2P5BA

The complex structure of jmjd2a and trimethylated h3k36 peptide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
347
Chain Sequence
b'ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the recognition of a methylated histone tail by JMJD2A.
pubmed doi rcsb
molecule keywords JmjC domain-containing histone demethylation protein 3A
source organism Homo sapiens
molecule tags Metal binding protein
total genus 103
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2p5bA01
4QU1A 5F2WA 5F3GA 3KV5A 5FYZA 4EZ4A 2XXZA 5FY1A 5FY8A 5F37A 5CEHA 5A7PA 5FYIA 4LXLA 5FZ8A 4HONA 4QXHA 5FZOA 5FV3A 5LY1A 5FZFA 5LWBA 4CSWA 2YBKA 5FZGA 5LW9A 3PU8A 2XUEA 5FP8A 5FZIA 4LIVA 4Y33A 5E6HA 3U4SA 2YU2A 5F5CA 4BU2A 2YU1A 5FPBA 5FZLA 5IVFA 3KV6A 4GD4A 3KV9A 3UYJA 4LIUA 3K3OA 3PTRB 3N9LA 3PURA 5FYCA 5FZAA 5F3CA 5FXZA 3N9QA 2WWJA 4QXBA 5FZDA 3PUSA 2YBPA 5FPLA 4CCJA 2VD7A 5F2SA 4GJZA 5FZ1A 5FY7A 3U78A 5F3IA 5FXXA 2Q8CA 4BISA 5FP4A 4URAA 3AL5A 5FZ4A 4QX7A 5IVVA 4BXFA 4CUGA 4CCOA 1VRBA 5A7WB 5A7WA 2GP3A 3NJYA 4IGQA 5FP9A 5FZKA 4EZHA 2OX0A 2XDVA 3PU3A 5A1LA 5FYTA 3AL6A 5FXVA 4ASKA 3AVSA 5FY9A 5FZ9A 4D6QA 5FPUA 4AAPA 4IGOA 5IVJA 5IVCA 3LDBA 4QWNA 5IVEA 3N9OA 2OT7A 5FZBA 5FZCA 4UF0B 4UF0A 4GAZA 5F5IA 3N9MA 2XMLA 5FUNA 5FYVA 3N9NA 5FYBA 5A7QA 4QX8A 5F3EA 5FZ0A 5FY5A 5K4LA 4V2VA 4EYUA 2P5BA 3K2OA 5FZ7A 3N9PA 3ZPOA 5A3TA 4V2WA 5FY0A 5A3NA 4CCNA 3KVAA 5FZEA 3PDQA 4QXCA 3ZLIA 4CCMA 5FYUA 3PUAA 4C8DA 4D6RA 4NUBA 5FJKA 2W2IA 3LD8A 4CCKA 4GJYA 4E4HA 5F39A 5FWEA 2Q8EA 2YBSA 5FJHA 5FYHA 4XDPA 5FXWA 5FZHA 5FYYA 4CCLA 5FYMA 3KVBA 2OQ7A 5FPVA 2OQ6A 3OPTA 5A3PA 5A7OA 3PUQA 4HOOA 5IWFA 4D6SA 5A1FA 3KV4A 5F32A 5FZOB 4TN7A 3K3NA 3OPWA 5IVBA 5IW0A 4LITA 4DIQA 5IVYA 5FPAA 5FZ6A 3RVHA 2PXJA 4DO0A 2GP5A 3AVRA 4Y3OA 5KR7A 5A7SA 5FWJA 3DXTA 4IGPA 5A80A 5LY2A 5FP3A 2OS2A 5FY4A 5FBJA 2Q8DA 2WWUA 2YPDA 5FUPA 5FP7A 5FYSA 5F5AA 5A7NA 3DXUA 4Y4RA 5ANQA 4AI9A 5FZ3A 5A3WA 5FZMA 5ISLA 4XDOA
chains in the Genus database with same CATH superfamily
3ITQA 4CEWC 1VBA3 4I0BA 1JYCA 3IN9A 4DZGA 1C5IA 4DY5A 5FYZA 1JYVA 4AK3A 4DINB 1YQ8A 1OLQA 4XZUG 5CZKA 2G9FA 1NKGA 1QQP2 3U37A 4QQLA 2WQ8A 4XFCA 5IATA 2O1QA 2WNEA 1S0EA 2R063 1FYUA 3W9AA 1BYHA 1AJKA 2WSUA 1H1AA 1R082 3I2IA 4HPKA 4FTEA 1CZSA 2ZA9A 3WDTA 2K0GA 2LW8A 3NAPC 5JOWA 1PZ9A 4YW2A 1RINA 4Y33A 4JKMA 1GQPA 3JQWA 2L9LA 4BU2A 1JZ7A 1VB4A 2Y6JA 4B3NA 3ACIA 4C0HA 1JN2P 2EIGA 5KXCA 1ENQA 3NJZA 3BUCA 3UJQA 4IEPA 2DFCA 3P3NA 1RUH2 1TQ5A 3N9QA 3NV4A 3ZXJA 3ZN5A 2XB6C 2GC1A 2XR4A 1EAH1 2ZKLA 5FY7A 3S7EA 3U78A 4FPHA 1JZ2A 3KCXA 3VKNA 1X33A 4YM3A 2Y26A 1SDWA 3GYDA 4XEZA 2ZGSA 1VBA2 2C9AA 1VRBA 1QQP1 2HKXA 5BNQA 4AEJA 5A1LA 4HKOA 1XB9A 4M01A 3S6PA 4WZCA 1I1EA 1R081 3CZUA 4RS5B 2R062 4COUA 2YC4A 3IDAA 3O1OA 3JXSA 4P9JA 4ARYA 5JXHA 3L9JT 2ZX4A 4Z92B 1IKQA 4QPIB 4XFFA 1W6QB 2OW4A 2V4VA 5FR3A 4L99A 4XXPA 4EN9B 2DURA 1K42A 3EXUA 4NHKA 5F3EA 1H8VA 2DFBA 4LE3A 1REEA 1NCQA 1RUH1 4V2VA 2NM1A 4IE7A 1VAKA 3POBA 3S0MA 3WNOA 1YWKA 1DQ6A 4XQ4A 2FMDA 3M2MA 2RG4A 2GN7A 3CU7A 3GXUA 2DBIA 2BW8A 3ZXDA 3BU7A 1SEFA 2WT1A 3GDBA 4XTPA 2WR9A 4CCMA 2BJSA 3T1MA 4LBKA 1HLCA 5FO9B 1VBA1 5FYUA 3H8RA 3P1IA 1XNDA 3KCCA 5DAXA 3WP5A 5EZWA 3UGGA 2QUOA 1H1MA 3BCWA 2CAVA 5BV6A 1SFPA 5FXWA 4QX5A 4UW3A 2R061 3AFGA 1LHVA 2ZX0A 3GF6A 2ZX1A 5A3PA 2R0HA 4ZKTB 3LDKA 4FFIA 3VD7A 1Z0HA 3PTYA 4QAWA 1RC6A 5A1FA 1YC61 4GQ7A 4RGKA 4IETA 3A7QA 2VZUA 1LHUA 5C5TA 5J36A 1BBT3 3AVRA 1N3OA 3KD4A 4KMQA 4A3ZA 3DXTA 3T09A 3LSDA 2D5HA 3NQHA 2VGDA 1A8MA 2QNKA 2WWUA 3HBZA 3S7IA 2VOWA 1W03A 2RHPA 5A7NA 1GKBA 1O5LA 3I2GA 2W3JA 3LA7A 5GZCA 2VZTA 2C9KA 1G8WA 1H9WA 5J3UA 4LBOA 3AKTA 4AZZA 3BVCA 2VUDA 1MZ6A 2XWJB 2FDFA 1YXWA 4UW4A 5CEHA 4GULA 4Q4W3 4A7YA 3ROUA 2JEMA 3WUDA 3WY6A 4HONA 3WP4A 1LGBA 1Y9GA 1WLDA 1KEXA 4FCAA 3BTZA 3EQEA 4S2HA 3BPSA 5L7OC 4QDRA 4KG0A 4Y1ZA 1TMF3 3ES4A 3SCFA 4QHOA 1UYYA 1XSRA 5FZLA 1H8TA 1W8WA 2WZR3 4GD4A 5FKBA 3RSJA 3UYJA 2XOMA 1AYM2 4LBQB 1R1A2 1PGL2 2VBPA 3AP6A 1XNKA 3RJ2X 1FNYA 3OTFA 3QLQA 3SC7X 5LBCA 2ZPXA 2ZAHA 5FPLA 2WSVA 1W6NA 2Y0IA 2WT0A 2BRTA 3PVNA 4LLOA 3W20A 4IV3C 5GLWA 1OVSA 2WDBA 2VZPA 5IVVA 1DDLA 5FK8A 1AR92 5CAZA 1C1FA 4NPLA 1WBLA 2XDVA 4LA3A 2ZGOA 1MZEA 3AL6A 1GMMA 2IWGB 5D1IA 5ABJB 4NROA 4IE6A 4Q4W2 4LKFA 2PA7A 5ABJA 3O1UA 1S0JA 1ND3C 1ZVFA 2ARAA 4UF0B 2JENA 3LB9A 4XF3A 4UF0A 4XF4A 3WSOA 3HVDA 2JIGA 2XG3A 1TMF2 5FUNA 2ZEWA 1AYM1 1N47A 1R1A1 5DZGA 4JV4A 3KT4A 5FZ0A 1PGL1 1POV0 4CRQA 4LEJA 1G9FA 1NQDA 2DCKA 2WZR2 3RZLA 5FBZA 2J1AA 3THTA 2C5DA 1GWLA 1QJEA 1ULEA 5SV8A 4Q0QA 1QDCA 3HQUA 4LPLA 1XE0A 1F2NA 4Q0VA 4WM8A 4XUQA 5LZ6A 2VZ1A 4SBVA 5LK5A 1K3IA 1AR91 4R9DA 2RS52 3KQ4B 2R073 3O0WA 4Z8BA 2YC0A 3UJOA 4F3JA 4LHNA 3ZYBA 4YGCA 5CVRA 3OEAA 5JOZA 2V73A 1W8OA 4XFGA 1IG3A 1PNFA 4NN0A 1VBE1 2IXIA 4RFT0 5A7OA 2CNAA 2Q1FA 2RMU2 4IE5A 1LAJA 4FPOB 4CDUB 5F9TA 4PDWB 4CDUA 1TMF1 2R30A 1OOPC 3ZN4A 3MDPA 2KR2A 4NIAA 4QX0A 3R0RA 1PM4A 5H9SA 1DGWA 3LIHA 1IGOA 3LFIA 2WZR1 4JGYA 2ZKNA 3HT1A 4Y1VA 5C5UA 3H7YA 4UAPA 4FBFA 4IGPA 3OEBA 3OUJA 1PO23 4YYOA 4N9HA 1O4YA 2J7MA 1SBFA 5JZGC 4MXWA 1F31A 2QQUA 2VQTA 5T5PA 3THCA 3OYWA 4RR3C 2D3PA 4OYUA 1D4M2 2RS51 1XXNA 2E51A 1FNZA 3H0OA 1XE7A 2ZZQA 2WO2A 1AXZA 1WMXA 5K8SA 3UNPA 3JZVA 4LK7A 5DDJ3 1GR3A 5IK4A 1KDKA 1PVC3 2BYVE 4MZUA 5GJ6A 2VCBA 2RMU1 4Q29A 4FPYA 4AXOA 3RDIA 3HOBA 5FZGA 2VMHA 1W6MB 4NJ4A 4YLZA 5I0RA 1W6MA 4PIZA 3GJAA 4IEYA 5FMDA 3WQ7A 4FQ4A 4PT6A 3ZYRA 2D97A 3VZMA 3WT3A 4QPGA 1V6MA 3Q8FA 5FYCA 4E9KA 1VLNA 4QGMA 2G19A 1PO22 1RJ7A 3FUQA 1OD3A 2JE7A 4XAEA 2EVXA 1D4M1 2VD7A 2X29A 5FZ1A 1OLRA 4LO8A 2OUJA 3RZKA 1PHMA 3DEMA 3CBNA 2R0FA 4N43A 4P9YA 3H8UA 4DPNA 3IIAA 1ZZ8A 3B01A 2VZRA 4XZPA 3U0ZA 1LHOA 5FY9A 1DYOA 1JHNA 1IPKA 1QNWA 2DVBA 3MIGA 4AQ2A 2UWAA 4MUVA 3U07A 5FZCA 1PO13 1RL3A 2IXKA 1ZRDA 3QH6A 3AMNA 2DCZA 3BOWA 1P8JA 3WOGA 1QWRA 4NMIA 1O91A 1UWWA 1N1VA 4N8MA 1QIQA 5DG1A 5GZGA 4BYYA 3ELNA 4RQPB 1GQGA 1W6OA 3SHRA 1DGRA 4RQPA 5BNOB 2QZ2A 1NA1C 3FWEA 1UPSA 2Y34A 1PO21 2IXLA 3C7EA 3OGGA 4AW7A 3CJXA 1O3RA 3WHTA 3ZFGC 2ZX3A 4E8CA 3CMGA 1PMHX 4JHZA 4JQRA 4AI2A 1LODA 1KQRA 3I2OA 4QDQA 2E9QA 3AP5A 3KVAA 3I3MA 4CDQC 4BQ1A 1LJ7A 2FDIA 3C8XA 3AMHA 3F95A 2XBO3 4J6GA 4IE0A 4CDWC 2IFRA 2WLQA 4JVAA 4AG4A 3WINE 3BALA 4CDXC 3VBOC 1SLLA 3FHIB 1QH6A 2W39A 2Q8EA 1SPPB 1DQ4A 4N53A 3OUIA 1SPPA 2JDMA 3HMYA 5L9VA 1PGSA 1YQ5A 4QGNA 2GC2A 4LLFA 1UU5A 4KG8A 5F8PA 1N3QA 2ZTNA 3VBUB 3PUQA 3T0AA 1ULCA 3VBUA 3VZKA 4A7KA 2VUAA 2GU9A 2YPJA 2YV8A 3FHAA 3H7JA 1NCRA 3WDYA 4XJUA 4KNCA 2R49A 1PO12 3ZXFA 4OVEA 4U2AA 3DV8A 2JD4A 1LB2A 1V0AA 1H6YA 4DXSA 1MS8A 3KGLA 4TXWA 1VE0A 1RMU3 5L9BA 4XE9A 4MG2A 1MACA 4IW3A 3DYOA 2ARCA 5FUPA 2VCMA 2RR13 3O1SA 2JG8C 1C8M2 2B4KA 3VV1A 3UGHA 5ACA2 1PM7A 1DIWA 4NOTA 5IT6A 2VW1A 5DZEA 3BKZA 3ILFA 4BLJA 2E53A 4CEWB 4DRRA 5M0TA 1DCSA 2W46A 3K51A 4XUOA 1W05A 2LALA 3FHQA 3RQ0A 2DYCA 1Q8VA 1A78A 5LRRA 2XBO2 1IHMA 2XLFA 5A7PA 3KHCA 5EWSA 1D2SA 1GP6A 4QXHA 1ODNA 2HWC3 4YNIA 1FAYA 1PK6C 1V6LA 2WAOA 4N9IA 3U11A 1F5JA 4JZRA 2XQRA 1AR73 3ACHA 3C2UA 3ZSLA 3OPZA 1O5UA 3J8F1 1TME3 1PO11 3NAPB 4GWNA 4OI2A 1GYKA 1OKOA 1X9PA 3R4DB 2RM22 3WG1A 3ETQA 4CUBA 2VCAA 5D2AA 1LOEA 5FMOS 5TSWA 4MX3A 1U5YA 1IQAA 5F3CA 2ET1A 1C8M1 1RMU2 2DVAA 2WWJA 4XFAA 4QXBA 5ACA1 2BERA 5IHRA 4AGRA 2RR12 3ZYIB 5F2SA 1WMFA 1W6PA 1N1YA 1T6GC 2D3SA 5FP4A 1HRV3 1SFNA 3IAPA 5I8SA 5HV0A 3NRUA 3A4UA 1QY4A 1IPJA 3VBFC 3VLBB 3I3QA 4E4ZA 4CUGA 3VL8A 2XBO1 1APNA 5J1XA 3WF1A 3JB8A 4IGQA 1WUVA 3WG2A 4EZHA 1WCSA 2VTXA 2XWBB 4KU8A 1L7LA 1ULOA 5I93A 2OXBA 2UY9A 2VOXA 3WF3A 2CWMA 3L2YA 3W58A 2DVDA 2HWC2 4QWNA 5I0DA 1C3HA 4Q4X2 2RDNA 1E57A 3UKNA 1AR72 4AOCA 4LOSA 3JBG3 2RM21 2YROA 1S0CA 5F5IA 4Q4V2 5JI7A 3KCYA 4DEVA 3VD4A 1UAIA 4K20A 2F4PA 2D6MA 4LHSA 4HVRA 4R9BA 1QU0A 1WA6X 2X09A 2QCSB 2BPA2 4DXRA 2JDAA 2V09A 3LEIA 2AC1A 2BOJA 1YCIA 2VQUA 3AMPA 4LR4A 1C57A 2RR11 3O12A 4YGEA 3VD5A 2XGXA 1V6IA 4IEQA 3ZMOA 1RTVA 2AZ5A 4XYXA 5T5JA 5CFDB 1FPN3 5CFDA 1ZA4A 1BVP1 4NAMA 1W9SA 1OA2A 1S0FA 2PHTA 1TG7A 3RPQA 4DY3A 3O1TA 2Y60A 4OI4A 1ENXA 1OFNA 5FJKA 3RYPA 2EIEA 3POFA 2WN2A 5F6LB 1GV9A 3R05A 3OJBA 1PIV3 4XDPA 1JZ3A 5FZHA 4AFDA 2HWC1 4BMEA 4COYA 3C7HA 2YXSA 2PHXA 4FQZA 1UYZA 4Q4X1 1AR71 4HANA 1O3TA 3E6BA 4FOQA 4HN0A 3AZXA 3A0NA 3C7OA 4OZOA 3PHMA 3ENRA 2WKKA 4JTOA 4Q4V1 4M3CE 2DV9A 2O14A 1VP6A 4NIDA 5IVYA 1YLLA 3WDUA 1U5IA 3JBG2 1GU3A 2DWRA 2Y6LA 5EYXA 2BBAA 5AFBA 4DO0A 5BNPB 1FX5A 5BNPA 2BZDA 3HN3A 2ZZJA 4HETA 1AL22 2IFWA 2XH6A 3GJBA 3OBTA 1X82A 2OS2A 4LQRA 5EV7A 3BU0A 1CAXB 4IXLA 1CAXA 2GNMA 3D6EA 2VQAA 4RFRB 4NO4A 2JECA 3D8CA 1GBGA 1W0NA 1O8SA 4QX3A 2Z42A 2QJVA 3HT2A 2H0BA 5HCBA 2JWPA 1ULDA 2WNOA 1FPN2 4A41A 5E88A 2IXHA 1JUHA 4B7KA 1C28A 3IT8A 1US2A 4AFBA 1G7YA 5FYIA 1GANA 2G9ZA 5FZOA 1AYN3 4I3PA 4A6SA 4Q0UA 4JGZC 2NN8A 3A22A 2GAUA 2ORXA 1UL9A 3KLSA 5EHDA 1W3VA 1RGSA 4W6WA 2J1UA 3BYWA 3WP6A 5G05L 4XTMA 1XOYA 1KJLA 2GZWA 3U4SA 1FI2A 2D5FA 3RGBA 1AL21 3PTRB 2WT2A 2ZGUA 3H1YA 1GNHA 3O1VA 4OCTA 2IVIB 4CEYA 1SHWB 3NNLA 2W95A 1Z7S2 5FZAA 4YZ4A 2BVVA 4RGAA 4G3YC 1S55A 4LHLA 1YQ6A 4BISA 1FPN1 2VE1A 3IDCB 4IV3B 3AL5A 5LATA 4ZS2A 1L7QA 1QXRA 1WCKA 2QQKA 2XJRA 2ZCWA 3BOPA 3VL9A 3WQ1A 3LQCA 1UKRA 1W28A 4HK9A 1WBFA 2HEWF 2TBVA 1NQJA 3PU3A 1KFUL 1B35C 1MS4A 