ A;  3RNJ A;  2PNI A;  1UJ0 A;  1JU5 C;  4LUE A;  1GFC A;  1X27 A;  1H92 A;  4DEX A;  3EHQ A;  4CC3 A;  1T3L A;  2DLP A;  4IIM A;  1B3Q A;  1ABO A;  1A0N B;  2RQW A;  2C0T A;  2D1X A;  4AFU C;  1FYN A;  3TVT A;  2KT8 A;  2JW4 A;  3UF4 A;  4CC2 A;  3SHW A;  1I07 A;  4AFS C;  2MCN A;  2CSI A;  2J6O A;  1UEC A;  2KT1 A;  4HXJ A;  2FRW A;  2EW3 A;  4OML A;  1ZLM A;  1T0H A;  2YUQ A;  2YUN A;  4ORZ A;  1ZSG A;  1S1N A;  2DF6 A;  2KYB A;  4KRT A;  4A63 B;  2MOX A;  1U3O A;  1ZUU A;  1TUD A;  2EGA A;  2BZX A;  4JJB A;  2VKN A;  1M8M A;  3QWX X;  1Z9Q A;  4J9D A;  3NPF A;  1GBQ A;  2ROT A;  2DIL A;  1SRM A;  4AFZ C;  1MV3 A;  1ZUK A;  2CRE A;  2EKH A;  2SEM A;  1WLP B;  2D0N A;  3NMZ C;  1UTI A;  3VS5 A;  2JT4 A;  2GQI A;  1BK2 A;  1BU1 A;  2ROL A;  5IHI A;  4LUD A;  2XMF A;  2CUB A;  4Z89 A;  3U23 A;  5ECA A;  3C0C A;  2ED1 A;  2EPD A;  2LX7 A;  1OPL A;  2D8J A;  1ZX6 A;  3JV3 A;  1YWP A;  2RQU A;  2J6K A;  1SHG A;  1PRL C;  2M51 A;  2X3W D;  1WDX A;  1WX6 A;  2M0Y A;  2EGE A;  4GLM A;  4RTZ A;  1T3S A;  1PKS A;  5IHK A;  2O2O A;  2DBK A;  2DE0 X;  4Y92 A;  1K76 A;  1QKX A;  2CT3 A;  2W0Z A;  1M3A A;  2NUZ A;  1GL5 A;  2RQT A;  4JPB W;  4JZ4 A;  3M0R A;  2FPE A;  1CKB A;  2L3Q A;  2IIM A;  2D8H A;  2LNH B;  2OI3 A;  4LE9 A;  2BZY A;  1RLP C;  2ESW A;  4OMQ A;  1SHF A;  1MV0 B;  1X43 A;  2DL7 A;  4J9I A;  4OMN A;  4HCK A;  4AG1 C;  1YNZ A;  2VWF A;  1GCQ C;  5GJV B;  1GBR A;  1CSK A;  2KYM A;  2C0I A;  3VS1 A;  1ZBJ A;  2G6F X;  1YN8 A;  2EVR A;  2DL5 A;  2F2W A;  3O5Z A;  2EBP A;  4J9G A;  2K9G A;  2GTO A;  2EYY A;  4ZNX A;  4OMO A;  2LQW A;  2GTJ A;  4JJC A;  2LCS A;  1AEY A;  1AWO A;  2GBQ A;  4E6R A;  2RF0 A;  2KR3 A;  4WCI A;  2YT6 A;  1NLP C;  2OJ2 A;  1M27 C; 
#chains in the Genus database with same CATH topology
 1M90 C;  1YJW T;  1K1Z A;  1K73 U;  1YI2 T;  4EIK A;  2Z0W A;  2RPN A;  4P5N A;  3CC4 T;  1KIK A;  2JNG A;  5FU6 B;  2HSP A;  4A4E A;  5DM7 R;  2K4Y A;  1DJ7 B;  2K57 A;  4N0A C;  2FL7 A;  5GAN e;  4JJD A;  2F2X A;  2ZGW A;  4FCY A;  3JCM b;  3HTR A;  2FPD A;  3CCM A;  1IRE B;  2NYS A;  4J9C A;  1M90 U;  1WYX A;  1VOM A;  3M5A A;  2DAQ A;  4N4G A;  2YRC A;  1E6G A;  2I0N A;  4CC7 A;  1VQK T;  1ZSZ B;  3CCV T;  2EFI A;  4D8D A;  4F7U B;  1QCN A;  2V8K A;  2XI9 A;  2ZPB B;  3CCL A;  4OB1 B;  3A8M B;  3C12 A;  5KYN A;  4X34 A;  1TTH B;  2AZV A;  2EJF A;  3M53 A;  1QWE A;  1U1S A;  3EAE A;  5FRN A;  3CPF A;  2ENM A;  2YLB A;  3PE0 A;  2DL3 A;  1EZZ B;  2QA4 T;  1S72 Q;  1HSQ A;  1OQK A;  3JCM X;  1GXI E;  5CAI A;  1AVZ C;  3RDV A;  4KUI A;  2FPF A;  1TUG B;  4HVV A;  5GMK h;  1KC8 C;  4XTV A;  3H9N A;  2BTT A;  1OOT A;  1W6X A;  3G4S A;  3QDR B;  1WZO A;  1YWO A;  1R0B G;  4C92 G;  2ZPI B;  1ZBX A;  2ZCF B;  4N4H A;  2PQW A;  2K6D A;  3OBW A;  3SEM A;  3V8K A;  4F7U A;  5HCK A;  1QLY A;  3HRT A;  1IO6 A;  1WHJ A;  1VYT A;  2L3P A;  1SEM A;  2P0K A;  1Y96 B;  2BZ8 A;  4Z88 A;  4E7L A;  2LTO A;  2CZ7 B;  4B6M A;  2DD5 A;  1XOV A;  2Y4Y A;  2A37 A;  1I0C A;  3VS6 A;  3QJY A;  4C5E A;  2A0F B;  3EFO A;  1YIT Q;  2V1Q A;  3CBM A;  1OU9 A;  5D6Y A;  1QQJ A;  4RTX A;  3LWH A;  1KG1 A;  1K8A