2P5EB

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPCIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eB00
2E6PA 2IH3B 4CAGA 1F45A 4J4PA 5EUKB 3J7HA 2DTMH 2EDBA 4S2SB 3H0TA 4JY6B 3QUMA 4L8CB 2BY0A 2HRLA 3ZDXF 2NTSP 5L8KB 3BJ91 3HC4H 3LQAL 1FL6A 1A6TB 4PJGE 3U2SA 5K93A 4JY4A 2X9XA 3QJHB 4M3KB 2NX5A 4PJ5E 4ZXBB 5DURD 2P46B 1HI6B 5HHVL 5ICZB 2D7QA 3SJVE 4ELME 1BZQK 2PTVA 5BZDA 1WC7B 3LD8C 3PGFH 4GKZB 3OAZK 4OLEA 5FYKL 2Q6WB 1EA9C 3O3DB 1G9NL 4KDTA 4LEOA 4K3GA 3B9KB 5LG1A 5SWQA 5B3JE 3V6FA 5BMFL 3SKOB 5A2FA 2Y07H 5B4MC 3D39D 5C8JB 3AAZB 1TVDA 3NZHL 4KJWD 2YUVA 4LARH 1MQ8A 3H0TB 1HXMB 2UV3A 5EO9A 4Z8FL 1MCPH 3G6JA 1IM3A 3GI8H 4G80B 1YPZE 3MRLB 1E4KA 3P30L 1QFUL 3AU1A 4M8VA 1EHAA 3FOMA 1G7PA 3ARFD 4GJTB 4LCYA 4E42B 4LLWA 4XAKD 4NUGH 1S7XB 3ARGB 3VCLB 4S2SA 2ZPKL 3MJ9A 1VADB 1XGUB 4F80A 3MRPB 5KVGL 3AFLA 3ALWA 3LZFH 4KI5F 1V7NL 3R1GH 3HZMA 3X13B 2EYSA 1SJEB 2C3GA 2LFGA 3E6HA 1QSFA 3NCYS 3VFUA 3DUSB 5CJ8A 1QFWL 1T83A 5C0BE 3VE0A 4M5YH 4ZQKA 1PZ5A 5MEOB 1GXEA 2EICA 1RK1B 2YOCA 1IT9L 1UCTA 1UWGH 3OAUL 2VLKB 1GCFA 3QPXH 1LO0L 2XYCA 3K4DA 3OKNB 3GO1H 5CJXC 4I0PD 4JGMA 2IBGA 5E9DB 1BOYA 1NC4A 3CXDL 3O3AA 5HVHC 3EYSH 1G0YR 2O5YL 3BUTA 5GRXG 4NQDA 4P9HL 3GJFA 1MCWM 5GSRA 4I9WE 1ETZB 3B9KD 4NGHL 1S8DB 5IB5B 1FG9C 5AYUL 2MCPL 3ZZ1A 3V7AG 5JPMA 1DBJH 1FVEB 2V9TA 4K94H 4NQSB 4CW1B 4PJEB 2IAMD 5HGAB 3QXDB 1JFQL 5TJWK 4O51A 5C7XL 4M8QB 4QOKE 2WINB 3GSWB 4J7RA 4A2MA 1WT5A 1X7QB 1H5BA 1BIHA 2DLTA 1GAFL 4X7FC 2DQCH 3GMQA 1I8IA 5E6IB 1FFOB 3RNKA 5B3JF 3I50H 2Z93B 4OGXH 2Q8BL 2VL5A 3DVFA 2UY7A 2E7BA 1KLGB 1FYTD 4QF1B 3QUXC 1A3RH 5JXAL 2FIKB 3OKEB 4G8IA 4H25A 4PGZA 2EH7L 4NN7C 4HX1B 5JDJA 4HWBH 1YDPB 5DRNA 3MRCB 1QRNE 4BZYA 1FP5A 4I4WA 3VFOB 1V05A 2XZQL 5JIIA 5EG6C 3LD8B 2DYPB 4GLRI 4YK4C 4AIXA 2AABH 4FQXB 2NLJA 1JCKA 3SDAD 5ADPH 1ITBB 3P0YL 4EUPB 1U42A 1NJ9A 3P9MA 4MJ5A 5KSBB 5IBUB 3TVMA 2GUOB 2YK1L 3PHSA 3VFMA 2EEDA 5T1MB 5HYQA 4K3JL 2KZWA 2PF6A 5C0BD 4MXVF 1RUKL 3EOAA 4KQ3H 5FDWA 1FRGL 1OOAA 2DI7A 5DVMA 2BERA 3BWUC 2ZCKH 1NCWH 3FMGH 1BP3B 3SE4C 3FHQA 3GMRA 1HKLH 1V7NH 4HF5L 2FHCA 2GCYA 5E6IA 4JY5L 4MA8H 2PXYB 3D3VA 1UYWH 4G9FD 4HGMA 3SGKA 4JB9L 6CGTA 3WN5B 5HJ3A 4OZFA 4XXDA 2XZCH 5KBNC 1CS6A 2YRPA 2FL5A 1I3GH 1YEDA 4K71C 5ANME 5JR1H 1RVFH 4Z6AT 4HWBA 5D7KD 4JPWH 1NMCC 3FOLB 1CD1B 3HB3C 3O8XC 4NNYB 5GGUB 1T0MB 3D85A 1D5IL 4LHUD 5C0GA 3GO1L 4O2FB 5HGHB 4E0RA 4QXGL 3I75B 3G9VA 4Z76B 3ABZA 3CFDA 4P9MH 3RTQD 4PV8B 2RR3A 4IRJD 1MCNA 1PKQB 1EHNA 3P73A 4NJ9H 4JDTH 4ZAKA 5F7EH 1P6FA 4Z95L 1A6VH 4XPFL 1L0QA 1S7VB 4JQIL 2DLGA 4N9GA 4U6TA 5ICXA 3UTPD 1MJJA 4NN5C 4K94L 4XNMB 4XZUA 1AXSA 2VLRD 2DKSA 4IDJL 3CFIC 2MCG1 5I8CB 2VSCA 4PRPD 5DK0A 5C7XH 3U0TB 1F02I 5DMJB 3KLDA 3QDJB 4OFVA 5DHVB 2ZCLH 3FT3B 1IGCH 3NCYP 3EO9H 1HSAB 5KN5A 1BZ7B 1LDPH 2GTZB 4YHIA 4A6YH 3U79A 1XIWB 2E9JA 4YXHL 4UOW1 4KROB 3QXUA 1KJVA 5GRUH 2BSRB 2AK4B 3BIBX 2YMXL 3EFDH 1X6LA 2EDEA 4LGSB 5EOQL 5DRZB 1AH1A 1DBAH 4X99A 1FNLA 2EC9U 3TO4D 2J8UF 5K9KB 1YN7A 4GMTH 2AW2A 1T2QH 1G0XA 4R6UA 1I9JL 4XP1H 2CUHA 3DJ9A 1NMBL 4KAQH 1ZEAH 3GSQB 1SQ2N 1UXWA 3CFDB 3ZYJA 3RI5K 4JQVA 1H3VA 3HI5H 3WDIA 4GG6B 1N64L 1QNZH 1A4KA 3RHWK 3UJJL 2BCKA 1LE5A 1AQKL 4Z7QE 1BQLL 4R90L 2HN7A 3QHFH 3HZKA 4L9LA 2YR3A 5L2JB 4LLMB 5FHAL 4G7YL 4LVHC 3HR6A 4AG4L 3FZUC 1MAKA 2DKMA 3I3DA 3OB8A 2ZCKL 4U4BA 4PJ7A 1CL7H 2HKHL 5IK3B 1WFOA 2X89D 1DFBL 4EI6A 3MLWL 1HXYA 4CADB 2DQIL 3F5WB 2QR0A 4PGBA 4V1DE 4OI9A 4WTZG 2VLMD 4JN1H 3VFPB 1RVFL 3EW3B 3HAEH 5HI4D 3K7UA 4OZHF 3UCRA 1PZUB 3HE6A 3QIWA 1D5IH 3ARGD 4UT6L 2NY2C 3SE9L 2EH8H 1F4WL 1S8DA 3L5XL 1C7SA 3ZE1E 5F1KC 2AV7A 3QQ3B 5IW1A 1CQKA 4HLZG 4HMEA 3RGVB 1XF3A 3FQUA 5L2KE 4PRPE 1IKFL 3CSPA 3DROA 2AJZB 3VWJC 2H8PA 1A6VL 2FECI 3QO0A 1AXTH 3QISA 2PW2B 3PWLB 3SGEH 3IDNB 2VXVH 3QUMH 3JWDH 4CU7A 1DLFH 2W0KA 4OFDA 2ZUTA 5JO5B 3EOBB 1JWSB 4OCLC 5HBBA 1WWWX 2DS4A 2UWEB 4OFIA 1MWAA 3MLUH 2Q6WA 4U1SB 3JTTB 1IGCL 4X5XB 4GBXA 4GW4B 1AIFA 4NKIL 1JI2A 1QHPA 5C07D 2FHFA 1SY6A 4L3EB 1F90L 1RJLA 3PDOA 4DVBB 4XVUC 3EFFB 3RBGA 2ZPKH 4XH2A 4R9HA 2PR4H 5B8CA 4HS3A 5EOQH 1ZHKB 3PL6D 1DBAL 5T1KD 3BO8A 1P69B 2BNQE 3GMPA 5AD0B 4ENEC 2EE3A 1JHLL 4GMTL 2WQ8A 4G9FB 3QRGL 2OR7A 4JZNA 3KJ6H 5D1QD 4WFGE 3WD5L 1SJEA 1JPSL 1QSEE 1M7DA 2W59A 3X11B 5TPWL 2Z0BA 1P9MA 5KW9H 1ZTXH 5EIIB 5A43C 3CFBB 3D18B 2IADB 2IBZX 4WI9A 4LFHD 2VLKA 5IQ9B 4G42A 1CDCA 3L3HB 2A6IA 1ACYL 1O0VA 4RAUA 3PWUB 5LAXB 3MRRA 3Q6GH 3FQRA 3TVMD 3NCJH 4K8RD 3THMH 4KZDH 4MVBD 5GGQL 5MHSE 4N1CA 1MWAH 3U30B 5AG8A 3BQUC 1FZOB 3IDXH 1P7KB 2G5BB 5TE4H 4X4XA 4ZS7H 4RGNC 5CZXC 1FVEA 5FAAA 1A4JB 1WICA 4QWWC 3QUMB 4TTDD 1ZLWK 1CFNA 2FBJH 5JOEA 5E2WH 4OM0L 3K81A 3ARQA 1NBZB 3QDME 4LP5A 1QR1A 3BW9B 4XNYH 1MCJA 1IBGL 3ARYA 3SDAC 1BEYL 3MLRH 4J3TA 3X3GH 3CFCL 2DN7A 2R56L 1BQSA 4DJMA 5L9DL 4M02A 3GMOB 4Z7VB 1UH3A 4KDVA 4F7PA 3QUML 4WV1C 2IAMA 3NGBC 4JZJA 4YLQT 5I18H 1QSFD 5I16A 3RVWC 1B0RA 3CPLA 4ZAKD 1Z9MA 2VLRA 3MUJA 3TIDA 4D9LL 1VACB 3IDIA 1TQCC 3WIIH 4PB9L 2IJ0C 3RL1B 1R24A 4FRWA 1S3KL 3BW9A 2YK1H 