1LOCA 3OBRA 5LEKA 1HIXA 4YM2A 3WF0A 1LOAA 2VZVA 2WNUC 2J1RA 4XDQA 1POQA 1QF3A 1TE1B 1UO9A 4K40A 2GC3A 3T2QA 1CIWA 2B9VA 1ZBE2 3CNAA 5JMOA 4MGTA 1UU6A 1ND3B 2WAAA 1HQWA 2W47A 3HNMA 1QMJA 3V0AA 4OQ8A 4I0WB 1IPSA 2HEVF 4META 2CV6A 4UT5A 4CU7A 4PF1A 5A7QA 3E5QA 5K4LA 5HCHA 1RXFA 3MI8A 1GZWB 1CJDA 1Z7S1 2A3XA 4FO9A 4FP2A 3MLKA 2X5IC 3ZPOA 4GMP0 2JXAA 2NP0A 1CPNA 3AX4A 3LF7A 3T08A 4IDZA 4CXXA 4ATFA 4NHMA 3ON7A 1CD3G 2P3IA 4WZFA 4CUAA 5DXDA 1OPOA 1QJX3 3CF6E 5CKNA 1DGRN 2W2IA 2NYYA 2YHJA 4AEDC 2JJ6A 1S0GA 4NWWA 2SLIA 2ZHKA 3ACLA 1AX0A 4YVWA 5CFCC 3ZFFC 3D82A 3EJKA 4P14A 1ZBE1 2BWCA 1DBNA 3I2JA 2H6BA 1Q8PA 4AHWA 3P3PA 3BI3A 1R1ZA 1HB4A 2QQNA 3IMMA 4AI8A 4YZ5A 3VBHC 4XJWA 5D8AC 3FLTA 2WYSA 1OOPB 3B9IA 4PBOA 2P3KA 4WVVA 5FLIA 4KU7A 4S2GA 4FFHA 3O5SA 2VNRA 1Q8SA 1Q56A 2YYOA 1SFYA 5KR7A 2ZHMA 3KWVA 4DS0A 5CNAA 2Y0OA 3D5OA 2ATFA 5C70A 2GMMA 4QX2A 5JZGB 3I97A 2QVSB 3U10A 4KGGA 2FCUA 5J7MA 5FZMA 2XLAA 5D21A 2QQIA 4YVSA 2VBBA 4MXVA 1DQ1A 5C3RA 2BOIA 3HPNA 1LECA 2JKBA 3WUCA 4DXTA 1PNGA 3MV01 4JTNA 1SG3A 1QJX2 4AWDA 4LHKA 3MICA 1BJQA 2E33A 4XABA 2HWE3 5GZDA 3KHBA 3POSA 1KDMA 4YFWA 2UWCA 1UIKA 5H9PA 4YG0A 1X9TA 2DU1A 4ZXEA 3M1HA 3NNGA 4CSWA 3BTYA 2EIBA 4UXAA 3VUOA 1RUH3 2WFF1 2DBNA 4H2AA 4XJAA 1X50A 5KHJA 1VBB2 1O59A 3VKOA 3KV6A 2R041 2A1XA 2CDPA 3N9LA 4BQ2A 2ZGNA 1MQTC 5JDBA 4IEVA 4E2GA 4QPWA 3GZEA 5FZDA 2YBPA 4E4DX 3L2HA 2TEPA 3O1MA 2C4XA 2JE8A 3ZSMA 2WQ4A 5FOBB 2PN5A 1YHFA 1RUJ2 3JD73 5JMCA 2XONA 2Y8KA 4FPGA 4OZXA 1QJX1 2JDKA 4Q26A 4YWAA 5K0UC 1RITA 1SDDB 3RNSA 3NJYA 4XQDA 1UY0A 2A6YA 5FYTA 1F5FA 4FAGA 1OQ1A 4CYDA 1SBEA 5IVJA 2HWE2 3PNAA 3RRDA 1M4WA 1WLWA 2QDNA 2XUMA 4AI1A 3GBWA 4Y4YA 2B5HA 5GLZA 4LOTA 3VKLA 4BQ5A 4DQAA 5JSRA 4AFCA 1VBB1 1A6CA 2R6QA 3BPZA 1OUSA 4PF5A 2EF6A 4Q0PA 4Y1UA 4O9EA 2QQOA 1CONA 2VZSA 4P5YA 4R9AA 4RGGA 1NA1B 1DYKA 2ZHNA 3LSEA 3LWCA 3IB3A 4MHRA 2Z79A 5JXJA 3UKTA 1NYWA 1EUTA 1TVGA 4Y5Z0 1A8DA 1SLCA 1K5MC 2C26A 3D0SA 3ZFGB 4OHXA 2KA3A 3O1RA 1E5SA 2OIIA 4ATEA 4ZZ5A 3QH7A 1AR63 1LOGA 1RUJ1 4GH4C 4ZU5A 1MZFA 2ZGTA 3J4UH 4EQVA 3B02A 4GWIA 2CTVA 1LU1A 3FUOA 1JOBA 1X7NA 3ZO0B 2W9XA 1D7PM 4XJ9A 3JD72 4FFFA 3ZSKA 4ZU7A 2ETEA 2VAUA 1I5ZA 4KH9A 4JQTA 1MS0A 5HBAA 2I2SA 5FPXA 4RS5A 1PZ8A 4IV1C 3VBOB 3ZDVA 4P9XA 1Q3EA 4HVQA 1G9CA 4V1PA 2HWE1 3OGVA 5B4NA 2HBTA 4QPIA 1W6QA 1RUC1 4EN8B 3MIFA 4LKDA 4D6SA 4XMIA 1AHSA 2B45X 2DTYA 4TSVA 2Y6FA 2PMWB 3LA2A 5LBFA 4OUMA 3SCHA 2E63A 1XBFA 1J3RA 2XKOA 3S5AA 3AFKA 2PAMA 5KHKA 2D44A 1URXA 4FTSA 4RHV2 3ZYJB 4RL7A 2PXJA 2O8OA 4HSLA 1UCXA 5E1RA 4CXWA 5A7SA 5IUQA 5FWJA 3H3LA 4GXLA 4HG6B 1NG0A 2CWSA 1UIJA 1ULFA 5FY4A 3KZ4C 4GZ9A 4D7YA 2JG8B 5C6CA 5ANQA 3PLQA 2V5DA 4H55A 4ZHNA 3THDA 3ZYPA 3Q8CA 1ZZ6A 5FZFA 4UFHA 2WZPP 1AR62 1YEWA 3JD71 5JAXA 1LGNA 1U0AA 1VBD3 1A3KA 4DFSA 1N1SA 1NZCA 3DN7A 4COWA 4C1WA 1NE6A 2XQXA 4N7UA 5AVPA 2RS33 3ECQA 2D6NA 2D43A 4IEWA 3PUHA 5J09A 4ET7A 1PK6B 5KHHA 2QQVA 1AYM3 1R1A3 2YBKA 4Q27A 1S2EA 4MADA 3URFA 2W1QA 4BZ4A 2E7QA 1VAMA 3LFMA 4PI2A 4RHV1 5E6HA 2P17A 2YU2A 3NKTA 2YU1A 3WP3A 5IYYA 1DGLA 3PJYA 1JW6A 4AFAA 5LK7B 1WMEA 3ZXEA 5G04L 3WNLA 1RHI2 2NQYA 2Y64A 1AR93 5JSPA 3WHUA 1RJ8A 2D98A 3AJYA 2KXLA 1S0DA 5DAPA 1W2AX 1AR61 2QE3A 4IERA 3MBWA 4Q8LA 5JSOA 1OKQA 4AYUA 3ZYGA 1CWPA 4OHYA 3WVJA 5GALA 3IM0A 1QJFA 3VBFB 2ARBA 4FOWA 3SXWA 4LBQD 1VBE3 3V0BB 2A3YA 2GP3A 4P08A 2OX0A 1VBD2 3HIFA 4B1LA 1UW8A 1IKPA 4CA9A 2RS32 1JBCA 3RI8A 5F1RA 5FO8B 4TLGA 1DQ0A 4Z2WA 4C0BA 5HCFA 1R64A 2VUCA 4Y1YA 2GN3A 4LBQA 1QJZA 1UZVA 4JDMA 2K46A 4AF9A 2A71A 2A73B 2W1UA 2W68A 2XJTA 2JX9A 3VBRC 2QFEA 3IPVB 4C91A 5C3QA 1WZXA 1RHI1 1YO8A 5T55A 2W08A 2JB4A 2RS53 3VDDC 2G4IA 4JX0A 3TEZA 2Q1MA 4EWEA 5F6KA 1AJOA 2ILMA 3IDEA 2QQMA 3AXEA 4I02A 2AENA 4D7TA 4CCNA 1UMIA 2V4AA 1WKYA 3CZJA 5FZEA 1MS5A 3BIWE 4YW5A 1YI7A 2QQLA 2EXJA 2ZEYA 3AK0A 2IVJA 3ZLIA 4C8DA 1LOFA 1Q8OA 2RMU3 3LDRA 1QNYA 4LBNA 2IUWA 1VBD1 4KL1A 2A6VA 3SEPA 1W90A 1W0OA 4E4HA 1JYNA 2C24A 1VBE2 1EP0A 4JRAA 4FXGB 2RS31 5FYHA 2WLPA 3RMYA 2HWB3 3RZZA 2VW0A 5FYMA 2CY6A 2VMCA 4K21A 2OQ7A 1BEV3 5A6YA 3MPBA 1OH3A 3H3ZA 3K46A 4HOOA 4I30A 5C4WC 2C1FA 3G7DA 3ES1A 2HWF3 1AR82 4AL9A 1CJPA 1AL0G 2PHFA 1K45A 5FPAA 1GOHA 3VDCA 5A3LA 4X8PA 1D4M3 5GLVA 3MF6A 2FQPA 2VMGA 4QHBA 5LY2A 1PZ7A 1W04A 3RYRA 2MPFA 2VQ0A 3UKVA 4G4FA 3NJVA 1VB2A 4FTBA 1S1AA 1BQPA 2RJ2A 3H42B 3Q8EA 4YGDA 5A70A 4QB2A 2JICA 1Q5OA 5FCCA 5FZ3A 1DG6A 3T2PA 4PIYA 5ISLA 1ST8A 3LE0A 4JCKA 5DG2A 5F2WA 5BNNC 3S57A 5C3OA 1D2QA 3IZOA 5DQ0A 4EN0A 2XHKA 3VDBA 2QTWB 2VJXA 1EY2A 5C33A 4FOYA 5HXMA 4Q5OA 2WIIB 1V70A 4LXLA 4CTEA 4PDWA 1GNZA 1YNAA 2IC1A 2HWB2 2Q0AA 2VVEA 1W8UA 4JGZB 1BEV2 4AVSA 4QDSA 1AR81 4XOGA 3ZN6B 4XBQA 3VB9A 5JI9A 2PQSA 2XUEA 1OVPA 2VMFA 3FBMA 4CVUA 2HWF2 1DFQA 5IVFA 3SCGA 1CVNA 2B46X 3M3OA 1W8HA 1ZRRA 3AM2A 1FT9A 2BFUL 4XVHA 1LGCA 4K3UA 4X6QB 2HYKA 3K4DA 1LU2A 3I54A 5DN2A 3ZMNA 2AEYA 1WCDJ 4M3CF 2LTNA 4J1XA 1Q43A 3O0XA 5A3OA 3DCQA 5AC93 4HLTA 3CJIC 3WCRA 5J48A 1YQ2A 3D0JA 1QOSA 3OD4A 4AR2A 1GWKA 2I45A 1JUIA 3VKMA 4ZZ8A 3CHXA 1OA4A 5FXVA 1B35B 3MF9A 2HWB1 5FZ9A 5FPUA 2CDOA 2WNUB 2FZ2A 3O7OA 2WNUA 2ZMLA 1BEV1 4LULA 1XJAA 2DU0A 3EBRA 5EYYA 2QKDA 3NV2A 5FO7B 1YUDA 2HWF1 4LKSA 3A23A 4BH9A 3KQRA 4P9LA 4XC9A 1WCUA 3OY8B 3ZSEA 3WW1A 3ZSJA 3OY8A 2JDUA 2BQPA 3WW4A 4OFGA 4K9SA 5EJZB 5JIAA 5DUVA 3OB8A 1RB8G 2X5IB 2XJVA 2UYBA 3CKHA 1XU2A 1N3PA 4MGKE 1QJY3 2Y6HA 2ZEXA 4BQ4A 2NMNA 4INDA 1GLHA 2RV9A 1BLZA 3P5BA 2D7FA 3OUHA 1I3HA 2HLEA 1T2XA 4QXCA 5JVVA 4A3XA 3FLPA 1JTZX 1LTEA 1W3XA 4F83A 5AC92 4NUBA 4YW7A 2ZBJA 4AEDB 4CCKA 3LOBA 2NZ9A 4LORA 2VM9A 2VZOA 4JDNA 1O7FA 4Q0SA 4XFIA 3J8F3 3SH5A 4GB31 1LEMA 5FYYA 2PYTA 5CFCB 3ZFFB 1JMUB 3IBMA 2YGMA 5LB6A 4ZPIA 4I0AA 1JZ6A 1HRI3 3WX5A 4NIHA 2QBXA 5KWRA 4XF1A 3ZYFA 3OGJA 5BNOA 2B8MA 3DKWA 4UFLA 2E26A 1MR5A 5LA2A 1C8M3 5ACA3 3RVHA 5AVAA 4XBLA 3AZWA 1BKZA 2GP5A 5L19A 5EP9A 3W5NA 1AVBA 3ILRA 5HI0A 2ZAAA 1AUYA 3BTAA 1SCRA 4AHZA 4J1WA 2Q8DA 5FBJA 4PLNA 2H0VA 3MZHA 4XW3A 1CZTA 2DVGA 2BNNA 2QQJA 3FC0A 4Y4RA 1Q8QA 4AI9A 1X8EA 3ETPA 5FFOC 1GFF2 1QJY2 5AC91 4QU1A 3NJXA 3AYEA 1CR7A 4I01A 5F3GA 2VULA 3KV5A 4FVVA 2P2KA 3SEEA 3VHPA 2X53S 3VKFC 3JUUA 3EYPA 3BODA 4B4PA 1JYXA 3CEWA 4L0PA 5T50A 3ZXAC 3ZXLA 2YC2A 1EV12 4FI9A 4QGLA 2RM23 3J8F2 3VGIA 3M3CA 1UXZA 5GLUA 3VN4A 3ZM8A 5LY1A 2FMYA 4ES8A 4QT6A 1BMV2 1YJKA 3FZ3A 2PAKA 3C7FA 2P37A 3H50A 2ZS6B 4UBGA 2XVLA 2ID4A 1HRI2 4R8HA 4XPVA 1KFXL 4UWDA 2YGLA 2YG0A 2N7GA 3UL2A 3KV9A 1FMD2 4LIUA 4W65A 1HW5A 5DMYA 1ZRCA 1WMDA 2VW2A 3J7LA 3P6BA 4FXKB 4I09A 4YRDA 1MQTB 1PMJX 2UU8A 5T5OA 3ASIA 1L7RA 4F7ZA 1C8NA 4CEWA 1H1IA 1QOTA 5FAXA 4DUXA 1NCQC 1E5IA 1QJY1 4Q1PA 2AR6A 1EPZA 1WWYA 3I7DA 4E4SA 4N90A 3MGUA 4P5HA 2ZX2A 3F2ZA 2RS12 3VHNA 4JRLA 4Y24A 1HB1A 4QPYA 1OD5A 3I49A 1WGPA 4GA9A 4Q4X3 3AYDA 1W2UA 3H1MA 1EV11 1MS3A 4GALA 3CDZB 4QKFA 4Q4V3 1WW6A 1XSQA 3NAPA 4NVPA 2WJSA 3HQXA 3SH4A 1IZ3A 1VMJA 3WG3A 1BMV1 3EMRA 3LDBA 2J1TA 2VECA 2JDNA 2Y38A 2J1SA 1HRI1 3N9OA 4XDOA 4DUWA 3HAGA 1CGPA 2ZXQA 1J58A 4D69A 1FMD1 4GKXA 4QQPA 1ODMA 4JKKA 3N9NA 5FYBA 4KBBA 4QX8A 3TAYA 5FY5A 3TNQA 3VHRA 4EE2A 2ES3A 2WBKA 2JG9C 1UD1A 3CL1A 4XXAA 5FDBA 1R092 2P5BA 3K2OA 3N9PA 2ZGPA 1HJGA 4Z07A 3SITA 5DAVA 2I07B 1RUOA 5A3NA 4WV8A 2CYFA 2RE9A 2JIJA 2FZ1A 1H0BA 4MV2A 3I8TA 4BWOA 2RS11 4CP0A 1GZ9A 2Q30A 5FLJA 5T5LA 3UETA 2PTMA 5EQUA 5FQ0B 4B4RA 3V64A 4ARXA 4R52A 5IJRA 5FQ0A 3AZYA 5T54A 4D3WA 4Y5TA 4DMIA 4GIQA 4IV1B 4JHTA 4D7SA 2D6PA 2X8KA 1YIFA 3PUIA 4N7IA 3DL3A 1VALA 4BMBA 4XJZA 3WNKA 3SMHA 1WD4A 3I4IA 3WEZA 5F7UA 4B4QA 1AL23 3POGA 2GNTA 3MW4A 5AFEA 5CU1A 3WNMA 4DIQA 1V6OA 3T4HB 5K7PA 4BA6A 2D40A 4Y3OA 2BVBA 5BY5A 4ORFA 3HJRA 1R091 4LO6B 2JKXA 3H3UA 5FIXA 1FOD2 1YIPA 5CG9A 1MVEA 1H8TC 2LRPA 2P3JA 1ZZ9A 3DXUA 4GWJA 3TWIA 3WQ0A 3JQXA 5DPNA 3E5UA 2FD8A 1RUE3 2VNGA 2FBEA 5C8WA 3H8XA 4HMZA 5E16A 2ERFA 1YFUA 4WVMB 2JE9A 2CAUA 4FPCA 4WVMA 3USUB 3MIBA 3PVBB 4MH0E 2KD7A 3OCPA 3USSA 1SLBA 1XYNA 4OHZA 4H7LA 2QZ3A 2XKPA 1M06G 2X05A 4S2DA 3N7LA 3WXPA 1OXCA 4WBBA 2Q8OA 3CO2A 3ZDSA 4COVA 2DUOA 2LS6A 5HPOA 2JB8A 1I6XA 4HKLA 4Q1RA 1KD7A 1QDOA 2PLV3 5LWBA 5ABJC 4Y1XA 5GKAC 1OT5A 1Z7S3 3IIIA 4TZDA 3WNNA 4LIVA 2EXKA 3ZVXA 5F5CA 3VZLA 4X6RB 2VMIA 3HEIA 1S2BA 1FOD1 1MS9A 1CPMA 2CU5A 2VO5A 4XCAA 5JR2A 3W5MA 3PIGA 2CGPA 3B7MA 2VTFA 5FTTC 3CQOA 1GZTA 4C90A 3MUZ1 2J22A 4TWTA 4XFHA 1GNYA 3N7MA 5L9RA 1FV3A 1V9U1 4XHXA 4YFZA 3HWJA 4IQPA 3BTXA 2DUQA 4IUGA 5H9QA 4KWLA 1J84A 4CCDA 1XPWA 1RUE2 4MO3M 1CAVB 4BDVB 2A70A 2WZ8A 1CAVA 1ZBE3 4W50A 4WM8C 3ST7A 2QDRA 3WZ1A 3GZUC 4I2OA 1H4GA 5FZKA 1JHJA 3I59B 2HWD2 2B39A 2LUWA 4CE8A 1ZNPA 3IDBB 5L7OB 3DPRC 4MGQA 4GMP3 5L7OA 5H9RA 4XQWA 3R6SA 4L9BA 4XILA 4OULA 3APBA 4FSJA 3B5LB 5IVEA 2OT7A 5FZBA 2WL1A 2ZGMA 5APAA 4OQ9A 4H14A 2PLV2 2ET7A 5JLVA 1PX3A 4A2UA 3MLJA 1K12A 4L92A 2YZ4A 2UWBA 3NW4A 4M00A 3ZIWA 3HBKA 5FREA 3VBRB 1HV1A 1XNTA 1OLME 3IWZA 1US3A 4ONUA 4EWAA 1TZOA 3N36A 1N1TA 4M4PA 3WW3A 5C71A 3ZKYA 3UV9A 3VDDB 2XJPA 4IV3A 4JGYC 3VDDA 1CIYA 3T3YA 2C0ZA 4ZY9A 4QXKA 1HQNA 2VG9A 2DCTA 3NKGA 3GM8A 1RUE1 4NHYA 3J9SA 4LK6A 1VBC3 2OVUA 4K8FA 5CKMA 3UESA 2PHDA 2HWD1 1SACA 3K4ZA 4YSFA 5F39A 4ZONA 5FWEA 1DZQA 1OI6A 3DUIA 1STMA 2AUYA 3AKPA 3V65A 1ND3A 2WFF3 2XL9A 4J25A 4YM0A 4OUEA 4UFMA 1W0PA 3WCSA 5IWFA 2PLV1 5C4WB 