U;  2X4J A;  4R0K A;  3EG0 A;  4M77 B;  2DTH A;  2K79 A;  3EGU A;  4J9H A;  2DL8 A;  1D0Y A;  3QSU A;  1YCS B;  1RI9 A;  2H8H A;  5C6S A;  2DRK A;  4OP0 A;  5DY9 A;  2E6N A;  3R6O A;  1HJD A;  4E7I A;  5I11 A;  5FWB A;  3UA6 A;  2A3L A;  1X2Q A;  5A0D A;  5KYW A;  5GAN j;  5CQX A;  1UGS B;  2E10 A;  2VXF A;  1ACM B;  3M9Q A;  4EMH A;  2CUD A;  3MO8 A;  3DLM A;  2DPP B;  1PNJ A;  3PGG A;  1YFN A;  1KC8 U;  3I55 Q;  2V1R A;  3OYH A;  1YBY A;  2KRO A;  5GAM e;  5AT1 B;  1HK9 A;  3V8J A;  2QQS A;  2HBP A;  2JS0 A;  2IPO B;  1M3B A;  5GAO p;  2XDB A;  4AFQ C;  3V7S A;  1EIF A;  4HCC A;  2DK3 A;  4V2S A;  2NUP A;  2OAW A;  1VUB A;  4C0Z A;  4C8Q G;  1WI7 A;  2RA2 A;  2DFU A;  1VQ9 A;  1U06 A;  4M75 C;  3G4S T;  2PZ1 A;  3BDL A;  4XTX A;  2DXT A;  3QG1 A;  3OS2 A;  1G3W A;  3I5S A;  1VQL Q;  4J9E A;  2CP7 A;  1EX4 A;  2RN8 A;  1JBM A;  4PJO D;  5GAN 4;  3G71 T;  3E2U A;  2DL4 A;  2YSQ A;  1MUZ A;  4C0D B;  5KYY B;  1YJW A;  1YJN A;  3JB9 D;  2DBM A;  1XNI A;  1QVG P;  3KXT A;  1K9M R;  4M78 E;  1MND A;  2DYB A;  5FU6 C;  2JM9 A;  5M9O A;  2A08 A;  3VYH B;  3SFM A;  1WNL A;  5A2Q E;  3OYI A;  3G6E A;  2M9U A;  1N8R C;  2P4R A;  2HDA A;  2RO0 A;  3ULR B;  3LWI A;  3A8O B;  4C5G A;  5GAN 5;  3FJP A;  4F7U G;  3CCU T;  4HCZ A;  4KUL A;  2PNI A;  1UJ0 A;  2O01 E;  3PNW C;  4C92 F;  5HK3 A;  1K9M C;  2DLP A;  1NPR A;  4AFU C;  2DXU A;  1Q7Y R;  3MEU A;  1VQ6 A;  1VIE A;  4GLK A;  2JW4 A;  4M75 G;  1OZ2 A;  1WJS A;  2R57 A;  2LT4 A;  4M77 F;  1X75 C;  4PJO E;  3SHW A;  4M77 G;  4M7A G;  1I07 A;  3S3N A;  3A8H B;  2O4X B;  2KT1 A;  3GOX A;  4OML A;  1ZLM A;  3CCQ Q;  2YUQ A;  3JSC A;  4PKC C;  4PJM A;  2KYB A;  1D3B B;  4M7D E;  2BE9 B;  4A63 B;  2X4X A;  1U3O A;  4L5G A;  3H6Z A;  3N5B B;  3M56 A;  2E70 A;  4JJB A;  2EQM A;  1M8M A;  3CBO A;  3L2Q A;  3RES A;  2MF2 A;  3QWX X;  1Z9Q A;  3E19 A;  3NPF A;  4ELZ C;  2ROT A;  4XU3 A;  4AFZ C;  1YHQ Q;  2D0N A;  1UTI A;  1U8R A;  2LVM A;  1Q86 C;  4WTO B;  1VQ6 T;  2XKO C;  2XMF A;  2CUB A;  4Z89 A;  3EG9 B;  3OYY A;  1OU8 A;  3BE3 A;  3LGF A;  2QTX A;  3GPL A;  3TCJ A;  2COZ A;  2QQR A;  5GAN 2;  2J6K A;  1I8F A;  1SHG A;  3P8B B;  3CCU A;  1G3T A;  2DD4 A;  2M51 A;  4FT4 A;  4GLM A;  2RK2 A;  2F1L A;  1G8X A;  2LQ8 A;  5IHK A;  2DVE A;  4Y91 A;  1FMW A;  3VYG A;  2PVO B;  4E7H A;  3TU4 K;  2EIF A;  1I81 A;  4JDS A;  4BE0 A;  2OI3 A;  2LNH B;  3MPU B;  1NPP A;  3X28 B;  4XU1 A;  2PVD B;  2ESW A;  3CXC P;  1OX8 A;  3HRS A;  1MV0 B;  1X43 A;  2DL7 A;  3G71 A;  1YJN Q;  4JS4 A;  2RHU A;  2M0O A;  3UPU A;  1YIJ Q;  2OTL T;  4KT0 E;  2OTJ A;  1YNZ A;  2VWF A;  2EAY A;  2KYM A;  3VS1 A;  4VUB A;  1TOV A;  2F2W A;  3AT1 B;  4NS5 A;  1VQL A;  2QAS A;  1VQM T;  1IB8 A;  1AWO A;  2KR3 A;  4WCI A;  2DYI A;  2JZ2 A;  3HPW A;  3I56 T;  1FX7 A;  3OYL A;  3HHT B;  1M27 C;  4PJO F;  3RKW A;  3MJX A;  3PVL A;  1VQ4 Q;  3FB9 A;  1QVF S;  4PJO B;  4BD3 A;  3JB9 G;  4O6J A;  3H8Z A;  1PM3 A;  3WVE B;  2JUF A;  4XU0 A;  4OGC A;  5GJW B;  2EYQ A;  4F14 A;  1VQ5 Q;  5FWC A;  1M90 R;  3MEA A;  4O5V A;  3M0S A;  2ED0 A;  4GBQ A;  4JRQ A;  1VQ5 A;  5LJ3 e;  3UA7 A;  3MEV A;  4PFZ A;  1OZ3 A;  3CCJ T;  3A1P A;  3OW2 P;  3EFO B;  2XHC A;  5CKB A;  1VQ8 T;  5DLQ E;  2QEX Q;  1O9S A;  1KD1 C;  1QKW A;  4MMK A;  1YI2 Q;  2KDS A;  2MI6 A;  2L3S A;  1AHJ B;  1QP2 A;  2EYW A;  3VS3 A;  1JXM A;  2AHJ B;  4FSS A;  2D6F A;  1M30 A;  3WVD B;  3A98 A;  3SB2 A;  5GMK j;  4FT2 A;  1ZHI A;  3RR6 A;  1VQ8 Q;  3HL8 A;  3X24 B;  2FHD A;  3I55 A;  3HP9 A;  1V1C A;  4C8Q E;  2LCL A;  1SG5 A;  2DVJ A;  1KD1 U;  2F2V A;  3PMI A;  1NE8 A;  2DM1 A;  2ECZ A;  4C8Q D;  2KVQ G;  1GCP A;  5CKH A;  1EFN A;  5EG2 A;  3EG2 A;  5KYX B;  3EHR A;  5D6W A;  3GBQ A;  2KXC A;  1AD5 A;  2W10 A;  3CMA Q;  5GAN 8;  1VQM Q;  2DIG A;  5IHN A;  1KSW A;  2X51 A;  1WA7 A;  3WXM B;  2WSF E;  3CMA A;  3JCM Q;  1MGQ A;  3CCR Q;  1D0X A;  4PLI A;  5LJ3 d;  3AHU A;  1O75 A;  1JQQ A;  2LP5 A;  3OS0 A;  5KYU A;  1AZE A;  1LVK A;  3LX7 A;  5EC7 A;  3I9Q A;  9ATC B;  3L1A A;  1UHF A;  3PIO A;  2KY9 A;  2HD0 A;  3MP8 A;  1S72 A;  1FMV A;  4JRI A;  1N8R R;  5GAN h;  2SRC A;  2GNC A;  3ASK A;  4C8Q B;  1ZSZ C;  4M75 E;  4E7K A;  2CP6 A;  2EQK A;  1I5O B;  5LJ3 g;  5KCO A;  4FIB A;  1VQ9 T;  4BUG A;  4F16 A;  4M75 D;  4OVA A;  2OTL Q;  3I35 A;  5LJ3 f;  1OUL A;  1OI1 A;  2WAC A;  4ESR A;  5KCH A;  2YUO A;  4M75 F;  3KFV A;  1R77 A;  4C8Q C;  1RAC B;  1RI0 A;  4BE2 A;  3NTH A;  2KBT A;  2JM8 A;  4M7D F;  2RMO A;  3PFS A;  5J39 A;  2EGC A;  2FG0 A;  2ZPF B;  4LXC A;  4XK8 E;  4LN2 A;  2PU9 B;  4FM4 B;  1VA7 A;  8ATC B;  2HEQ A;  4RUG A;  2YHT A;  1IHV A;  4EDU A;  5LJ3 j;  1VQK A;  4HKE A;  3UAT A;  2HSE B;  3QHS A;  3R6N A;  2CSQ A;  1RAD B;  1UGQ B;  2QDL A;  1N9S A;  4FL6 A;  1QCO A;  4J5Y A;  1TS9 A;  2L0A A;  3CC2 A;  2HBW A;  3O8V A;  2JS2 A;  4DA4 A;  4IIO A;  2KE9 A;  3OS1 A;  1N5Z A;  2FZK B;  1Q82 C;  1UGR B;  2HMA A;  3I55 T;  4M7A A;  2DEU A;  4N0A A;  1X6G A;  1OV3 A;  2P0P A;  4C92 B;  1TG0 A;  3VUB A;  3VRY A;  1NYF A;  5IN1 A;  3SDZ A;  4WF2 A;  1E6H A;  1HD3 A;  1AZG B;  3CC4 A;  4NL3 A;  5GMK e;  1WXT A;  3JCM h;  4E7Z A;  1UE9 A;  1QVF P;  4LDW A;  2KQW A;  4DBQ A;  3P8D A;  3DKM A;  3VU3 C;  1WQW A;  1TXQ A;  2O4X A;  4ZN3 A;  3CMA T;  4B9X A;  3EG1 A;  1FMK A;  1RAH B;  5GAM j;  4M78 A;  2DMO A;  2MIO A;  4GY5 A;  4RCB A;  1Q7Y C;  4J6Y A;  2O88 A;  1YJ9 T;  3CCJ A;  3OYE A;  3MKD A;  1VQO A;  3CCM Q;  3M0P A;  1N6A A;  1IRX A;  5C0M A;  3JCM P;  3QZ5 B;  3THK A;  3HRU A;  2A28 A;  2V8I A;  1WJQ A;  1HYO A;  1GRI A;  2VC8 A;  2YDL A;  4RTU A;  1PSE A;  1ZUY A;  3CCE A;  4HVW A;  2MAM A;  1J3T A;  2XU8 A;  1UB4 A;  2DIQ A;  3C4S A;  3ZL7 C;  2FZC B;  2YRD A;  2ZAE A;  4BI8 B;  1M2O A;  3GNG A;  1C0M A;  2CGH A;  3QPH A;  4LD6 A;  3LGL A;  1ZQ1 A;  2VGM A;  3M0T A;  3GIB A;  2C06 A;  1V76 A;  3DB4 A;  5D6X A;  1VQL T;  3X26 B;  1RAE B;  3EH2 A;  3CCS Q;  2VVK A;  1VYU A;  2QEX A;  2VB6 A;  3CC7 Q;  2HCK A;  3QZ9 B;  4HCB A;  1Y07 A;  2LJ0 A;  4C5H A;  4D8K A;  5I22 A;  3CBP A;  4EMG A;  1BBZ A;  4LUE A;  3LW5 E;  1VQ5 T;  2OTL A;  1H92 A;  2QA4 A;  3V7C A;  3OSV A;  2YXY A;  2LDM A;  3QYH B;  2DJZ A;  3X20 B;  4IIM A;  4JLI A;  3L2W A;  2JJ9 A;  2RQW A;  1BI0 A;  3E9F A;  3RKY A;  4JRP A;  1K9M U;  4MZM