2P5EB

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPCIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eB00
1MQ8A 4MLSA 3KYOA 4LK4A 1HNGA 1KPRB 3G5XA 5D1XC 3WFEL 5IFHL 3WFHB 1LO2H 1IGCH 3P0VH 4LVHB 3LKOB 1AY1L 3N1PC 1WZMA 3FQRB 3OXSA 2X7LB 1NGZA 1IBGH 4YO0A 5E7BA 1E4WL 3PABB 3UO1L 3WNMA 5JA9A 4P4RA 3MRLB 5EORH 3AS1A 5AG8A 4NQVB 4OCSH 2X2YA 5C09B 1WBZB 5IMOB 5L2KD 2N4IA 3VWKA 3FO1B 4JFFB 3DRQB 2JB5H 5HD8D 2G9HB 3VRIA 4R0LC 4PV8A 2JKXA 5CGTA 2FGWH 4N90E 1JMZA 3TVMB 1EHLH 1MPAH 4S1RL 1C12A 1DQMH 3EFFA 1RAMA 2E8YA 1KCSH 1YNLL 3JUYA 4G80A 1RUAL 3C5SB 3HE6D 1K4CB 2PYFB 3LHPH 4YJZL 3S36L 4CW1B 4WW1A 1H3GA 3BP5B 4ZFOL 2IGFL 1D9KC 3Q1SL 4HUWA 4PJBF 1LDSA 1G6VK 4GAYA 5KVEH 1XF2A 4NWUH 1NDGA 4NRXB 4KZEH 4N8CH 4HWZB 1N6QL 4V2BA 1MNUH 1E6JH 1NFIB 3ULSB 4JFQB 3MRIB 4HS3B 5CAYB 3QUXB 5F89B 2OI9C 3SGEI 3TC9A 5IQ9B 3SDAA 2VZUA 3AUVA 5E56A 2A6KA 1LO0H 3RIFF 1MCJA 1NLBL 1W0YT 4EVNA 3L5IA 4NHUA 1NUFA 1EEYB 1FDLH 2NZ9C 3SDAD 3U9PL 2XQYG 3OBAA 4N8VG 2QHRH 2DQJL 4JFPA 2JJVA 4QHUB 3SGDH 2BXZA 3LRGA 3NCFB 3LY6A 4LP4A 3L6FB 1J0HA 4HIXH 3BPLC 1SHMA 2NY6C 3QIBC 3HMWL 2AXFA 1N64L 5I1DB 2JCCF 4M62H 5BXFB 3LKRA 4KRPD 3AC0A 4C58B 4ODWB 3MYJA 3GSNH 5DF0A 3ZDYE 6FABH 3VXNB 1QVOA 1NGPH 3GIVB 2Q8BL 5MENB 4OT1H 4KJWC 4L9LC 3H9YA 1FZJA 5LAXA 4WI2A 5E5RB 4M7JL 4L3CB 4AJ0A 5CWSB 3NFNA 5E2VH 3CZJA 5HY9B 2P47B 1RIVH 4NYLB 4C83A 4Q2ZA 2EXYD 5KG9A 4R4FL 3PGFL 1NC2B 1EXUA 1UM6L 4PRAA 4Y1AE 1B6UA 4B5EA 1DQDH 1NLDL 4LPVA 4UTBH 5FM5O 3LKNA 3QDGB 3WIHL 1XZ0B 4N0RA 5DJDB 3MNZB 3QO1A 4IIQB 4JHZA 4HZLB 1ZLVK 1CYGA 1RUML 3PDOB 4GKNB 4M03A 4HWBL 2YN5A 3S9DB 5HVFB 2FX7L 4I18B 3SPVB 1BZ7B 3RHWF 3P73A 1A4JB 3O4OB 3U0TA 1B0RB 4W6YB 2A0LD 3SKJL 4ERSH 1FNLA 2EDBA 3OAYK 1DEEB 2P24A 1FVEB 3TBWA 4IRJD 3HR6A 1A1MA 4RWYL 1QKZL 2W0KA 5FCSH 5H37G 3ARSA 4EOWL 3J7HA 5ANMB 1CDHA 3B8SA 3MBXH 4FXLA 1G6RL 3IS1X 2WWMC 2VLRD 1G7LA 1GL4B 3WHE0 4NFDA 4M9PA 4OCWL 5CILL 1YC7A 1BAFH 2C3VB 4POZC 5DS8A 2DJUA 2X05A 3ZDXF 4F3FB 4J12A 3D39A 1NCWL 1VENA 2OL3H 5IB2A 1INDL 1YQ2A 4OCNC 4HS8H 4AEHL 2Y5TB 1XGQA 3MJGX 1FVDB 4PREB 1T22B 3HCVB 4U6VL 2V2XB 1IM3B 3FOLA 4L8CA 3T1FA 5D7SL 5E8NA 3VFSA 1PG7W 2H9GA 1S3KH 4DTGH 5D2NE 5AZ2L 2P5WE 2P7TA 1T03H 4MJ4A 3MV8D 1IEBA 2ITCB 4S10A 4YE4L 4MNQB 3X3GH 4XMLH 3FT2A 1S7WA 1LK3L 1JNHB 1N4XL 3BN9D 3LKQA 5GS3A 2NY2B 3OGOE 5TGBA 5LGHH 1VACB 4ODXB 1YY8B 3V5KA 3RNKB 3L9RB 5IEHA 4NKMA 3RQ3A 1ZTXL 2HTKD 3V7AE 2XY1A 3BDXA 4F2MB 1OT2A 1OGAB 1WTGT 4PRIA 2XY2A 4HC1A 1J1XH 4K9EH 4C56B 3PP4H 4FXGA 1KV3A 4RDQF 1JWUA 4KPHL 4G8FB 1MCCA 1F4WH 5CJQH 1IAOA 4XNZB 4C4KT 3ME0A 3N9GH 4GRWH 3KPRB 3LN4B 5CEXA 4QOKE 1GRWA 4XNXH 1NUDA 3C6LC 5L88H 1T3FA 3K80A 1ITCA 1LE9A 3MV01 4XCFH 5I1IH 4F80A 4JRYD 5EZOL 2HRPL 3RUGE 4PJ7B 4NQDE 4LGRB 5JXEA 3D18B 5J11C 5KSAD 1CG9B 1B0GA 1D5MA 2W92A 2YD5A 3VXUE 5HVWA 1WIUA 5CJXC 3G9VA 5GGVY 1DUYA 4NO0B 1UXWB 2Y72A 5AD0A 3E2HB 1S7QB 4OI9A 1AXTL 1FNGB 4Y88A 3QO0A 5DMJB 3G6AA 3TO4B 4P9HH 3S96B 4L8SB 4NJAH 2HFEB 4JHAL 2Z31D 4ZUTA 1NUNB 2EC8A 1ZOXA 4X4MA 3U0PB 5EIVA 5ICZA 3MRJA 4RA3A 2P48B 3FQNA 3P4MB 5HDBE 3EOTL 4JY4B 5H94A 4GLRI 5ICYA 5CLWA 3HUJB 3RIAK 4EDXB 4GW1B 3QZWG 5CHNB 4EBQH 1MJUL 2X4TB 3DIFA 2I60L 1NL0L 1RZFH 2EH8L 2E9BA 1F90H 4Y19E 4LU5L 1ZLUK 4ZFGH 4UU9A 1JHKH 1A6VL 4AEEA 1SJHA 3CVHB 3HI6H 5JR1H 4MMXC 4MX7B 1VFAA 3QPXH 4A6YB 4K7PH 2VISB 2YSSA 3PHQA 5J1TC 3V0VB 2VL4A 5IR1B 4PJ9C 3GGWA 