3KV4A 2R043 1HB3A 1UY2A 2VBDA 3GCWA 3QOPA 1ASJ3 4UBHA 1GZWA 2BBVA 5FRAA 1GWMA 4CU9A 5C9AC 3TEWA 3I2KA 4R9CA 3WD5A 2YFZA 5ANNA 2P6CA 5JUVA 1COV1 2HH9A 1LCLA 1NY72 3AMMA 4AQ6A 2VOVA 4LO4B 2ZHLA 2PHWA 4QQ2A 3MO4A 2ZMKA 3FE5A 4Q4Y3 4BXSV 1HDKA 3AZZA 3KB5A 1IG0A 3MHZA 4QPGC 4OI1A 2AYHA 2VC9A 4X8NA 2A6ZA 4BQWA 5FUIA 3FL7A 2FHRA 1T6BX 5JCTA 3TRSB 5JPMB 5EPAA 4BB3A 4FPFA 1VBC2 3TEXA 2XXZA 3POJA 1RYYA 4RA0A 3ZFEC 3PVOA 2VXJA 2WC2A 4M3CB 4P02B 4N43C 1J59A 1VR3A 3N7JA 4HN1A 5FZ8A 1VBB3 4AGGA 5FPZA 3ILNA 4GMP1 4KWUA 3UGFA 1KITA 1OOPA 3MEPA 1CZVA 2WFF2 2ZGQA 5E89A 4NIIA 4Y5SA 4P00B 3ZPYA 1XNCA 2ZGRA 3AKQA 4CP9B 3PU8A 1OUXA 2VH9A 2R042 2RJKA 5JWPA 1ASJ2 1UZ0A 3KMHA 1BK0A 4XETA 1DF0A 1NY71 5JZGA 2OYZA 3GALA 4L2NA 5BUVA 3AZVA 1RUJ3 4RR3B 3NV3A 4RR3A 5KHGA 1XRUA 3GBGA 4RQPC 3PUSA 1XNAA 4E8DA 1RUI3 3MLLA 3T4VA 4Q4Y2 1ULGA 1WLTA 3WQBA 5FXXA 3UK9A 3WR0A 4DRVA 3CJIB 4CU8A 1VBC1 2AACA 3CJIA 4MGIE 1VAVA 5A32B 3RZJA 1RUC3 1FATA 3Q8BA 2PFWA 4DEQA 4IEXA 5DAWA 4CPBA 1CAUB 1W06A 3W59A 1RXGA 1DU3D 1WD3A 1S2KA 3KSCA 4MGZE 4PIXA 4W6XA 1OURA 3D4KA 5A6QA 1LR5A 3FFQA 1ZX5A 1OA3A 3OD0A 4N53C 2I74A 4O9GA 4XUTA 4DUVA 1MEC3 1ZREA 1ASJ1 1YFXA 5CA6A 2TNFA 5KXEA 4OI0A 2VR4A 4BHPA 3VBUC 2DTWA 2HYXA 4XMAA 1W9FA 4HXCA 4QM8A 5L73A 3ZKUA 2HBUA 4MGSA 1NCRC 5F5QA 3WW2A 3ATGA 5IFPA 2NLRA 4NRPA 4NAOA 4KGQA 3SNMA 2EAAA 1AX1A 2GALA 4Q4Y1 4QHZA 3OSDA 1SLAA 4V2WA 1XC6A 1PGW2 1O6UA 2RDRA 1QOOA 2A6XA 1BHGA 1RUI2 3M4FA 3MIHA 3PDQA 2ENRA 2J1VA 4O7XA 3S30A 5LBBA 3NWKA 4CU6A 5A3UA 5E8AA 5JOYA 1OHFA 1UYPA 5LBEA 1RUC2 1KXGA 5KC5A 4LTAA 2WA4A 3AP4A 3H9AA 1GQHA 1UKGA 1HV0A 3GNEA 2V5YA 2MHFA 4XURA 4RHV3 2HJIA 2Z4FA 4RSUA 4FPJA 1C1LA 2SBAA 1ZRFA 3MIEA 4A44A 4AEMA 3OPWA 1MEC2 5A1AA 1NA1A 1H2LA 4WVZA 4RD7A 3VD3A 4HPKB 4ITCA 2W1WA 1W8ZA 3ZFGA 3TEYA 4MHUA 2WO7A 1ND2C 3SQOA 4IEZA 4BQYA 1WA4A 3HR9A 3ACFA 1LHNA 1UMZA 1PGW1 3DGTA 1FV2A 4PLMA 4CDQA 4BJ0A 4CDQB 3RWNA 1RUI1 4DNYA 4CDWB 2FCTA 4CDWA 3LPGA 4XF9A 2J42A 1UU4A 4CDXB 4XACA 4CDXA 5LRSA 3VBOA 2WS92 2UYAA 3WG4A 3E97A 1CX1A 2C6SA 1LHWA 4LO7A 3U14A 1F35A 3POYA 1Y9QA 1JYWA 5BPXA 1UY3A 1W8NA 1VPHA 2VVFA 3ZXKA 2E7AA 3ACGA 5KXBA 4L8QA 5KHIA 1H9PA 4C1XA 3NL1A 5CBLA 5J37A 4AQTA 5LW9A 1MEC1 1XYPA 1RHI3 3SISA 4Q8KA 5FP8A 4QKBA 2V72A 4B29A 3IKWA 1OQDA 1LKNA 5FK7A 2JG8A 1DGWX 3KF3A 1UOBA 1W39A 2EA7A 1LNSA 1HKDA 2R32A 2XLGA 2WZEA 4PCRA 4XUNA 3RFRA 2TUNA 1H2KA 3NNFA 4CCJA 1W9WA 1NCQB 4YW3A 2Q8CA 3T2TA 2AEZA 1UXXX 2XJSA 3AXDA 2WS91 4URAA 3JB4C 4YW1A 2EALA 5DUXA 3MW2A 2MNGA 2JDPA 3OGSA 3QACA 1GSLA 5CFDC 4BK4A 3AP7A 1D0GA 1PK6A 1Y9MA 2BDRA 5FP9A 4K1ZA 1WLCA 1ZZBA 2W1SA 2Z69A 5IVCA 2B7YA 4OLLA 5A33B 1DHKB 1UF2C 1Y3TA 5A33A 1LEDA 1RUD3 3RS6A 3VD9A 1QHDA 4H7MA 4Y20B 3M8LA 4P9GA 3DKQA 1H4HA 4Y20A 2GNDA 1ONAA 3N9MA 3EO6A 1F4AA 4KBZA 4QQOA 5HXVA 5C8CC 1JOPA 3NV1A 2XL7A 2RDSA 3INAA 2JG9B 2RJLA 2JG9A 3IMNA 4R4ZA 1BVVA 5BNPC 5A3MA 1POV3 5DUWA 1G86A 3VBFA 2JDHA 4AQSA 2WNVC 3DF0A 2F6BA 1J3PA 2FDHA 3KT7A 4EWDA 3QBQA 3V0BA 1Z78A 4BQ3A 1HQLA 1ENSA 2QQPA 1GUIA 1UQXA 2WA3A 3I3BA 1GP4A 4HZFA 4W6YA 2LM3A 4P9IA 3HD8B 1NX9A 2Z5WA 3K48A 4LUMA 4A7ZA 3LZZA 2FDGA 4FPKA 1AZDA 2GDFA 1V6NA 4GJYA 1AR83 2Y33A 4CCLA 3E6CC 3VZNA 2XJQA 3ZR5A 2OQ6A 4PHZA 1HJFA 2P3YA 5EXOA 3VBSC 5IFTA 4HFSA 1VMFA 1O4ZA 1CESA 4UFKA 1WCQA 1ZRIA 5JXIA 1NAEA 2CSGA 3IPVA 4JDOA 1RUD2 4HK8A 4HKWA 4M4RA 3PMEA 1A34A 4GWMA 5FZ6A 5BXXA 5T3NA 4M0NA 1O8PA 4AVVA 1UOFA 3IAQA 4ZXKA 4W4ZA 2IXCA 1JI6A 1JH5A 2GNBA 1QXPA 2AREA 1H8TB 4UYBA 3RZGA 4OMCA 2G9GA 3MV11 3KF5A 1RUF3 1VRH3 4CEYC 1BBT2 3T0BA 2WUHA 3PVEA 5GZEA 3VZJA 1OC1A 4G9SB 4E2QA 2EIDA 3KGZA 2D93A 1W6NB 1YRZA 3LEGA 4EZ4A 1J83A 1OQEA 1NT0A 5JPNB 5FY8A 3POEA 4FPEA 3GZTB 4BCUA 4PBPA 5FLHA 1O4TA 2VCCA 2LROA 2E7TA 3TBDA 4EV0A 3ME2A 1C5HA 1RUD1 4BQXA 1H2NA 1H30A 1UOJA 5SV5A 4K1YA 1J1LA 3M3EA 2WFPA 2Y6GA 4LBMA 4D8MA 5FPBA 1GZCA 4A4AA 4DB5A 4BLIA 2A3WA 4LKEA 3K3OA 2KM2A 4XHBA 3DYPA 2UURA 1ACCA 3C7GA 3H1WA 1PX4A 1BBT1 1POV1 1TNRA 3ZR6A 3O14A 2WO1A 3BN6A 1SBDA 1RUF2 1MZ5A 1UZYA 1VRH2 1W9YA 5J96B 5FZ4A 4UFIA 4A6OA 1UNBA 3WF4A 1DQ2A 4FOVA 4GB33 1O3SA 3K4AA 3DYMA 4WM8B 4YW6A 2BTVC 3KT1A 3N35A 1UX6A 1F9KA 1OPMA 3WNXA 5LA1A 4JGZA 1JU4A 5DABA 3AP9A 1OSGA 4NRQA 1S0IA 3ZN6A 3DPRB 3DPRA 4AI3A 3FJSA 1SMVA 5JXGA 4Q4W1 4FPLA 1XE8A 4YVWC 5CG8A 3JCIA 2VOTA 1KRIA 4JAAA 5ERLA 3C3VA 4WM7C 1UMHA 2VTXJ 3MW3A 4AHXA 3ALQA 2PELA 5IK8A 3N7KA 3V56A 2VMDA 1CN1A 2VNVA 1U12A 1NOVA 4EYUA 3GGLA 3I2HA 4K6BA 1YYNA 3MYXA 2DF7A 3POWA 2K9ZA 4JGYB 2XJUA 4K8RB 1HXS3 2W87A 3K75B 1QGLA 2XVGA 1D4VB 1RUF1 1VRH1 4TLFA 5DAQA 2A5ZA 3H8OA 2WYFA 4UI9L 4Y26A 4TYSA 2HEYF 2Z2SB 4FT8A 4MXWB 3GHNA 4QM9A 3ZIXA 2D6KA 1B35A 4D6RA 1KS4A 3OYWB 1ALYA 3LCPA 1S0BA 4GB32 5A6ZA 4YVSC 2FCVA 2YBSA 2WN3A 3SKVA 4OHWA 3QD6A 5KC6A 2P6HA 2YFUA 4SLIA 2EXHA 2A6WA 5FPVA 1OFSA 1PMIA 1CX4A 5CKQA 4EJRA 2R072 3NSTA 4QX1A 5HCAA 2AH2A 1E5RA 1XU1A 3B94A 1EYBA 2PQQA 1SCSA 5IVBA 5IW0A 4NIGA 1LENA 1NUKA 3GCXA 3T1LA 5C9AB 1MPXA 2X5IA 5C9AA 4YG6A 2RDQA 4MGYE 2DUPA 1IS3A 1OF3A 2AGSA 2R16A 3B93A 2BFUS 4JC1A 3ZYHA 2YPDA 5I8TA 2F4LA 5LCWL 2VVDA 1HN1A 4QPGB 4B8EA 3N3HA 2A7AA 2BNOA 2R7EB 1HXS2 4AEDA 3D3AA 5A3WA 5C3PA 3B69A 1EV13 2WWSA 3THPA 1IS5A 4IEUA 4E2SA 4MSVA 2ZGLA 5CFCA 3ZFFA 3MUY1 3TNPB 4A42A 3WNPA 1W2NA 3JU9A 5JR7B 3ZFEB 3ZFEA 4N43B 3VBHB 5D8AB 3VBHA 4ASLA 2R071 3B00A 4XUPA 5D8AA 5B4XA 1FMD3 2EICA 4LBJA 3AB0A 4LUKA 4XF0A 3R4UA 1JZ4A 5I0SA 5CYYA 2MEV3 5B2GB 2VZ3A 1REDA 2Y6KA 2ADDA 4YM1A 5JOXA 5DDJ2 1PVC2 4Z2AA 1X36A 2JDZA 2GC0A 3O1PA 3RWKX 4PQQA 4HT1T 2W92A 4TTGA 2OZ6A 2RS13 4OUSA 1TEIA 4IE4A 4LMFA 5FXZA 1UPIA 4IEOA 4AGVA 2XVKA 3TN93 4DOUA 1GOGA 1HXS1 1W6OB 4A45A 1V00A 1H6XA 5C3SA 1EUUA 2BP6A 5I91A 4I3GA 4KI5M 3SKJE 1JS9A 1SLIA 1ZYBA 2CL2A 1EPWA 5EFUA 4BOWA 4BXFA 3WLUA 2X10A 3OF1A 3PMSA 2A75A 3NMBA 1UY1A 2K2SA 4ASKA 3AVSA 2NMOA 5EJ1B 4AAPA 4IGOA 4BE3A 4QMAA 4RS5C 2VPVA 3E6DA 1BXHA 4N53B 4NWVA 1W2OA 5DDJ1 1R093 1PVC1 4QPIC 3ZOIA 1NLRA 1Y4WA 2MEV2 1SLTA 2DCJA 4LO5B 1MQTA 3I3EA 3TYJA 1UZZA 3AC0A 5FMOL 4PJYA 1NCRB 2CGOA 3I3DA 4CP1A 4MYEA 1NZIA 1LOBA 3GBFA 2BGPA 2PHLA 4CXYA 2BGOA 3X29B 1JU3A 1JYIA 3G6JB 2VNOA 3LPFA 5A3TA 3TN92 1GP5A 2ADEA 3WV6A 3KM5A 5K0UB 5K0UA 4ISQA 4RN5A 1KJRA 4Z1VA 5K9YA 1DQ5A 3M70A 2DDUA 5IK5A 2G1MA 3OBAA 4IESA 4BIFA 4BM8A 4AAXA 2VXRA 1QKQA 1D0HA 2W94A 4PI0A 4XIOA 3RZMA 3KVBA 4JKLA 1XYOA 1W9TA 4XFBA 3T30A 3OG2A 1FOD3 1LRHA 2MEV1 5F32A 2VY0A 4OHVA 4BIOA 3AYAA 2BEOA 2ZOEB 1YFWA 2FDKA 1DYPA 4R4XA 4AI0A 2F17A 1F4HA 1K5MB 1NE4A 3LGRA 1UY4A 1K5MA 2WQZC 2BWAA 3FX3A 4GH4B 4URTA 1PVXA 1ND2B 1V9U3 3Q8AA 4GH4A 1B09A 1ND2A 4S2FA 4CP2A 5FP7A 5IAVA 4RYDA 5F5AA 4NE9A 1UYXA 3TN91 3WDVA 4L11A 4FP3A 5LASA 3WDXA 4F8AA 5BYNA 3FN9A 3RI9A 2W5FA 4IV1A 4UOJA 3FBYA 3RZHA 2WO3A 4AVTA 3QCWA 1CAWB 1VIWB 1CAWA 1W6PB 1MVQA 3FMGA 3PJQA 5F37A 2Q4SA 2Q1ZB 4UW5A 1JYTA 3LEMA 5IK7A 1W99A 1NLSA 3E5XA 3MFCA 4NHXA 2ZGKA 1JOJA 2H6CA 4QD2A 1H2MA 4XBNA 4EROA 1DLLA 2W91A 3RG0A 3MIDA 2OUHA 4MOAA 4LA2A 3VHOA 1F8VA 1NXD1 4M0HA 2YMZA 3B9CA 5FZIA 1L3JA 2VZQA 4HL0A 3TOJA 4IL7A 2OPKA 4PQ9A 1X8MA 3BGAA 4QQHA 3S5QA 4B7EA 1CQ9A 2EXIA 3FFZA 1KGYA 1VMHA 1QJU3 3PURA 1ZZCA 3WDWA 1TME2 4FFGA 1GICA 4OMDA 4ASMB 3HNBM 1JODA 1V9U2 4XJ8A 4XCBA 4YG3A 4AE2A 1RUNA 1JZ5A 3AMQA 2O0OA 5T52A 3N4MA 1C4RA 1YFYA 2GSYA 2RVAA 2HWD3 3EB7A 4GJZA 1RMU1 2GH8A 4HSJA 4NR1A 5F3IA 3USUA 5CADA 3NNJA 1LESA 4QX7A 5CISA 1OH4A 4GKYA 2VL4A 1F15A 4CCOA 1DP0A 5L36A 1QH7A 4ISRA 1YJLA 4CUCA 2XHNA 1IS6A 2B9UA 1WW7A 2YY1A 4UFJA 2CHHA 1LOFC 3AJZA 3NNMA 4Q2FA 5GZFA 1HRV2 4ZS3A 4D6QA 4MLOA 2JD9A 1AXYA 3T2OA 1XNBA 5FMCA 2EAKA 1AXKA 2VUJA 1COV3 4L97A 3A21A 4LE4A 4AFMA 4GAZA 1FXZA 3BB6A 4YGBA 4PLOA 4COZA 1NLQA 2XMLA 2NPIA 5FYVA 4QB1A 1HN0A 5A6XA 1QXJA 5C8CB 1SQ4A 3EHKA 5C8CA 1TME1 3PL0A 3AKSA 1G6NA 1Y7BA 1QJU2 1DZTA 4K7JA 3OBZA 2WRAA 4O65A 4Y22B 2ZJCA 4Y22A 3DECA 3VZOA 2WNVB 2WNVA 3U75A 2W0XA 2CGNA 3I59A 1S4CA 1E5HA 3BIEA 3PUAA 3RMXA 2BUKA 2BU9A 2E32A 2PHUA 4XIKA 3AYCA 2UY8A 1HRV1 1UZWA 3GHMA 1HX6A 5FJHA 4HVOA 5I0TA 1VJ2A 3VBSB 3OPTA 1W2TA 1WW4A 3VBSA 2IXJA 3KS7A 3T0DA 1YQCA 4CDUC 4PDWC 5FZOB 1OF4A 4TN7A 3VBRA 2B42B 2BNMA 1PIV2 4LITA 2GMEA 1COV2 1WW5A 2WINB 4CCCA 3E1F1 4WVWA 1W8TA 5KBFA 3JBG1 1QJU1 2VMEA 1JXNA 4LBLA 5FP3A 3Q9OA 5FMBA 4NRMA 5FYSA 1MS1A 4LJHA 3LKJA 5EIYB 1RUG3 4BK5A 3J26N 4P9WA 4CEYB 4H3WA 4EN7B 5GM0A 1REFA 3RYKA 1I5PA 5I0UA 3WF2A 3B3QE 3J7MA 3W21A 4AVAA 4Z82A 2OKXA 1UOGA 1RVF3 5FY1A 3POIA 3GZAA 4NPMA 1TNFA 2P1BA 1ZBA3 5C4WA 2OZJA 5FV3A 4FAHA 1BZWA 1K5JA 1RIRA 2W52A 2YDEA 4B1MA 1BK1A 2ORZA 2VU9A 1IS4A 1UN1A 1JZ8A 1W8FA 2Q5TA 2ZEZA 3NVCA 1PIV1 4BPZA 1IOAA 1ZA7A 2YB7A 1G9AA 2ZABA 4YARA 5LEJA 3AKRA 1AYN2 3ZX7A 4LT5A 4XAAA 4CZSA 2OA2A 2E31A 4QU2A 2BGCA 4AHYA 4YZ2A 3FLRA 1J1TA 4W8JA 5HV4A 3V0AB 3MFAA 1IQDC 3M7AA 3HN1A 1U5ZA 3MPPG 5J98B 5BNNB 2E6VA 5BNNA 2ZMNA 4MVTA 4ZU4A 2PHRA 5DZFA 1U5XA 3PIJA 3VDAA 5FOJB 1RUG2 4YW4A 5IAXA 5GLTA 3I2DA 4M3CA 2D3RA 4YZ1A 5CIRA 2DCYA 2XPJA 5A7WB 5EJ3A 5A7WA 3LIGA 2ARXA 4NHLA 4O61A 1RVF2 4QB6A 3A0KA 2P4EA 1Y43B 2JDYA 3K77A 4CP9A 1ZBA2 1V6KA 2DVFA 4ES9A 1UX7A 1BCXA 1XQNA 2OPWA 3CIHA 3LOIA 1ULPA 2IZWA 4DXZA 4YVWB 3M3QA 1NXMA 1GOFA 1AYN1 1QEXA 4WM7B 3RJRA 4WM7A 4CPBD 1J3QA 4HBNA 4U36A 5BNOC 2D6LX 1AF9A 3UT0A 2O8QA 3TB0A 4AEKA 2YUEA 4AVBA 5FZ7A 1KS5A 4D0QA 2GMPA 4EN6B 3R4SA 3HQRA 1ZM1A 5FY0A 1EAH3 2J1EA 1SZBA 1RUG1 3CLPA 4E27A 4D94A 5A32A 1OBNA 1ZZ7A 3LA3A 1YI9A 2QQWA 3M3IA 1CAUA 2P34A 2ZACA 3LD8A 1HB2A 1QQP3 4AVCA 1RVF1 1G9DA 1G9BA 2VOKA 4YVSB 5LA0A 3LAGA 1DLCA 4YPJA 1ZBA1 3ORJA 2BV4A 5I8YA 2GH2A 3ABZA 1R083 4QKNA 5LA9A 3I2FA 1OLMA 4KWKA 1AX2A 2WABA 4CCEA 5JIUA 1DZRA 4UW6A 3ZXGA 3K3NA 5KXDA 3OOXA 2FDJA 4LNVA 3LEKA 3SLIA 5CB7A 2PAEA 4YZ3A 5DUUA 5FKCA 4QKDA 3U4XA 1ENRA 5A80A 3SH3A 2D6OX 3OGRA 4KQ7A 2WS93 3NO8A 3O0VA 3J7NA 3HNYM 1O3QA 5C7GA 1LULA 1OMIA 3J7HA 2R1DA 4KWJA 1I9RA 2R1BA 1EAH2 3U1XA 4NPRA 1V6JA