A;  2EKO A;  3TVT A;  1MMN A;  1VQ4 T;  3UF4 A;  3RMQ A;  2MK5 A;  3JB9 F;  2MCN A;  2CSI A;  2J6O A;  1MHN A;  2FRW A;  5FLX E;  3G6E Q;  6AT1 B;  2FB7 A;  2HQX A;  2EJ9 A;  4J6W A;  3PTA A;  2ZPE B;  1M1K C;  3FC3 A;  2MOX A;  3V7R A;  2BZX A;  3FDR A;  3NTK A;  4J7I A;  1M2V B;  2MPX C;  4KBM B;  1N8R U;  2COY A;  4BDY A;  1ZA2 B;  2DIL A;  2XDP A;  1SRM A;  1ZUK A;  4R55 A;  2CRE A;  2SEM A;  4JJN K;  3ME9 A;  2B8A A;  1WLP B;  1SKU B;  2BUD A;  3VS5 A;  2JT4 A;  1B34 B;  1BU1 A;  3M4G A;  3QDF A;  2HKQ B;  3HFO A;  1BIB A;  2AIR B;  3M58 A;  4PFP A;  1WQ7 A;  2P4T A;  4EMK A;  3CPW A;  3JV3 A;  1KQ2 A;  3OYC A;  1Q81 U;  2QXF A;  3OYN A;  1RAI B;  2X3W D;  1M1F A;  1WDX A;  1WX6 A;  2QQA A;  2EGE A;  1MMG A;  3URG A;  1T3S A;  2RH2 A;  2WSC E;  1PKS A;  2RHX A;  2DBK A;  4NL2 A;  1SSF A;  1JRI A;  3SWN C;  2DE0 X;  4ZGJ B;  4Y92 A;  1K76 A;  1QKX A;  2COW A;  2CT3 A;  2W0Z A;  1M3A A;  1GL5 A;  1KHI A;  4MDX A;  2RQT A;  5FU7 C;  1VQP T;  1OX9 A;  2QTV A;  2CKK A;  1CKB A;  1V29 B;  2GQV A;  5LJ5 d;  2RHY A;  4M75 A;  3OB9 A;  4OMN A;  4AG1 C;  2E41 A;  5GAN 6;  4A4H A;  5GJV B;  1GBR A;  1CSK A;  2G6F X;  2EVR A;  4DBH A;  3O5Z A;  2MWP A;  2LC4 A;  4J9G A;  2EYY A;  4QVZ A;  4ZNX A;  1KQS A;  1HXD A;  3GF5 A;  2LCS A;  5IAY A;  1BI1 A;  4PJN A;  4EPC A;  4KGV B;  2RF0 A;  3G7Z A;  1YJ9 A;  3OYD A;  3M54 A;  2OJ2 A;  1VQ7 T;  3JCM W;  1X01 A;  1G83 A;  1YJN T;  2BKD N;  2HL5 C;  2QI2 A;  5GAM h;  2XD0 A;  2K5I A;  3ZEH A;  1SF9 A;  5HK0 A;  2GFA A;  1U5S A;  3PMT A;  2LJ1 A;  2X35 A;  5FW9 A;  5LJ5 g;  1W2B P;  5CCA A;  3FLG A;  5KE3 A;  4RTV A;  3SD4 A;  2AKK A;  1VQ7 Q;  3NTI A;  5A0G A;  2JXB A;  4C8Q F;  2J6F A;  2VUB A;  1NZ9 A;  2WSE E;  1ARK A;  2E65 A;  3H0H A;  4BAC A;  2KRM A;  3J7A F;  1NEG A;  2QA4 Q;  4M77 A;  4M75 B;  1BB9 A;  1VQN Q;  1K73 C;  1IHW A;  3HFN A;  3NGP A;  1H3H A;  2K7A A;  3G6E T;  3G1J A;  2K3B A;  1M5Q 1;  2E5K A;  4M7D C;  3M59 A;  1BCO A;  4QT7 A;  3M57 A;  1UGP B;  1OPK A;  1NG2 A;  2VGN A;  4DEY A;  1VQO Q;  2RB6 A;  3EFS A;  3LH5 A;  4M77 D;  2LMJ A;  3FRN A;  2FEI A;  4PJO C;  3S3M A;  3TEE A;  3CD6 A;  1UJY A;  1KQS P;  4PLL A;  1YIJ T;  3CME A;  4II1 A;  4OMM A;  2FRY A;  4CC4 B;  4MZT A;  4LDV A;  4HVU A;  1K73 R;  3EGX A;  1XTD A;  4LD9 K;  1VIF A;  3INZ A;  3OYB A;  1FXX A;  4UC4 A;  3VJP A;  4DOV A;  2AKL A;  4D6W A;  4RTW A;  2CT4 A;  4RCC A;  2RI2 A;  1I5L A;  5CQY A;  1YP5 A;  2JTM A;  2RNA A;  3CCJ Q;  3CCR T;  4C0G A;  2CZ1 B;  3VS4 A;  1PCX A;  3TSW A;  2ZPH B;  1S72 T;  4A53 A;  4DBR A;  5GAN d;  2HZY A;  2CDT A;  2L2P A;  3RKX A;  4BE1 A;  1NEB A;  4Y28 E;  2A7Y A;  1VQ6 Q;  2KEA A;  4Z02 A;  5CIU A;  3Q1J A;  4J7F A;  5KE2 A;  1VYV A;  4MDW A;  4MML A;  4E47 A;  2OX7 A;  1D1B A;  1PC0 A;  1JJ2 P;  3BFM A;  2EYX A;  3VKI A;  5GAN g;  1WHL A;  2Y4X A;  3QO3 A;  5GAN f;  2KNB B;  1VQN A;  3JB9 I;  4QKU A;  1AWJ A;  2PUO B;  3OYG A;  4XAX B;  3VRZ A;  1TH7 A;  4C92 E;  2KAF A;  1WIE A;  2JMC A;  4LDY A;  1B7T A;  2PTK A;  2QK0 A;  4E2F B;  1UUE A;  2E5Q A;  4Q5W A;  2O31 A;  3MCA B;  1T0J A;  1VQ9 Q;  2RJF A;  2A36 A;  4JUV A;  2LX9 