4UOJA 1KPVB 5HXMA 4WW2A 4K7PH 4B7IA 4DEPC 4U6XA 3FOMB 3VRJB 4ONFH 1BQHA 2VH5L 5D2NE 4WIQA 2KDGA 5BZWB 3STLB 1CLOH 2ITDB 5F89B 4Y4FD 1E4XI 4JANB 4Y89A 2WWMD 2NY4C 2XQYG 1JBJA 3UC0L 4Q74A 1KXQE 2BSSB 2FO4A 3RIFF 1ADQH 1UG9A 3WD5H 4LP4A 4F2MB 4RQQA 5ID0B 1SM3L 3LS5L 4G9FA 3GBNL 1EO5A 4RSVA 4X4YB 2RQ8A 1LP9B 5IHZB 5IJKC 3C5ZA 3BKYL 3TO2A 3GMOA 1AJ7L 1QQDB 5A2KH 4DVRH 1CI5A 1G7IB 4NQTA 2R8SH 5IB3B 4YGVA 1IC7L 5HDBE 5IBTH 5DEZA 3I85A 1NCUA 5DD5H 3CDGB 3Q6GL 1MHEA 1U3HA 3BH8B 3QFDB 4PV8A 5LXGH 1CZ8H 3VRIA 5AG9A 3IAQA 3GMPB 4AIZB 4X7TB 1OT2A 4NNYA 4Z7OE 4FFVD 1V3KA 1WFNA 4ZMAT 1OPGL 4GKSB 3O4LD 2DICA 2KUTA 1CCZA 5DGQA 2D7NA 3DRQB 3RWIA 3B9EA 2R39A 3ARFC 3WS3B 4PGBB 3UAJD 2JB6B 1M7DB 1QUNA 3O4LB 5H8DA 1WQVT 3D69B 2FBOJ 3T77A 4PJBA 3MRDB 1ZA6B 2RIKA 3MLRL 4NNPH 2PO6B 1KB5B 4ODUB 5F7DB 1IAKA 2IMNA 3I3BA 3O6KL 3S35L 1IGIL 4Y4HB 1GZQB 4Y19E 4V2CB 1QVOB 2XKNA 5IB4B 2AQ2A 4YIQB 5F7YC 3WJLA 5IJKA 3OTTA 1NCTA 2HT3C 5E56A 2VZ1A 1QBBA 2XY1A 1EHLH 4WI5A 4QEGA 3QJFA 5DDHB 4H88H 4X6FB 5DMGC 3TP4A 4ONHA 1YEEH 4KAQL 1VA9A 3BPNC 5INCB 5TH2A 1MCOL 2XXMB 4C58B 5HD8D 3BPLB 4WUUD 3EJYD 4PB9H 4U1MB 4DGYH 1S3KH 4GO6B 5HYSB 3TYGL 2B39A 3VXTB 4PREA 1NFIB 4HJJH 1JPST 4N8VA 4TUOB 3K4AA 5KS9A 2PYFA 1XGRA 1JGDB 3O6MH 2X4UB 5GGTH 1CL7L 3BUYA 4P2QE 3VFNA 5DSCA 1H3UA 3DXAB 3PP3K 5E1AA 4M6MH 5F9OL 1U3YA 4GXUN 2B20A 1D6EA 1M71B 3QPQC 3RDTD 1MQKL 5F3HA 4OLWH 5HDBF 4NO3A 4QT5A 4UILH 3RP1A 1DEEB 5EBGA 5LBSL 5DJDA 3BD5A 1ORQA 3S3JA 3KWWA 1Z2KA 4PY8I 2CUMA 2F5BH 3LHPH 2R8SL 3IYLW 2XI9A 4O9HH 1SEBB 2E8YA 4G9DB 5DD5L 1TPXC 3WUWA 4DN3L 1NCAL 4PJXF 5TFSL 3RGVA 4YHLL 5EORL 3FO9A 4FFYL 1T2JA 3MOBH 5DR5L 5EZIH 1XR8B 3OGOE 2BY3A 4R3SA 4G6KH 4Z7UA 2FX7L 3NACH 4FN0A 5D2NC 1U8NB 3MRCA 1WAAE 4LK4A 1J0IA 4U6HB 5HHQA 1U8PB 3V6OE 2NY5H 1WZKA 3D39A 5DJDB 5E4IA 1CLCA 1Q94A 3HZVB 3V5HB 1G9NC 1I7UB 1KG0A 2YEZB 4LCCB 5C0NC 5DHVA 1S7WB 5DSCB 1TZIB 3GHEH 5IIEB 2V2XB 3VXPA 3TVMC 1IGIH 4RFEB 1RZJL 5IESL 4U0RB 4BFEA 3RVXD 4NRXB 3HI1A 4N0UA 3BT2H 4Q9CA 4LSRL 4XXCA 1L7IH 2XKUA 2BVPB 2E7CA 5E94A 3W39A 4RA3A 5K9KA 5I1GH 1BD2A 1MCOH 2GCYB 5KANG 1PAMA 3WUWB 3RIAF 3MJ9H 2PKDA 4MHHI 4J3XA 1EEZB 2JK5B 5DRXB 5KW9L 4BSJA 1IMHC 1QO3B 3QCVL 5IIEA 1FNGA 1OGTB 3S88H 1MJJB 5CJBA 3RPIA 5DJ2B 4Y8AA 2VLKD 2IALA 1LO3L 5CGTA 1L4IA 2OJEB 4LLVB 5LGJB 5GGTL 3PXJA 2NX5E 2CMRL 2EKSB 3HE7B 5GGQH 3CSYB 3EYOB 4HWZA 1JRHI 4F9LA 1PG7X 4XPGL 5BOZG 1JWUA 2OX5A 1KCUL 3CXHK 2B1HH 3OKOA 3QDGE 4R26H 4OLWL 5C2BH 3DGGB 3RUGB 3HKFA 1YN6A 3ROLA 3FKUS 4BFGA 5ICXB 4XP4L 5F7MC 4PJXA 3T4YA 1XCTB 3P77B 1KEMH 3GBML 4HZLB 1G7QA 4D0BA 2Y23A 4U1MA 3TYFB 5SWSB 2CXGA 3VWJB 2MKLC 1WSST 3G6JE 4X7TA 1G9MC 1QSVA 2JIXA 4N8CH 3VFTA 4BSWA 5HVGB 3ZSTA 3H7BB 1MIEH 3P9MB 1V7MH 4WENB 5FYKD 2D7TH 4PJGB 3JTSA 5BXFB 1JNLH 3V0VA 1TETL 4A2LA 3QHTC 4ZD3L 5EU6B 1QYGL 1ZANL 2QQLL 3DXAA 3OG6B 1VPOH 4G6KL 3V0WL 3RZCB 1FFNA 4BH8A 3STZA 5F3HB 2VZUA 4UIMB 5HHMD 1N8ZA 1X5GA 2DQHH 3G04A 1IGJB 4PJAA 3ARVA 2DLFH 1P84K 3MTRA 3I6KA 5ICZA 5KS9F 5A40E 4RNRB 3QFJB 4OQTA 4HT1H 2R0ZH 4ETYA 2Y5TB 5DC4B 4Z7WF 1WZMA 1BVLB 5TDNA 5D8JH 5BO1H 5D7SH 1NMAL 5IESH 1KJ2H 5DEFB 2NNAB 4HKZB 3SDXE 3PDOB 3PGDA 1QLFB 5HGAA 1OQXA 3QA3A 3S3PA 4YFLI 3WXVH 1YQ2A 3D6GA 1YC8A 1H15A 4FNLL 1RUMH 4YWGL 5F3BA 4JHAH 1RAMA 4OSUL 5FYJE 3UC0H 3BAEH 2D03H 3GK8L 3DETD 3EZ8A 3ARDB 3LS5H 4X7SL 3HFML 2Q76B 3KPSB 3AUVA 5F89A 3BKYH 3C5ZC 4L8BA 1I1FB 1F2XK 1JMZA 1K4DA 3ALXA 4YHKL 1EFXD 2PW2A 4LSQH 3VCLA 4KUCF 2H41A 5TQ2L 5I15L 3R06B 3FQNA 4RIRB 1YEGL 1E4XL 1FVCB 2YPKA 2OBGA 4PJDE 4M1CC 3SDDB 4OIIH 3NFSH 2VXQH 3CU7A 1KLGA 1U3HD 4LSPL 1QKZL 2FO4B 4Y5XC 5TQ0H 1N26A 3QFDA 2HT4C 4WUKL 4M62L 4XCFH 2W38A 4M6NL 5LWYH 3QIUC 3PWPB 5BS0E 1ZGLA 1TCMA 3AVEA 1S7XA 3LS4H 1XAUA 5BVJA 5ILTH 3LSOA 4JDZB 3HC3H 5F8QC 4WV1B 3PHQA 2P5EE 3T3MF 4E5XA 1HQRB 4KKBD 2GK2A 1FO0A 3BKCL 4PLJC 3CVIH 2V5TA 3IDYB 2PW1A 4W4OA 1AGFA 3KPLA 4W4OC 3VU2A 2AXHA 4P9HC 3RX7A 2FYYB 4LPXA 1JN6A 2YBRB 1XGQA 2G2RB 2IANA 3DI2B 3LEVL 4AH2A 4HUXB 1N5YL 2E9WA 4QRRA 3VMOA 3WJJC 3VGAC 3QUZC 2I5YH 2BXYA 3V8OA 3C6SB 4PRID 3V0WH 5M94B 1BF2A 3O11B 4RMUA 3LQZA 4IMKC 4LHUB 1Q9KA 4U1LA 3WYRA 3HPJA 5I1DB 1U93A 4NRZB 4POUB 1RZIA 4GKZA 4DCQB 5E2VH 5I2IB 3JV4B 3SQBA 3B2VH 1HCFX 2R29L 5IVXE 2F54B 1PYWA 3OHXA 5BQ7A 4RGMB 2GK0A 3K1DA 5B39B 1EMTL 3BX7C 5GGSY 1U92B 3IDYC 4HT1L 3P4LA 1PVHA 2YD5A 1IEAB 3KR3H 5ANMA 1KN4L 4G6JL 5D8JL 1DUZA 3W9DA 3MXWH 3T0AA 1YNTB 4M5ZH 4Y8DC 3V6FB 2HWZL 1JI1A 4JG0L 1A3LH 1ACZA 4I2XA 2PTUA 3C6SA 1F3JB 3V0AC 5TDPB 2ESVB 1JHKH 5J13B 4UU9A 4AEHH 4OSUH 3FQRB 1OLLA 4X8JA 5F8RC 1S9XB 1ORSA 5DT1L 5E5UB 5ITBL 3KYAA 1JN6B 1V8HA 3VD7A 5EZOL 2XQBL 1JTTA 3NH7H 3TNNA 1T7VA 1K3IA 3S4SG 2PXYD 5C0CD 5GS3A 3RVVD 1IAIM 1OF2A 3ARSA 5JO5A 3F7YB 3SEPA 5GJSL 4OAWA 3TZVC 2Q8AH 3BE1L 1NCBL 3B3IB 2CR6A 4O9HL 4EXKA 1LVEA 4QRRD 4F7EA 5HDOA 3UZVB 5EFIB 3W9EA 2C4XA 1MI5B 3E6FA 4A6YB 3FN0L 5EORH 4LSPH 3UZEA 3OKLB 1K6QL 2A1WH 3MV8D 1KTKE 2JCCA 4U1SA 2GAZB 4K23L 3WXWH 4XH2B 3T0WA 1Q38A 1IEAA 4HLZH 5FGCB 3HC3L 1XR9A 4Y16D 4FQ1H 3TCXA 4L3EA 