chains in the Genus database with same CATH topology
4QU1A 5F2WA 5F3GA 3KV5A 5FYZA 4EZ4A 2XXZA 5FY1A 5FY8A 5F37A 5CEHA 5A7PA 5FYIA 4LXLA 5FZ8A 4HONA 4QXHA 5FZOA 5FV3A 5LY1A 5FZFA 5LWBA 4CSWA 2YBKA 5FZGA 5LW9A 3PU8A 2XUEA 5FP8A 5FZIA 4LIVA 4Y33A 5E6HA 3U4SA 2YU2A 5F5CA 4BU2A 2YU1A 5FPBA 5FZLA 5IVFA 3KV6A 4GD4A 3KV9A 3UYJA 4LIUA 3K3OA 3PTRB 3N9LA 3PURA 5FYCA 5FZAA 5F3CA 5FXZA 3N9QA 2WWJA 4QXBA 5FZDA 3PUSA 2YBPA 5FPLA 4CCJA 2VD7A 5F2SA 4GJZA 5FZ1A 5FY7A 3U78A 5F3IA 5FXXA 2Q8CA 4BISA 5FP4A 4URAA 3AL5A 5FZ4A 4QX7A 5IVVA 4BXFA 4CUGA 4CCOA 1VRBA 5A7WB 5A7WA 2GP3A 3NJYA 4IGQA 5FP9A 5FZKA 4EZHA 2OX0A 2XDVA 3PU3A 5A1LA 5FYTA 3AL6A 5FXVA 4ASKA 3AVSA 5FY9A 5FZ9A 4D6QA 5FPUA 4AAPA 4IGOA 5IVJA 5IVCA 3LDBA 4QWNA 5IVEA 3N9OA 2OT7A 5FZBA 5FZCA 4UF0B 4UF0A 4GAZA 5F5IA 3N9MA 2XMLA 5FUNA 5FYVA 3N9NA 5FYBA 5A7QA 4QX8A 5F3EA 5FZ0A 5FY5A 5K4LA 4V2VA 4EYUA 2P5BA 3K2OA 5FZ7A 3N9PA 3ZPOA 5A3TA 4V2WA 5FY0A 5A3NA 4CCNA 3KVAA 5FZEA 3PDQA 4QXCA 3ZLIA 4CCMA 5FYUA 3PUAA 4C8DA 4D6RA 4NUBA 5FJKA 2W2IA 3LD8A 4CCKA 4GJYA 4E4HA 5F39A 5FWEA 2Q8EA 2YBSA 5FJHA 5FYHA 4XDPA 5FXWA 5FZHA 5FYYA 4CCLA 5FYMA 3KVBA 2OQ7A 5FPVA 2OQ6A 3OPTA 5A3PA 5A7OA 3PUQA 4HOOA 5IWFA 4D6SA 5A1FA 3KV4A 5F32A 5FZOB 4TN7A 3K3NA 3OPWA 5IVBA 5IW0A 4LITA 4DIQA 5IVYA 5FPAA 5FZ6A 3RVHA 2PXJA 4DO0A 2GP5A 3AVRA 4Y3OA 5KR7A 5A7SA 5FWJA 3DXTA 4IGPA 5A80A 5LY2A 5FP3A 2OS2A 5FY4A 5FBJA 2Q8DA 2WWUA 2YPDA 5FUPA 5FP7A 5FYSA 5F5AA 5A7NA 3DXUA 4Y4RA 5ANQA 4AI9A 5FZ3A 5A3WA 5FZMA 5ISLA 4XDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QU1 A;  5F2W A;  5F3G A;  3KV5 A;  5FYZ A;  4EZ4 A;  2XXZ A;  5FY1 A;  5FY8 A;  5F37 A;  5CEH A;  5A7P A;  5FYI A;  4LXL A;  5FZ8 A;  4HON A;  4QXH A;  5FZO A;  5FV3 A;  5LY1 A;  5FZF A;  5LWB A;  4CSW A;  2YBK A;  5FZG A;  5LW9 A;  3PU8 A;  2XUE A;  5FP8 A;  5FZI A;  4LIV A;  4Y33 A;  5E6H A;  3U4S A;  2YU2 A;  5F5C A;  4BU2 A;  2YU1 A;  5FPB A;  5FZL A;  5IVF A;  3KV6 A;  4GD4 A;  3KV9 A;  3UYJ A;  4LIU A;  3K3O A;  3PTR B;  3N9L A;  3PUR A;  5FYC A;  5FZA A;  5F3C A;  5FXZ A;  3N9Q A;  2WWJ A;  4QXB A;  5FZD A;  3PUS A;  2YBP A;  5FPL A;  4CCJ A;  2VD7 A;  5F2S A;  4GJZ A;  5FZ1 A;  5FY7 A;  3U78 A;  5F3I A;  5FXX A;  2Q8C A;  4BIS A;  5FP4 A;  4URA A;  3AL5 A;  5FZ4 A;  4QX7 A;  5IVV A;  4BXF A;  4CUG A;  4CCO A;  1VRB A;  5A7W B;  5A7W A;  2GP3 A;  3NJY A;  4IGQ A;  5FP9 A;  5FZK A;  4EZH A;  2OX0 A;  2XDV A;  3PU3 A;  5A1L A;  5FYT A;  3AL6 A;  5FXV A;  4ASK A;  3AVS A;  5FY9 A;  5FZ9 A;  4D6Q A;  5FPU A;  4AAP A;  4IGO A;  5IVJ A;  5IVC A;  3LDB A;  4QWN A;  5IVE A;  3N9O A;  2OT7 A;  5FZB A;  5FZC A;  4UF0 B;  4UF0 A;  4GAZ A;  5F5I A;  3N9M A;  2XML A;  5FUN A;  5FYV A;  3N9N A;  5FYB A;  5A7Q A;  4QX8 A;  5F3E A;  5FZ0 A;  5FY5 A;  5K4L A;  4V2V A;  4EYU A;  2P5B A;  3K2O A;  5FZ7 A;  3N9P A;  3ZPO A;  5A3T A;  4V2W A;  5FY0 A;  5A3N A;  4CCN A;  3KVA A;  5FZE A;  3PDQ A;  4QXC A;  3ZLI A;  4CCM A;  5FYU A;  3PUA A;  4C8D A;  4D6R A;  4NUB A;  5FJK A;  2W2I A;  3LD8 A;  4CCK A;  4GJY A;  4E4H A;  5F39 A;  5FWE A;  2Q8E A;  2YBS A;  5FJH A;  5FYH A;  4XDP A;  5FXW A;  5FZH A;  5FYY A;  4CCL A;  5FYM A;  3KVB A;  2OQ7 A;  5FPV A;  2OQ6 A;  3OPT A;  5A3P A;  5A7O A;  3PUQ A;  4HOO A;  5IWF A;  4D6S A;  5A1F A;  3KV4 A;  5F32 A;  5FZO B;  4TN7 A;  3K3N A;  3OPW A;  5IVB A;  5IW0 A;  4LIT A;  4DIQ A;  5IVY A;  5FPA A;  5FZ6 A;  3RVH A;  2PXJ A;  4DO0 A;  2GP5 A;  3AVR A;  4Y3O A;  5KR7 A;  5A7S A;  5FWJ A;  3DXT A;  4IGP A;  5A80 A;  5LY2 A;  5FP3 A;  2OS2 A;  5FY4 A;  5FBJ A;  2Q8D A;  2WWU A;  2YPD A;  5FUP A;  5FP7 A;  5FYS A;  5F5A A;  5A7N A;  3DXU A;  4Y4R A;  5ANQ A;  4AI9 A;  5FZ3 A;  5A3W A;  5FZM A;  5ISL A;  4XDO A; 
#chains in the Genus database with same CATH topology
 3ITQ A;  4CEW C;  1VBA 3;  4I0B A;  1JYC A;  3IN9 A;  4DZG A;  1C5I A;  4DY5 A;  5FYZ A;  1JYV A;  4AK3 A;  4DIN B;  1YQ8 A;  1OLQ A;  4XZU G;  5CZK A;  2G9F A;  1NKG A;  1QQP 2;  3U37 A;  4QQL A;  2WQ8 A;  4XFC A;  5IAT A;  2O1Q A;  2WNE A;  1S0E A;  2R06 3;  1FYU A;  3W9A A;  1BYH A;  1AJK A;  2WSU A;  1H1A A;  1R08 2;  3I2I A;  4HPK A;  4FTE A;  1CZS A;  2ZA9 A;  3WDT A;  2K0G A;  2LW8 A;  3NAP C;  5JOW A;  1PZ9 A;  4YW2 A;  1RIN A;  4Y33 A;  4JKM A;  1GQP A;  3JQW A;  2L9L A;  4BU2 A;  1JZ7 A;  1VB4 A;  2Y6J A;  4B3N A;  3ACI A;  4C0H A;  1JN2 P;  2EIG A;  5KXC A;  1ENQ A;  3NJZ A;  3BUC A;  3UJQ A;  4IEP A;  2DFC A;  3P3N A;  1RUH 2;  1TQ5 A;  3N9Q A;  3NV4 A;  3ZXJ A;  3ZN5 A;  2XB6 C;  2GC1 A;  2XR4 A;  1EAH 1;  2ZKL A;  5FY7 A;  3S7E A;  3U78 A;  4FPH A;  1JZ2 A;  3KCX A;  3VKN A;  1X33 A;  4YM3 A;  2Y26 A;  1SDW A;  3GYD A;  4XEZ A;  2ZGS A;  1VBA 2;  2C9A A;  1VRB A;  1QQP 1;  2HKX A;  5BNQ A;  4AEJ A;  5A1L A;  4HKO A;  1XB9 A;  4M01 A;  3S6P A;  4WZC A;  1I1E A;  1R08 1;  3CZU A;  4RS5 B;  2R06 2;  4COU A;  2YC4 A;  3IDA A;  3O1O A;  3JXS A;  4P9J A;  4ARY A;  5JXH A;  3L9J T;  2ZX4 A;  4Z92 B;  1IKQ A;  4QPI B;  4XFF A;  1W6Q B;  2OW4 A;  2V4V A;  5FR3 A;  4L99 A;  4XXP A;  4EN9 B;  2DUR A;  1K42 A;  3EXU A;  4NHK A;  5F3E A;  1H8V A;  2DFB A;  4LE3 A;  1REE A;  1NCQ A;  1RUH 1;  4V2V A;  2NM1 A;  4IE7 A;  1VAK A;  3POB A;  3S0M A;  3WNO A;  1YWK A;  1DQ6 A;  4XQ4 A;  2FMD A;  3M2M A;  2RG4 A;  2GN7 A;  3CU7 A;  3GXU A;  2DBI A;  2BW8 A;  3ZXD A;  3BU7 A;  1SEF A;  2WT1 A;  3GDB A;  4XTP A;  2WR9 A;  4CCM A;  2BJS A;  3T1M A;  4LBK A;  1HLC A;  5FO9 B;  1VBA 1;  5FYU A;  3H8R A;  3P1I A;  1XND A;  3KCC A;  5DAX A;  3WP5 A;  5EZW A;  3UGG A;  2QUO A;  1H1M A;  3BCW A;  2CAV A;  5BV6 A;  1SFP A;  5FXW A;  4QX5 A;  4UW3 A;  2R06 1;  3AFG A;  1LHV A;  2ZX0 A;  3GF6 A;  2ZX1 A;  5A3P A;  2R0H A;  4ZKT B;  3LDK A;  4FFI A;  3VD7 A;  1Z0H A;  3PTY A;  4QAW A;  1RC6 A;  5A1F A;  1YC6 1;  4GQ7 A;  4RGK A;  4IET A;  3A7Q A;  2VZU A;  1LHU A;  5C5T A;  5J36 A;  1BBT 3;  3AVR A;  1N3O A;  3KD4 A;  4KMQ A;  4A3Z A;  3DXT A;  3T09 A;  3LSD A;  2D5H A;  3NQH A;  2VGD A;  1A8M A;  2QNK A;  2WWU A;  3HBZ A;  3S7I A;  2VOW A;  1W03 A;  2RHP A;  5A7N A;  1GKB A;  1O5L A;  3I2G A;  2W3J A;  3LA7 A;  5GZC A;  2VZT A;  2C9K A;  1G8W A;  1H9W A;  5J3U A;  4LBO A;  3AKT A;  4AZZ A;  3BVC A;  2VUD A;  1MZ6 A;  2XWJ B;  2FDF A;  1YXW A;  4UW4 A;  5CEH A;  4GUL A;  4Q4W 3;  4A7Y A;  3ROU A;  2JEM A;  3WUD A;  3WY6 A;  4HON A;  3WP4 A;  1LGB A;  1Y9G A;  1WLD A;  1KEX A;  4FCA A;  3BTZ A;  3EQE A;  4S2H A;  3BPS A;  5L7O C;  4QDR A;  4KG0 A;  4Y1Z A;  1TMF 3;  3ES4 A;  3SCF A;  4QHO A;  1UYY A;  1XSR A;  5FZL A;  1H8T A;  1W8W A;  2WZR 3;  4GD4 A;  5FKB A;  3RSJ A;  3UYJ A;  2XOM A;  1AYM 2;  4LBQ B;  1R1A 2;  1PGL 2;  2VBP A;  3AP6 A;  1XNK A;  3RJ2 X;  1FNY A;  3OTF A;  3QLQ A;  3SC7 X;  5LBC A;  2ZPX A;  2ZAH A;  5FPL A;  2WSV A;  1W6N A;  2Y0I A;  2WT0 A;  2BRT A;  3PVN A;  4LLO A;  3W20 A;  4IV3 C;  5GLW A;  1OVS A;  2WDB A;  2VZP A;  5IVV A;  1DDL A;  5FK8 A;  1AR9 2;  5CAZ A;  1C1F A;  4NPL A;  1WBL A;  2XDV A;  4LA3 A;  2ZGO A;  1MZE A;  3AL6 A;  1GMM A;  2IWG B;  5D1I A;  5ABJ B;  4NRO A;  4IE6 A;  4Q4W 2;  4LKF A;  2PA7 A;  5ABJ A;  3O1U A;  1S0J A;  1ND3 C;  1ZVF A;  2ARA A;  4UF0 B;  2JEN A;  3LB9 A;  4XF3 A;  4UF0 A;  4XF4 A;  3WSO A;  3HVD A;  2JIG A;  2XG3 A;  1TMF 2;  5FUN A;  2ZEW A;  1AYM 1;  1N47 A;  1R1A 1;  5DZG A;  4JV4 A;  3KT4 A;  5FZ0 A;  1PGL 1;  1POV 0;  4CRQ A;  4LEJ A;  1G9F A;  1NQD A;  2DCK A;  2WZR 2;  3RZL A;  5FBZ A;  2J1A A;  3THT A;  2C5D A;  1GWL A;  1QJE A;  1ULE A;  5SV8 A;  4Q0Q A;  1QDC A;  3HQU A;  4LPL A;  1XE0 A;  1F2N A;  4Q0V A;  4WM8 A;  4XUQ A;  5LZ6 A;  2VZ1 A;  4SBV A;  5LK5 A;  1K3I A;  1AR9 1;  4R9D A;  2RS5 2;  3KQ4 B;  2R07 3;  3O0W A;  4Z8B A;  2YC0 A;  3UJO A;  4F3J A;  4LHN A;  3ZYB A;  4YGC A;  5CVR A;  3OEA A;  5JOZ A;  2V73 A;  1W8O A;  4XFG A;  1IG3 A;  1PNF A;  4NN0 A;  1VBE 1;  2IXI A;  4RFT 0;  5A7O A;  2CNA A;  2Q1F A;  2RMU 2;  4IE5 A;  1LAJ A;  4FPO B;  4CDU B;  5F9T A;  4PDW B;  4CDU A;  1TMF 1;  2R30 A;  1OOP C;  3ZN4 A;  3MDP A;  2KR2 A;  4NIA A;  4QX0 A;  3R0R A;  1PM4 A;  5H9S A;  1DGW A;  3LIH A;  1IGO A;  3LFI A;  2WZR 1;  4JGY A;  2ZKN A;  3HT1 A;  4Y1V A;  5C5U A;  3H7Y A;  4UAP A;  4FBF A;  4IGP A;  3OEB A;  3OUJ A;  1PO2 3;  4YYO A;  4N9H A;  1O4Y A;  2J7M A;  1SBF A;  5JZG C;  4MXW A;  1F31 A;  2QQU A;  2VQT A;  5T5P A;  3THC A;  3OYW A;  4RR3 C;  2D3P A;  4OYU A;  1D4M 2;  2RS5 1;  1XXN A;  2E51 A;  1FNZ A;  3H0O A;  1XE7 A;  2ZZQ A;  2WO2 A;  1AXZ A;  1WMX A;  5K8S A;  3UNP A;  