4QTIL 3CZFB 1BJMA 5C08D 4M6OH 4BQCA 4OCRH 1F6LL 4XXCC 4PJBB 3VD5A 3W9DB 1NMBH 2IQ9H 4V1DE 5C2BL 4IBLT 3TA3C 1YMHB 4NQCE 4DKDC 1NBYB 4NNYA 2VZ3A 2LFGA 3W39A 5IMKB 5DEFA 3INUH 1F3RB 3FRUB 4HEME 5EOQL 2QTEA 4OLWL 4ZSOA 3GJEB 4MZ2A 3QEQA 3U30C 3PJSB 1NCUA 1CICC 3ZT6A 4JZOA 1RZ8B 3SE8H 2IANA 2E7BA 1H0DB 1ND0B 4XWGH 1MLBB 2C4FU 5FHAH 4KKLC 4UTAH 4P46A 3RBGA 4CNIB 4XBPB 1KBGH 5J57B 1L0QA 2V17H 1EBPA 2WUCL 3O3DB 3SDXE 3PV7A 4RX4A 1BVLB 1MUJB 3RA7H 4RFEB 1DUZB 1JWMB 2H6PB 3SO3B 3HC4L 1UG9A 1QRNB 4RX4D 3JV6A 3QULB 4KRLB 3A67H 1CZ8L 2JCCB 2UYLA 5JW4M 3AFLA 2OR7A 1IL1B 3KPNA 4PLJC 3WE6B 1NH6A 4RAVB 3MOBL 4LPYA 1A7NL 2AI0L 5B8CA 5LJYH 5IHBA 3LD8C 3FO9B 4I4WA 2BNQA 3DMMA 5FUCC 4HSQA 1IRAY 4LKCB 2ZUUA 2AJSH 4AG4H 2EEAA 1P4IH 1N0XL 1RIVL 3RKDD 3OJDB 4S0TD 4LHUA 5JNYA 4HXBH 4J3VA 5L9DL 3N1QC 1EHXA 4X99B 3G04A 5AWNH 1KB5H 3FB7B 1DE4B 4LHUD 4WEMB 4AM0B 3HS0B 2BFVH 4PJ8B 1SYSB 2MQ0A 1GOFA 2DTSA 2H26B 3MV11 3T2OA 2V9RA 4J3SA 4HD9A 2NY3D 2R4SL 1WT5C 3U4AA 1JWSA 4PJAF 2XWTB 4XP4H 3GHBL 2IEPA 3GI9H 4JQVA 3SKNA 3IS0X 5SV3A 2EE9A 5DSCA 3OAZK 1WZLA 2Q7NA 4ERSL 1CFNB 4HC1H 3S88L 3ARQA 3H3BC 4J3WA 1Y6NR 1LEIA 5DVMA 4DW2L 2P8LA 3UTZA 5LQBH 1QSZA 1UH3A 4R90H 4JANB 4N90D 5C86A 5EBGA 1NGYA 1TMCB 4U6YA 4M6MH 4OZHF 3Q5OA 3O8XC 3RGHA 1DBMH 2ZSVB 4XCEB 3VI3E 5T5NG 4OZIE 2PW2A 1UB5A 1ZT1A 4O2EA 1ZGLP 1I1AC 4ZUUB 2HA1A 4LAQH 1CD1B 3LQZA 5JPMA 2VLKE 4APQC 4AENA 1DZBA 5JIHA 3GMRA 5CSGA 4QRQB 3SCMC 1XAUA 2DYPB 3KLHD 2PR4L 1HHKB 3ZYJA 4OFDA 2RBLA 2DWEA 4S11A 1U9KA 4H8WC 3T09A 4ZNCD 5HDLA 5C2UB 2ZCKH 1UH4A 4FQPA 2O93L 1ED3A 5DK0B 4NOFA 3QDMD 3OB8A 4PS4H 3C6SB 1FZMB 2W1NA 4NWTL 5F7EL 1OHQA 3C5ZC 3TIDA 5GSRA 5HYJB 3VFNB 3Q5YA 5HYSA 5GISH 1Q0YH 1CLCA 2D7TH 3DX9A 4Z6AT 3F12B 3S3SA 4F7PB 3ABZA 1TVHA 3DUUB 2ATPA 4TUJA 1N0LA 3SOBL 4EN3B 4QRPE 1CD0A 5TDNA 5DYOB 1TLKA 3RX7A 3PL6A 3WKMH 3N1GC 1PY9A 2FIKA 4JFEA 3T2NH 1Q8MA 4ODBD 1A7OH 3N1MC 3B9DA 3UBXA 3BVNA 3SKOB 3GSWA 1TCMA 1E28B 4KVNL 4NPYB 1IC4L 3L95A 1GCFA 2BVQB 5DC0A 4Y1AA 1NDMB 2X1XR 1HILB 5INCA 1LD9A 3K2UL 4YDVB 1F5WA 1T2QH 3RL1A 4Y1AD 2BSSB 5ACLA 1S7XA 4M1CD 3QEHA 1KEGH 3RY6A 2FB4H 4JO3H 4U1IA 5TE4L 3S37X 1KCKA 4MB4A 4NJAL 5HHNA 3LH2H 4P9MH 1CXEA 3RPIB 1HHIB 3WO4B 1BJ1J 4ZUSB 4BSWA 2JB6B 4P2RD 4PRHE 5IB1B 1G9NH 5E1AB 3UTSA 3G5ZB 1F45A 1ZHNB 4X4ZA 2XN9E 5E5MA 2F15A 3GMMA 5FGBC 1UJ3A 2E7HA 3MC0A 1SEBB 1CQYA 2YD9A 4U3HA 1MRFL 1J88A 3MLUL 2E9IA 4MDIB 1CIUA 1MWAB 2BSTA 5GZND 5C0ND 1WBYB 4PJDF 4KJYA 1QO3A 4XCNA 3JSSA 5MEOB 2VLJE 5IWLC 3C8HA 2VXUH 1PJ9A 1ZANH 2QL1A 5GZOD 3SDDC 3H9SE 1S8DA 4WUUB 2FECL 4NQXA 3CXDH 4WY7H 1EAPA 4TSBL 1MCOL 1U8IA 5HGBB 3MCKA 1H8OA 4RWHA 4XZUA 2LAGB 3RWHB 1GGBH 1IFHH 2H8PB 5I18L 2BZDA 3C2AL 1AO7E 3BZFB 3VXRD 2BX5A 3VRLF 5JOFA 4HX1A 5J13B 4DOHB 2IQ9L 3FZUD 2DQFA 3GSXA 5D96B 3U36B 4HJ0D 4MYWB 43C9B 1T20A 1OLLA 4LARH 5D2NA 1QBLL 4LCWB 4NBXB 4G8IA 2QEJA 4RQQB 4WDIA 4QXGH 2NY0C 1P4BL 1B4RA 1R5WB 2P5WD 1GAFH 1QFUH 2P8MB 3SGKC 3L1OH 2ZUVA 3LZFL 4JRXB 1QFWH 3TYGH 3DXAD 4Z7VF 4LNVA 3QNXB 1FO0A 2FATH 4X6DF 5DRXB 5FHAL 2H1PH 3ZLQC 1BVZA 1FV1B 3LRSB 1QD0A 1ZMYA 4H20H 3VFRA 4P57A 1MI5B 4WU7B 3ULUF 1HCFX 3QEGH 2FH8A 3WKNA 4GXUN 2YRZA 3U82B 4CN6A 4IMLA 4D0BA 5LBSH 3W11D 1INEH 1XGTB 2D2OA 3F7YB 3OX8B 2IQAA 4AQOA 1YEIH 1CE6A 4QOKA 3EJZC 3RL2B 1OWRM 1S7UB 3WIFA 3IFOB 3H3PH 4XPFH 5FCUH 3CXHK 3PHOA 4HIHB 1FZOB 5C0DB 1QLRA 3VXPA 1TJIL 4GRLA 5HI4C 1ZA6A 4LSRL 