4P48A 4WFFD 4NRYA 5GS0H 2VABA 5BVPL 3KPSA 5IT2L 2SEBB 5TE7H 2ID5A 2Y7QA 1X44A 2IH3A 4D9QD 1U8JA 2HP4A 5D7JC 1PQZB 1MLCA 4GW1B 5KAQG 3F12A 3OR6A 1IAMA 5KSBE 2A6DA 1K3ZA 2EYRA 1AQDA 1MFBL 3JWOL 1NKRA 5HYJE 4OF8A 1CR9H 5F96H 2G60H 2W9DL 3NN8A 4WY7L 4OZFG 5JMOC 5EC1B 3DVGA 4KV5E 4U6YB 2R1YB 5DD6B 4Z77B 3HG1B 3L5WB 3MFFA 1FV1A 5CINL 1N6QL 4ODXB 4F7CA 4EI5A 3KLAA 1NEZA 1I1RA 1PSKL 1CD9B 3CX5K 4XB7A 4BK5A 4G8FB 3C8DA 1AGDB 4KUZH 1YEFH 2V2TA 4OV5B 4YR6A 1LWRA 3HNSL 2I07B 1XF5A 1PX4A 3IFNL 4AMKL 2VDPH 1FE8H 1NAKH 2FD6H 3F62A 5C92A 3IDNA 2XTJB 4Y4KB 1OHQA 2HWZH 3FQWB 4JG0H 3QNXA 4KMLB 4LCWD 2XNAA 5DK2A 4AEIH 4DGIL 4I3SH 1NPUA 1JHKL 1AD0A 4NWUL 5L2KA 1OSZA 2EKSA 3MV7E 3SGKC 3EYFA 3L95B 2E9IA 1OAYL 3L5HA 1PEZA 4NJAH 4JJ5A 1OGTA 3RWHA 2DWEA 4X9BA 3PGFL 4JKPH 2OJEA 5MEPA 3EGSA 5L0QB 1RIVL 3SOBH 1S9KC 4JG1H 1ZHNB 3Q6FA 4LLMA 3HE6C 5GJSH 2P5WB 2WWKO 3ECBB 3Q48A 4UNTA 3U46B 5JDSB 1KLFA 2IQAA 2W91A 1C5DB 2WM0A 5AWNH 5SWZD 1CGTA 3RWJA 1JNJA 4XCNA 5HHNA 4H20H 5FKAA 4OZHA 4KZEH 3F5WA 4D9RE 3P77A 3VW3H 4KTDL 4PJHF 5E8PA 5C0GB 3OJVC 1JUFB 1LNUA 3JWDC 2ZJSL 1XCTA 4PJ8B 4J8RB 4IS6A 5I66A 5E5MA 3W0WE 4F7MB 1DBBL 4CKVX 5I1LA 2DD8H 3JTSB 1CLZH 3PDDA 3RU8H 3WFDL 1S7RB 3HC0A 4JHWH 4U1KA 1U91A 3LZFL 3QNYB 1D6VH 4TNVF 5HPMB 3BZFB 1I3UA 4FFWD 4L4TB 2NY1B 3BUYB 1VFBB 4YDVB 1MOEA 2WLZA 4GS7C 2GJZB 5F96L 1JWMA 4M5YL 1LILA 2GFBA 3B6SB 4QRUA 2QADD 3GHBL 2VLKE 3GZKA 2N7AA 4K71B 1JF6A 2OXGA 5DJ6B 3QCTL 4PGEA 4MJ2A 5A16B 3AM8A 3L7FB 3VDAA 5KN5B 3B2UD 1WCBB 3C87A 2XICA 4X99B 5MP6H 5CZXD 2MCPH 1EO8L 4P4RB 1P2CA 2JK5A 2DM3A 4R97B 3OQ3B 2BRRL 4GKNB 4O2EA 3QDMA 3WIFA 4AEIL 1WBYA 3QFJE 2R2EB 2DOCA 1JHTB 1MEXH 2DMKA 1KPRB 3KGRA 4HUUA 5FOBB 4Q7DA 1A6WL 1MCIA 3MLXH 4WI4A 4WO4B 5F9AC 1U36A 4HUMB 2BJMH 4ODHH 1OAYH 3JBG7 4G5ZH 4WCYH 1BVKB 5FDWB 4WVRA 4YDIH 3LMJL 1A3RL 5JXAH 5ESVB 1OD7A 3PNWB 4X6BB 4XC3H 3GSWA 1F2QA 4O2FA 2D0HA 1RUPL 5K59E 4GRWE 1E6JH 1MUJA 2JIXD 4H26B 4PRHD 2VLRE 4Z7QF 1UQSA 5C9KA 1DBML 3BPLC 1LO2H 4RWYH 1HH6A 5JDSA 4I18C 4XHJD 3RI5F 5DDHA 5I1HH 1AO7D 3QCUL 4PJCB 3S34L 5F7WC 4ERSL 4YH6A 4CRPA 2XNAB 4KMQA 4DGVH 2MMXA 4U05A 3RTQA 5IHUL 3VXRA 1MNUH 4EJ1C 5L88H 3BZ4A 4TTDC 3CAFA 5HYSA 3INUH 2APVA 1G7HA 4UT9H 1WBXA 5GQBA 1PX3A 4Z7UF 5E1AB 3F58L 5DEGA 4OFKA 4EUPA 1D6EB 4JHWL 4TYUA 2VQTA 5EBWA 3OJDB 4N0CD 2CLZA 5D7LD 3DYMA 5K59F 3U46A 4O4YH 5T33L 5DJCB 5I1CH 5B21A 1T1XB 3QDJD 1UZ6E 4U1NA 4OD3L 5DJ8B 1RJCA 3R4DA 1S5HA 3QP3A 2WBKA 2Z92A 1W0WB 3DVGB 3MLZL 4WHDA 1Q0YH 4C4KO 2M26A 1NAML 4QXGH 4YDKH 2GSGB 3FQTB 3IS0X 1IGFL 5FO7A 5BQ7B 1PKQE 1AP2B 3ELAT 2B0SL 3QHZL 2ZG2A 4JFEA 4PRNB 4ZPTB 2EDDA 3L1OH 4OZIF 3DBXA 3E0GA 3RY6C 4QRQB 2AEQH 3PWPE 5J0BA 1AGCB 3RKDC 3Q1SH 1QLEH 3OXRB 4LCIH 2X4SA 1HILB 3FFCE 4M7LH 4OZFH 5EO0B 3BE1H 1FNHA 3FZUD 3TA3C 2JCCF 5E9DD 5KVEL 4CW1A 1B6UA 1BQUA 3MX0A 3MRDA 3IU4H 3DUHA 1FFOA 3REVB 4LVOB 1OAQH 4ZUTB 5ESQB 4NKOB 5MERA 4JREC 2J7LA 3GMQB 4A6YL 1LO4L 2YWZA 4Y19A 3CLEL 3JVGA 4WCYL 1UM4H 5CFHA 3EO0A 3BXNA 1RZJC 4X80H 1KEGL 5T1DL 4JKWA 1I3VA 4JRYB 3VFGL 5SV3A 2P24B 2WWMC 1TTFA 2FJFB 2G75A 3BMWA 4JDZA 4BZ1H 3VFRA 3BP7B 4OZIE 3WFBH 1QZ1A 1SHMA 4P4KC 1RHHA 2NY1D 4QXTA 4IOIB 5BS0D 1YJDL 7FABH 3DO7A 4KV5F 3V79C 1BFOA 1NANH 5ID0A 2BOBA 5DFVC 4F7TB 4Y4FA 1RURL 1EDQA 3S34H 4BUHA 2X4QA 3SY0B 2VDOL 1YEKH 3V5KA 1I1AD 4V1DA 5HI3D 4HH9B 2QHRL 1FC2D 3RWDB 1NGXB 4MJIB 4GKSA 1FAIH 2A0LD 1T5XB 5CAYB 1Q0XL 1A4JA 5IBUG 1C5BH 3MUGB 1A21A 1I1AB 2B4CC 1UWEL 5F9WB 3EO0B 3ZTNH 2WP3T 1X5KA 4OQ1A 5F44A 3HB3D 3O8XD 2ICWJ 4U49A 4TSCH 4G3YL 3QDGB 1SJVA 4M7ZC 3F58H 2A0LC 4JPIA 1UZ6F 5FA3A 3H8NA 5FV2A 1QR1B 1LGVA 1BBDL 2XQYK 3GSXB 2HKHH 4XPHL 3MRPA 3VFRB 4Z0BL 2JJUA 1IRAY 3WSQH 5IV2B 1CICB 1J8HB 1A7RH 3U2SB 4Y2DC 3MRJB 5I1CL 1B0RB 3CPLB 3VXSD 1G7JB 3KXFE 4JN1L 4OCXH 4GSDL 1IC5L 4WFHD 4Z7WA 4QWWD 1JNHA 5IB1A 1NAMH 4O00A 5JHDD 3L5XH 3RRQA 5HVWA 4KK9C 2N1KA 1IGFH 5I1JL 4OKVB 4HXBH 1U6AH 4DQOH 1O5DT 3B5HA 2B0SH 4FQIH 4YXKH 3S5LG 4CVUA 4JKPL 3VG9B 4OCSL 5T3ZH 1I8MB 4LQ1A 5EIIA 4PD4J 3BO8B 1XZ0B 5AD0A 4HV8B 3IJHB 4HHAA 4FMFA 2CKBL 5IQ9A 5HHMB 1KPVA 3MV9B 2BZDA 4K3EL 2E7LC 3Q1SL 4UNVA 4OTXL 3U1SL 1MCSA 4QRQA 2N7BA 3QIUB 4XMLH 1JV5B 1A6UH 2J6EA 4MJ6A 4EZMA 2DQDH 3MRKB 4C55A 1QLRA 3H9SE 3BKML 4RMRA 4K8RC 3MLUL 1CYGA 1OAQL 1G1YA 5DQDH 2X42A 4GW5B 1LDSA 5LGHH 1BX2B 1CVSC 3ZKMC 2YD4A 3V9FA 1ZK9A 3OMZA 3REVA 2V2WA 1R3LB 1G84A 2QBWA 4G42B 4O2CA 3EDDA 4R4FL 1CTOA 4PS4L 1KCRH 1X4ZA 3FCTA 4O02L 2H2PC 4QTHA 5TDNB 4FQLL 4DZBB 4JO2H 1AGEA 1MREH 5SX4H 2ED8A 4JFQA 1D6VL 3MRGA 1JZ7A 1T0PB 4DKDC 3H9SB 4X6CB 1G6RL 2WLYA 3T65B 2XKSA 1OP5K 1JPSH 3H9SD 5BW7A 3F65A 2R0KL 3UBXB 3RWEB 5F1SA 1EVTC 1RSFA 3ARBD 4XMKL 1P4BH 3N1QC 1MI5D 2OR9H 3MGOA 4LNVA 3WO3B 4GG8A 1UXWB 1B4JH 4Z78B 1S7SB 2JIXB 3HS0A 3G5YA 3D0LA 4KHTH 2FATL 2YPKB 3MV8A 3L3IA 2AKRA 3PQYD 1ZHBA 3UYOD 3S5LA 4B53A 4C57C 1DSFH 4MWFA 3IDMA 4ZS7L 1JPGB 3DO3A 5D5MA 5EBMA 2YD3A 5F70A 4P4RA 1BWMA 5BRZE 1EBPA 4PRNA 4OCYL 3IGAB 2WP3O 5C2UB 2HYMA 5LCVH 2QSTA 2LU7A 4W6YB 1A6WH 2D7PA 3MLXL 4XNYL 1T3FA 4NT6B 