3JZV A;  4LK7 A;  5DDJ 3;  1GR3 A;  5IK4 A;  1KDK A;  1PVC 3;  2BYV E;  4MZU A;  5GJ6 A;  2VCB A;  2RMU 1;  4Q29 A;  4FPY A;  4AXO A;  3RDI A;  3HOB A;  5FZG A;  2VMH A;  1W6M B;  4NJ4 A;  4YLZ A;  5I0R A;  1W6M A;  4PIZ A;  3GJA A;  4IEY A;  5FMD A;  3WQ7 A;  4FQ4 A;  4PT6 A;  3ZYR A;  2D97 A;  3VZM A;  3WT3 A;  4QPG A;  1V6M A;  3Q8F A;  5FYC A;  4E9K A;  1VLN A;  4QGM A;  2G19 A;  1PO2 2;  1RJ7 A;  3FUQ A;  1OD3 A;  2JE7 A;  4XAE A;  2EVX A;  1D4M 1;  2VD7 A;  2X29 A;  5FZ1 A;  1OLR A;  4LO8 A;  2OUJ A;  3RZK A;  1PHM A;  3DEM A;  3CBN A;  2R0F A;  4N43 A;  4P9Y A;  3H8U A;  4DPN A;  3IIA A;  1ZZ8 A;  3B01 A;  2VZR A;  4XZP A;  3U0Z A;  1LHO A;  5FY9 A;  1DYO A;  1JHN A;  1IPK A;  1QNW A;  2DVB A;  3MIG A;  4AQ2 A;  2UWA A;  4MUV A;  3U07 A;  5FZC A;  1PO1 3;  1RL3 A;  2IXK A;  1ZRD A;  3QH6 A;  3AMN A;  2DCZ A;  3BOW A;  1P8J A;  3WOG A;  1QWR A;  4NMI A;  1O91 A;  1UWW A;  1N1V A;  4N8M A;  1QIQ A;  5DG1 A;  5GZG A;  4BYY A;  3ELN A;  4RQP B;  1GQG A;  1W6O A;  3SHR A;  1DGR A;  4RQP A;  5BNO B;  2QZ2 A;  1NA1 C;  3FWE A;  1UPS A;  2Y34 A;  1PO2 1;  2IXL A;  3C7E A;  3OGG A;  4AW7 A;  3CJX A;  1O3R A;  3WHT A;  3ZFG C;  2ZX3 A;  4E8C A;  3CMG A;  1PMH X;  4JHZ A;  4JQR A;  4AI2 A;  1LOD A;  1KQR A;  3I2O A;  4QDQ A;  2E9Q A;  3AP5 A;  3KVA A;  3I3M A;  4CDQ C;  4BQ1 A;  1LJ7 A;  2FDI A;  3C8X A;  3AMH A;  3F95 A;  2XBO 3;  4J6G A;  4IE0 A;  4CDW C;  2IFR A;  2WLQ A;  4JVA A;  4AG4 A;  3WIN E;  3BAL A;  4CDX C;  3VBO C;  1SLL A;  3FHI B;  1QH6 A;  2W39 A;  2Q8E A;  1SPP B;  1DQ4 A;  4N53 A;  3OUI A;  1SPP A;  2JDM A;  3HMY A;  5L9V A;  1PGS A;  1YQ5 A;  4QGN A;  2GC2 A;  4LLF A;  1UU5 A;  4KG8 A;  5F8P A;  1N3Q A;  2ZTN A;  3VBU B;  3PUQ A;  3T0A A;  1ULC A;  3VBU A;  3VZK A;  4A7K A;  2VUA A;  2GU9 A;  2YPJ A;  2YV8 A;  3FHA A;  3H7J A;  1NCR A;  3WDY A;  4XJU A;  4KNC A;  2R49 A;  1PO1 2;  3ZXF A;  4OVE A;  4U2A A;  3DV8 A;  2JD4 A;  1LB2 A;  1V0A A;  1H6Y A;  4DXS A;  1MS8 A;  3KGL A;  4TXW A;  1VE0 A;  1RMU 3;  5L9B A;  4XE9 A;  4MG2 A;  1MAC A;  4IW3 A;  3DYO A;  2ARC A;  5FUP A;  2VCM A;  2RR1 3;  3O1S A;  2JG8 C;  1C8M 2;  2B4K A;  3VV1 A;  3UGH A;  5ACA 2;  1PM7 A;  1DIW A;  4NOT A;  5IT6 A;  2VW1 A;  5DZE A;  3BKZ A;  3ILF A;  4BLJ A;  2E53 A;  4CEW B;  4DRR A;  5M0T A;  1DCS A;  2W46 A;  3K51 A;  4XUO A;  1W05 A;  2LAL A;  3FHQ A;  3RQ0 A;  2DYC A;  1Q8V A;  1A78 A;  5LRR A;  2XBO 2;  1IHM A;  2XLF A;  5A7P A;  3KHC A;  5EWS A;  1D2S A;  1GP6 A;  4QXH A;  1ODN A;  2HWC 3;  4YNI A;  1FAY A;  1PK6 C;  1V6L A;  2WAO A;  4N9I A;  3U11 A;  1F5J A;  4JZR A;  2XQR A;  1AR7 3;  3ACH A;  3C2U A;  3ZSL A;  3OPZ A;  1O5U A;  3J8F 1;  1TME 3;  1PO1 1;  3NAP B;  4GWN A;  4OI2 A;  1GYK A;  1OKO A;  1X9P A;  3R4D B;  2RM2 2;  3WG1 A;  3ETQ A;  4CUB A;  2VCA A;  5D2A A;  1LOE A;  5FMO S;  5TSW A;  4MX3 A;  1U5Y A;  1IQA A;  5F3C A;  2ET1 A;  1C8M 1;  1RMU 2;  2DVA A;  2WWJ A;  4XFA A;  4QXB A;  5ACA 1;  2BER A;  5IHR A;  4AGR A;  2RR1 2;  3ZYI B;  5F2S A;  1WMF A;  1W6P A;  1N1Y A;  1T6G C;  2D3S A;  5FP4 A;  1HRV 3;  1SFN A;  3IAP A;  5I8S A;  5HV0 A;  3NRU A;  3A4U A;  1QY4 A;  1IPJ A;  3VBF C;  3VLB B;  3I3Q A;  4E4Z A;  4CUG A;  3VL8 A;  2XBO 1;  1APN A;  5J1X A;  3WF1 A;  3JB8 A;  4IGQ A;  1WUV A;  3WG2 A;  4EZH A;  1WCS A;  2VTX A;  2XWB B;  4KU8 A;  1L7L A;  1ULO A;  5I93 A;  2OXB A;  2UY9 A;  2VOX A;  3WF3 A;  2CWM A;  3L2Y A;  3W58 A;  2DVD A;  2HWC 2;  4QWN A;  5I0D A;  1C3H A;  4Q4X 2;  2RDN A;  1E57 A;  3UKN A;  1AR7 2;  4AOC A;  4LOS A;  3JBG 3;  2RM2 1;  2YRO A;  1S0C A;  5F5I A;  4Q4V 2;  5JI7 A;  3KCY A;  4DEV A;  3VD4 A;  1UAI A;  4K20 A;  2F4P A;  2D6M A;  4LHS A;  4HVR A;  4R9B A;  1QU0 A;  1WA6 X;  2X09 A;  2QCS B;  2BPA 2;  4DXR A;  2JDA A;  2V09 A;  3LEI A;  2AC1 A;  2BOJ A;  1YCI A;  2VQU A;  3AMP A;  4LR4 A;  1C57 A;  2RR1 1;  3O12 A;  4YGE A;  3VD5 A;  2XGX A;  1V6I A;  4IEQ A;  3ZMO A;  1RTV A;  2AZ5 A;  4XYX A;  5T5J A;  5CFD B;  1FPN 3;  5CFD A;  1ZA4 A;  1BVP 1;  4NAM A;  1W9S A;  1OA2 A;  1S0F A;  2PHT A;  1TG7 A;  3RPQ A;  4DY3 A;  3O1T A;  2Y60 A;  4OI4 A;  1ENX A;  1OFN A;  5FJK A;  3RYP A;  2EIE A;  3POF A;  2WN2 A;  5F6L B;  1GV9 A;  3R05 A;  3OJB A;  1PIV 3;  4XDP A;  1JZ3 A;  5FZH A;  4AFD A;  2HWC 1;  4BME A;  4COY A;  3C7H A;  2YXS A;  2PHX A;  4FQZ A;  1UYZ A;  4Q4X 1;  1AR7 1;  4HAN A;  1O3T A;  3E6B A;  4FOQ A;  4HN0 A;  3AZX A;  3A0N A;  3C7O A;  4OZO A;  3PHM A;  3ENR A;  2WKK A;  4JTO A;  4Q4V 1;  4M3C E;  2DV9 A;  2O14 A;  1VP6 A;  4NID A;  5IVY A;  1YLL A;  3WDU A;  1U5I A;  3JBG 2;  1GU3 A;  2DWR A;  2Y6L A;  5EYX A;  2BBA A;  5AFB A;  4DO0 A;  5BNP B;  1FX5 A;  5BNP A;  2BZD A;  3HN3 A;  2ZZJ A;  4HET A;  1AL2 2;  2IFW A;  2XH6 A;  3GJB A;  3OBT A;  1X82 A;  2OS2 A;  4LQR A;  5EV7 A;  3BU0 A;  1CAX B;  4IXL A;  1CAX A;  2GNM A;  3D6E A;  2VQA A;  4RFR B;  4NO4 A;  2JEC A;  3D8C A;  1GBG A;  1W0N A;  1O8S A;  4QX3 A;  2Z42 A;  2QJV A;  3HT2 A;  2H0B A;  5HCB A;  2JWP A;  1ULD A;  2WNO A;  1FPN 2;  4A41 A;  5E88 A;  2IXH A;  1JUH A;  4B7K A;  1C28 A;  3IT8 A;  1US2 A;  4AFB A;  1G7Y A;  5FYI A;  1GAN A;  2G9Z A;  5FZO A;  1AYN 3;  4I3P A;  4A6S A;  4Q0U A;  4JGZ C;  2NN8 A;  3A22 A;  2GAU A;  2ORX A;  1UL9 A;  3KLS A;  5EHD A;  1W3V A;  1RGS A;  4W6W A;  2J1U A;  3BYW A;  3WP6 A;  5G05 L;  4XTM A;  1XOY A;  1KJL A;  2GZW A;  3U4S A;  1FI2 A;  2D5F A;  3RGB A;  1AL2 1;  3PTR B;  2WT2 A;  2ZGU A;  3H1Y A;  1GNH A;  3O1V A;  4OCT A;  2IVI B;  4CEY A;  1SHW B;  3NNL A;  2W95 A;  1Z7S 2;  5FZA A;  4YZ4 A;  2BVV A;  4RGA A;  4G3Y C;  1S55 A;  4LHL A;  1YQ6 A;  4BIS A;  1FPN 1;  2VE1 A;  3IDC B;  4IV3 B;  3AL5 A;  5LAT A;  4ZS2 A;  1L7Q A;  1QXR A;  1WCK A;  2QQK A;  2XJR A;  2ZCW A;  3BOP A;  3VL9 A;  3WQ1 A;  3LQC A;  1UKR A;  1W28 A;  4HK9 A;  1WBF A;  2HEW F;  2TBV A;  1NQJ A;  3PU3 A;  1KFU L;  1B35 C;  1MS4 A;  1LOC A;  3OBR A;  5LEK A;  1HIX A;  4YM2 A;  3WF0 A;  1LOA A;  2VZV A;  2WNU C;  2J1R A;  4XDQ A;  1POQ A;  1QF3 A;  1TE1 B;  1UO9 A;  4K40 A;  2GC3 A;  3T2Q A;  1CIW A;  2B9V A;  1ZBE 2;  3CNA A;  5JMO A;  4MGT A;  1UU6 A;  1ND3 B;  2WAA A;  1HQW A;  2W47 A;  3HNM A;  1QMJ A;  3V0A A;  4OQ8 A;  4I0W B;  1IPS A;  2HEV F;  4MET A;  2CV6 A;  4UT5 A;  4CU7 A;  4PF1 A;  5A7Q A;  3E5Q A;  5K4L A;  5HCH A;  1RXF A;  3MI8 A;  1GZW B;  1CJD A;  1Z7S 1;  2A3X A;  4FO9 A;  4FP2 A;  3MLK A;  2X5I C;  3ZPO A;  4GMP 0;  2JXA A;  2NP0 A;  1CPN A;  3AX4 A;  3LF7 A;  3T08 A;  4IDZ A;  4CXX A;  4ATF A;  4NHM A;  3ON7 A;  1CD3 G;  2P3I A;  4WZF A;  4CUA A;  5DXD A;  1OPO A;  1QJX 3;  3CF6 E;  5CKN A;  1DGR N;  2W2I A;  2NYY A;  2YHJ A;  4AED C;  2JJ6 A;  1S0G A;  4NWW A;  2SLI A;  2ZHK A;  3ACL A;  1AX0 A;  4YVW A;  5CFC C;  3ZFF C;  3D82 A;  3EJK A;  4P14 A;  1ZBE 1;  2BWC A;  1DBN A;  3I2J A;  2H6B A;  1Q8P A;  4AHW A;  3P3P A;  3BI3 A;  1R1Z A;  1HB4 A;  2QQN A;  3IMM A;  4AI8 A;  4YZ5 A;  3VBH C;  4XJW A;  5D8A C;  3FLT A;  2WYS A;  1OOP B;  3B9I A;  4PBO A;  2P3K A;  4WVV A;  5FLI A;  4KU7 A;  4S2G A;  4FFH A;  3O5S A;  2VNR A;  1Q8S A;  1Q56 A;  2YYO A;  1SFY A;  5KR7 A;  2ZHM A;  3KWV A;  4DS0 A;  5CNA A;  2Y0O A;  3D5O A;  2ATF A;  5C70 A;  2GMM A;  4QX2 A;  5JZG B;  3I97 A;  2QVS B;  3U10 A;  4KGG A;  2FCU A;  5J7M A;  5FZM A;  2XLA A;  5D21 A;  2QQI A;  4YVS A;  2VBB A;  4MXV A;  1DQ1 A;  5C3R A;  2BOI A;  3HPN A;  1LEC A;  2JKB A;  3WUC A;  4DXT A;  1PNG A;  3MV0 1;  4JTN A;  1SG3 A;  1QJX 2;  4AWD A;  4LHK A;  3MIC A;  1BJQ A;  2E33 A;  4XAB A;  2HWE 3;  5GZD A;  3KHB A;  3POS A;  1KDM A;  4YFW A;  2UWC A;  1UIK A;  5H9P A;  4YG0 A;  1X9T A;  2DU1 A;  4ZXE A;  3M1H A;  3NNG A;  4CSW A;  3BTY A;  2EIB A;  4UXA A;  3VUO A;  1RUH 3;  2WFF 1;  2DBN A;  4H2A A;  4XJA A;  1X50 A;  5KHJ A;  1VBB 2;  1O59 A;  3VKO A;  3KV6 A;  2R04 1;  2A1X A;  2CDP A;  3N9L A;  4BQ2 A;  2ZGN A;  1MQT C;  5JDB A;  4IEV A;  4E2G A;  4QPW A;  3GZE A;  5FZD A;  2YBP A;  4E4D X;  3L2H A;  2TEP A;  3O1M A;  2C4X A;  2JE8 A;  3ZSM A;  2WQ4 A;  5FOB B;  2PN5 A;  1YHF A;  1RUJ 2;  3JD7 3;  5JMC A;  2XON A;  2Y8K A;  4FPG A;  4OZX A;  1QJX 1;  2JDK A;  4Q26 A;  4YWA A;  5K0U C;  1RIT A;  1SDD B;  3RNS A;  3NJY A;  4XQD A;  1UY0 A;  2A6Y A;  5FYT A;  1F5F A;  4FAG A;  1OQ1 A;  4CYD A;  1SBE A;  5IVJ A;  2HWE 2;  3PNA A;  3RRD A;  1M4W A;  1WLW A;  2QDN A;  2XUM A;  4AI1 A;  3GBW A;  4Y4Y A;  2B5H A;  5GLZ A;  4LOT A;  3VKL A;  4BQ5 A;  4DQA A;  5JSR A;  4AFC A;  1VBB 1;  1A6C A;  2R6Q A;  3BPZ A;  1OUS A;  4PF5 A;  2EF6 A;  4Q0P A;  4Y1U A;  4O9E A;  2QQO A;  1CON A;  2VZS A;  4P5Y A;  4R9A A;  4RGG A;  1NA1 B;  1DYK A;  2ZHN A;  3LSE A;  3LWC A;  3IB3 A;  4MHR A;  2Z79 A;  5JXJ A;  3UKT A;  1NYW A;  1EUT A;  1TVG A;  4Y5Z 0;  1A8D A;  1SLC A;  1K5M C;  2C26 A;  3D0S A;  3ZFG B;  4OHX A;  2KA3 A;  3O1R A;  1E5S A;  2OII A;  4ATE A;  4ZZ5 A;  3QH7 A;  1AR6 3;  1LOG A;  1RUJ 1;  4GH4 C;  4ZU5 A;  1MZF A;  2ZGT A;  3J4U H;  4EQV A;  3B02 A;  4GWI A;  2CTV A;  1LU1 A;  3FUO A;  1JOB A;  1X7N A;  3ZO0 B;  2W9X A;  1D7P M;  4XJ9 A;  3JD7 2;  4FFF