1FGNH 4QOKD 4BZ2L 4GFTB 3RUGA 3BD3A 4NQDA 1PBYA 3ZYOA 1ZK9A 2AEQL 4ZUWB 2X9YA 1J0ZA 4G8GE 4WW2C 3VXUA 4GRLD 2FJHA 2NYYC 1UCBH 3K8MA 1KT2A 2VZSA 4ZD3H 2WAHA 3W5NA 2CLVB 1BZQK 2OTPA 3KPSB 3P4OA 3T0AA 3VXUD 5C0BA 2YEZB 4GT7A 5L8LB 3QQ4A 3GSVA 5MERA 1DL7H 1ZEAL 1MCEA 3ZKNC 2J5LC 2VE6A 3BMVA 1N5AA 4HLJA 3JXAA 1KB5L 4OAWA 1F8TL 4HXAH 5FV2A 2BFVL 4RMWA 4N5UA 3ZE1E 2EXWD 1LK2A 1WF5A 4QT5B 1BQHB 1U8KA 1T0NA 1TPXB 2DI9A 1PSKH 3ZDZF 1A9BB 2D3VA 1JPGB 3F5WB 3HNTH 3QNZA 3HB3D 3NCEB 1AXSB 4WO4B 4YGVA 2GK0B 3ARRA 2VYRE 3OB0K 2XZAL 1RY7B 3RX5A 3HPLB 2IG2H 1P7HL 4PRNB 3FN0L 3SDYL 1XCQB 4I77H 4Y19D 4PJIE 4R0LB 1PYWA 5FUZH 3QUML 4R90L 4I2XA 2H32A 1DBJH 3JWDH 4YH6A 3EZ8A 2UZIH 3I50L 1P7QA 3L3HA 1K4DA 4QRSA 1EX0A 4L5FL 4OLEA 4YIQB 1V05A 4V1DA 5H37H 4EI5A 3C60C 4NQCA 3PGDB 2DMKA 1DLHB 4YFEA 5A2IH 1P7QD 4R26L 2DMCA 1D9KB 3GB7B 2P5EA 4FTVA 5GRUL 4V1DD 1AFVL 1T7YA 4EI5D 4NQCD 5I0DA 5HHPA 3KYAA 2DLIA 2YPKB 3P77B 3IDUA 2E6QA 5DUML 1Q9LB 1JFQL 3CMOL 4AH2A 3BEVB 3RI5K 3WFCL 1M7IA 1CVRA 4WGVB 3I3DA 3LIZH 3B2UC 2R8SH 3QH3A 1A7RL 4WHYG 3QA3B 1ZA3A 4UT7L 4DAGH 1AC6A 4LAJH 2QJDA 3IFPA 1UYWH 2NY4D 2VDLH 5FKAA 1ACZA 2BNUA 4NZUH 1AQKH 1KG0B 2J6EL 2FJFA 3BPOB 1HDMB 3VGAC 5ITBH 2D31A 3IDGB 2W91A 3WV0A 3VI4F 2HRLA 5B39B 1INQB 2PW1B 3BPLB 3W9EA 3JVGC 4RMVA 2NY6B 1C1EH 2DQCL 3QIBB 4KUZH 2IPTH 4OI8A 4KDWA 4MD4A 5EUOF 5I73C 3LKPA 2R39A 4UNUA 3ZL4H 4U33A 3V4UL 3IB4A 5JPNB 1RZ7L 3DRTB 4YNYA 1T1YB 2AJZB 1FCCA 2DBLL 5AYUH 3PNWA 5JHLH 5FXCH 5B4MC 1DN2A 1GGIH 5GHWL 1T1WB 3RTQC 4UUJB 4P2OC 4FMFA 5TJWK 1Z0MA 2H3NA 5E2TH 3FQXB 5IJKC 3CX2A 1QTYT 1YYLH 1JTTA 4X6FA 2EYSA 4K3EH 2Y36H 3SE3C 2PTTB 2H2PC 4ZS6D 4RBPK 5C7XL 4BZYA 2X89A 4ZOEA 3IETB 1W0VA 2F54A 1QP1A 2WP3O 4MQTB 5HYQB 5IQ7L 1FO0H 4NC1C 2HH0L 2FX8L 5E6IA 2XZZA 4RGNC 5CZVL 4L9DA 1I3VA 2X89D 4B53A 4KQ4L 1FFOA 3OQ3B 3OHXB 5CJ8A 1JZ2A 5H2BA 3O6LH 3VFMA 4PJDB 3B5HA 3IU4L 1MELA 3U0WL 1EPFA 3FHAA 2DB8A 3VD4A 3HNSH 4OZIA 2I9TB 1ZHLA 1HQRB 1QHOA 1HZHL 3TBYB 3OKDA 5I30H 5C8JA 4KMTH 4O2CB 3C8KB 5E8PB 5I1JL 2UWEE 4XMKH 4X6CE 3NIFF 1A21A 3TH4T 2OX5A 2ADGB 3VFTA 1UC6A 2VLKD 5MP6L 4K3DH 1RUKL 1NAMB 3T0VA 5JQ6H 3SBWC 3C2SA 1U8QA 1G9ML 4QKXB 4PRDA 2H2SD 2ZPKH 3S35L 3UP1A 2NLJA 4JO2H 2PUQT 2HN7B 3ZTNH 5IKCB 2WM0A 1MRCL 3R0MA 3WEXA 4NQUA 1WAAE 4HBQA 2F19L 3BP7A 3GMQA 4Z7VB 4ELMA 4OZFA 2EDDA 3I6KB 5D9SA 1Q0XH 4LQ1A 1MH5A 1KIQA 5DGRA 5C0GB 4FHBD 1WBXB 1JUFA 1U8NA 1F3JB 4FFZH 4PD4K 1A0QL 5IOPA 1MFAH 4QRPD 1F4YH 2IC2A 3EUUA 4HIJB 1ZS8A 1BLNA 2HWZL 4BH7B 4JLRA 4XPFL 1MCBA 4PGEA 2X41A 4KFZC 3E3QE 1UQSB 3VFUA 3C6LB 1A1NA 1JK8B 3KPPA 4MAYD 2FWOB 2WQRA 1FNAA 3L5HA 2ADJB 1KCUL 1FORL 1KB9K 1LE5B 3CFJB 3MNWA 5ADOL 5J11B 4AIXA 4YEFA 4LEXH 4DFIA 3MBEA 4CMHB 1J1OL 2D7NA 3TNNA 2P43B 3AAZB 2ORBL 1UACH 2E27H 2EO9A 1QQDB 2ARJB 4JN1H 5D7LB 1XF1A 2X44D 5T5FH 5INDB 1I7ZA 1L7IL 2HP4A 4K9EC 5HHVH 1X5JA 4PY7A 4HXAL 2FSEB 4ZTOL 4LCUB 3HFMH 3UJTL 2JJTA 1U91A 2CDEB 2GY7B 2A77H 1KLUB 3PDDA 3BIAX 1JI1A 2O5YH 4PRHD 2DJSA 4Z18A 1H8NA 1UM4H 2BJML 4Y4KB 2XN9D 4OIIH 5I1CL 1KELL 2GSGB 2VITB 2GFBB 1U95B 3O3AB 4POYA 4QTHB 2Y9RT 2VLJA 4JFDE 1WUNT 1HI6B 4L8BA 3EHBD 1YEGL 3H9SA 1TDQA 3TH2T 4MJID 4J8RA 4J3XA 3VWJD 1M7DB 3V6FA 4LBEA 2VZ1A 5FUZL 4U1LA 3H9SD 4LIQE 4P9HC 5SWZB 4OFYA 1K2DB 5CBEA 5E2WH 5IFJB 4HT1H 1T21B 1AO7A 3MCG1 3SDAC 4XVSL 4PJ9B 1CD8A 4CU7A 1NGQL 3BMWA 1FBIL 4M6AA 4NQEE 4NGHL 1A8JH 4WHDA 1AO7D 3HZMB 