1IBGH 5T1LB 3O9WD 4JPVL 1KTRL 5HHVH 4HXBL 4J1UB 4NDMB 2XPGA 3G6DH 2BSTA 4R96A 1Z9OA 4NN6C 5CLWA 3LMJH 4GKNA 1GIGH 1Z6JT 5EA0L 5DJAB 1OM3L 7CGTA 2P1YA 3DYOA 5DMIH 5HHPA 3RFZC 4HKZA 5L6YH 2YA2A 5L7XL 1T0NA 2Y07L 1HH9B 3NABH 5IW1B 3C60D 3ZTJH 4OLZL 4IRZH 3EZJB 3S35X 5HHOE 3AS2A 4M61A 4DZ8B 2YUXA 3U82B 3BEWA 4G9FE 4KJWC 5FCUL 4BH7B 3BPOC 3KYKL 4YHOL 2Q20A 3HC4L 4Y5YA 1I7ZB 3TF7C 4U1GB 8CGTA 1QA9A 4YBHA 5ISZB 2BNRD 2JJTC 1J88A 1MLBA 1EPFA 4FQLH 2ZNWA 3EYOA 1MREL 2E6QA 3HZYB 3BRFA 1XGYH 4GRLA 1NDGB 4Q6YA 1UENA 4UZGA 5CJQH 3TBVA 5GGRA 3RL2B 4LQFL 4IMLA 3SJVA 4ELMA 2CRMA 3DARA 5H37H 3NTCL 5I73C 4NBZB 5J11C 1AFVL 3MUY1 4R97C 3RZWA 5E08H 4LF3B 4IOFC 3R8BB 4NOBA 1CIDA 1X3DA 3HNTL 5FUOH 4NN5B 2QKIB 2OR9L 1N4XH 3WN5A 4YDKL 1D5BB 5EDXA 4LSTL 3AC0A 1BHGA 4W81A 3T0XA 2DMCA 3FB8B 4JKKA 3QG7L 1S7WA 5LXGL 1DLHB 3O4LE 5BRZB 2OSLB 5J6HA 1IGML 3C5SA 1LP9F 4GRLB 2AEQL 3VFOA 5I6XB 1V5JA 4YHYC 5D2NB 3O8XB 3PL6C 1DBJL 3E1F1 5DD1L 5A1AA 4PLKC 1I7ZA 2R0WH 1M05A 5T5NG 3TCLA 4PR5A 2VIRB 4YE4L 1S7VA 1GZPA 3MRHB 2AVGA 4L3AA 1A7BA 1J0YA 4N9GB 4L8SA 5MEQB 1JGEA 1OGAA 2R2EA 3HNVL 1TPXB 1OVZA 4NQXA 2D3VA 3R8QA 2ESVD 3O6LL 1RZ8B 5E99L 2YA1A 3FQXB 3U36A 1P4LA 5DK0B 2BNRA 1P9MC 5ALBH 1XF1A 1GIGL 4PJBF 4G8GD 4TPRH 4HWBL 3HAEA 1H9VA 4LF3A 4XNZB 3PV6A 2JJSC 1JWMB 4FXKA 4GG6A 1NJ9B 4XRCA 4WJ5A 5D7LE 1EHLL 1R3IH 4P4KA 5C09D 1AGBB 4G6AC 5IG7A 2PXYA 3D3VB 5F7DA 4QT5B 5IVXA 4PG9B 4ZTPH 2J3SA 5C08A 4NGHH 4OI8A 1WAAF 5AYUH 4HBCL 5F7LB 4Z7NE 3C6LC 3NOIA 3RWCA 2Z35A 2WUBL 2VZSA 3BESR 4U1GC 2QHRH 4YIQA 1I1CA 2OP4H 3FOLA 5GGUA 4AJ0A 4M7LT 4YHOH 3W2DH 1GPOL 1S9VB 2LTQB 1XF2B 3NZ8A 4MZ3A 4HC1L 5D2LF 1FL5A 5KTEH 4EDWL 3SKJH 4O2CB 2ZOLA 3FO9B 5CILH 2C3VA 3QIUD 2ZUSA 3HCVA 4XPHH 1VGEH 1X7QA 2W0FB 3QNZB 1W0YT 2X09A 4PJDF 4WHYH 1T0MA 4N8VB 3N50A 4JB9H 4X6DF 4NWTH 2XTJC 1NCCH 4MD5B 4UILL 2ICES 4NKMB 3ILQD 5BZWA 3STLA 4KMTL 1T2XA 3RWHB 3D0LB 3OXSB 4LLWB 2P8MA 1YDPA 3EOTH 1I8KB 4W6WB 1KGCD 1A02N 4MS8C 1A6AA 4N0RA 4XPAH 4EEEA 1U8JB 3B4NA 1H3TA 3O6FD 4PJ5B 4S11A 1CGSH 1EO7A 3FHAA 5DHVH 3W0WD 3ZE0F 1T83C 2IQAB 4FQIL 4OZIB 3MGOB 2MPAH 1GGCL 2AV1A 4PJ8D 5CWSA 4NQCE 1IGMH 4MXWH 4WO4D 3KWWB 1QQDA 5MI0B 3LKNA 3ARBA 5DR5H 5EZIL 4FQQA 2FIRT 1G7IA 2ZUVA 4CN1A 3H3PL 2ITCB 3QDMD 4U6YA 5DD1H 1E4JA 3MLYL 3WNNA 2B5IB 3LKRA 2UWEF 4KUCD 4XMLL 1HKLL 4MWFB 3AXLA 4Z7OF 1I8LC 4HIEB 4JY5H 1BM3H 4MA8L 4POZD 3D69A 3BKMH 4ZS6C 3OZ9L 1A1OB 1AY1H 3JV6A 3N85H 4QNPF 4U6VH 4IM8A 1QLRB 3HNVH 5AAMA 4JDVB 4XT1C 3QZWG 3GI9H 1MJ7H 1QSED 3W9DB 4R4FH 4JPWL 1JV5A 1R3LA 3MA7B 3MV9A 5DTFA 1A7NL 1PEWA 1R3HA 4L4VA 4KVCH 2NY6D 1KFAL 2K9UA 3QUYC 5IB5A 2LE9A 4JAMA 4Y4HA 3FAXA 4P9ML 2R1WB 3HRZB 3LEXB 2W07A 3BT2L 2AEIT 4P23C 1KB5A 1T2QL 4ODUA 3WFCH 4E41E 1MCFA 1DQTA 4I18A 4P3DA 1G6RH 2DB8A 1BIIA 1LK2A 5ABDE 1G6VK 3D87B 3ROOA 1WIOA 3PWUA 5DGRA 4JRYE 4NKQB 5GZND 1QNZL 4JANA 5F7KC 5F88B 1AQKH 2IFGA 5JTWA 4PJ9B 4TN9A 1CG9A 1QR4A 2JKXA 3KPTA 3L3JA 1FHGA 4X6CA 2BVQB 3DX7B 4UV4L 4X6DE 1MI5A 3E6FB 3I6LE 5M7QA 3NA9H 3VJ6A 3Q5YA 1AGFB 3KPLB 2F9BT 3OKMA 4HS8H 3NA4A 3P40A 4QTIL 2HVKA 3ZKXC 5J57B 4R2GC 3RWEA 1YNLL 1H8SA 2YMXH 3PUCA 1G6RB 3U7AA 5K9QI 3NGBB 4NWTL 5I0DA 1NCCL 3MBEC 3UBXA 4MQTB 3LRSB 2P42B 4I48A 3O81A 1AGCA 1MCBA 5HGBA 4RAVA 1R5IA 1WZ1L 4PJEE 4ZOAA 4GAGH 5IVZB 5JXEC 2QADB 3GBMH 3WLWC 1FZOA 1NMBH 2H1PH 5FHBH 5B39A 1P1ZB 5SV4A 1Q1JH 3EOTL 2CDGA 3MLSH 3TBYB 4JGJA 3ULUL 4EUPH 1FCCA 2ENSA 5IB1B 5IP4A 4K2UL 4XPAL 2WW8A 4L4JA 5GGVH 2EDJA 4IOIA 1I1FA 4MCYA 1GGIH 4ORGB 2BDNH 4ZD3H 5DMIL 1QYGH 5I1KL 3BZEA 3SDXA 1I8MA 1X4XA 3WE6A 2YD1A 4RGNB 2HLFD 3KVQA 4V1DB 3ARTA 1VESA 1OTTC 2YD9A 1SVZA 1MCRA 2IQ9H 3BP7A 4EI5C 2ADIA 2HLFC 4QXTB 4U6VL 1MHCA 3EJZC 1Y18B 4UUJA 1YYML 4FQXD 5KJRH 2HMIC 3IDJA 5EU5B 2DLFL 1I1AC 5EPMB 5ACZB 1OY3B 3W11C 3D18A 4URTB 2DM4A 4HH9A 1GOGA 1XT5A 4KVCL 1KJ2L 4KHXL 4S0TD 3ZKXB 4M43L 4NQDD 5K9JH 3VFSB 3SN6N 2V5MA 2Q86B 5KZCB 3MA9H 3VXMD 3HA0A 1HI6A 1JGVL 3MNVA 1JHLH 4WWKC 5EBLA 1RMFL 1AXTL 3K46A 3NTCH 2ICCA 1JVKA 1W0WA 1WLHA 1HXYB 4Z7WB 1HCVA 1G7MB 2A6JB 3JWDL 4TSAL 2NPLX 4LRNH 3HFMH 3WFHB 2CPCA 3FB6B 4ZPTA 1HZHL 3VFPA 3HNTH 1HIML 2D4FA 5TQ2H 5I15H 3EDFA 4OGAD 4RBPK 1WTLA 1TITA 5C0DB 3QUZD 4Q6IA 5ESQA 3NA9L 4YUEH 4K3HA 3RGVD 2QQNL 3OV6A 5E8DL 4HIIB 2IANE 1HDMB 1FNSL 3KLHC 1FG2B 2JJWA 3HRZA 3IS1X 1Y6KR 4IRJB 5IFAH 2VN4A 3IDXL 1CFNB 3OXSA 4WUKH 4XCFL 4M6NH 3MR9A 4R4BB 2P24A 2PYED 3PWVA 5LWYL 4GXVH 4FFVC 1FNGB 3NBNA 1A7PH 1QBML 3ZDYE 4G7VH 3QNZA 3NCMA 3LS4L 4PJXB 3GMLB 1RJLB 5C0CE 5CSGA 2DKUA 5HI5D 1Q1JL 1CLYH 2APXA 1BAFL 1JWUB 1TDQA 1CFTB 5E2TH 3P4MA 2ED7A 3O6LH 1ZGLP 1ZT7B 3T0ED 5GGVL 1HEZB 2Z8WC 3QEHB 2R56H 5JHLH 3DVNB 4L1DA 1FORL 3BZ4B 3D9AH 5J56B 3MRQA 5FGSA 2HTLD 1P2CB 4C54A 4LDOB 2HA1A 1B0GB 4KZDL 5JLZB 1R3IL 2NMSA 5IROA 5I9QC 4JVUA 3ISWA 3CUPA 5FB8B 2L7UA 3J8F7 3NIGE 2X44D 3WNLA 1JGUL 1YYMH 2WUBH 4BQCA 3ESVF 2H32B 3SPVB 3RY5A 4FXGA 2YXMA 3LIZL 1BVZA 1T1XA 1BGXH 2ZCHH 1EXUB 3NIDF 3PNWA 5E2WL 4LASH 5F71A 1EZVX 4K7PL 3N1PC 2Y5TA 2V2XA 3VXPB 1CXKA 2IG2L 1A8JH 3ILQC 4M5ZL 2OYPA 