A;  1NJI U;  1K4U S;  2L89 A;  3CCQ A;  3NHN A;  3E1S A;  2O9V A;  2FO0 A;  5LJ5 f;  4J9B A;  3QII A;  5LJ5 j;  1W2B A;  5CK9 A;  2RQR A;  2R5M A;  5GMK i;  1KK7 A;  2E12 A;  5LJ5 e;  2DER A;  3CME T;  1OEB A;  1JB0 E;  4F04 B;  4YTL A;  1AT1 B;  4EMK C;  1PHT A;  2NLU A;  5CKF A;  3H0I A;  3RUX A;  8AT1 B;  4LNP A;  3ZFJ A;  1JEG A;  1UEB A;  2YUP A;  2XDD A;  3E9G A;  1LCK A;  2DA9 A;  1NJI C;  2K2M A;  1MNE A;  3CCL Q;  2GFU A;  4FW2 A;  3T9N A;  3MET A;  3RBB B;  2MYS A;  2ATC B;  3CCR A;  3J81 E;  2DXC A;  3A8G B;  1QCF A;  4KGZ B;  3L2U A;  5GAO m;  1UGV A;  4Z8A A;  5I21 A;  2CS7 A;  4XU2 A;  4M77 E;  2K5L A;  3CCM T;  2RHZ A;  1NM7 A;  4L59 A;  1ABQ A;  1P92 A;  2LZ6 B;  1RAG B;  1MMD A;  1UFF A;  1QVP A;  3C95 A;  5GAN 7;  1NYG A;  2K5F A;  4DQ2 A;  3V8L A;  5I2S A;  3EGD A;  4R56 A;  3H41 A;  2KI7 A;  2RI3 A;  2ZZD A;  2M16 A;  4IUP A;  1AWW A;  2VYT A;  1YIJ A;  2EQJ A;  2OTJ Q;  2CH4 A;  2QG9 B;  4RG2 A;  2B86 A;  1UDL A;  4K11 A;  2PUK B;  2M02 A;  2K2V A;  2YRV A;  1KJW A;  1VQ7 A;  1H3Z A;  1X69 A;  1G2B A;  1UHC A;  4FSX A;  4XTY A;  1PWT A;  2KRS A;  1UG1 A;  2AZS A;  3FJ5 A;  4N4I A;  2E3I A;  4BB7 A;  1C6V X;  4C92 D;  2JTE A;  2QQB A;  1OYX A;  1D0Z A;  1Y96 A;  3VUZ A;  2CP0 A;  4PNO A;  2KGT A;  3RNJ A;  2HQH A;  1JU5 C;  3VV0 A;  1GFC A;  1X27 A;  3CD6 Q;  3OYK A;  1G5V A;  3MP6 A;  1WJR A;  1A0N B;  5GAM f;  1M8V A;  2IVW A;  4M77 C;  3OMC A;  5GAM g;  3OA6 A;  7AT1 B;  4ZTF A;  4AFS C;  4HT9 A;  4M7D A;  2EW3 A;  1D09 B;  3EGD B;  1ZSG A;  1FWZ A;  2E6Z A;  4AT1 B;  4KRT A;  3L2V A;  3UT1 A;  2NUT A;  4PJO A;  5LL6 S;  1Y7X A;  1ZUU A;  1TUD A;  3HKS A;  2X4W A;  3OW2 S;  2EGA A;  2RM4 A;  3JCM f;  4A4K A;  2AT1 B;  1YCY A;  4J9D A;  4C92 A;  1GBQ A;  3JCM g;  3JB9 J;  4PJJ A;  1TWB A;  1MV3 A;  2R5A A;  2EKH A;  3CPW S;  3NMZ C;  3QUI A;  3GP8 A;  1NBE B;  1QMC A;  2GQI A;  1NJI R;  1BK2 A;  5IHI A;  2ROL A;  1RL2 A;  2HKN A;  1JJ2 A;  2CZ0 B;  5GAO l;  1BI3 A;  3U23 A;  3OBY A;  3C0C A;  2RJD A;  2EPD A;  2LX7 A;  2XG8 D;  1OPL A;  2D8J A;  3I56 A;  5FU7 B;  3PIP A;  3QBY A;  3C94 A;  1VQM A;  3X25 B;  5CR2 A;  1K8A C;  3OS5 A;  4ZGD B;  3CCE Q;  1QVG A;  1KC8 R;  4JS5 A;  4C5I A;  3CCU Q;  2O2O A;  5IT9 E;  3S6W A;  3G71 Q;  2L5Q A;  2NUZ A;  1KHC A;  3GNF B;  4J83 A;  2FPE A;  2L3Q A;  3EH1 A;  2D8H A;  3M55 A;  3TRE A;  2LNV A;  1M1K R;  1SHF A;  1YJW Q;  3OYJ A;  2DZ9 A;  4J9I A;  3P8H A;  3J80 E;  2MWO A;  4PFO A;  2P84 A;  3JCM V;  4CI0 C;  3JB9 H;  3CC7 T;  4QQ6 A;  1YN8 A;  3JAM E;  1IZ6 A;  4EMK B;  4A4G A;  2LCC A;  5KYX A;  5GAN 3;  1M4Z A;  2K9G A;  2GTO A;  1K8A R;  2H3E B;  2GTJ A;  2LQW A;  1AEY A;  3BW1 A;  4PJL A;  3OY9 A;  5GMK l;  1D1C A;  1ZSZ A;  4J6X A;  1NLP C;  4FYY B;  4FYW B;  2DEQ A;  4BDZ A;  2X9H A;  4J9F A;  2KSS A;  4ME7 A;  2VV5 A;  3FEO A;  4OMF B;  1WHK A;  4M78 F;  3LLR A;  2ZPG B;  1K9A A;  3A8L B;  1Y57 A;  4IUV A;  1LNX A;  1D3B A;  4AG2 C;  3D7S B;  3UDC A;  3QWY A;  2YWW A;  4OMP A;  3CCS A;  1U1T A;  2Y90 A;  3CPW P;  3JRZ A;  5L23 A;  4C8Q A;  2ABL A;  1RAA B;  2JMA A;  1GFD A;  2NWM A;  1BI2 A;  1RLQ C;  3PVQ A;  2DZC