3KXFD 4GW4B 1HEZA 3TA3B 4CVZA 2ILLA 4UDUB 2EDRA 4RGOH 4P48A 1EVUA 3RDTB 1NFDE 4YQXH 5T3ZE 5F93C 1YA5A 5I8EA 3KDMB 4NCC1 5CSZB 4OLUH 1CICB 1JPSH 2WWKO 1OGTB 1S9XA 2DQHL 1BQUA 2Z8SA 4HJJL 5IW6B 2JELL 2B20A 1TCRA 3TF7C 4AMKL 1A22B 2ZCLH 1AJ7H 1FCGA 5M7QA 1G84A 1NGXA 1UA6L 3VJ6B 2D7OA 4KY1H 1GXEA 1FL6B 5EPMA 5E95B 3VFPA 4U4BA 4X7TB 4M3KB 5D93B 2APWA 1YPZF 3MRCA 3BKML 1HWHB 2K7PA 4G8GA 1A14H 1T0MA 4GAGL 3VGFA 1XFPA 3TP4A 3RWFA 4Y5VA 5DHYB 2VWEE 4L8DA 5HHQA 3LD8B 4G8GD 4H0IA 4WW2F 4NHCH 2A0LC 4XB8A 4E41B 1JRHI 4UOW0 1YN6B 3PP3K 4PGCA 3HZKA 3AMKA 2OSLB 4TSAL 3O41B 4PLOB 1VKXB 1MJ7H 2VXSH 3B9VA 4X80L 4OGAD 2AK4A 2YPVL 2YBRA 5T3XH 3ES6A 1VSCA 1N3NB 3CSGA 2XV6B 2GUOB 3K81A 3FTGB 1NCNA 3QXUA 4OFKA 4HGWA 1FFPA 2SEBA 4MA3A 3ARUA 5FA3A 3RVXD 1X7QB 5BV7H 1CGVA 4PR5A 1YJDH 4NKIL 1HHGB 3PXJA 3QG7L 4OZFH 4FP8H 3WFBH 4TQEH 3FN3A 5C0RH 3G5VA 1T7XA 2Z92A 3OG6B 4X7FC 2BCKA 3QXAB 4P59H 4BA8A 3KNBA 5KOMC 5C9JA 1BHGA 1R3LA 4PJIA 1KC5H 2ARWA 4YWGH 1KTLB 4HUXB 2E6JA 4HQQH 4NN7C 1CL7L 3MODL 2XICA 3TO2A 2GW5A 1NBVH 2DJ4A 3GSRA 3ULVL 2VO5A 5E24E 2D0GA 2ZNWA 4NM8H 4ODTL 4MXVF 2ZJSH 3BN9C 5CP7A 2PETA 5J06A 3QDAA 1LILA 3T4YB 25C8H 2DKUA 4YPGA 1U8OB 2HTKC 3BQUB 2E9WA 5DJCB 4HWNA 4KMTL 1I8IA 3NCYP 3QT2A 2W0FA 3QPQC 1S7VB 4FQ2H 1I1AB 5F9AC 1U6AH 3RZCD 4EKXA 5F9JB 2MCPH 1DCLA 3SCMB 3D5OF 4GOSA 1BD2B 4NT6A 3CU7A 5I74C 2YKLL 3DOSA 2GJ6E 4E5XA 1RJZB 2E9JA 1LO4L 5LWYL 4PJGE 1I9JL 5SWQA 2DQGH 2Y06H 1MRDH 4J3UA 2DQIL 5FOBA 5A2FA 2K3TA 2D4FA 3TBSB 5D1QA 1Q0XL 12E8L 5DQ9B 1GGCH 5KSAC 3C5ZB 3BZEA 4DQOH 4FQCH 3CIQA 3I75A 2W0PA 1JF5A 5D7IB 5JOEA 4CJ1A 3OG4B 3MV7B 3AREA 2OP4H 3DO7A 5E8DL 1T4KB 4XNQB 3JBG7 4UV4H 1CT8A 1MFAL 1X5XA 2DTMH 5TF1L 1SY6L 4K3JL 2R0WL 2PN5A 2Z31C 2BOBB 3C08H 4NP4H 5TDOB 2HT4D 5ISZB 5JOPE 3IKCB 4OV5A 3PHSA 5K9QI 1EVTC 5DI8B 1NJ9B 4K7FA 5DD5H 4KZDH 3HG1E 3PWNB 4WRLA 5DDHA 1LMKA 3JTTA 5FO7B 1NBQA 1F4XH 4OLXH 1RIHH 5E5UB 1FLRH 2HVJB 2C3GA 4FRWA 1R3JB 1XCTB 2HJKB 4K07A 4LL9A 3T3PE 3A0OA 2CK0H 1Z5LB 5C0CE 4HUNB 1R0AL 5CGYD 2PO6D 2BK8A 2RCSL 4UQ3A 3AXLB 4Q9QH 1UM4L 3STBA 3B9KB 3KGRA 4TUKH 4F7CA 1FAKT 2VKWA 1A47A 1T1XA 1KCVL 3BESR 2GYSA 3IDMA 3UTTD 3PIQA 3IDIB 1RZIB 5KANI 3SDDB 4NNXA 3BWAB 3Q6FB 1DEDA 3MMEB 5D7JA 4KXZI 4O9HL 5A43C 5IF0A 3BP6A 5E2WL 1KNOB 1T2JA 5F72S 2AK1H 1YNKL 2V2TB 2B2XH 1ZHBB 4X6CA 3QQ3A 1XF4B 3ZHKA 4JPWL 5D7JD 4BQ9A 1G9NC 4XP1H 4QEGA 4K8RL 1EK3A 2FEEL 1WFTA 1MCSA 3P40A 4QRRE 3P2TA 1PVHA 3U83A 3VFVB 3ZHDA 3ORJA 4LQFL 1J8HD 1MCWM 3TGXA 3ZO0A 4B7LA 1PKQE 5KVDL 5I71C 1I1FA 1WAAA 2VC2L 1R24B 3KWWA 4MAUL 4ZOBA 1PG7H 2NY0B 4AT6A 2W65A 4M4PA 3RGVB 3Q3GA 1FIEA 3E1F1 4UDTB 3TZVD 3KYKH 5KW9L 1KJ3L 3SQOL 3MJ9L 2R4RL 1G7HA 2NTFB 2PYEE 4G7YL 1EUTA 5B8CC 3RKDC 2WNGA 4KMQA 4XRCB 4DUWA 4N0UB 2JLLA 1BQHG 1KEML 1QZ1A 1UVQB 1CBVH 5EU5B 2BC4B 4KU1A 2P42B 1IGYB 4J7RA 1UKSA 4LKXB 4YBLC 5EU6A 3UYRH 1S9VA 1L6ZA 2V2WB 4G6FB 2NY3C 3U7WH 1EO5A 2X4PA 1YEDA 1EFQA 4P23B 2EE2A 5H35A 3CC5A 1B0WA 2RB8A 4ZPTA 2FCBA 4WW2B 1CK0L 4JQVC 4X6BA 1RIUL 3WHXA 1ORQA 3SGDI 1X5FA 3KYNB 2X4QB 4G9DA 4KVCH 4XCCH 5EO9A 3LN5B 5A1AA 1CQKA 4TVPL 3HR5B 2DDQH 1A3RL 2GK2A 2J5LB 5CP3A 3MRPB 4OFIA 4UILH 1Z9LA 5DC9B 4X9FA 5FHBL 4F7EA 3P11H 3P0YL 1V7ML 5DUBA 4XP5L 2ZKHL 3O3BA 5K59E 3F7QA 4BQBA 5JHDA 2CGRH 1OP3H 1PDKA 5C0AE 4HUMB 4QHLA 3MUZ1 4DKEH 4BQ8A 4MDJB 4GMSL 5BV7L 5I1AB 1EO8L 4ISVB 1HXMA 5BO1H 5J3HD 1CLYL 4TQEL 5HGDB 5F7YC 