3WNPA 4RFEA 4TVPD 1WCQA 1KPRA 1CLOL 1J8HE 4R7DA 5IVXB 3BP6A 3O3UN 4EIGB 3VI3E 2BNQD 5FO7B 1ZLSH 2YRZA 2C1PA 5FYKH 4Q6IC 3UP1A 4BQ6A 3BP4A 1UZ8B 5J9PA 3U0TA 3GEWB 5L8JB 5C0FA 2ORBL 4NC0B 1MRDL 3UBXI 5DJ2A 5DEFA 3WBDA 3NIFE 1E0OB 2R2HA 5EZOH 1VEPA 3SKMB 4KTEH 4LARL 3MNZB 2AEPH 2ZSVA 4DVRL 4ONOA 3QO1A 5EULV 4PP1C 1HH6B 1UB5A 1KJMB 3BH9B 2VQ1B 4MXVE 4KVNL 4GRWF 1S9WB 3O2DA 4MJ5B 4MNQB 1D5BA 5C86A 5KSBA 3VMNA 3C9NB 2WZPD 1GGCH 5LGJA 3QQ4B 3UPCA 2OTPA 2AJSL 3BP6B 2NY4D 3HR5B 5A3IC 4ZDHB 4GQ9L 2GJZA 2VH5H 4Y4KA 4ZFOB 2VDLH 1R5WA 3CFKA 3O0RH 5J1SC 4Y5YC 1T66D 4M93C 2IPUG 1A4KB 5D2NA 1TZIA 1ZHLB 2CDFA 1U0QA 3F7VA 5JIPA 4X0KA 4XAWL 1F3DJ 5MENA 1GC1L 1XR8A 3QG6A 3EYFB 4LCCC 5ICYB 1QFWH 1A9EA 4M9OA 4XPTH 3GBNH 4L8DA 1BBJA 1L0YA 5INDB 3VWJA 2VDNL 2WBJB 3CJJA 4QHKJ 2FB4L 4JPKL 4PJHB 5HGHA 4E0RB 4K7PX 2HJKB 1MAMH 4ZFOL 1KENL 1GGTA 5CGMA 4NFBA 5D1XD 4HUWB 2P5WA 4X4ZA 5EOTB 5JPNA 1R3HB 4L4VB 2B2XL 1YC7A 3QUXD 4DWHA 2O5YH 4KKLC 1RZ7H 2FJGA 4WI8A 1YA5A 3MODH 2Q7YA 3F6LA 4KI1A 4LCWE 3STBA 4BM7A 4JFFD 3P73B 3HZYA 1K9TA 1F3RB 1QEWB 1FDLH 2CK0L 3MV7A 4PP1D 1ZGLM 2Z93A 1AHWA 1DN0A 4OD2B 2H2PD 2NW2A 1HK6A 4FS0A 1YEFL 2ZKHH 4FQ2H 1JFQH 4J8RA 1KSRA 1GRWA 3MBED 5EN2A 1BGXL 2CDEB 3B9VA 2BSRA 3VA6A 3GSRB 2VKWA 1GAFH 1T20B 5L8LB 3O45A 5I73B 3V6BR 2X89A 4BUGA 3EJYC 1F58L 1RK1A 4OZHB 4MJID 1KV3A 4YHIB 1TCRB 2BVOB 3N0PB 1U8KA 2EXYD 4OZHE 1B0GA 3L3DB 4HMCA 3T77B 5J3HC 5B3NA 1KT2A 1MQKH 5HHME 4DAGL 4PD4K 5HYQB 3FONA 5FM4A 1DUYB 2VDKH 2XPGB 4HEME 2H32A 2I25N 1Z0MA 3TNNB 1EEUA 2JF1A 3LHPL 4Z5RA 1HQ4A 5D7IF 2RAMA 3WL9B 1ZWIB 3B8YA 3FT2A 1S9XA 3TBTA 5IFHH 1IM9D 4A6YA 3QDAA 2IAND 2I60L 4Y16A 4S1DC 1XMWA 4FFZH 5I1KH 1GZQA 4OAWB 2QEJA 4HCRH 3WDHA 1IZJA 5I1IH 1XR9B 2ZJSH 4MGXA 3RUGE 4BH7A 1LP9A 4LOUD 3VGBA 2C3WA 4HF5H 4PGJA 5E4EC 1A5FH 3KPRE 5EU6D 2EC8A 5KJRL 2I9TB 1F3DH 2ITDA 2ZSVB 3QEQD 4TUKL 1KIQA 5DD0H 3K0WA 3MRBA 2ADJA 4XVUD 3BSZH 3RNQB 3QXAA 5T1KA 1N59A 1VADA 4HHAB 1NFDE 3O4OC 4DW2L 2IAMC 4KHXH 1F11B 4MDIA 3VWKA 4X4YA 3BJLA 5IHZA 1K8DB 1U92A 1MLCB 1FIGL 1EEQA 1S7SA 4JKMA 4ODBD 4XVJH 1NEZB 1OLZA 1T7XA 1AQDB 4JQIH 4OGAC 5EB9A 3V4UH 1A1NA 2R69L 3X14A 1JZ2A 3FB5B 5SWZE 3MNVB 5EBLB 4OM1L 1JPTH 1ZA3B 3OBAA 3DETC 3KDMB 3VFWA 1VCAA 3IJHA 5I16B 4ELKB 2F8VA 3ALPA 4NQEE 5J12C 1EV2E 3ARGC 4O58L 2NY5L 4OV5A 3BVNA 2CJUL 4EN3A 1ITCA 4YR6B 5GHWL 3BPCA 4ZO6A 3MZGB 2RGSA 2R4RH 5ANMB 1EHXA 1MJUH 1JE6A 4C56D 1LO3H 4N8PA 5D6DA 1I75A 5DYOB 4GW5A 3ME0A 5F9DC 2DWDA 3PABA 5C0DA 5CMAA 3P9LA 4ODVH 5EC2A 4I2XB 1PGRB 1A7OH 5HDQL 3ES6B 4I0PB 3QO1B 1OQOA 3JVGC 1CVRA 4RIRA 3QXDA 1A9BB 1DQMH 4Z9KB 4NO2A 3T09A 4YDIL 1R24B 5IWLA 5J1TC 1BREA 1SY6H 4TULL 4MNQE 3MZTA 4HUXA 2ADFL 5GXBB 4JFQB 3FFDB 4OFYA 5IEHB 1RZKL 2OZ4H 2EC9T 3EAKA 4XI5C 3DIFA 1INDL 4V2BA 3GMMA 2MHAA 3SE8H 2VXTH 4NZUH 4WDIA 2V9QA 5D1XB 2VABB 2I60H 2Y1VA 4LKXB 5SWQB 2FH6A 3KPMA 1SJHA 5FKPB 1F13A 5IHUH 4XNZC 3VG9C 4WFEE 4K07A 3GMNB 5DXWA 3ARGA 5I1IL 3ROOB 4OF3A 1WEJH 1AC0A 4QXWA 1N5AB 5CEXA 1OP9A 4L29A 1IAII 2FRGP 3MRFB 5SX4I 5D6DC 5MERB 5GRJH 4YDLC 2BVQA 4YGVB 3HMXA 4B5EA 5DYOA 2LVEA 5I17A 3KPSD 5HPOA 4YFDB 2EIBA 1KXTB 1AR1D 3FRPA 5DD0L 1BJ1H 2ZCHL 4NBXB 3VXMA 4HAFA 1TTGA 3QR2A 2YD8A 1L6ZA 4MB5A 3FFCA 1T21B 1BOGA 4LVNB 3S9DB 2FWOB 1GHFL 1PYWB 3P4OA 4NQED 4FOMA 5CZKA 1V7ML 5BJTA 4IIQA 2EEAA 3IFOA 1RUML 4Y4FB 1MWAB 4LPUA 2Y6SC 3DVIA 1AKJB 4TVPE 2NW3A 2CIIB 2ORBH 4L4TD 3PWPD 4IRSC 1YNTA 4RMTA 1JPTL 4JZJB 4L3CA 2G75B 3HLAB 3FQNB 4GAJH 4YHNB 4U1NB 1NGPL 4FQPA 1WJ3A 2BVUA 2I24N 4Y5VC 2CKBA 5E9DE 2YSSB 1YQVL 4HUVA 4Q58C 3LRGA 5CWSB 2CJUH 4HWUA 1KB9K 5GHWH 1DVFD 2AK1H 4LSQL 4F7TA 4M7LL 2D7OA 1ED3A 4WHYG 5HYJD 3RQ3A 4NO0D 4M4PA 4KJYA 1OGAE 4IBLT 5DK3A 3WUZA 2YPLE 3BPCB 5FO8A 4Q0XL 3DSFL 4EI6B 4XTRD 1HN1A 4ODVL 4PJ9C 4WFHE 1P7QD 2X40A 2FNBA 1I1AA 4X6CF 4MB3A 5FYLD 2HT2D 1A1MA 5C0RH 2EDXA 1F42A 4X80L 3PWLA 1BJ1J 1SY6L 4TULH 5EUOA 5ACLA 3ARDC 3BAEL 3CFJA 4XGZB 4HPYL 3PWNA 4GAFB 4XB8A 1OAKH 2QSCL 2WSKA 1NDMA 3HMXH 2C3VB 2MTPA 4XCEA 1BPVA 4HAGA 1JF1A 1OB1B 4H26A 4HSQA 3L9RB 4Z5RB 1AE6H 3QUYB 1J0HA 4JPKH 1UQSB 4QRTB 4HXAL 2FJFA 4ZODA 1K4CA 1SBBA 2CGRL 4BZ2L 3CCHA 3V4PH 3WJLC 2NNAA 2I9TA 3OAYK 3TN0A 1HHHB 1ES0B 4YZFE 4KGJA 2NYYD 3NFSL 4OCRL 2VR4A 5D96C 5E8NA 4ZTOL 1C5BL 5D1ZB 4DFIA 1IAIL 1KLUB 1OSPH 5FYLE 2PTTA 3ULUE 3VA2C 1FDLL 4TSCL 1R3JB 3B2VL 3OJDA 3PIQA 3MJ6A 1OAXL 3A67H 3O41A 1NSNH 5HI4C 1YY8A 1Z9SA 1ZMYA 1NUNB 2MFNA 3MOQA 1VERA 5BS0A 4ZO7A 2F8XC 3KLHD 1DVFB 4G6JH 5GS1C 2BCKB 1LE5B 1AI1H 4AM0B 4LKXA 1A6ZA 5D93B 5BV7C 4PJFA 2IPKA 5C08B 3F7PC 1BJ8A 5FYJD 4WUUA 2VYRE 4Z0XA 3T8XA 1Q94B 4S1DD 3QXWA 5FYLL 4XWGH 4R4NC 2AJXH 3T2NL 3TIEB 1C08B 5I18L 5E2VL 2APWA 3V0VB 4NZTL 1INEH 2K1MA 1E28A 1C12B 4MXQC 1WGOA 2EDHA 3JV6B 5I19L 4HQQL 2GITB 4X7DC 4Z7VF 3UTTE 2DQEH 3TN0D 3ARWA 3BIKA 1FYTA 1KTLB 3LDBC 4Q97A 3IJYA 3TM6A 5I74B 3UDWC 2AJYL 3AB0C 2EEBA 4P46C 4LEXH 3C6LB 3UTOA 5E8OB 1P53A 3F7QA 4FQ1L 3BDYH 4I2XE 4X83A 5ENWA 2EIDA 4P2RA 5GZOD 1N2RB 2IPTL 1OAKL 2QSCH 4P3DB 3QIBB 4G9DA 3KYNB 1E28B 4ZAKC 1J1PL 