A;  3ZSK A;  4ZU7 A;  2ETE A;  2VAU A;  1I5Z A;  4KH9 A;  4JQT A;  1MS0 A;  5HBA A;  2I2S A;  5FPX A;  4RS5 A;  1PZ8 A;  4IV1 C;  3VBO B;  3ZDV A;  4P9X A;  1Q3E A;  4HVQ A;  1G9C A;  4V1P A;  2HWE 1;  3OGV A;  5B4N A;  2HBT A;  4QPI A;  1W6Q A;  1RUC 1;  4EN8 B;  3MIF A;  4LKD A;  4D6S A;  4XMI A;  1AHS A;  2B45 X;  2DTY A;  4TSV A;  2Y6F A;  2PMW B;  3LA2 A;  5LBF A;  4OUM A;  3SCH A;  2E63 A;  1XBF A;  1J3R A;  2XKO A;  3S5A A;  3AFK A;  2PAM A;  5KHK A;  2D44 A;  1URX A;  4FTS A;  4RHV 2;  3ZYJ B;  4RL7 A;  2PXJ A;  2O8O A;  4HSL A;  1UCX A;  5E1R A;  4CXW A;  5A7S A;  5IUQ A;  5FWJ A;  3H3L A;  4GXL A;  4HG6 B;  1NG0 A;  2CWS A;  1UIJ A;  1ULF A;  5FY4 A;  3KZ4 C;  4GZ9 A;  4D7Y A;  2JG8 B;  5C6C A;  5ANQ A;  3PLQ A;  2V5D A;  4H55 A;  4ZHN A;  3THD A;  3ZYP A;  3Q8C A;  1ZZ6 A;  5FZF A;  4UFH A;  2WZP P;  1AR6 2;  1YEW A;  3JD7 1;  5JAX A;  1LGN A;  1U0A A;  1VBD 3;  1A3K A;  4DFS A;  1N1S A;  1NZC A;  3DN7 A;  4COW A;  4C1W A;  1NE6 A;  2XQX A;  4N7U A;  5AVP A;  2RS3 3;  3ECQ A;  2D6N A;  2D43 A;  4IEW A;  3PUH A;  5J09 A;  4ET7 A;  1PK6 B;  5KHH A;  2QQV A;  1AYM 3;  1R1A 3;  2YBK A;  4Q27 A;  1S2E A;  4MAD A;  3URF A;  2W1Q A;  4BZ4 A;  2E7Q A;  1VAM A;  3LFM A;  4PI2 A;  4RHV 1;  5E6H A;  2P17 A;  2YU2 A;  3NKT A;  2YU1 A;  3WP3 A;  5IYY A;  1DGL A;  3PJY A;  1JW6 A;  4AFA A;  5LK7 B;  1WME A;  3ZXE A;  5G04 L;  3WNL A;  1RHI 2;  2NQY A;  2Y64 A;  1AR9 3;  5JSP A;  3WHU A;  1RJ8 A;  2D98 A;  3AJY A;  2KXL A;  1S0D A;  5DAP A;  1W2A X;  1AR6 1;  2QE3 A;  4IER A;  3MBW A;  4Q8L A;  5JSO A;  1OKQ A;  4AYU A;  3ZYG A;  1CWP A;  4OHY A;  3WVJ A;  5GAL A;  3IM0 A;  1QJF A;  3VBF B;  2ARB A;  4FOW A;  3SXW A;  4LBQ D;  1VBE 3;  3V0B B;  2A3Y A;  2GP3 A;  4P08 A;  2OX0 A;  1VBD 2;  3HIF A;  4B1L A;  1UW8 A;  1IKP A;  4CA9 A;  2RS3 2;  1JBC A;  3RI8 A;  5F1R A;  5FO8 B;  4TLG A;  1DQ0 A;  4Z2W A;  4C0B A;  5HCF A;  1R64 A;  2VUC A;  4Y1Y A;  2GN3 A;  4LBQ A;  1QJZ A;  1UZV A;  4JDM A;  2K46 A;  4AF9 A;  2A71 A;  2A73 B;  2W1U A;  2W68 A;  2XJT A;  2JX9 A;  3VBR C;  2QFE A;  3IPV B;  4C91 A;  5C3Q A;  1WZX A;  1RHI 1;  1YO8 A;  5T55 A;  2W08 A;  2JB4 A;  2RS5 3;  3VDD C;  2G4I A;  4JX0 A;  3TEZ A;  2Q1M A;  4EWE A;  5F6K A;  1AJO A;  2ILM A;  3IDE A;  2QQM A;  3AXE A;  4I02 A;  2AEN A;  4D7T A;  4CCN A;  1UMI A;  2V4A A;  1WKY A;  3CZJ A;  5FZE A;  1MS5 A;  3BIW E;  4YW5 A;  1YI7 A;  2QQL A;  2EXJ A;  2ZEY A;  3AK0 A;  2IVJ A;  3ZLI A;  4C8D A;  1LOF A;  1Q8O A;  2RMU 3;  3LDR A;  1QNY A;  4LBN A;  2IUW A;  1VBD 1;  4KL1 A;  2A6V A;  3SEP A;  1W90 A;  1W0O A;  4E4H A;  1JYN A;  2C24 A;  1VBE 2;  1EP0 A;  4JRA A;  4FXG B;  2RS3 1;  5FYH A;  2WLP A;  3RMY A;  2HWB 3;  3RZZ A;  2VW0 A;  5FYM A;  2CY6 A;  2VMC A;  4K21 A;  2OQ7 A;  1BEV 3;  5A6Y A;  3MPB A;  1OH3 A;  3H3Z A;  3K46 A;  4HOO A;  4I30 A;  5C4W C;  2C1F A;  3G7D A;  3ES1 A;  2HWF 3;  1AR8 2;  4AL9 A;  1CJP A;  1AL0 G;  2PHF A;  1K45 A;  5FPA A;  1GOH A;  3VDC A;  5A3L A;  4X8P A;  1D4M 3;  5GLV A;  3MF6 A;  2FQP A;  2VMG A;  4QHB A;  5LY2 A;  1PZ7 A;  1W04 A;  3RYR A;  2MPF A;  2VQ0 A;  3UKV A;  4G4F A;  3NJV A;  1VB2 A;  4FTB A;  1S1A A;  1BQP A;  2RJ2 A;  3H42 B;  3Q8E A;  4YGD A;  5A70 A;  4QB2 A;  2JIC A;  1Q5O A;  5FCC A;  5FZ3 A;  1DG6 A;  3T2P A;  4PIY A;  5ISL A;  1ST8 A;  3LE0 A;  4JCK A;  5DG2 A;  5F2W A;  5BNN C;  3S57 A;  5C3O A;  1D2Q A;  3IZO A;  5DQ0 A;  4EN0 A;  2XHK A;  3VDB A;  2QTW B;  2VJX A;  1EY2 A;  5C33 A;  4FOY A;  5HXM A;  4Q5O A;  2WII B;  1V70 A;  4LXL A;  4CTE A;  4PDW A;  1GNZ A;  1YNA A;  2IC1 A;  2HWB 2;  2Q0A A;  2VVE A;  1W8U A;  4JGZ B;  1BEV 2;  4AVS A;  4QDS A;  1AR8 1;  4XOG A;  3ZN6 B;  4XBQ A;  3VB9 A;  5JI9 A;  2PQS A;  2XUE A;  1OVP A;  2VMF A;  3FBM A;  4CVU A;  2HWF 2;  1DFQ A;  5IVF A;  3SCG A;  1CVN A;  2B46 X;  3M3O A;  1W8H A;  1ZRR A;  3AM2 A;  1FT9 A;  2BFU L;  4XVH A;  1LGC A;  4K3U A;  4X6Q B;  2HYK A;  3K4D A;  1LU2 A;  3I54 A;  5DN2 A;  3ZMN A;  2AEY A;  1WCD J;  4M3C F;  2LTN A;  4J1X A;  1Q43 A;  3O0X A;  5A3O A;  3DCQ A;  5AC9 3;  4HLT A;  3CJI C;  3WCR A;  5J48 A;  1YQ2 A;  3D0J A;  1QOS A;  3OD4 A;  4AR2 A;  1GWK A;  2I45 A;  1JUI A;  3VKM A;  4ZZ8 A;  3CHX A;  1OA4 A;  5FXV A;  1B35 B;  3MF9 A;  2HWB 1;  5FZ9 A;  5FPU A;  2CDO A;  2WNU B;  2FZ2 A;  3O7O A;  2WNU A;  2ZML A;  1BEV 1;  4LUL A;  1XJA A;  2DU0 A;  3EBR A;  5EYY A;  2QKD A;  3NV2 A;  5FO7 B;  1YUD A;  2HWF 1;  4LKS A;  3A23 A;  4BH9 A;  3KQR A;  4P9L A;  4XC9 A;  1WCU A;  3OY8 B;  3ZSE A;  3WW1 A;  3ZSJ A;  3OY8 A;  2JDU A;  2BQP A;  3WW4 A;  4OFG A;  4K9S A;  5EJZ B;  5JIA A;  5DUV A;  3OB8 A;  1RB8 G;  2X5I B;  2XJV A;  2UYB A;  3CKH A;  1XU2 A;  1N3P A;  4MGK E;  1QJY 3;  2Y6H A;  2ZEX A;  4BQ4 A;  2NMN A;  4IND A;  1GLH A;  2RV9 A;  1BLZ A;  3P5B A;  2D7F A;  3OUH A;  1I3H A;  2HLE A;  1T2X A;  4QXC A;  5JVV A;  4A3X A;  3FLP A;  1JTZ X;  1LTE A;  1W3X A;  4F83 A;  5AC9 2;  4NUB A;  4YW7 A;  2ZBJ A;  4AED B;  4CCK A;  3LOB A;  2NZ9 A;  4LOR A;  2VM9 A;  2VZO A;  4JDN A;  1O7F A;  4Q0S A;  4XFI A;  3J8F 3;  3SH5 A;  4GB3 1;  1LEM A;  5FYY A;  2PYT A;  5CFC B;  3ZFF B;  1JMU B;  3IBM A;  2YGM A;  5LB6 A;  4ZPI A;  4I0A A;  1JZ6 A;  1HRI 3;  3WX5 A;  4NIH A;  2QBX A;  5KWR A;  4XF1 A;  3ZYF A;  3OGJ A;  5BNO A;  2B8M A;  3DKW A;  4UFL A;  2E26 A;  1MR5 A;  5LA2 A;  1C8M 3;  5ACA 3;  3RVH A;  5AVA A;  4XBL A;  3AZW A;  1BKZ A;  2GP5 A;  5L19 A;  5EP9 A;  3W5N A;  1AVB A;  3ILR A;  5HI0 A;  2ZAA A;  1AUY A;  3BTA A;  1SCR A;  4AHZ A;  4J1W A;  2Q8D A;  5FBJ A;  4PLN A;  2H0V A;  3MZH A;  4XW3 A;  1CZT A;  2DVG A;  2BNN A;  2QQJ A;  3FC0 A;  4Y4R A;  1Q8Q A;  4AI9 A;  1X8E A;  3ETP A;  5FFO C;  1GFF 2;  1QJY 2;  5AC9 1;  4QU1 A;  3NJX A;  3AYE A;  1CR7 A;  4I01 A;  5F3G A;  2VUL A;  3KV5 A;  4FVV A;  2P2K A;  3SEE A;  3VHP A;  2X53 S;  3VKF C;  3JUU A;  3EYP A;  3BOD A;  4B4P A;  1JYX A;  3CEW A;  4L0P A;  5T50 A;  3ZXA C;  3ZXL A;  2YC2 A;  1EV1 2;  4FI9 A;  4QGL A;  2RM2 3;  3J8F 2;  3VGI A;  3M3C A;  1UXZ A;  5GLU A;  3VN4 A;  3ZM8 A;  5LY1 A;  2FMY A;  4ES8 A;  4QT6 A;  1BMV 2;  1YJK A;  3FZ3 A;  2PAK A;  3C7F A;  2P37 A;  3H50 A;  2ZS6 B;  4UBG A;  2XVL A;  2ID4 A;  1HRI 2;  4R8H A;  4XPV A;  1KFX L;  4UWD A;  2YGL A;  2YG0 A;  2N7G A;  3UL2 A;  3KV9 A;  1FMD 2;  4LIU A;  4W65 A;  1HW5 A;  5DMY A;  1ZRC A;  1WMD A;  2VW2 A;  3J7L A;  3P6B A;  4FXK B;  4I09 A;  4YRD A;  1MQT B;  1PMJ X;  2UU8 A;  5T5O A;  3ASI A;  1L7R A;  4F7Z A;  1C8N A;  4CEW A;  1H1I A;  1QOT A;  5FAX A;  4DUX A;  1NCQ C;  1E5I A;  1QJY 1;  4Q1P A;  2AR6 A;  1EPZ A;  1WWY A;  3I7D A;  4E4S A;  4N90 A;  3MGU A;  4P5H A;  2ZX2 A;  3F2Z A;  2RS1 2;  3VHN A;  4JRL A;  4Y24 A;  1HB1 A;  4QPY A;  1OD5 A;  3I49 A;  1WGP A;  4GA9 A;  4Q4X 3;  3AYD A;  1W2U A;  3H1M A;  1EV1 1;  1MS3 A;  4GAL A;  3CDZ B;  4QKF A;  4Q4V 3;  1WW6 A;  1XSQ A;  3NAP A;  4NVP A;  2WJS A;  3HQX A;  3SH4 A;  1IZ3 A;  1VMJ A;  3WG3 A;  1BMV 1;  3EMR A;  3LDB A;  2J1T A;  2VEC A;  2JDN A;  2Y38 A;  2J1S A;  1HRI 1;  3N9O A;  4XDO A;  4DUW A;  3HAG A;  1CGP A;  2ZXQ A;  1J58 A;  4D69 A;  1FMD 1;  4GKX A;  4QQP A;  1ODM A;  4JKK A;  3N9N A;  5FYB A;  4KBB A;  4QX8 A;  3TAY A;  5FY5 A;  3TNQ A;  3VHR A;  4EE2 A;  2ES3 A;  2WBK A;  2JG9 C;  1UD1 A;  3CL1 A;  4XXA A;  5FDB A;  1R09 2;  2P5B A;  3K2O A;  3N9P A;  2ZGP A;  1HJG A;  4Z07 A;  3SIT A;  5DAV A;  2I07 B;  1RUO A;  5A3N A;  4WV8 A;  2CYF A;  2RE9 A;  2JIJ A;  2FZ1 A;  1H0B A;  4MV2 A;  3I8T A;  4BWO A;  2RS1 1;  4CP0 A;  1GZ9 A;  2Q30 A;  5FLJ A;  5T5L A;  3UET A;  2PTM A;  5EQU A;  5FQ0 B;  4B4R A;  3V64 A;  4ARX A;  4R52 A;  5IJR A;  5FQ0 A;  3AZY A;  5T54 A;  4D3W A;  4Y5T A;  4DMI A;  4GIQ A;  4IV1 B;  4JHT A;  4D7S A;  2D6P A;  2X8K A;  1YIF A;  3PUI A;  4N7I A;  3DL3 A;  1VAL A;  4BMB A;  4XJZ A;  3WNK A;  3SMH A;  1WD4 A;  3I4I A;  3WEZ A;  5F7U A;  4B4Q A;  1AL2 3;  3POG A;  2GNT A;  3MW4 A;  5AFE A;  5CU1 A;  3WNM A;  4DIQ A;  1V6O A;  3T4H B;  5K7P A;  4BA6 A;  2D40 A;  4Y3O A;  2BVB A;  5BY5 A;  4ORF A;  3HJR A;  1R09 1;  4LO6 B;  2JKX A;  3H3U A;  5FIX A;  1FOD 2;  1YIP A;  5CG9 A;  1MVE A;  1H8T C;  2LRP A;  2P3J A;  1ZZ9 A;  3DXU A;  4GWJ A;  3TWI A;  3WQ0 A;  3JQX A;  5DPN A;  3E5U A;  2FD8 A;  1RUE 3;  2VNG A;  2FBE A;  5C8W A;  3H8X A;  4HMZ A;  5E16 A;  2ERF A;  1YFU A;  4WVM B;  2JE9 A;  2CAU A;  4FPC A;  4WVM A;  3USU B;  3MIB A;  3PVB B;  4MH0 E;  2KD7 A;  3OCP A;  3USS A;  1SLB A;  1XYN A;  4OHZ A;  4H7L A;  2QZ3 A;  2XKP A;  1M06 G;  2X05 A;  4S2D A;  3N7L A;  3WXP A;  1OXC A;  4WBB A;  2Q8O A;  3CO2 A;  3ZDS A;  4COV A;  2DUO A;  2LS6 A;  5HPO A;  2JB8 A;  1I6X A;  4HKL A;  4Q1R A;  1KD7 A;  1QDO A;  2PLV 3;  5LWB A;  5ABJ C;  4Y1X A;  5GKA C;  1OT5 A;  1Z7S 3;  3III A;  4TZD A;  3WNN A;  4LIV A;  2EXK A;  3ZVX A;  5F5C A;  3VZL A;  4X6R B;  2VMI A;  3HEI A;  1S2B A;  1FOD 1;  1MS9 A;  1CPM A;  2CU5 A;  2VO5 A;  4XCA A;  5JR2 A;  3W5M A;  3PIG A;  2CGP A;  3B7M A;  2VTF A;  5FTT C;  3CQO A;  1GZT A;  4C90 A;  3MUZ 1;  2J22 A;  4TWT A;  4XFH A;  1GNY