A;  2FZG B;  1IXD A;  3EG9 A;  1Q82 U;  1PD0 A;  2HL3 A;  1WHM A;  2QDY B;  4QVC A;  3OYA A;  4LDX A;  1D1A A;  4M7A F;  1NLO C;  2X4Y A;  4M7D G;  4M7A B;  4QQG A;  1XQH A;  3JCM d;  4MZP A;  3CCQ T;  2J05 A;  2CP2 A;  1QP3 A;  3BDU A;  5I2M A;  4PJO G;  3DLL A;  2VAS A;  2QGF B;  2RK1 A;  3CXC A;  1M2V A;  3REB B;  4JZ3 A;  2XID A;  3MHX A;  2YLC A;  3KUF A;  4ZTJ A;  2J7I A;  4CRI A;  3CCE T;  4LDU A;  1Y71 A;  3I5R A;  1B34 A;  1SPK A;  2CZ6 B;  1VQN T;  4QQD A;  5GAM d;  2RJE A;  3EG3 A;  1KQS S;  4KUD K;  3OSS C;  1Q81 R;  3BY7 A;  4A4F A;  1N27 A;  1LJO A;  4PL6 A;  1I4K 1;  1VQO T;  3IQL A;  3VS2 A;  1K0X A;  5GAO q;  1M1K U;  2C0O A;  3VS0 A;  4B9W A;  1IGU A;  2KMT A;  1Z9Z A;  1Q82 R;  3M0Q A;  2E1H A;  3OYF A;  1TSF A;  2E3H A;  2K3X A;  2CH4 W;  4KH1 B;  4A54 A;  3A5Z B;  4TVR A;  2KRN A;  1CKA A;  1B07 A;  1Y0M A;  2EQI A;  2QQ9 A;  5GAO r;  1QWF A;  4M4Z A;  4AMC A;  4NOY A;  1BYM A;  5HKC A;  4BY6 B;  1Q81 C;  2XK0 A;  3CC2 T;  2DRM A;  1AWX A;  3M4Y A;  2PVG B;  3CQT A;  3QKJ A;  2DKG A;  4PK4 A;  4F7U F;  1M9S A;  1GCQ A;  2G3R A;  5J26 A;  2GGR A;  1WFW A;  2RI5 A;  4KH0 B;  1I1J A;  3ZBD A;  2LJ3 A;  1WXU A;  2O9S A;  2JN0 A;  3CD6 T;  1TUC A;  3RMS A;  3JCM J;  1AOJ A;  2AK5 A;  3CEY A;  1KFZ A;  4BY6 C;  2EYZ A;  1G3Y A;  3M0U A;  1H8K A;  4M7D D;  4F7U E;  3I56 Q;  1X6B A;  1X2K A;  4XQ3 A;  1LPL A;  4C92 C;  4QVD A;  1WGS A;  2CYZ B;  3CCV A;  4ELY C;  1F1B B;  3TSZ A;  4FYX B;  3OQ5 A;  4OB2 B;  1PRM C;  1WXB A;  1VQK Q;  2X3X D;  1ZA1 B;  4FYV B;  2HAX A;  4E7S A;  5IH2 A;  3CME Q;  4M7D B;  1YJ9 Q;  4RG8 A;  5AYF A;  1PKT A;  1RUW A;  5GMK m;  2HQE A;  1W4S A;  3REA B;  3CC2 Q;  2F5K A;  1BCM A;  5A0L A;  5IXF A;  4J8O A;  2KXD A;  5GAO n;  5KYU B;  4X1V A;  2H3J A;  2GF7 A;  1JO8 A;  3VS7 A;  5FRM A;  1Q86 U;  2EQU A;  2MMP A;  4BI4 A;  2E64 A;  1W1F A;  3PT9 A;  2NUT B;  5LJ3 h;  2RQV A;  3EGX B;  3MP1 A;  1VQ8 A;  1E7O A;  2DNU A;  1K0S A;  4RTT A;  2OAU A;  2DJQ A;  1W70 A;  3EFR A;  3RIR A;  4M7A E;  3TQ7 P;  1YIT T;  2BE7 D;  2JOY A;  4XTU A;  2J06 A;  2CP5 A;  5CVI A;  2LQK A;  1KQ1 A;  2KK4 A;  2M1H A;  2F5T X;  4FW1 A;  1SSH A;  2L8D A;  4OF1 A;  2DX1 A;  4ZGE B;  2LQN A;  3QYG B;  1JXO A;  4HT8 A;  2F69 A;  3H0F A;  4ANJ A;  4ATO A;  4DOW A;  3SWN A;  5KH6 A;  2IG0 A;  1VQP Q;  1PSF A;  2QGG A;  5KYW B;  1Q7Y U;  4RKU E;  4F17 A;  1RAB B;  2LRQ A;  4RTY A;  2GCX A;  1M3C A;  2RD1 A;  2DXB A;  4OGE A;  1WPY A;  4X9C A;  4ZN1 A;  1SRL A;  1WHH A;  2DTI A;  4OB0 B;  1N9R A;  4C0F A;  4M78 G;  3S3O A;  5IXB A;  1XJW B;  4X9D A;  1BIA A;  5DLO A;  2OTJ T;  2I2L A;  4DEX A;  1TU0 B;  2LT1 A;  3EHQ A;  2DO3 A;  2K3Y A;  4CC3 A;  3L2R A;  1T3L A;  4M78 D;  4DBF A;  3G4S Q;  1R0C B;  4L6V 5;  1B3Q A;  1ABO A;  2JTF A;  2C0T A;  2D1X A;  5CO7 A;  5HY6 A;  1FYN A;  2KT8 A;  4QW2 A;  3CCL T;  3CCS T;  2BIV A;  4IUQ A;  3SWN B;  3QJ6 A;  1MMA A;  4CC2 A;  1G3S A;  4C0D C;  1JJ2 S;  1UEC A;  4HXJ A;  2R58 A;  2CP3 A;  1T0H A;  3CCV Q;  2YUN A;  4ORZ A;  4M7A C;  1S1N A;  2NUP B;  2DF6 A;  2D9T A;  3UWN A;  5FRO A;  2EJG A;  4IUR A;  1W2B S;  1LOJ A;  2FYK A;  4M7A