1G7QB 4D0BB 3N1FC 3WO4B 4OFYD 4Y1AB 5C6TH 3BSZL 4HUKB 3IF1B 3ULUD 1W72L 4NKMA 4U0RC 4HXAH 43CAB 4EVNB 1NUGA 3D1MC 2R4SH 5DRZA 5C0BB 3DXAD 3OKOB 3BIKB 5IBTL 2ZOKA 4JR9L 4C4KT 3GUTB 5B22A 1X9QA 4NQXB 3V2AR 1ULVA 4XXCC 1AR1C 1N6QH 2BSTB 5EU6E 2F5AL 3C6LA 4UDTA 2C5DC 4Y4FC 1PG7H 3KPPB 5JNYA 1PSKH 3P11H 4XPBH 5F1IA 1KNOA 1MPAL 4XWOD 3D39B 4IOFD 4LSSH 4U1IB 4BELD 1KTLA 4OZ4B 5CSBA 5IT2H 3UTSB 4PJEA 2VDPL 4L3EE 4ESKA 2R4RL 4N1HB 3RWCB 4M61B 1OT1A 2OR8A 4PRIB 5FF6B 4S1RL 1WIUA 3G5YB 3UTSD 4KK5D 1KG0B 3RNKB 3PGCA 1ZHBB 1P7QB 5IG7B 5HHOA 3LN4A 4P23D 4KGLA 2QQKL 2A74B 4NWUH 1ES0A 3LN5B 1J10A 4QKXB 2O93L 1A7OL 5HDQH 4LLYA 4TUJB 1ZLVH 5HYJA 3HI1B 3SGDI 3MRQB 3VWKD 4Y19D 4JFHD 4QHKI 4QNPE 3V5DB 4FHBD 1NGWA 3TWCH 1LD9A 1N3NA 2AXGA 4HWEL 3O41B 3SOBL 3SCMA 5EC1A 2GUOA 1BZ7A 2GTZA 4M7KH 5BV7L 4L4TA 4NQVA 4GMSH 3G5ZB 3NABL 4UV7H 3S7GA 1WIPA 2Z4QB 3NPSB 2W9LA 4NZRH 3HCVB 4LDLB 3BI9X 3C09C 3MUHL 4GW1A 1YNKH 4DN4H 3LV3B 5FEBA 1G7HB 5GRWA 4KJPC 1CDJA 5E6ZA 5JW3H 5JUEH 2UZIL 5FCUH 5I75B 5EO1B 5T1MA 5CSZA 5E6YA 4P57A 1MELA 2V2WB 4I3SL 2MQ3A 4I0PC 1XF5B 1W72A 5CEYA 4K55A 3QUXB 3VE0B 1U8OB 3GJFB 4WHTA 1NUFA 1R3KA 2HG5B 2IPTH 4JREB 3MRGB 5C3LD 1C1EH 1MFCH 1E4KC 3QNXB 5DK2B 4F37F 1AGEB 4PRAA 2AXFA 5AZ2L 2KPNA 3CMOH 4XP9H 3WIHL 4HLJA 3EDKA 4JG1L 4O51B 5KSAD 3O3AB 5EOCH 1BQHB 4R4BA 1QVOA 4RMQA 2OTUB 1QHOA 4H5SB 1OL0A 4NCC2 2XN9E 2QTEA 4Y4HC 1DDHA 2XTJD 2O5XH 2FEEL 4AL8H 2GHWB 5JW5B 3MRLA 4PBWD 1UM6H 3TBVB 5IM7B 4S1SH 1JL8A 3LKQA 3AU1B 4NC1E 1OAUH 1TCRA 3ARRA 2X4OA 2BP3A 4KTDH 3TBWA 5KZCD 2CLVB 1RUQL 5CP7B 4PY8J 3OPZH 3CSBA 3KYMB 4EN3D 3O6FA 3P11L 4XPBL 4GAJL 2IBBA 3CSGA 1KBGL 5CUSL 3C2AL 1YQVH 5EBMB 1I7TB 3C8HA 1CLZL 5C0CA 3IFPA 1CICA 3BN3B 3M45A 1AKJA 3KPNB 3UYRH 2PCPB 4MCZA 1UCBL 3IFOB 4LIQL 3QULA 4PJIF 4NZJA 2DJUA 4Q0XH 5IBLC 1DL7L 4P3CL 3DWTA 4X6EB 1VENA 1UH2A 1OARL 3SBWA 5ID1A 1P84J 3MV11 4P5MA 5E99H 1C12A 5BW7C 4X9GA 3QIUA 3MLVH 5EOTA 4JY6A 4L8CA 1Z3GL 4GQPH 1X5HA 1PKOA 1QSEB 4OBRA 2FGZA 4ZFFA 1L7IL 4PJHA 3NN8B 2XV6B 4M7JH 4AEFA 3UTTB 1SMOA 5I1GL 3V5KB 2NY0D 4K7FB 4M7KL 5BV7H 2YZ1A 3N06B 4M1DH 1OTUC 3H3KA 3FFDA 3OKDA 4M03A 3TIDB 3PXHA 5C71A 3GSNH 3WHE0 4RAVB 4RDQF 3MMEA 3BISA 4ZXBA 5I1HL 4D0CA 1IC1A 1CGYA 3FO2B 1H0DB 2DTML 4LEOB 1A1MB 2CGRH 1U58A 4BZ2H 2LTQC 3V4PL 3SKOA 4PJIE 5LGKA 1BX2A 9CGTA 2APTA 3BKJL 3KXFD 1ZLUH 1FZJB 5IROC 4PRDB 1J8HA 4G8GA 5GISL 1T80A 3IKKA 4OQTH 3ZDXE 2H45A 4UQ2A 4HFWB 1HXMA 5EO9B 1HSBB 3A67L 4H1LB 1NSNL 2DF3A 2VDRH 1EGJH 1IM3B 4XP4H 1FO0B 3GIVA 2A6KA 3B43A 3CMOL 2Q3ZA 1FN4B 4I5BA 4F33B 1RUPH 3AMLA 1LE9A 1HNGA 3AAZA 3RA7H 3K8MA 3TESA 1E4WL 4PUBL 4L1HA 2XWJB 2W9EH 5IR1B 4D0CB 5TF0A 1CFBA 2NZ9D 2FEEI 4PLOB 1ZLVK 4OZGE 1U3HC 4JFEB 1MCPL 4C83A 4PY7B 3DBXB 4GLRH 4CU6A 4EOWL 5JXED 2G2RA 2IANB 3S97C 4KROD 1TETH 4ODWA 5C0ND 3P0VL 2PNDA 4JRXE 5IM7A 2E6JA 3OPZL 3HPJB 4JAMB 4F15C 2ZUYA 4PJCF 1TFHA 2P43B 2R1WA 4Y2DA 1X5FA 2AJXL 1YPZF 4XNQA 5FECB 3ES6A 1KBGH 1J8HD 3JWNC 5CKAA 1EXUA 1MY5A 5IJVB 3TO4A 3VH8G 4NQEB 2VE6B 4NZTH 4HJGA 1KPUB 1UA6L 5DC0A 5J4MA 1J11A 2F54A 5I71B 4KY1L 4QXUH 4OLXL 3Q5TA 12E8L 1I85C 4DUWA 3C60A 1FSKB 3RWFB 1T03H 2FX9L 3EBAA 4E41A 4NO0B 4BKLA 4QY8B 4MCZB 1WBXB 2AI0L 4ZFZB 1DCLA 5FK9A 5BO1L 4Y0GA 3MYJA 5E1HB 4MJIA 3G9AB 4MNGB 1K8IB 1M4KA 1J1XH 5E2JA 3UDWA 4ZUUA 3ZKND 3CLEH 3LKRB 1KTDA 3FN9A 3VXQA 1FNEA 5FUZH 1R0AL 2AJYH 1QD0A 2O26U 1LQSR 4MAUL 1DANT 4YWGH 1NL0H 1ZAGA 3TT1L 3ZLQC 1M6OA 1RULH 3BIAX 2NCMA 3MBXL 4LCWA 1MI5E 4I9WD 1CFSA 1A1NB 3X14B 3CLFH 2MKWA 3VWKB 3L1OL 4MSWA 4JZNB 1FO0L 2DAVA 3TA3D 1H3WM 3HE6D 5BJTB 2AEWA 1UM5H 3IT8D 5DJ0A 2OJZL 1VKXA 1CDBA 4H1LH 4N5ED 4Q9BA 5HGBB 2J6EH 3QWRD 1HOCB 2EDKA 3Q3GB 2HRPH 1KYOK 2QLVB 1T5WA 4ZS6D 2NY3C 2OQJB 3UJIH 3GB7A 4LDEB 1S78C 3PWPA 1JP5A 3EUUA 3X11A 3HE6B 3UROR 1B6DA 5BVJB 1H8OA 1N0XH 5ID1B 1ZVSB 2AXFB 4HW6A 4X4XB 1NQBA 4LVOC 5TQ0L 5HYEA 1UWEH 2DQCL 4W4NA 4MZ2A 3U6RA 1Y18A 1HQ4B 2VC2H 3W5NA 2APFA 3OKLA 2K7PA 1H15B 2ZOLB 4F9PC 1ED3B 3FRPG 3QDMB 2JB5H 3T08A 1KEGH 5FCSH 3V4VL 4UAOC 1KCVH 1JF5A 2AK4D 1X5YA 3WSQL 1QO3A 1YNLH 1S9VA 1XF2A 2X41A 3HN3A 3NPZB 4LAQL 3RPKA 4OF0A 2CKBB 3CZFA 1BVKA 2CLVA 4JFOB 3KNBA 3GSVB 5DJXA 5KSAA 1JGLL 4GBXB 3QO0B 2WUCL 3C5SB 4Y2DD 5FV1L 3DMMC 1EERB 5DS8B 4HJ0D 4UDTB 4L3ED 2XZAL 3RPIB 2VO5A 4MAYD 1PFCA 5I9QB 1EJOH 4L9LB 5IGXH 3EFFA 3IJSB 4EQ3A 5IVZA 5EN2B 1KCSH 3QXAB 1XH3A 3BXNB 3HE7D 1C7TA 3DGGA 3NIGF 3RUGA 4NM8H 4G3YH 1YECL 3IU3A 2OCFD 1EFXA 5F7FA 5CHNA 1WCBA 4KY1H 4OTXH 3LN5A 12E8H 4QHNA 1BFTA 4P2QD 2VISA 5C0JB 4U3XA 1S9YB 4Z0BH 3DMMB 2BVOA 3V5HA 2HJLA 3UJTH 3AXLB 4P46D 3OR7B 5D7JB 3KR3L 3TV3H 1ZLUK 2XZCL 3OJ2C 3D2UD 4JE4B 4D94A 4XCCL 4BH8B 3DHMA 1CD1A 5T5FH 1U8QA 4FQJH 1MCQA 1Q9WB 3LQAH 1KJ3H 3C9NA 4XZUB 5ERWB 4HUNB 3FO2A 4K8RH 3SDCB 3TJEL 4JO2L 4ZO8A 5KAQF 4TVPH 4RMSA 1C5DA 5KSUA 3PV6B 4O2EB 3W5MA 5F7EL 2XQBH 1S5HB 1RI8A 3NH7L 4Z95H 4OGYH 1SEQL 2EDQA 3Q0HA 2R23A 4KRLB 1AXSB 2CKBH 1WTGT 4CJ1A 1MCEA 3UXFA 3ZMRA 1ORQB 1JUFA 1LNUB 1WISA 3QQNA 4PG2C 4N1EA 2VXUL 4HX1A 2X9YA 4IMLB 4CVZB 3W11D 1FIEA 