3L7FA 1C16A 3BX7C 5HI3D 3VXSE 4K94L 2ZUWA 1U93A 2NX5E 1H3PH 4QHMA 4RIRA 2MFNA 1IQDB 1RZKL 2DQDH 1OTSD 2AVGA 4JFDD 1TETH 5I16A 3KLHC 2Q76B 2C4FT 4X9BA 3ZZ1A 4DGYL 4CL7A 1JYVA 5E2JA 2DM3A 4G8EA 3F7RA 3MLWH 4HH8A 1HH9B 4HMDA 4U05A 1H3WM 2NY5L 2CLRB 1J0JA 3ECBB 4NQEA 2ZJSL 5T1LB 5B39G 4LLVB 5FYLL 2HKHH 1WWCA 5F9OH 1YN7B 3H6JA 1QFHA 3O9WD 1KYOK 4N0FB 1XF5A 4O4YH 2CIKB 3JV5A 1NFDA 3MRQA 1CR9L 3MGOB 4OD2B 4MHHG 1NC4B 2Q7YB 5MEPB 4OLVL 1WWBX 3GSOA 2R2BA 2QQKH 3MA9L 4YXHH 1KJVB 2RHEA 5GS2H 1KN4H 5T3ZD 3IFNL 4LLMA 5FK9A 1I7UA 2B7DT 4KHXH 2XA3A 4HKJA 4JQXC 3R06A 1U3HA 3QG6A 5K9KB 5J7CC 1DQQB 1P53A 5E4EB 1JGVH 4BELD 3QUKA 4JY5H 3GKWH 3MV9B 3JWOH 2ZCHH 2OR9L 3EO9H 1NBZA 3DVGA 4Z7QF 1MEXH 1IGJB 5DFWH 3I3EA 4JG1L 2VABA 3DJ9A 1GOGA 4FQCL 3VGAB 2YPLE 2OJZH 4WCYL 1TXKA 4M1CC 5JORB 3T77A 4YDKL 4U1JB 3DPBA 3KPQB 3V52L 4JFHE 3OKLB 2F5AL 4KKBD 4JKWA 4XNMB 1BM3H 1M6OA 3RY6C 2CDFB 4XP9H 5ITFB 1RPQA 3I2CL 4LVNC 2R1WA 2R29L 5I73B 1D5XA 2BVTA 2NMSA 1KIPA 3RY4A 2L0DA 3QDJE 4NQSB 2VDPL 1HXYB 4LGSB 4U1MB 1BREA 3BXNA 1SBSL 2N7AA 5DD0H 3H2WA 4RGMC 3CLFL 4ONGL 4I0PB 4P5KB 5GZNC 5C0NC 3CDFA 4U6HA 3C5JA 1A6AA 3SE9L 3WNLA 3W0WB 4RFOH 2IPKA 3HLAA 5TH2A 5GZOC 4OLXL 3MRKB 4YK4C 3DGGA 4YXLH 5IV2B 2EECA 1FLRL 4IRSA 5C0EB 4Q6IC 4JFYB 3GBLA 2EH7L 1FH5L 4X0KB 1I7TA 4GSDH 2XWBB 3CDGB 4R4BB 4JFOA 3GSNB 1CF8L 1DQTA 2MMXA 2AEPL 3D0VB 3R1GL 4NQTA 4QXTB 4RGNB 3SHSA 4PY8J 4P5TD 3FZUC 3H7BA 4E9LA 1LEGA 3HI5L 5FUOL 1E6OH 1SM3H 5TDPB 3IAPA 4R2GB 4R6UA 4LOUD 5D2NC 2PTVA 2OM5A 5JW5B 1RZJH 4PJXE 3GHEL 1O5DT 4PG2A 1FAIH 5HHMB 5GGTL 4KROD 4WV1A 1KUMA 1BWMA 1AHWA 3IYLW 4TTDD 4FQ1L 1V8HA 2EIBA 4LCCA 1AD0A 2AK1L 4UIMB 3EBAA 4HKBB 3MACL 1AGCA 1MHEB 4OCMC 5B3NA 3EYVA 1U8JB 5HJ3B 3KS0H 2A6JB 3E0GA 43CAA 2BP3A 5IVXA 1ZVSB 3W11C 2IPUK 1JHTA 4OD1H 3L3JB 3VG0H 5AAWA 4FQXA 3L3DA 1CWVA 1OY3B 1WCBA 5EZLB 3ALXA 5CP3H 2FECI 2CD0A 3S6CA 4PJGA 4FQXD 3VD9A 1F6AB 1L7TL 4GG6F 2GJ6D 3S4SG 3I3BA 4NN5B 3EYOA 3DX6A 4IOIB 3WFDL 1BGXH 5M95B 5CGMA 4GRLC 3P3YA 1SMAA 1S5HA 4Z0BL 4M5ZL 3MYZA 3NZ8A 4G6JH 4FFYL 1GC1H 4PV9A 3NA9H 3QHZH 2OL3B 1V3KA 5IROA 3TV3L 4YDIL 3MQIA 1HIMH 1C5DA 3MX0A 5DHVA 5EFIB 1ES0A 4PJHE 1AKJA 2VMFA 4LIQH 2AS5M 3X3FL 2GTWA 1UB6A 2M8XA 4JDVB 4BSVB 3VXME 1AKJD 2EXWC 4OB5H 4PJFA 3KYOB 2VDKH 3FFCE 2Z91A 4MB5A 3G5XB 2WBJA 2EE3A 1XT5A 3CXHJ 2F53A 3I6GA 2APVA 1H3XA 3HB3C 3HG1A 3RVUD 4OLYL 1N59B 2WBJD 3D85A 4LRIC 5AYQA 4JREC 2PCPA 1EGJL 4F58L 4F9PA 1D5ZA 3HG1D 1MCHA 3OXSB 5T3ZH 1NGZB 4KK6D 1ZV5A 3D85D 3PWVA 1YUHA 4P4RB 1IT9H 4MS8D 4ZOAA 2FJGA 1D5IH 5C0CA 3MFFA 4YX2H 2HJLA 4YFLF 1YEKH 3VWKB 1M7XA 1QA9A 3QCUL 3IKKA 3VRIB 1QFWM 1ACYL 4PV8B 2IADA 5C0CD 4YEEA 5GIRA 4UB0H 2HFFA 2F58L 4JN2A 4GRWB 4TSCH 2APFA 3BAEH 3MR9A 1C12B 5HBBA 4UQ2A 3EFFB 3WCYA 4G80B 4U1HA 3NACH 1VFBA 3Q5TA 3EZJB 3UPAA 4B50A 3WD5L 4EI5C 4WW1B 4YHKH 4OZGA 4Y5YA 1MVFA 1EMTL 2MSPA 4HUWB 3PWJA 4GAYB 1XF2B 1NDGB 4I3RH 1YQVH 1BOGA 4OQTA 1IM9A 5DRWA 4Z76A 1CFBA 3MRNB 4PBXA 4QRTA 4EXKA 4J3OC 3DUSA 3EO1A 1JN6A 5D1XA 1IM9D 1I8MA 1I9RL 3GDBA 4JR9H 1RSFA 4JPKL 1CTNA 2NY4C 3SDAB 4QRRA 4BZ1H 2A6KB 4EVNB 2VH5H 1VERA 5KAQG 4LGPB 4NHUB 3QRFM 1PKQA 1J87A 4QRRD 3CFDA 5D2LA 5IESL 3K7UA 4IDJH 3FL7A 4GUPA 4X5WA 3P9LA 4OGXH 4TRPL 5E8OA 1EJOH 4JFPB 3ZT5A 5DD1H 1N6UA 1CTOA 1YECL 3QI9D 3MXWH 4UIKL 3MRBA 1T2XA 2QADD 4DEPC 4AQ1B 2A9NH 2AXFB 4UI2A 3LKRB 1FRGH 3MYJB 3EO0A 3ARBA 5D71H 3PWUA 4ZAKD 1QVOB 