D;  2VKN A;  1QW1 A;  5J3B A;  4RMO A;  3HSB A;  2P0Q A;  1PG5 B;  4XTW A;  4IUU A;  2VXE A;  1QVF A;  3OW2 A;  2EWN A;  3CC7 A;  3GLX A;  1Q86 R;  3ER0 A;  2DET A;  3OYM A;  4M78 B;  3QXE B;  2L3R A;  1VQ4 A;  3CC4 Q;  1YI2 A;  3NFC A;  2E4H A;  1PD1 A;  4LUD A;  1BKB A;  4M78 C;  5D7U A;  3JCM c;  2V26 A;  5CKE A;  5ECA A;  2ED1 A;  3L2Z A;  5CKD A;  5KYY A;  5L8R E;  4KGX B;  1ZX6 A;  1YWP A;  2RQU A;  4OB3 B;  1PRL C;  2M0Y A;  4RTZ A;  4FU6 A;  2QEX T;  1RAF B;  4JLG A;  1Q95 G;  1YHQ A;  3CXC S;  3DB3 A;  4E7J A;  4XTZ A;  3LYI A;  4IKF A;  1M1G A;  2QYZ A;  4HA8 A;  4JPB W;  2D0Q B;  2RHI A;  4JZ4 A;  3M0R A;  3KBG A;  3OMG A;  2IIM A;  3FIF A;  4LE9 A;  3MEW A;  2BZY A;  1RLP C;  1X6O A;  2RJC A;  1R8O B;  4OMQ A;  3JCM e;  4BI3 A;  1VQP A;  3RER A;  3L42 A;  2HNI A;  1H64 1;  2XIC A;  1QVG S;  4HCK A;  1GCQ C;  2C0I A;  4JRK A;  1ZBJ A;  1YHQ T;  1C1A A;  3LH0 A;  2DL5 A;  2FVU A;  1KD1 R;  2V8J A;  4IUT A;  2EBP A;  4OMO A;  4JJC A;  1YIT A;  2QAZ A;  2DTO A;  2GBQ A;  1IGQ A;  4E6R A;  3F70 A;  5LJ5 h;  1WHG A;  2YT6 A;  2JVV A; 
#chains in the Genus database with same CATH homology
 1G83 A;  4J9F A;  3PVL A;  1K1Z A;  1K9A A;  1Y57 A;  4EIK A;  4AG2 C;  3QWY A;  4OMP A;  2RPN A;  1KIK A;  1U5S A;  5L23 A;  2HSP A;  2LJ1 A;  5FW9 A;  5GJW B;  2ABL A;  4F14 A;  2JMA A;  1GFD A;  2NWM A;  1RLQ C;  3PVQ A;  5FWC A;  4JJD A;  4RTV A;  3M0S A;  2ED0 A;  2AKK A;  2F2X A;  4GBQ A;  2JXB A;  2FPD A;  2J6F A;  3UA7 A;  1ARK A;  3H0H A;  2KRM A;  4J9C A;  1NEG A;  1NLO C;  1BB9 A;  1WYX A;  1QKW A;  1E6G A;  2I0N A;  3NGP A;  4CC7 A;  2K7A A;  1H3H A;  2K3B A;  2L3S A;  2J05 A;  4D8D A;  2E5K A;  2EYW A;  4QT7 A;  3VS3 A;  1JXM A;  1OPK A;  1NG2 A;  2AZV A;  4FSS A;  4DEY A;  1QWE A;  1M30 A;  3LH5 A;  2ENM A;  2LMJ A;  2FEI A;  3REB B;  3A98 A;  4JZ3 A;  3PE0 A;  2DL3 A;  1UJY A;  1HSQ A;  2J7I A;  4OMM A;  1V1C A;  2FRY A;  4CC4 B;  1AVZ C;  2DVJ A;  3I5R A;  4HVU A;  2F2V A;  1SPK A;  2FPF A;  2DM1 A;  2ECZ A;  4HVV A;  1GCP A;  3EG3 A;  1EFN A;  1OOT A;  2BTT A;  3EG2 A;  1W6X A;  3EHR A;  3GBQ A;  2KXC A;  1AD5 A;  2W10 A;  3IQL A;  2AKL A;  1KSW A;  5IHN A;  4RTW A;  3VS2 A;  1K0X A;  2CT4 A;  1YWO A;  1WA7 A;  2C0O A;  3VS0 A;  1YP5 A;  1Z9Z A;  2RNA A;  3M0Q A;  2K6D A;  3VS4 A;  3TSW A;  3SEM A;  1JQQ A;  2CH4 W;  2LP5 A;  5HCK A;  1AZE A;  1QLY A;  5EC7 A;  3I9Q A;  2CDT A;  2L2P A;  1IO6 A;  1UHF A;  2KRN A;  1VYT A;  1CKA A;  2L3P A;  1NEB A;  1SEM A;  2BZ8 A;  2SRC A;  2GNC A;  1B07 A;  4Z88 A;  2KEA A;  1Y0M A;  2EQI A;  1XOV A;  1QWF A;  2A37 A;  1I0C A;  3VS6 A;  4M4Z A;  1VYV A;  4F16 A;  2EYX A;  3I35 A;  2V1Q A;  2DRM A;  4RTX A;  1AWX A;  3CQT A;  2KNB B;  4ESR A;  4R0K A;  3EG0 A;  1AWJ A;  2YUO A;  2K79 A;  3EGU A;  3VRZ A;  4J9H A;  2DL8 A;  1GCQ A;  2GGR A;  1WFW A;  3KFV A;  1YCS B;  1RI9 A;  2H8H A;  1WIE A;  1I1J A;  2JMC A;  2KBT A;  2DRK A;  2JM8 A;  2LJ3 A;  1WXU A;  2RMO A;  2O9S A;  2PTK A;  2EGC A;  1HJD A;  2FG0 A;  1TUC A;  1UUE A;  1AOJ A;  2AK5 A;  5I11 A;  4LN2 A;  1KFZ A;  2O31 A;  5FWB A;  2EYZ A;  3UA6 A;  3M0U A;  1H8K A;  1X2Q A;  1T0J A;  2A36 