2NTFB 1E6OL 5TE6H 4KQ4H 4P59L 5LGHL 1MFNA 3P30H 3T3PE 5MENB 4WWKB 2VLLB 3BWAB 4HGKC 1YEHH 1DQJB 4AENA 1EIBA 3K4ZA 5HYIA 1RY7B 5D7IE 1BLNA 4XNUH 5FGRA 3IGAA 1KCRL 4Z7UB 4O02H 4RMVA 4F7MA 5L2JA 1TZGH 2OMBA 3IVKA 3RTQB 3IJYB 1I7TA 1AC6A 1D5XB 3VD5A 1RUAH 1IQDB 2OTWA 4MD0B 5CBEA 2RCSH 4OBSA 4E9LA 1TTUA 1IL1A 4U1KB 4OCYH 1MCDA 3M1BB 2Y5EA 1WWAX 4LIQE 2Q7YB 4EI5B 3RUGF 2GSIA 1URLA 1GOHA 3FB5A 3MXVH 5D9SB 5E2TL 4NPYA 4KDTC 1PLGH 4TQEH 1UADC 1CD8A 4O5LL 3I75A 5CJ5A 1IEHA 4K3DH 4IMKA 3IFLH 1LO0H 2WIIB 4XP6L 4Z18A 1F11A 4MDIB 3SDDD 4ORZC 5FHAH 2CD0A 3LPFA 4JLRA 1U8LB 5HJ3B 2XACC 3CXDH 2C1PB 4DZ8A 4M7JL 1CL7I 3DGCR 1YEDB 1RZ8A 2WV3A 1I7UA 2F74A 3SJVB 4ELMB 1ADQA 2OZ4A 3GDBA 1B90A 1JHTA 4R2GD 4WEMB 1RK0A 2FJHA 5L2KB 1RFDH 3MV8E 1DSFL 3KNBB 3U7WL 1DJSA 4OT1L 4G6FD 5ISZA 2QADC 5C3TA 1IE5A 3T1FA 2DRUA 2A9ML 4PREB 5J89A 4HDIB 3MBEB 5EU3B 3ET9F 1QBLH 4X9HA 1M71A 4YQXL 3SE9H 4OGXL 3H42H 1QSFB 3VFUB 4K8RL 2C3XA 2NZIA 4AIZA 4UT7L 1Q9LA 4NFDA 1EGJL 4MA1C 4PRIE 3KLAB 1ZXQA 4GRWH 1RIVH 1ZE3C 5L0QC 3TIEA 4YGAB 4JM2C 4WWID 4U3CA 3BHBA 5JPNB 3KPQA 2YSSA 1DBKH 5E9DA 2QSQA 4JFPB 5ALCH 4J1UA 3FB6A 2W9EL 5DD6A 2G9HB 3DHJA 4JEGB 4MNGE 1HYSD 2VXUH 4NQDB 4OZFB 4PJ7E 2GJJA 1Z9LA 4MD4B 1ZA6A 2OL3B 4HS6B 5TE6L 4KQ4L 4P59H 3TT3L 2YD2A 3P0VH 2CLRA 2K3TA 1CDYA 4KRNA 1BZ9B 3LN4B 4NKIH 3GSOB 1U9KA 3LPWA 4IRSA 1YEHL 1J0ZA 5JQ6L 3RWIB 4UU9B 2HTKD 4J4PC 1KN2H 3F7YA 4DUXA 2I9LB 3UZQA 4LCUA 1RUKH 2MNUA 3LV3A 4JM4L 4MAYC 1BLNB 4F37K 3IXAB 2IPUK 3ZE2F 4PBVC 5GRVK 3V6OC 2WNGA 1AO7B 1I1YA 4PRHA 2BSSA 3C60B 2WK2A 2CSPA 4JO4L 1EZVY 4X5WA 4AY0A 2B4CH 1CDGA 4JFFE 1J5OL 3EDEA 4CVZA 2OK0H 4XPTL 4M8QA 1J1XL 2HVJA 2R9HC 4P5KA 1G9ML 4NM4H 3O4OB 5GSVA 4BSVA 5FUOL 4GH7B 4XP6H 3H9HB 3B9DA 2QJDA 3RZCC 3A0OA 1RULL 4RDQG 4UUJB 3MBXH 3ZYZA 3OX8A 1CFTA 2C3HA 4PGCB 1BBJB 1RZGB 3CLFL 1YEJL 3QG7H 3FFCD 4LCWB 2GY7B 1QFWI 5MP6L 1NBZA 3BEVA 3EHBD 5CGYC 3ZHLA 2MOVA 2HRPL 1OTSD 3T0VA 3C8KB 4OZ4A 3RWGA 3DRQA 2H26B 3WUWG 1NCDH 5C07B 4ELMF 1CXLA 4OJFL 1ZS8A 3X17A 4APQC 1VFMA 4J6RL 5DF0A 4PJ8A 5HY9B 4YE4H 2BNQA 3B8SA 1S7QA 1QBLL 3F7RA 1XEDA 4YQXH 3DX6A 4EDWH 3EO9L 4PJFE 5K9OB 5IF0A 2YRLA 4XBPA 4NKOA 4LHUG 4HC1A 2JB5L 3T0EC 1T1YA 1TLKA 3HG1D 1MY7A 5C0IA 4QHMB 4G6AD 4WTWA 3OKKA 3LVEA 4YDJB 4F7PB 2W92A 4DEPB 1ZT4B 3JUYA 1E6JL 1T7YA 1CQYA 3LSOB 3SKMA 3R06A 1SBSH 3N9GL 5IVNA 2J88H 3K80A 4CNIB 4RRPA 3NZHH 3BQUD 2Y06H 5DD3L 3G6AA 5B39G 3C09B 1LO2L 4RWYL 3EJJX 3CXHJ 3KS0J 2WBJD 1QFHA 4PRPB 3MNWB 1VACA 4HBCH 1ZEAL 3QWOB 5F97E 3QCUH 1JF1B 1OB1A 3L95A 4ERSH 3JXAA 2XIDA 2C4FT 3PHOA 3G6JB 3LB6C 3UTTA 3CFBA 3WIIL 5T5NF 2A9NL 4HKJB 3L3HA 2VUOA 4JFDB 3WS6C 5E0QA 1NGXA 5DJXB 3PHQB 4ISVA 2D9CA 1NFDA 2V17L 4AG4H 1Q72H 2DDQH 1QRNB 1IKNA 4LCYB 4JM4H 3H3PH 1I85A 1P7KA 3MLYH 1Q9OB 2FCBA 4K94C 2FYYA 5GS0D 5I2IA 5I0ZA 5C0JA 2DQIH 1R5VB 5SWZA 3RWFA 4PRHB 5DO2D 1B4RA 3SGDH 2AGJH 1SM3H 1ROWA 5F88A 3WE6B 5D7JD 1NFKA 4XCCH 1EFXB 4P5TB 4RBPH 4OD3H 4MA3B 3PL6A 1MJ7L 2V7HA 2UYLB 4NM4L 4HIJA 1IT9H 1H0DA 1XZ0A 2AQ1A 3OAUH 1UWGL 4NHCH 3T2OA 1U8IB 3QPXL 1CT8B 3ZHKA 2NXZC 3S96B 3MLZH 1E27A 1A7NH 3G5XB 5I6XC 3ARDA 4DW2H 3LKQB 3U30C 4RGND 4R0LB 2Q76A 1OGAD 3WFEH 3G5VB 3ARXA 1RIHL 5FM5O 3O9WA 2GJ6B 5F3BB 1IEBB 3RVUD 4NO5B 1AO7E 2I26N 5JW5A 1I8KA 3V4UL 4CMHC 3L3OB 1N6VA 4NQCA 1QLEL 2HFFB 4XAKE 3S36X 3AY4C 3BP5B 4PV9A 5SWSA 1DLFL 5DUBB 3T3PF 3IETA 3L5IA 3WO4C 2BSED 2VOTA 1AY1L 4MA3A 1E6OH 5J6GA 1O7VA 4LBEB 3PQYA 3QIBC 3T04D 3KJ4B 2NX5D 4NUJB 4ETQB 3KPNA 4PJ5D 3QEGH 4OLUH 5CKGA 3EYVA 3TYFA 2F53B 2XRAL 1AD9B 4FG6C 3BD3A 5AZEH 4KKLD 3ARBB 4Y5VA 3N9GH 3BGFB 1F4XL 2UYLA 1DQML 3C08L 4ZFGH 2J8HA 2RCSL 1F8TH 4DKFL 4PJGA 4JQXC 1BQHG 5GZNC 1BD2B 2IGFH 4GT7A 5KG9B 2Z4QA 2H8PB 3L3GB 4R0LA 3O9WC 4QHUA 2ICWI 2FEDC 3S37H 3CVHH 3FRUB 4D0DB 3STZB 4FQHB 3C5JB 1X5IA 4RAHA 1GH7A 3QDHA 2DQTL 4ZUUB 4Y4KC 3NCEB 5AAWA 3EO1A 1FNEB 1G7JA 4GBXD 3LH2L 4M1GH 2NY6C 2VZ3A 4QHMA 3U4EA 2DQUH 5KSAC 3OF6A 3IDJB 5EU5A 4HWZB 1NBYB 3NCJL 1OW0C 4HS8L 3MCLL 1VFAB 1YPZA 3GSUB 3BN9D 2FZ3A 4M6ML 5BV7B 3NZ8B 3B9AA 5TE4L 5HD8C 2Z31A 3BGMB 5HPMA 1YN7B 1FZJA 2Q7NA 1U41A 2AGJL 1NLDH 4U1IA 1JWSA 2P4AB 5EH1A 3TCLB 1K4DB 4MX7B 4G6FB 1DVFC 1TQBC 5SX5H 2XWJA 3I9GL 4HV8A 2FBJL 2OL3H 2OSLA 5J6HB 2RBLA 3LRHA 2F5BL 2X2YA 2FJHB 3CDFA 1ERNA 1CK0H 2GT9B 1REIA 4K2UH 4TTGA 1RIHH 4NFCA 1CXFA 2EE2A 3CFEA 5DJYB 5F72S 2C9AA 3DO7B 3CFCH 1KCLA 3ARED 2VTFA 1G9NH 4I3GA 4C83B 5HHOD 4FQCL 4FXKB 1RZGA 3I6GB 2HFTA 3V5DA 3ULUF 2LAAA 5E24E 3LKPB 3U1SH 3QH3B 3PV7A 1JTOA 2O5ZH 4X7EC 3FQXA 2VRAA 1NGPH 2W0PA 3KYNA 1CDUA 4LRIA 2DQDL 2CO6B 5M95B 2H9GB 2UZXB 4IRJC 4P2QA 5C08D 2YEZA 4LCCA 1HIMH 3GI8L 4X5LA 5FYKU 1WBYB 4B7LA 2BVPA 4P2RB 3D85B 2Y4SA 3X3FH 3FT3A 3DX6B 4QRPA 4U0QB 3VDBA 3QZWA 1RZJH 4NUGL 3VRLE 5DJZB 4C56A 4P57B 1UJTA 3TZVB 5LVEA 5K9JL 4IS6B 5I66B 5HGGS 3E8UL 3FO0H 4HG4K 1MFAL 5J3HD 2P7TB 1T22B 1BZ9A 1MCKA 4LSUH 3R1GL 2AJVL 5E7FA 1FL3A 1KOAA 1IQWL 4XP1L 3HC0B 4X4ME 2P8PA 3DNKA 4L8SC 4YC2C 4G43B 1TQCB 4F9LC 4ACPA 3BQUA 2X4OB 3EOAB 2OK0L 3HMXL 2VITA 4TSAH 2VR5A 