2PYED 3MGAA 5BS0E 4GW5A 1HSBA 4JDZA 1FZJB 2ZCHL 5LAXB 1J9CT 1NMAL 5GQBA 3NFNB 5BOZG 3L7EA 4G9FE 3AVEA 4Q2ZB 5EA0H 4C83B 4MA8H 5DJ6B 5KG9B 1PGRB 1LEKA 5GJSL 3LCYA 1EXUB 2ZUXA 4PRAB 3Q48A 1EFXA 4ODHH 4LPWA 1WSST 3FKUS 4D9LL 3LKNB 4BKLA 3MZTA 4ZS6C 1K6QH 4QY8A 3QO1B 1EFXD 3C09B 5J6GA 5EZIH 2R0KH 5I1LA 5IJVA 5DURD 1MF2H 2GCYA 4LSSL 4P2QE 4PJCE 3P73B 4YFLI 5I8OH 3U0TB 1MJ8L 1G7PA 2R1YA 4ZO6A 4ORGA 5DUPH 2WP3T 2CRIA 2P24B 2WMPA 4P0DA 3TBWB 1A1MB 3GMOA 5I15H 1ZGLA 2Q87A 3VH8A 4JE4B 3KS0J 3CVHL 5C0AD 3SGJC 1NEZA 3BPCA 1VB9A 1G7LB 1WZ1L 5ANME 3T8XA 5GRJH 4A6YL 1MCNA 4ZS7H 5T1DL 4L9LA 2NX5A 1IZJA 4HJGA 3VXSD 4L29A 3D39B 2NR6C 5IB2B 5F71A 4D3CL 2NX5D 1XGQB 5DHVH 3NIGF 1I3RA 4LASH 4JKPL 4R7DA 4KTEH 5ADPH 1UZ6F 1Q9WA 3FOLB 4YBQD 4L8CB 3T1FB 5E8NB 1VPOL 5KS9F 1KB5B 3VFSB 1TVBA 5BZWA 3DVFA 5TFSH 1MHHA 1NSNH 2H9GB 3MLRL 2P7TB 3O6KL 3NVQA 1IEBB 5D70L 4TULL 2YN3A 4MA7H 4FFWD 3FT2B 1S7WB 2YC1A 1YEHL 3LKQB 4MNQE 4MNGA 1H8SA 4U6TA 5TGBB 3V5KB 1FNHA 5IEHB 1NMCC 4NKMB 2Q3AA 3PE9A 4Y8AA 1JZ7A 4K8RD 4JVWA 2D0HA 1C08A 4Y0GA 5BVJA 4PRIB 5JMOC 3D9AL 4A2MA 4U7MA 3U4BH 1XGYL 3RNQB 3ARGD 1X9QA 3IU3A 4HFUL 2J8OA 4FXGB 1U3YA 1JWUB 4OF5A 2EDWA 2DLGA 3CPLA 4C56E 4MAYC 4MXWL 2CQVA 1IAOB 3M8OH 1F11A 2CJUL 1K8IA 2VXQL 9CGTA 5HYEA 1BGXL 3NTCL 4KKCD 4X8JA 1T3FB 2I07A 1X5GA 1LE9B 2YPLA 4DZ8A 1CLOL 1S9WA 2DIAA 1MAML 5DMIL 2J4WH 1GC1L 3MLZL 4N0YL 3QHZL 3QIWA 2YPLD 1B0GB 1D5MB 4JFZL 5JDSA 4OQTH 4YHMH 4PD4J 4LSQH 3BDYH 4JFHD 1DUYB 4CU6A 2LTQB 5AD0B 4K55A 1BFVL 1K3ZA 4LCYA 3QDJA 1JPST 3QO0B 3G6AB 5DRNA 4I9WE 3IFLL 5IM7A 3DSFL 2JJTC 4UV7H 1GHFH 3QDJD 4ZUTB 3NAAH 4JM2A 4D0DA 1PLGL 1RU9H 3O6FD 3L3GA 1OM3L 5ICZB 3MRJB 3FQNB 4HK0A 1GPOL 4JM2D 3DBXA 5BVPL 5H94B 3EHBC 1KB9J 3U48A 3ZYIA 5ICYB 3KVQA 3QQNA 3VWJC 5F7DA 4ZFFA 4FS0A 4FQIL 1FYTD 4YUEL 1W72A 3DIFB 1D5IL 4KJQD 1FJ1A 3V8CA 3U79A 2ESVA 2DQEL 1WCQA 4N1EA 4ZYKA 4M7KL 1BIHA 2WSKA 4UU9B 4G42A 1DR9A 1MFDH 1SJHB 4LPTA 4Z7OF 1VFAB 5EULV 4I5BA 3PGCA 2YSSB 3PHQB 3DV4A 5DT1H 3GGWB 3UDWA 1F3DH 3U7AA 1EA9C 5DD6A 3S4SA 2OJEA 5E9DD 5F97E 5C07E 4KI5F 4OBSA 5MEQA 2ICWA 4PJXA 4NNYB 1UKTA 1SBBA 5CCKH 2DMBA 2G5BA 5B21A 3D3VD 5DEFB 3U1SH 3W39B 2XKNA 1HINH 3K0WA 1GSMA 4HLZG 4W70A 5I8KH 1FHGA 1KJ2A 4WWKD 4ZSOB 4OJFL 3QEQB 4Q6YA 4JVUA 3UTOA 1G7JA 1EEUA 1RURH 4JO4H 3LRHA 4JZOB 4PJEA 2B4CH 1CVSC 4JR9L 4PRPD 2IANB 2QQNH 5IIEA 2FH6A 1NPUA 3CFEA 5FYLD 4P46B 4NRZA 3EFDL 1WZKA 3B2VH 3LEXA 1FLTX 5DR5H 4ACPA 3WLBA 1LHZA 3OKEA 4HW6A 5I71B 1H3VA 1GGYA 1YY9D 3JV6B 3ZE2F 1N5YL 2F8VA 4OFPA 4Q0XH 3UBXI 2UYLB 3ULVF 5K9QG 5HDQL 1I3GH 2CH8A 2JCCE 1FRGL 2X10A 3EYUH 3KPNB 3NMEA 1MOEA 1LO5A 2GKIA 4NZTH 4JRWA 4D8PA 3RKPA 2XRAH 4Y5VC 4PTTA 5B8CB 2YRLA 3BD5A 7FABH 4I4WB 2BNQB 3DMMB 4LVOB 2FYYA 5IB4A 3EIFA 4OGAC 2Y07H 3VXMA 5E8EA 4LHUB 5JNYB 3GBML 4JKMA 4JPVH 1BFOA 1NCDH 5HI5D 5E6YA 3GIZL 5AEAA 4YBLB 3QWOA 5LGKA 3G04B 4I3GA 4ODHL 5I1HH 3VXMD 3RVXC 3KHQA 3FFCD 3CK0L 2NY3B 3BGAA 3MGTA 1OAUH 1NANH 4HHAA 2B1AH 5FKPA 1LP9F 3L5WA 3SKMB 3PQYA 2R0KL 1JWSB 5EOCH 3SKNB 3GK8H 3VE0A 4XPTH 5DSCB 1UGNA 3FQTA 5J4MA 4XNYL 3T2PA 2DQUL 3HRPA 5K9JL 4WUKH 1MWAL 3QEUA 1U8MA 1LEIB 4Y2DB 2G9HA 2VIRB 2P8LB 4HUKB 1A7QL 1IGFH 3ZYZA 4XVJH 1RFDH 4JFFD 1A3LH 1T04A 3HRZA 1KXVC 1DBKH 3BKJH 1NGYB 1TZIA 5FYJU 2UUDH 4U6YB 1IKFL 4ODVH 5GRJL 4JQIH 5IEKA 5GS1C 5C70A 2XZQL 2PW2B 1AR2A 1UB5B 3RZCC 5MHSE 1ZT1B 4O2EB 4EEEA 2VL5A 4KK5D 1KXTB 