A;  1VA7 A;  1X6B A;  1X2K A;  2HEQ A;  4RUG A;  1K4U S;  3NHN A;  2O9V A;  3UAT A;  3TSZ A;  2FO0 A;  2CUD A;  3R6N A;  2CSQ A;  2QDL A;  4J9B A;  1PRM C;  1WXB A;  2L0A A;  2RQR A;  1PNJ A;  2HBW A;  2X3X D;  2JS2 A;  4IIO A;  2KE9 A;  1N5Z A;  5IH2 A;  1OEB A;  2V1R A;  1PHT A;  1X6G A;  3H0I A;  1PKT A;  1RUW A;  2KRO A;  4LNP A;  1OV3 A;  3REA B;  1TG0 A;  3VRY A;  1NYF A;  1JEG A;  2JS0 A;  2YUP A;  1M3B A;  1LCK A;  1E6H A;  1HD3 A;  1AZG B;  2DA9 A;  5IXF A;  2K2M A;  1WXT A;  2KXD A;  1UE9 A;  4X1V A;  4AFQ C;  3RBB B;  1JO8 A;  3VS7 A;  2OAW A;  1W1F A;  1QCF A;  2RQV A;  1UGV A;  4Z8A A;  3EG1 A;  1FMK A;  1E7O A;  1WI7 A;  2DNU A;  2DMO A;  2MIO A;  2O88 A;  1K0S A;  4RTT A;  1NM7 A;  1U06 A;  2DJQ A;  1W70 A;  1ABQ A;  3M0P A;  2LZ6 B;  2J06 A;  1UFF A;  3THK A;  2PZ1 A;  1NYG A;  2A28 A;  3I5S A;  1GRI A;  2YDL A;  1SSH A;  4J9E A;  4RTU A;  3H41 A;  1ZUY A;  2DX1 A;  2RN8 A;  4HVW A;  1AWW A;  2LQN A;  1J3T A;  1JXO A;  3H0F A;  2CH4 A;  2DL4 A;  2B86 A;  1UDL A;  4K11 A;  2YSQ A;  3ZL7 C;  1MUZ A;  2DBM A;  1KJW A;  4F17 A;  2DYB A;  2JM9 A;  4RTY A;  1X69 A;  2A08 A;  1G2B A;  1M3C A;  1UHC A;  1PWT A;  2KRS A;  1UG1 A;  2AZS A;  3M0T A;  2P4R A;  3FJ5 A;  2HDA A;  1SRL A;  1VYU A;  2VVK A;  3ULR B;  2JTE A;  2HCK A;  2LJ0 A;  4D8K A;  5I22 A;  5IXB A;  2KGT A;  1BBZ A;  3RNJ A;  2PNI A;  1UJ0 A;  1JU5 C;  4LUE A;  1GFC A;  1X27 A;  1H92 A;  4DEX A;  3EHQ A;  4CC3 A;  1T3L A;  2DLP A;  4IIM A;  1B3Q A;  1ABO A;  1A0N B;  2RQW A;  2C0T A;  2D1X A;  4AFU C;  1FYN A;  3TVT A;  2KT8 A;  2JW4 A;  3UF4 A;  4CC2 A;  3SHW A;  1I07 A;  4AFS C;  2MCN A;  2CSI A;  2J6O A;  1UEC A;  2KT1 A;  4HXJ A;  2FRW A;  2EW3 A;  4OML A;  1ZLM A;  1T0H A;  2YUQ A;  2YUN A;  4ORZ A;  1ZSG A;  1S1N A;  2DF6 A;  2KYB A;  4KRT A;  4A63 B;  2MOX A;  1U3O A;  1ZUU A;  1TUD A;  2EGA A;  2BZX A;  4JJB A;  2VKN A;  1M8M A;  3QWX X;  1Z9Q A;  4J9D A;  3NPF A;  1GBQ A;  2ROT A;  2DIL A;  1SRM A;  4AFZ C;  1MV3 A;  1ZUK A;  2CRE A;  2EKH A;  2SEM A;  1WLP B;  2D0N A;  3NMZ C;  1UTI A;  3VS5 A;  2JT4 A;  2GQI A;  1BK2 A;  1BU1 A;  2ROL A;  5IHI A;  4LUD A;  2XMF A;  2CUB A;  4Z89 A;  3U23 A;  5ECA A;  3C0C A;  2ED1 A;  2EPD A;  2LX7 A;  1OPL A;  2D8J A;  1ZX6 A;  3JV3 A;  1YWP A;  2RQU A;  2J6K A;  1SHG A;  1PRL C;  2M51 A;  2X3W D;  1WDX A;  1WX6 A;  2M0Y A;  2EGE A;  4GLM A;  4RTZ A;  1T3S A;  1PKS A;  5IHK A;  2O2O A;  2DBK A;  2DE0 X;  4Y92 A;  1K76 A;  1QKX A;  2CT3 A;  2W0Z A;  1M3A A;  2NUZ A;  1GL5 A;  2RQT A;  4JPB W;  4JZ4 A;  3M0R A;  2FPE A;  1CKB A;  2L3Q A;  2IIM A;  2D8H A;  2LNH B;  2OI3 A;  4LE9 A;  2BZY A;  1RLP C;  2ESW A;  4OMQ A;  1SHF A;  1MV0 B;  1X43 A;  2DL7 A;  4J9I A;  4OMN A;  4HCK A;  4AG1 C;  1YNZ A;  2VWF A;  1GCQ C;  5GJV B;  1GBR A;  1CSK A;  2KYM A;  2C0I A;  3VS1 A;  1ZBJ A;  2G6F X;  1YN8 A;  2EVR A;  2DL5 A;  2F2W A;  3O5Z A;  2EBP A;  4J9G A;  2K9G A;  2GTO A;  2EYY A;  4ZNX A;  4OMO A;  2LQW A;  2GTJ A;  4JJC A;  2LCS A;  1AEY A;  1AWO A;  2GBQ A;  4E6R A;  2RF0 A;  2KR3 A;  4WCI A;  2YT6 A;  1NLP C;  2OJ2 A;  1M27 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...