3HI5L 4LRNL 4BQ8A 2NLJB 2P8MB 3NCBB 4Z7UE 3GJEA 5E8EB 3MFGB 4R90H 2VLJE 1UC6A 4P5KB 1HYSC 3TVMB 5DZOA 4LNRB 4S1QH 1IM9A 4KPHH 3SCMC 1IC7H 1CFQA 4DVBA 4NP4L 3EYSL 2YC1B 4LLYB 4TUJA 3QAZB 1UZ8A 5E8DH 5J9PB 4OCRH 1WF5A 1FSKC 1GC1C 3HUJA 3ORJA 4UINH 3QEUB 3SDAA 1KF9B 2FX8H 1BFSA 4P49A 3CK0H 4X5XA 5CLTA 1WFTA 4DTGH 4WUUE 3GMRB 1CWVA 2LVCA 4U6HA 5HHQB 2LU3A 5KVFH 1NCDL 1JZ5A 4P5TC 5ESAA 2I07A 1V3LA 4N0UE 1KGCE 1TVHA 1UGNA 3I2CL 1AI1L 4GRMA 2NY0C 1UB6A 2XG5A 3KPRB 1BD2E 1NC4D 4JRXA 3U4EB 1ZHNA 4M7ZB 5DMKA 1FYTE 3CH1A 4NQSA 5F9WC 3QJFB 1QG3A 3QSKB 3B3IA 1MRDH 5JA8B 5L6YL 4P3WA 4FFWC 3GJEB 5E8EA 5EO1A 3BHBB 4WI7A 3I6GA 4IDLA 5DURB 4OLZH 4NO3B 2QHLA 2FLRT 2J8UB 4RQQB 4YFEA 1H3PH 1PQZA 2FIKA 2FH8A 3OKEA 4RMWA 4TNWK 2VL5B 5B38G 3QT2A 4UOW0 2EYRB 4YK4B 3QUXA 3VMPA 1CFSB 1MSPA 2ICWA 2HG5A 4JFED 3D2UB 3U83A 1JGDA 2GT9A 4HQQH 5IB3A 1FL5B 4UTAH 3T4AB 1ZHLA 2VZTA 4LLVA 2DIAA 2VXSL 5CIPA 1KUMA 5E00B 3UTSA 1NMAH 1Q72L 3TJHD 4NN7B 4FXGB 2EDTA 3O0RL 4K9EL 1ZLSL 2Z9TA 3KPPA 1FQ9C 1MVFA 3WCYA 4N0YH 3Q2CA 2F53D 3KJ6L 4POZC 4GRMB 2ZWLT 1FL3B 4KRPD 1N6UA 4APQB 1A14L 3HI6L 2HH0L 3EYUL 3RZCD 3WKNA 2HT3D 3EYQC 1D9KC 2FJGB 5TPWH 1N3NB 1ZTXL 4LL9A 4WU5A 3BN9C 1KENH 3QUYA 5FO9B 1G7MA 5FGBC 5FUCC 3AMKA 1MFEH 1NBQA 2B2XH 1NDMB 4PJAE 4DN3H 1MFDL 5AUMA 5CEZD 1AXIB 1TVBB 3ARFB 2P7TA 4WW1B 2H32H 3S96A 1T20A 1TNMA 4KRMB 3LQAC 4OUOA 3UAJC 3QQ9C 4QO1A 1U8PA 3F8UB 2O61B 2BY2A 4ZYKA 2F8OA 4KJPD 1DR9A 2ZOKB 4U1JB 1F5WA 5JPMB 4W70A 3IVKB 1CIUA 2R0WL 5KSVA 6FABL 3MQIA 1TQBB 4M6OH 4HIHB 2DQFB 3VH8A 5IMMA 3HS0B 4JPIB 3C60C 4L4TE 3PG2A 1J0JA 1FC1A 4WI3A 1UB5B 5GIRA 4JRWA 3QEGL 3ULVC 5EUOF 2ESVE 5A2LH 1L0XA 3JV4A 3O3EA 1INQA 1FYHB 1X5JA 3RVTC 3SHSA 4YXLL 4Z77A 2X4RA 5E2UH 3ECBA 2ENYA 1X5XA 1TJHH 2EE6A 2H3NB 3UTQB 4ZFGL 1LEIB 3QEHA 4W6XB 3WIHA 5TDPA 3SE4A 1CFVH 1JZ6A 1RHHB 4KRPB 4I18B 3MO1B 4PRPA 3F7VB 3M8OL 3S37L 1MH5A 4GMSL 32C2B 4KC3B 2OP4L 3UJJH 5JOPD 1EMTH 3K74B 5ELIA 3O2VL 1DUZB 5EUOB 1YNKL 3U0PA 1KN4H 3RWDA 3B9KC 4I5BB 4F33A 1K2DA 5HDLA 1Q9WA 1F58H 4HCRA 1OP3K 2DM7A 5TF1L 2UZIH 4M1GL 2E9BA 5CILL 5I8OL 2EDNA 2E3VA 4TRPH 1MHHA 3NPSC 4ALAL 1DFBH 4WO4C 4AEHL 4QHUB 1UACH 2KL6A 3BMVA 4IOSD 5FXCH 1XGTA 1HH9A 5DT1H 3GKWH 5ITBH 4E5XB 1IILE 4DAGH 1DZBA 3TN0B 5C0CB 3G04B 2GYSA 3LOWA 1MF2L 4NSKA 2XTJE 3K2UL 3EO1B 4WFED 1EX0A 2X6MA 4FQQB 1EGJA 4PB0L 1XGQB 35C8L 1F4WH 1CK0L 4AH2B 2GKIA 4L3CB 1MFEL 3VGEA 2AJUH 3JUZA 2FZ3B 4MQ7B 4UBDC 2AV7B 3QQ3A 1CZ8L 3G5VA 2GSGA 4XVJL 2CR3A 2E7MA 4X6DB 4FQCH 3T0EA 2X4SB 5EO0A 1QSEA 2QQLH 2X1WL 3MRIB 1VPOL 4YHMH 5ISZD 1OTSC 5DUPL 3SGEI 4QCIB 1S7UB 1FLTX 2NZ9C 4Z7NF 4O58H 2DQHL 1RD6A 2APBA 1LP9E 3WLBB 3P9LB 1IKNC 2GK0B 2WBJC 4GS7B 4OCWL 2Z8VC 2DM2A 4M6OL 3DUUA 4X5WB 4KJQC 3SCMD 3JTTA 4IIQC 2EDLA 1MHCB 1I9EA 2ZNXA 3L3IB 1RZIB 2R0ZL 4MLSA 3CC5A 3PGDB 3U9UB 4FTVD 4DFHA 5EZJA 4YPGB 2G60L 2W9DH 2EYTB 1KFAH 3O3BB 3MLTB 1ZV5A 3WNKA 5B8CC 4PJIA 4H0HB 5EU4B 2P44B 3HPLB 1NFDB 1Z3GH 4NIKB 3D2UA 1FIGH 4YC2B 5MEOA 1MRCH 1EUTA 1NEUA 3MRNB 3MYZA 5EBWB 3MGTA 2WANA 3TH3T 4JHZA 1RZKH 2OZ4L 1NLBH 4X7SH 4M1DL 3QUKA 1T1WA 4U1HB 3T1WA 1FAKT 1ZKAA 3AB0B 3VXUA 3O2VH 3TYGH 4JJHA 3V8CA 1K5NB 1MVUA 3I3EA 3L7EA 4NQEA 1T21A 3CC5B 2HN7B 3ZDZE 4KKCD 4P5TD 4JFYA 5JORA 4NQCB 5EZJB 1INQB 4JQXA 5I8OH 1FG2A 4OGZA 4OZGA 2JCCB 1NBVH 5IV2A 1WBZA 1C16B 1G7LA 4Q6IB 4WO4A 2CIIA 3ZDYF 4QY8A 3S4SB 1JJUA 1T1YB 3O45B 4OQTL 5FA3B 4HD9A 1UEMA 3BPNB 4ZOCA 4PLKD 3DRTB 1FFNB 2MJWA 5GRJL 1PDKA 2YN5A 3VI4E 1HSAA 3GKWL 4UIMA 5KVFL 1RU9H 2KKQA 3L6FA 5C70A 1KCKA 4XCYB 1HHJA 3QUYD 5DHYB 2VDMH 2MQCA 2DL2A 2EKJA 2DMBA 1FGNL 2Z35B 3ARPA 5CBAB 2I9LA 4I77L 2ADFH 4P2CG 1KJVB 2L0DA 4WTXA 4PB0H 3TA3A 2F54E 3MLSL 3NFPA 5CJOH 3UTZA 3OWEA 1AP2A 5IW6A 1INDH 4PGDB 2FR4A 1GHFH 1HHKB 4JM2F 2NY2B 4YHLH 4EDXB 3MNWA 4RISH 2I5YL 3SDCD 3V7MA 1LK3L 4MJIE 2EE9A 1ND0A 3UO1L 2HJFA 1EEZA 4HMDA 4NBYB 1FJ1B 3D0VA 5D4QA 3P9WB 1YN6B 4NO2B 4X98A 4RA0C 2G5RA 1YMHA 1H3PL 1T1ZA 2EXWC 2ATPA 1U91B 3QNYA 2AK1L 2XZZA 1R5VA 4GBXC 3QULB 1NGQL 5BCAA 3HE7A 5D96B 3HMWH 3HZVA 5E5RB 2HKFL 1J86A 3VH8B 4UTAL 3S98A 4WEUD 3EYQD 3GM0A 4QRUB 2Y25A 5GJTL 5DZLA 3HZKB 2J1KA 4MAYA 3ZKSD 2FL5B 1D9KB 4P46A 3EDJA 4TOYL 4R3SB 1MRCL 3NIFF 1OAZH 3HHRB 3QCTH 5IFJA 3L7FA 1M1SA 3NCFB 4X6EA 3C2SA 2CDGB 2DI9A 4AQ1B 4N0UB 3VFTB 1KJMA 5K9OA 4AT6B 3OKDB 4KXZI 1NLBL 1JZ4A 2CLRB 1AR2A 5B4MD 2ZG1A 2R2HB 3QBTB 4HK3N 2F15A 1LEGB 1UKQA 1C5CL 5JA9A 3GGWB 4LKCB 3RJQB 5IOPB 3W0WA 4LCUB 5IB2B 4I4WB 1CBVH 2I27N 2BRRH 4ELKA 1HE7A 4N5UA 5DC9B 2IH1B 2W60B 3D25A 4PTUA 5CP3A 5FOBA 2CMRH 5GGRB 1XIWA 3MJ7B 3UPRA 1T6WA 2VC2L 5E5MB 1X5AA 3QDJA 1W72B 4HPOL 5AUMB 3VFNB 3SKUD 1U8OA 1U58B 1A7PL 3MROA 4TNWF 2AJ3A 4ZFOA 3VG0L 3VFVA 4XC3L 4HULB 2RJMA 5F21B 5HHXL 1KEML 5GS0L 1LK2B 1I4FB 4KK6D 5E8PB 4PG2A 1SYVA 3VXRB 1CLYL 5CJOL 5EUOE 4OD1L 1BAFH 4TNVK 4WW1A 1KIQB 5D1QB 1CDIA 2BC4A 5JLZA 1FNAA 1MFBH 4NQUA 5C9JB 4HKXA 2J4WH 2FDBP 5HHPB 1AHWC 4D3CH 1NMCB 1FORH 4YXLH 1ZANH 1A47A 1RJYA 3WHXA 4PP2A 2XWTB 1MNUL 3GRWH 1WVZA 5J1AB 2UVFA 3UO1H 5DJAA 1LEGA 2F58H