3LQZB 5JPMB 3I9GL 4AENB 1I8LA 3GMRB 4PGDA 2W9EH 2ZG2A 3TJEH 5C1MB 4MQSB 3TT1H 4IMKC 2DWEB 5EU3B 1NSNL 1XR9A 3G6JF 1MREH 2J2ZA 1I85A 2Q8AL 1WT5A 2AJ3A 3QUXD 4I1NB 4B7IA 1MLCA 3RP1A 5TE7H 1ED3B 4OV6F 2AXGA 3OZ9H 3N06B 3S37L 2YXFA 3TIDB 5GSRB 4XNUH 4C54A 1SEQL 4X8XA 1CL7I 5HYSB 1NCBH 1OSPH 3TPUA 3DX9B 5HYJE 1TVHB 2ATPB 4TUJB 4MJ5A 2Y23A 3BJ91 4H25A 4YXKH 5TDNB 4FQHA 4BK5A 4WU5A 2HT4C 5BS0A 3S5LG 3PL6B 4WFEE 2ADFH 5LVEA 2YK1L 1MIEH 2ZSWA 2FIKB 1QNZH 4JFEB 3M8OL 3O8XA 4JO1H 1ZLWK 1Q94A 3UBXB 3FHQA 3BVNB 4YC2C 3WLWD 4G9FA 5BS0D 3GSWB 1KPVA 5DZLA 2UV3A 5FYKU 4F7MA 3HC3L 3L95B 2HT2D 2MJWA 4DGVH 2LVCA 4Y1AB 4G9FD 2BOCA 4DGIL 5INCB 4GKZA 1LD9B 3V6ZA 4APQA 5DD3H 4OIAA 3RL1B 3V4PL 2GQHA 5CJOH 4PB0H 1S7XB 3QEHB 2B1HL 1TENA 1KJ2H 5T5NF 1F3DJ 4JHWL 4LVNB 4U1IB 2CPCA 5CGYC 5L6YH 3IJHB 4N9GA 3MLPA 5HHNB 4OF0A 3EAKA 2VQ1A 4P2QA 4PJCA 5BOPA 4BSWB 4P3CH 5CUSL 2Z4QA 2R2EA 1TQCC 3EDJA 3UTSB 1RU9L 2W9LA 2WINA 3JWOC 3RIAF 4RGMB 1KCRH 1UT9A 4P2QD 1KN2H 3HE7A 5E5MB 3GMMB 3OTTA 1UJ3B 5GGQH 1JPTH 4L4TA 4P49A 2VDNL 4NNPL 3QCVH 3HE7D 1J7VR 1AGFA 2BSTB 1DQLH 3GM0A 4YK4B 2CMRH 1QO3B 1CLZH 4XCNB 1ZKAA 1IGTA 2Z8VC 1E4KC 3RVTD 1S8DB 1F02I 5KVFL 4NQXB 5D7JC 3M1BA 4WUUE 4NM4H 1U8IB 3MCKB 5E7FA 5CEZL 5KVGH 2N56A 4XZUB 1JIBA 3MOAH 2DM2A 4O5LL 1GGUA 1EEZA 2I27N 3B9EA 5JOFB 3HCVA 3K74B 4HX1B 3GSXB 1MJJA 1TJHH 2DQFB 2VXTH 3MOQA 4HZAA 1Q72L 3FQUA 4LSPH 5EO1A 5GGUA 3UJIH 5GS0L 5DVOA 1T20B 5L0QC 3MLVH 5D2NB 4ZO9A 2D03H 3FJTA 1QBBA 3CSYA 4G8IB 3QFDA 3EYSH 4WDIB 2DRUA 5E99H 3TZVC 2BDNH 3WXVH 4GXVH 1HWGB 5HGHB 1F58H 1AE6H 4M8VA 4NDMA 3DECA 3VXTA 5E4IA 4KK9D 2W9DH 2OLDA 4ELMF 5HVHC 2GY5A 1FP5A 1X6LA 4MNQD 4JFXA 4JRXE 1FO0B 4KTDH 5FGBA 5E08L 4KRMB 3MXVL 3VFRB 1JNJA 4P57B 4F7TA 3AS3A 1P6FA 4IMLB 4MQ7A 3WNPA 4D0BB 3ET9F 4MCYA 5EOCJ 5EU4A 4KJPD 2IQAB 3E3QC 1A9EA 1OAQL 1ZXQA 1CE6B 2KZWA 4QOKB 1AH1A 4FXKA 1G0DA 4C56D 3WIFB 1YMMA 3PHOB 1QLRB 3VXPB 1RUQH 4GRLB 3UYOD 1ZA6B 4OSUH 4U0RB 4GJTB 2DF3A 3RUGB 2XKSA 4NQDB 1TJGL 3FO2A 1JYXA 1G7QA 5TE6H 2YZ1A 3DYMA 2FJHB 7FABL 3H9ZA 2AAVA 1KT2B 5GJTL 2FX9H 5ILTL 3P4OB 3DETD 4NO0A 1YYML 5C0BB 3QQ4B 3GSVB 5MERB 3CFIC 4RMSA 3P4NA 2VE6B 2HJFA 4KQ3L 1D5BA 1N5AB 4LRNL 3OAUH 4KV5F 2EC9U 2EZ0D 4NO0D 4NO3B 4OAWB 4OLZH 3BT2H 4I9WD 4U1NA 4LDEB 3TO4D 1YEFH 1LK2B 2C5DC 5HI3C 3QUYA 1KCLA 1U8KB 1DSFH 1T0NB 5H8DA 4JREB 1L9MA 1HHHA 4YAQA 4PJAE 1OTSC 1A6WL 3QNZB 4XPTL 3EDEA 4PRBA 3O0RH 2BMKA 4JZNA 3MSPA 1MFEL 4YGVB 4J6RL 5SWSE 1TTUA 3EYFA 1VESA 5MI0C 5FYKH 2QSQA 2IFFL 5I2IA 2P49B 1PYWB 3GFUA 4PJ5E 5E6ZA 3MCLH 4XVJL 4I2XB 3OV6A 2AJYL 3O9WC 2RIKA 3S8WA 1P7QB 3L3HB 1K4DB 4QRSB 3VW3H 5C07A 4X9IA 4OZHE 4V1DB 4V2CB 4EI5B 4NQCB 5I19L 1YEEH 4MMZC 4U0QB 3N85L 2P5EB 5C07D 1TQBC 4FTVB 1MHCA 5DRZA 1JHLH 4IOFC 3BN3B 2AABH 3J8F7 3LQAC 5HHPB 3NPSC 1NAML 3CAFA 5TQ2H 3WL9A 1G9MC 4AH2B 4WJ5A 2OMBA 4H8WH 1M7IB 1T5WA 1U3HC 3O3EA 3GBNH 4MA1C 2CRZA 4Z0XA 2NY4B 5IMMA 2EIZA 3QH3B 1WVZA 4Y5XA 4CNIA 4R8WH 1ZA3B 5SX4H 3DX7A 1E4XL 5ETUA 3IFPB 5FKAB 5BRZE 2BNUB 2XACC 2BRRL 2JK5A 4NBYB 1KYOJ 5J1AA 4Q9RL 3ZKXC 3ETBF 1WIPA 2FJFB 3SDCA 3MLYH 4KKBC 2D31B 4FZ8H 1OCWL 4XPBH 3OKYA 5J12C 4UT9H 1NCBL 4IOSD 1OSPL 4XMPH 3W9EB 2DKMA 3SDCD 4HBCH 2VNCA 1I9IH 1IGIH 3BJLA 5EDXA 4DEPB 5JUEL 3STZA 1QOKA 4MD4B 1QRND 3I02A 4JM4H 4X5XA 2VWEC 2MHAA 3CFBA 1BEYH 4U3XA 3LKPB 3AU1A 3V0WL 3LMJL 5AZEL 2JJSA 3DUHA 3V0AC 1V7NL 3QQ9D 4ODSH 5JLZA 3LEYL 3QNYA 