A;  3N7M A;  5L9R A;  1FV3 A;  1V9U 1;  4XHX A;  4YFZ A;  3HWJ A;  4IQP A;  3BTX A;  2DUQ A;  4IUG A;  5H9Q A;  4KWL A;  1J84 A;  4CCD A;  1XPW A;  1RUE 2;  4MO3 M;  1CAV B;  4BDV B;  2A70 A;  2WZ8 A;  1CAV A;  1ZBE 3;  4W50 A;  4WM8 C;  3ST7 A;  2QDR A;  3WZ1 A;  3GZU C;  4I2O A;  1H4G A;  5FZK A;  1JHJ A;  3I59 B;  2HWD 2;  2B39 A;  2LUW A;  4CE8 A;  1ZNP A;  3IDB B;  5L7O B;  3DPR C;  4MGQ A;  4GMP 3;  5L7O A;  5H9R A;  4XQW A;  3R6S A;  4L9B A;  4XIL A;  4OUL A;  3APB A;  4FSJ A;  3B5L B;  5IVE A;  2OT7 A;  5FZB A;  2WL1 A;  2ZGM A;  5APA A;  4OQ9 A;  4H14 A;  2PLV 2;  2ET7 A;  5JLV A;  1PX3 A;  4A2U A;  3MLJ A;  1K12 A;  4L92 A;  2YZ4 A;  2UWB A;  3NW4 A;  4M00 A;  3ZIW A;  3HBK A;  5FRE A;  3VBR B;  1HV1 A;  1XNT A;  1OLM E;  3IWZ A;  1US3 A;  4ONU A;  4EWA A;  1TZO A;  3N36 A;  1N1T A;  4M4P A;  3WW3 A;  5C71 A;  3ZKY A;  3UV9 A;  3VDD B;  2XJP A;  4IV3 A;  4JGY C;  3VDD A;  1CIY A;  3T3Y A;  2C0Z A;  4ZY9 A;  4QXK A;  1HQN A;  2VG9 A;  2DCT A;  3NKG A;  3GM8 A;  1RUE 1;  4NHY A;  3J9S A;  4LK6 A;  1VBC 3;  2OVU A;  4K8F A;  5CKM A;  3UES A;  2PHD A;  2HWD 1;  1SAC A;  3K4Z A;  4YSF A;  5F39 A;  4ZON A;  5FWE A;  1DZQ A;  1OI6 A;  3DUI A;  1STM A;  2AUY A;  3AKP A;  3V65 A;  1ND3 A;  2WFF 3;  2XL9 A;  4J25 A;  4YM0 A;  4OUE A;  4UFM A;  1W0P A;  3WCS A;  5IWF A;  2PLV 1;  5C4W B;  3KV4 A;  2R04 3;  1HB3 A;  1UY2 A;  2VBD A;  3GCW A;  3QOP A;  1ASJ 3;  4UBH A;  1GZW A;  2BBV A;  5FRA A;  1GWM A;  4CU9 A;  5C9A C;  3TEW A;  3I2K A;  4R9C A;  3WD5 A;  2YFZ A;  5ANN A;  2P6C A;  5JUV A;  1COV 1;  2HH9 A;  1LCL A;  1NY7 2;  3AMM A;  4AQ6 A;  2VOV A;  4LO4 B;  2ZHL A;  2PHW A;  4QQ2 A;  3MO4 A;  2ZMK A;  3FE5 A;  4Q4Y 3;  4BXS V;  1HDK A;  3AZZ A;  3KB5 A;  1IG0 A;  3MHZ A;  4QPG C;  4OI1 A;  2AYH A;  2VC9 A;  4X8N A;  2A6Z A;  4BQW A;  5FUI A;  3FL7 A;  2FHR A;  1T6B X;  5JCT A;  3TRS B;  5JPM B;  5EPA A;  4BB3 A;  4FPF A;  1VBC 2;  3TEX A;  2XXZ A;  3POJ A;  1RYY A;  4RA0 A;  3ZFE C;  3PVO A;  2VXJ A;  2WC2 A;  4M3C B;  4P02 B;  4N43 C;  1J59 A;  1VR3 A;  3N7J A;  4HN1 A;  5FZ8 A;  1VBB 3;  4AGG A;  5FPZ A;  3ILN A;  4GMP 1;  4KWU A;  3UGF A;  1KIT A;  1OOP A;  3MEP A;  1CZV A;  2WFF 2;  2ZGQ A;  5E89 A;  4NII A;  4Y5S A;  4P00 B;  3ZPY A;  1XNC A;  2ZGR A;  3AKQ A;  4CP9 B;  3PU8 A;  1OUX A;  2VH9 A;  2R04 2;  2RJK A;  5JWP A;  1ASJ 2;  1UZ0 A;  3KMH A;  1BK0 A;  4XET A;  1DF0 A;  1NY7 1;  5JZG A;  2OYZ A;  3GAL A;  4L2N A;  5BUV A;  3AZV A;  1RUJ 3;  4RR3 B;  3NV3 A;  4RR3 A;  5KHG A;  1XRU A;  3GBG A;  4RQP C;  3PUS A;  1XNA A;  4E8D A;  1RUI 3;  3MLL A;  3T4V A;  4Q4Y 2;  1ULG A;  1WLT A;  3WQB A;  5FXX A;  3UK9 A;  3WR0 A;  4DRV A;  3CJI B;  4CU8 A;  1VBC 1;  2AAC A;  3CJI A;  4MGI E;  1VAV A;  5A32 B;  3RZJ A;  1RUC 3;  1FAT A;  3Q8B A;  2PFW A;  4DEQ A;  4IEX A;  5DAW A;  4CPB A;  1CAU B;  1W06 A;  3W59 A;  1RXG A;  1DU3 D;  1WD3 A;  1S2K A;  3KSC A;  4MGZ E;  4PIX A;  4W6X A;  1OUR A;  3D4K A;  5A6Q A;  1LR5 A;  3FFQ A;  1ZX5 A;  1OA3 A;  3OD0 A;  4N53 C;  2I74 A;  4O9G A;  4XUT A;  4DUV A;  1MEC 3;  1ZRE A;  1ASJ 1;  1YFX A;  5CA6 A;  2TNF A;  5KXE A;  4OI0 A;  2VR4 A;  4BHP A;  3VBU C;  2DTW A;  2HYX A;  4XMA A;  1W9F A;  4HXC A;  4QM8 A;  5L73 A;  3ZKU A;  2HBU A;  4MGS A;  1NCR C;  5F5Q A;  3WW2 A;  3ATG A;  5IFP A;  2NLR A;  4NRP A;  4NAO A;  4KGQ A;  3SNM A;  2EAA A;  1AX1 A;  2GAL A;  4Q4Y 1;  4QHZ A;  3OSD A;  1SLA A;  4V2W A;  1XC6 A;  1PGW 2;  1O6U A;  2RDR A;  1QOO A;  2A6X A;  1BHG A;  1RUI 2;  3M4F A;  3MIH A;  3PDQ A;  2ENR A;  2J1V A;  4O7X A;  3S30 A;  5LBB A;  3NWK A;  4CU6 A;  5A3U A;  5E8A A;  5JOY A;  1OHF A;  1UYP A;  5LBE A;  1RUC 2;  1KXG A;  5KC5 A;  4LTA A;  2WA4 A;  3AP4 A;  3H9A A;  1GQH A;  1UKG A;  1HV0 A;  3GNE A;  2V5Y A;  2MHF A;  4XUR A;  4RHV 3;  2HJI A;  2Z4F A;  4RSU A;  4FPJ A;  1C1L A;  2SBA A;  1ZRF A;  3MIE A;  4A44 A;  4AEM A;  3OPW A;  1MEC 2;  5A1A A;  1NA1 A;  1H2L A;  4WVZ A;  4RD7 A;  3VD3 A;  4HPK B;  4ITC A;  2W1W A;  1W8Z A;  3ZFG A;  3TEY A;  4MHU A;  2WO7 A;  1ND2 C;  3SQO A;  4IEZ A;  4BQY A;  1WA4 A;  3HR9 A;  3ACF A;  1LHN A;  1UMZ A;  1PGW 1;  3DGT A;  1FV2 A;  4PLM A;  4CDQ A;  4BJ0 A;  4CDQ B;  3RWN A;  1RUI 1;  4DNY A;  4CDW B;  2FCT A;  4CDW A;  3LPG A;  4XF9 A;  2J42 A;  1UU4 A;  4CDX B;  4XAC A;  4CDX A;  5LRS A;  3VBO A;  2WS9 2;  2UYA A;  3WG4 A;  3E97 A;  1CX1 A;  2C6S A;  1LHW A;  4LO7 A;  3U14 A;  1F35 A;  3POY A;  1Y9Q A;  1JYW A;  5BPX A;  1UY3 A;  1W8N A;  1VPH A;  2VVF A;  3ZXK A;  2E7A A;  3ACG A;  5KXB A;  4L8Q A;  5KHI A;  1H9P A;  4C1X A;  3NL1 A;  5CBL A;  5J37 A;  4AQT A;  5LW9 A;  1MEC 1;  1XYP A;  1RHI 3;  3SIS A;  4Q8K A;  5FP8 A;  4QKB A;  2V72 A;  4B29 A;  3IKW A;  1OQD A;  1LKN A;  5FK7 A;  2JG8 A;  1DGW X;  3KF3 A;  1UOB A;  1W39 A;  2EA7 A;  1LNS A;  1HKD A;  2R32 A;  2XLG A;  2WZE A;  4PCR A;  4XUN A;  3RFR A;  2TUN A;  1H2K A;  3NNF A;  4CCJ A;  1W9W A;  1NCQ B;  4YW3 A;  2Q8C A;  3T2T A;  2AEZ A;  1UXX X;  2XJS A;  3AXD A;  2WS9 1;  4URA A;  3JB4 C;  4YW1 A;  2EAL A;  5DUX A;  3MW2 A;  2MNG A;  2JDP A;  3OGS A;  3QAC A;  1GSL A;  5CFD C;  4BK4 A;  3AP7 A;  1D0G A;  1PK6 A;  1Y9M A;  2BDR A;  5FP9 A;  4K1Z A;  1WLC A;  1ZZB A;  2W1S A;  2Z69 A;  5IVC A;  2B7Y A;  4OLL A;  5A33 B;  1DHK B;  1UF2 C;  1Y3T A;  5A33 A;  1LED A;  1RUD 3;  3RS6 A;  3VD9 A;  1QHD A;  4H7M A;  4Y20 B;  3M8L A;  4P9G A;  3DKQ A;  1H4H A;  4Y20 A;  2GND A;  1ONA A;  3N9M A;  3EO6 A;  1F4A A;  4KBZ A;  4QQO A;  5HXV A;  5C8C C;  1JOP A;  3NV1 A;  2XL7 A;  2RDS A;  3INA A;  2JG9 B;  2RJL A;  2JG9 A;  3IMN A;  4R4Z A;  1BVV A;  5BNP C;  5A3M A;  1POV 3;  5DUW A;  1G86 A;  3VBF A;  2JDH A;  4AQS A;  2WNV C;  3DF0 A;  2F6B A;  1J3P A;  2FDH A;  3KT7 A;  4EWD A;  3QBQ A;  3V0B A;  1Z78 A;  4BQ3 A;  1HQL A;  1ENS A;  2QQP A;  1GUI A;  1UQX A;  2WA3 A;  3I3B A;  1GP4 A;  4HZF A;  4W6Y A;  2LM3 A;  4P9I A;  3HD8 B;  1NX9 A;  2Z5W A;  3K48 A;  4LUM A;  4A7Z A;  3LZZ A;  2FDG A;  4FPK A;  1AZD A;  2GDF A;  1V6N A;  4GJY A;  1AR8 3;  2Y33 A;  4CCL A;  3E6C C;  3VZN A;  2XJQ A;  3ZR5 A;  2OQ6 A;  4PHZ A;  1HJF A;  2P3Y A;  5EXO A;  3VBS C;  5IFT A;  4HFS A;  1VMF A;  1O4Z A;  1CES A;  4UFK A;  1WCQ A;  1ZRI A;  5JXI A;  1NAE A;  2CSG A;  3IPV A;  4JDO A;  1RUD 2;  4HK8 A;  4HKW A;  4M4R A;  3PME A;  1A34 A;  4GWM A;  5FZ6 A;  5BXX A;  5T3N A;  4M0N A;  1O8P A;  4AVV A;  1UOF A;  3IAQ A;  4ZXK A;  4W4Z A;  2IXC A;  1JI6 A;  1JH5 A;  2GNB A;  1QXP A;  2ARE A;  1H8T B;  4UYB A;  3RZG A;  4OMC A;  2G9G A;  3MV1 1;  3KF5 A;  1RUF 3;  1VRH 3;  4CEY C;  1BBT 2;  3T0B A;  2WUH A;  3PVE A;  5GZE A;  3VZJ A;  1OC1 A;  4G9S B;  4E2Q A;  2EID A;  3KGZ A;  2D93 A;  1W6N B;  1YRZ A;  3LEG A;  4EZ4 A;  1J83 A;  1OQE A;  1NT0 A;  5JPN B;  5FY8 A;  3POE A;  4FPE A;  3GZT B;  4BCU A;  4PBP A;  5FLH A;  1O4T A;  2VCC A;  2LRO A;  2E7T A;  3TBD A;  4EV0 A;  3ME2 A;  1C5H A;  1RUD 1;  4BQX A;  1H2N A;  1H30 A;  1UOJ A;  5SV5 A;  4K1Y A;  1J1L A;  3M3E A;  2WFP A;  2Y6G A;  4LBM A;  4D8M A;  5FPB A;  1GZC A;  4A4A A;  4DB5 A;  4BLI A;  2A3W A;  4LKE A;  3K3O A;  2KM2 A;  4XHB A;  3DYP A;  2UUR A;  1ACC A;  3C7G A;  3H1W A;  1PX4 A;  1BBT 1;  1POV 1;  1TNR A;  3ZR6 A;  3O14 A;  2WO1 A;  3BN6 A;  1SBD A;  1RUF 2;  1MZ5 A;  1UZY A;  1VRH 2;  1W9Y A;  5J96 B;  5FZ4 A;  4UFI A;  4A6O A;  1UNB A;  3WF4 A;  1DQ2 A;  4FOV A;  4GB3 3;  1O3S A;  3K4A A;  3DYM A;  4WM8 B;  4YW6 A;  2BTV C;  3KT1 A;  3N35 A;  1UX6 A;  1F9K A;  1OPM A;  3WNX A;  5LA1 A;  4JGZ A;  1JU4 A;  5DAB A;  3AP9 A;  1OSG A;  4NRQ A;  1S0I A;  3ZN6 A;  3DPR B;  3DPR A;  4AI3 A;  3FJS A;  1SMV A;  5JXG A;  4Q4W 1;  4FPL A;  1XE8 A;  4YVW C;  5CG8 A;  3JCI A;  2VOT A;  1KRI A;  4JAA A;  5ERL A;  3C3V A;  4WM7 C;  1UMH A;  2VTX J;  3MW3 A;  4AHX A;  3ALQ A;  2PEL A;  5IK8 A;  3N7K A;  3V56 A;  2VMD A;  1CN1 A;  2VNV A;  1U12 A;  1NOV A;  4EYU A;  3GGL A;  3I2H A;  4K6B A;  1YYN A;  3MYX A;  2DF7 A;  3POW A;  2K9Z A;  4JGY B;  2XJU A;  4K8R B;  1HXS 3;  2W87 A;  3K75 B;  1QGL A;  2XVG A;  1D4V B;  1RUF 1;  1VRH 1;  4TLF A;  5DAQ A;  2A5Z A;  3H8O A;  2WYF A;  4UI9 L;  4Y26 A;  4TYS A;  2HEY F;  2Z2S B;  4FT8 A;  4MXW B;  3GHN A;  4QM9 A;  3ZIX A;  2D6K A;  1B35 A;  4D6R A;  1KS4 A;  3OYW B;  1ALY A;  3LCP A;  1S0B A;  4GB3 2;  5A6Z A;  4YVS C;  2FCV A;  2YBS A;  2WN3 A;  3SKV A;  4OHW A;  3QD6 A;  5KC6 A;  2P6H A;  2YFU A;  4SLI A;  2EXH A;  2A6W A;  5FPV A;  1OFS A;  1PMI A;  1CX4 A;  5CKQ A;  4EJR A;  2R07 2;  3NST A;  4QX1 A;  5HCA A;  2AH2 A;  1E5R A;  1XU1 A;  3B94 A;  1EYB A;  2PQQ A;  1SCS A;  5IVB A;  5IW0 A;  4NIG A;  1LEN A;  1NUK A;  3GCX A;  3T1L A;  5C9A B;  1MPX A;  2X5I A;  5C9A A;  4YG6 A;  2RDQ A;  4MGY E;  2DUP A;  1IS3 A;  1OF3 A;  2AGS A;  2R16 A;  3B93 A;  2BFU S;  4JC1 A;  3ZYH A;  2YPD A;  5I8T A;  2F4L A;  5LCW L;  2VVD A;  1HN1 A;  4QPG B;  4B8E A;  3N3H A;  2A7A A;  2BNO A;  2R7E B;  1HXS 2;  4AED A;  3D3A A;  5A3W A;  5C3P A;  3B69 A;  1EV1 3;  2WWS A;  3THP A;  1IS5 A;  4IEU A;  4E2S A;  4MSV A;  2ZGL A;  5CFC A;  3ZFF A;  3MUY 1;  3TNP B;  4A42 A;  3WNP A;  1W2N A;  3JU9 A;  5JR7 B;  3ZFE B;  3ZFE A;  4N43 B;  3VBH B;  5D8A B;  3VBH A;  4ASL A;  2R07 1;  3B00 A;  4XUP A;  5D8A A;  5B4X A;  1FMD 3;  2EIC A;  4LBJ A;  3AB0 A;  4LUK A;  4XF0 A;  3R4U A;  1JZ4 A;  5I0S A;  5CYY A;  2MEV 3;  5B2G B;  2VZ3 A;  1RED A;  2Y6K A;  2ADD A;  4YM1 A;  5JOX A;  5DDJ 2;  1PVC 2;  4Z2A A;  1X36 A;  2JDZ A;  2GC0 A;  3O1P A;  3RWK X;  4PQQ A;  4HT1 T;  2W92 A;  4TTG A;  2OZ6 A;  2RS1 3;  4OUS A;  1TEI A;  4IE4 A;  4LMF A;  5FXZ A;  1UPI A;  4IEO A;  4AGV A;  2XVK A;  3TN9 3;  4DOU A;  1GOG A;  1HXS 1;  1W6O B;  4A45 A;  1V00 A;  1H6X A;  5C3S A;  1EUU A;  2BP6 A;  5I91 A;  4I3G A;  4KI5 M;  3SKJ E;  1JS9 A;  1SLI A;  1ZYB A;  2CL2 A;  1EPW A;  5EFU A;  4BOW A;  4BXF A;  3WLU A;  2X10 A;  3OF1 A;  3PMS A;  2A75 A;  3NMB A;  1UY1 A;  2K2S A;  4ASK A;  3AVS A;  2NMO A;  5EJ1 B;  4AAP A;  4IGO A;  4BE3 A;  4QMA A;  4RS5 C;  2VPV A;  3E6D A;  1BXH A;  4N53 B;  4NWV A;  1W2O A;  5DDJ 1;  1R09 3;  1PVC 1;  4QPI C;  3ZOI A;  1NLR A;  1Y4W A;  2MEV 2;  1SLT A;  2DCJ A;  4LO5 B;  1MQT A;  3I3E A;  3TYJ A;  1UZZ A;  3AC0 A;  5FMO L;  4PJY A;  1NCR B;  2CGO A;  3I3D A;  4CP1 A;  4MYE A;  1NZI A;  1LOB A;  3GBF A;  2BGP A;  2PHL A;  4CXY A;  2BGO A;  3X29 B;  1JU3 A;  1JYI A;  3G6J B;  2VNO A;  3LPF A;  5A3T A;  3TN9 2;  1GP5 A;  2ADE A;  3WV6 A;  3KM5 A;  5K0U B;  5K0U A;  4ISQ A;  4RN5 A;  1KJR A;  4Z1V A;  5K9Y A;  1DQ5 A;  3M70 A;  2DDU A;  5IK5 A;  2G1M A;  3OBA A;  4IES A;  4BIF A;  4BM8 A;  4AAX A;  2VXR A;  1QKQ A;  1D0H A;  2W94 A;  4PI0 A;  4XIO A;  3RZM A;  3KVB A;  4JKL A;  1XYO A;  1W9T A;  4XFB A;  3T30 A;  3OG2 A;  1FOD 3;  1LRH A;  2MEV 1;  5F32 A;  2VY0 A;  4OHV A;  4BIO A;  3AYA A;  2BEO A;  2ZOE B;  1YFW A;  2FDK A;  1DYP A;  4R4X A;  4AI0 A;  2F17 A;  1F4H A;  1K5M B;  1NE4 A;  3LGR A;  1UY4 A;  1K5M A;  2WQZ C;  2BWA A;  3FX3 A;  4GH4 B;  4URT A;  1PVX A;  1ND2 B;  1V9U 3;  3Q8A A;  4GH4 A;  1B09 A;  1ND2 A;  4S2F A;  4CP2 A;  5FP7 A;  5IAV A;  4RYD A;  5F5A A;  4NE9 A;  1UYX A;  3TN9 1;  3WDV A;  4L11 A;  4FP3 A;  5LAS A;  3WDX A;  4F8A A;  5BYN A;  3FN9 A;  3RI9 A;  2W5F A;  4IV1 A;  4UOJ A;  3FBY A;  3RZH A;  2WO3 A;  4AVT A;  3QCW A;  1CAW B;  1VIW B;  1CAW A;  1W6P B;  1MVQ A;  3FMG A;  3PJQ A;  5F37 A;  2Q4S A;  2Q1Z B;  4UW5 A;  1JYT A;  3LEM A;  5IK7 A;  1W99 A;  1NLS A;  3E5X A;  3MFC A;  4NHX A;  2ZGK A;  1JOJ A;  2H6C A;  4QD2 A;  1H2M A;  4XBN A;  4ERO A;  1DLL A;  2W91 A;  3RG0 A;  3MID A;  2OUH A;  4MOA A;  4LA2 A;  3VHO A;  1F8V A;  1NXD 1;  4M0H A;  2YMZ A;  3B9C A;  5FZI A;  1L3J A;  2VZQ A;  4HL0 A;  3TOJ A;  4IL7 A;  2OPK A;  4PQ9 A;  1X8M A;  3BGA A;  4QQH A;  3S5Q A;  4B7E A;  1CQ9 A;  2EXI A;  3FFZ A;  1KGY A;  1VMH A;  1QJU 3;  3PUR A;  1ZZC A;  3WDW A;  1TME 2;  4FFG A;  1GIC A;  4OMD A;  4ASM B;  3HNB M;  1JOD A;  1V9U 2;  4XJ8 A;  4XCB A;  4YG3 A;  4AE2 A;  1RUN A;  1JZ5 A;  3AMQ A;  2O0O A;  5T52 A;  3N4M A;  1C4R A;  1YFY A;  2GSY A;  2RVA A;  2HWD 3;  3EB7 A;  4GJZ A;  1RMU 1;  2GH8 A;  4HSJ A;  4NR1 A;  5F3I A;  3USU A;  5CAD A;  3NNJ A;  1LES A;  4QX7 A;  5CIS A;  1OH4 A;  4GKY A;  2VL4 A;  1F15 A;  4CCO A;  1DP0 A;  5L36 A;  1QH7 A;  4ISR A;  1YJL A;  4CUC A;  2XHN A;  1IS6 A;  2B9U A;  1WW7 A;  2YY1 A;  4UFJ A;  2CHH A;  1LOF C;  3AJZ A;  3NNM A;  4Q2F A;  5GZF A;  1HRV 2;  4ZS3 A;  4D6Q A;  4MLO A;  2JD9 A;  1AXY A;  3T2O A;  1XNB A;  5FMC A;  2EAK A;  1AXK A;  2VUJ A;  1COV 3;  4L97 A;  3A21 A;  4LE4 A;  4AFM A;  4GAZ A;  1FXZ A;  3BB6 A;  4YGB A;  4PLO A;  4COZ A;  1NLQ A;  2XML A;  2NPI A;  5FYV A;  4QB1 A;  1HN0 A;  5A6X A;  1QXJ A;  5C8C B;  1SQ4 A;  3EHK A;  5C8C A;  1TME 1;  3PL0 A;  3AKS A;  1G6N A;  1Y7B A;  1QJU 2;  1DZT A;  4K7J A;  3OBZ A;  2WRA A;  4O65 A;  4Y22 B;  2ZJC A;  4Y22 A;  3DEC A;  3VZO A;  2WNV B;  2WNV A;  3U75 A;  2W0X A;  2CGN A;  3I59 A;  1S4C A;  1E5H A;  3BIE A;  3PUA A;  3RMX A;  2BUK A;  2BU9 A;  2E32 A;  2PHU A;  4XIK A;  3AYC A;  2UY8 A;  1HRV 1;  1UZW A;  3GHM A;  1HX6 A;  5FJH A;  4HVO A;  5I0T A;  1VJ2 A;  3VBS B;  3OPT A;  1W2T A;  1WW4 A;  3VBS A;  2IXJ A;  3KS7 A;  3T0D A;  1YQC A;  4CDU C;  4PDW C;  5FZO B;  1OF4 A;  4TN7 A;  3VBR A;  2B42 B;  2BNM A;  1PIV 2;  4LIT A;  2GME A;  1COV 2;  1WW5 A;  2WIN B;  4CCC A;  3E1F 1;  4WVW A;  1W8T A;  5KBF A;  3JBG 1;  1QJU 1;  2VME A;  1JXN A;  4LBL A;  5FP3 A;  3Q9O A;  5FMB A;  4NRM A;  5FYS A;  1MS1 A;  4LJH A;  3LKJ A;  5EIY B;  1RUG 3;  4BK5 A;  3J26 N;  4P9W A;  4CEY B;  4H3W A;  4EN7 B;  5GM0 A;  1REF A;  3RYK A;  1I5P A;  5I0U A;  3WF2 A;  3B3Q E;  3J7M A;  3W21 A;  4AVA A;  4Z82 A;  2OKX A;  1UOG A;  1RVF 3;  5FY1 A;  3POI A;  3GZA A;  4NPM A;  1TNF A;  2P1B A;  1ZBA 3;  5C4W A;  2OZJ A;  5FV3 A;  4FAH A;  1BZW A;  1K5J A;  1RIR A;  2W52 A;  2YDE A;  4B1M A;  1BK1 A;  2ORZ A;  2VU9 A;  1IS4 A;  1UN1 A;  1JZ8 A;  1W8F A;  2Q5T A;  2ZEZ A;  3NVC A;  1PIV 1;  4BPZ A;  1IOA A;  1ZA7 A;  2YB7 A;  1G9A A;  2ZAB A;  4YAR A;  5LEJ A;  3AKR A;  1AYN 2;  3ZX7 A;  4LT5 A;  4XAA A;  4CZS A;  2OA2 A;  2E31 A;  4QU2 A;  2BGC A;  4AHY A;  4YZ2 A;  3FLR A;  1J1T A;  4W8J A;  5HV4 A;  3V0A B;  3MFA A;  1IQD C;  3M7A A;  3HN1 A;  1U5Z A;  3MPP G;  5J98 B;  5BNN B;  2E6V A;  5BNN A;  2ZMN A;  4MVT A;  4ZU4 A;  2PHR A;  5DZF A;  1U5X A;  3PIJ A;  3VDA A;  5FOJ B;  1RUG 2;  4YW4 A;  5IAX A;  5GLT A;  3I2D A;  4M3C A;  2D3R A;  4YZ1 A;  5CIR A;  2DCY A;  2XPJ A;  5A7W B;  5EJ3 A;  5A7W A;  3LIG A;  2ARX A;  4NHL A;  4O61 A;  1RVF 2;  4QB6 A;  3A0K A;  2P4E A;  1Y43 B;  2JDY A;  3K77 A;  4CP9 A;  1ZBA 2;  1V6K A;  2DVF A;  4ES9 A;  1UX7 A;  1BCX A;  1XQN A;  2OPW A;  3CIH A;  3LOI A;  1ULP A;  2IZW A;  4DXZ A;  4YVW B;  3M3Q A;  1NXM A;  1GOF A;  1AYN 1;  1QEX A;  4WM7 B;  3RJR A;  4WM7 A;  4CPB D;  1J3Q A;  4HBN A;  4U36 A;  5BNO C;  2D6L X;  1AF9 A;  3UT0 A;  2O8Q A;  3TB0 A;  4AEK A;  2YUE A;  4AVB A;  5FZ7 A;  1KS5 A;  4D0Q A;  2GMP A;  4EN6 B;  3R4S A;  3HQR A;  1ZM1 A;  5FY0 A;  1EAH 3;  2J1E A;  1SZB A;  1RUG 1;  3CLP A;  4E27 A;  4D94 A;  5A32 A;  1OBN A;  1ZZ7 A;  3LA3 A;  1YI9 A;  2QQW A;  3M3I A;  1CAU A;  2P34 A;  2ZAC A;  3LD8 A;  1HB2 A;  1QQP 3;  4AVC A;  1RVF 1;  1G9D A;  1G9B A;  2VOK A;  4YVS B;  5LA0 A;  3LAG A;  1DLC A;  4YPJ A;  1ZBA 1;  3ORJ A;  2BV4 A;  5I8Y A;  2GH2 A;  3ABZ A;  1R08 3;  4QKN A;  5LA9 A;  3I2F A;  1OLM A;  4KWK A;  1AX2 A;  2WAB A;  4CCE A;  5JIU A;  1DZR A;  4UW6 A;  3ZXG A;  3K3N A;  5KXD A;  3OOX A;  2FDJ A;  4LNV A;  3LEK A;  3SLI A;  5CB7 A;  2PAE A;  4YZ3 A;  5DUU A;  5FKC A;  4QKD A;  3U4X A;  1ENR A;  5A80 A;  3SH3 A;  2D6O X;  3OGR A;  4KQ7 A;  2WS9 3;  3NO8 A;  3O0V A;  3J7N A;  3HNY M;  1O3Q A;  5C7G A;  1LUL A;  1OMI A;  3J7H A;  2R1D A;  4KWJ A;  1I9R A;  2R1B A;  1EAH 2;  3U1X A;  4NPR A;  1V6J A; 
#chains in the Genus database with same CATH homology
 4QU1 A;  5F2W A;  5F3G A;  3KV5 A;  5FYZ A;  4EZ4 A;  2XXZ A;  5FY1 A;  5FY8 A;  5F37 A;  5CEH A;  5A7P A;  5FYI A;  4LXL A;  5FZ8 A;  4HON A;  4QXH A;  5FZO A;  5FV3 A;  5LY1 A;  5FZF A;  5LWB A;  4CSW A;  2YBK A;  5FZG A;  5LW9 A;  3PU8 A;  2XUE A;  5FP8 A;  5FZI A;  4LIV A;  4Y33 A;  5E6H A;  3U4S A;  2YU2 A;  5F5C A;  4BU2 A;  2YU1 A;  5FPB A;  5FZL A;  5IVF A;  3KV6 A;  4GD4 A;  3KV9 A;  3UYJ A;  4LIU A;  3K3O A;  3PTR B;  3N9L A;  3PUR A;  5FYC A;  5FZA A;  5F3C A;  5FXZ A;  3N9Q A;  2WWJ A;  4QXB A;  5FZD A;  3PUS A;  2YBP A;  5FPL A;  4CCJ A;  2VD7 A;  5F2S A;  4GJZ A;  5FZ1 A;  5FY7 A;  3U78 A;  5F3I A;  5FXX A;  2Q8C A;  4BIS A;  5FP4 A;  4URA A;  3AL5 A;  5FZ4 A;  4QX7 A;  5IVV A;  4BXF A;  4CUG A;  4CCO A;  1VRB A;  5A7W B;  5A7W A;  2GP3 A;  3NJY A;  4IGQ A;  5FP9 A;  5FZK A;  4EZH A;  2OX0 A;  2XDV A;  3PU3 A;  5A1L A;  5FYT A;  3AL6 A;  5FXV A;  4ASK A;  3AVS A;  5FY9 A;  5FZ9 A;  4D6Q A;  5FPU A;  4AAP A;  4IGO A;  5IVJ A;  5IVC A;  3LDB A;  4QWN A;  5IVE A;  3N9O A;  2OT7 A;  5FZB A;  5FZC A;  4UF0 B;  4UF0 A;  4GAZ A;  5F5I A;  3N9M A;  2XML A;  5FUN A;  5FYV A;  3N9N A;  5FYB A;  5A7Q A;  4QX8 A;  5F3E A;  5FZ0 A;  5FY5 A;  5K4L A;  4V2V A;  4EYU A;  2P5B A;  3K2O A;  5FZ7 A;  3N9P A;  3ZPO A;  5A3T A;  4V2W A;  5FY0 A;  5A3N A;  4CCN A;  3KVA A;  5FZE A;  3PDQ A;  4QXC A;  3ZLI A;  4CCM A;  5FYU A;  3PUA A;  4C8D A;  4D6R A;  4NUB A;  5FJK A;  2W2I A;  3LD8 A;  4CCK A;  4GJY A;  4E4H A;  5F39 A;  5FWE A;  2Q8E A;  2YBS A;  5FJH A;  5FYH A;  4XDP A;  5FXW A;  5FZH A;  5FYY A;  4CCL A;  5FYM A;  3KVB A;  2OQ7 A;  5FPV A;  2OQ6 A;  3OPT A;  5A3P A;  5A7O A;  3PUQ A;  4HOO A;  5IWF A;  4D6S A;  5A1F A;  3KV4 A;  5F32 A;  5FZO B;  4TN7 A;  3K3N A;  3OPW A;  5IVB A;  5IW0 A;  4LIT A;  4DIQ A;  5IVY A;  5FPA A;  5FZ6 A;  3RVH A;  2PXJ A;  4DO0 A;  2GP5 A;  3AVR A;  4Y3O A;  5KR7 A;  5A7S A;  5FWJ A;  3DXT A;  4IGP A;  5A80 A;  5LY2 A;  5FP3 A;  2OS2 A;  5FY4 A;  5FBJ A;  2Q8D A;  2WWU A;  2YPD A;  5FUP A;  5FP7 A;  5FYS A;  5F5A A;  5A7N A;  3DXU A;  4Y4R A;  5ANQ A;  4AI9 A;  5FZ3 A;  5A3W A;  5FZM A;  5ISL A;  4XDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...