3PNWB 1A6UH 5L2JA 2F5BH 4LNRA 1OD9A 3KJ6L 4PYHA 2FD6H 4LLWA 4AZ8A 1CE1H 4F37K 1FNEA 2QKIA 3CDCA 4MVBD 3GO1L 1OAXL 1QSFA 1IC5H 3ILQD 4PB0L 3T0BA 2H3NB 2PNDA 4EDWH 3VFGL 4OUOA 3KPTA 4MXQD 2P8PB 2AJXH 4X6FB 2EYSB 4YHNA 4HPYH 1JZ6A 1N26A 4P5TC 4PJ8D 3BZ4A 4PP1D 1W0VB 2F54B 3OJMB 3H0TA 4PUBH 4G7VH 5E6IB 2X4NA 2HKFH 3X17A 5I17A 4HCRA 1BQLL 4YZFF 1JGLL 5TQ0H 2APTA 4L3EA 1JTOA 1B4JH 1JPTL 4UZGA 4R3SA 1FFOB 3BKCL 1A2YA 4LOUC 5KZCB 4U7KA 2WLZA 5H2BB 3JVGA 3JTSA 3VFMB 1QR1A 4DUVA 2HMID 4KROC 1FPTL 4KH2A 2CMRL 4JKKA 3OMZA 4PJDE 1CLZL 1ZWIA 3GMNA 4HPOH 2EEDA 2BHYA 1TITA 4LLYA 4PG2C 4XBEH 4OZIB 1F13A 1ZHLB 2ZOLA 4F57H 4ZQKA 3OKDB 5C8JB 4WHCA 1AD9A 2FLBT 5MHSD 3IXTA 1MCPH 3S5LA 3D2UA 2X6MA 2J3SA 1NAKH 2WK2A 5I9QB 2V6HA 2BSED 4ZXBA 1BBJA 5DA0B 3RTQA 4LSUL 3VRLE 3VFTB 2VXTL 1TJHL 4FQXC 4P2OA 1OARL 5IB5A 2DAVA 2OZ4H 2QQLL 3D0LA 3D2UD 5E2UL 5IJKA 4ZXBD 1U8QB 3HC0A 4PRDB 1B2WH 3BH8A 2NLJB 3SE3A 1M4KA 4CMMA 4LLQA 4NUGL 5TPWH 3WEXB 1IAKA 3EOBA 3BP7B 3GMQB 5HTSA 1GOHA 4OZFB 4ELMB 1CGSH 2JTDA 5D9SB 1HYSD 4G6AD 1SJEA 3WIIH 4XX1G 1MH5B 4Z7VE 1KIQB 5C08E 1NMCB 3SJVE 1IGMH 1JUFB 4X6DE 1U8NB 4N8PA 4YHOL 5KTEL 5IROC 1J05A 2VSDA 5FYJL 1FVCA 3D25A 3TT3L 3ULUE 5HYJD 4UINH 5IOPB 3A6BH 4OTXH 4OIBA 5JMRA 1WEJH 1FIGL 4CVWA 4KAQH 1ZS8B 2HTLD 4P2YA 2AXJA 4EN3D 1P9MA 1BLNB 4WFED 3ZE0F 5EOTA 4JLRB 1RI8A 4PGEB 3RVUC 5J9PA 2WBJC 5GGRA 3VFUB 1RUQL 1A1NB 3KPPB 4WTWA 2IH1A 2J12B 2O61A 3UROR 3M17A 4IRZL 4KK6C 3BGMA 3IJSA 2DLFL 4MS8C 3HMXL 3FB8A 3F58H 3MNWB 1MY7A 4F9PC 3BO8A 3MBEB 4PY8I 3NH7L 3TNNB 4RRPA 1IQWH 1GVIA 3E6FA 5DJ2A 1EBAA 4EQ2A 1I7ZB 4AK1A 2VDQL 4PY7B 1XR8A 3L5XH 3AS0A 3W81A 1U91B 5ESVA 3QP3A 2IH3A 3GNML 4YHYB 5GXBB 5I1EL 4M1GH 4K3HA 4BH8A 2FRGP 1UXSA 3NZHL 3ZDZE 2DD8H 4LEOA 2YMXL 3IDYC 4Y5YC 4PJ7F 5T1KA 2CKBA 3O0RL 5GGVL 5IBTL 1XGUA 1GIGH 1UENA 3KR3L 4BSJA 2VLJB 4JB9H 2MPAH 4L8BB 3H9SB 5T1KD 3TCXA 3BKYL 4EIZC 4J8RB 2MKLC 5FYKL 2Q6WA 5D8JL 4WFFE 1W2KT 3V6FB 4LBEB 4YBHA 4U1LB 1J1PL 3LS5H 5HGBA 3IT8D 5CBEB 3QHFL 4KHTL 1I7RA 4WUUD 5D4QA 1MFCH 1AO7B 2AV7A 1P5UA 3MJ8A 3BP4A 2AJVH 5I6XC 1PG7X 1OF2A 5E1HB 5L2KA 3QI9C 1HEZB 3FFDA 2AGJL 4CVZB 3RI5F 1HKLL 3HUJF 3NABL 1K5NA 4FZEL 1G7IA 5I8EB 1FGVH 4LCWD 5IHUL 4ZAKC 1MIMH 3HE6A 8FABA 3K4ZA 1CFSA 3QJFA 2G60H 1V3JA 4LHUG 4NFBA 1HQ4A 1S9XB 2NXZB 3ARBC 3BH9A 3OKNA 4XAWH 3CGTA 5KJRL 5ALBL 4JRXD 3NFSH 3BI9X 4HCRH 4NJ9H 4R8WL 1ADQA 3DNKA 1TCRB 3KAAA 1J12A 1SMOA 4K23L 3DVNA 2GSIA 3LB6D 4NZRL 2G5RA 2Q3ZA 1NGXB 4JDTL 5F9WB 5BMFL 4GLRH 3OX8A 5EPMB 3VFPB 3TBVA 3VI4E 1R3IH 4GQ9H 5A2KH 4HIHA 3D69A 3MRCB 3X11A 4G8GB 3L5JA 4XVTL 1QEWA 1BEYL 4YDLC 1OAYL 1T0MB 3EDDA 5EUOE 4EI6A 3VGBA 3W2DH 3G6DH 2B4CC 3RWFB 3WS6C 3DTXA 4Y5VB 1H3UA 4L8DB 5HHQB 4WEBH 4Z5RA 5IGXH 3QDME 3O2VL 4PGCB 1A6UL 5F7HA 3HZKB 4E41E 5L7XL 2YEZA 3RZWA 2R0LH 4FNLL 1JRHL 3O6ML 2AK4B 4RFNB 2YBRB 3ES6B 4OGYH 4UAOC 3BHBA 1RJYA 1DVFA 3HPJA 4JG0H 5B3JF 4HGWB 1FFPB 2SEBB 4M93B 3FCTA 4MA3B 2VXVH 3OKKA 4HPYL 1AGDA 4PJAA 5FA3B 4PR5B 5DWUL 1DVFD 5F9DC 4FABH 1JNNL 4WFHE 2RGSA 2LV4A 4S1SL 3X13A 3BZDA 1MFBH 1Z9OA 3U7YH 3WUWA 1OTUD 4M6NL 3T3MF 2R0ZL 3H42L 1JPFA 5SWSA 3G5VB 2Z92B 2VDML 2BCKB 3KNBB 5C9JB 1D7FA 1Q1JH 4YBQC 1B4JL 1R3LB 4OF7A 4GMTL 2HAZA 4PJIB 4S1QH 5SWSD 4PJ5A 1ORSA 3RU8H 5HHXH 4WO4D 4KTYA 4XPHH 3FAWA 4FQLL 3TO2B 4PBVC 4PJ5D 5F7MC 2IFGA 3GSRB 4FFWC 4GKSA 4OZHA 3ROLA 3TJHD 5HYSG 3NFPB 5LCVL 3MLSH 1X5KA 3OKMA 5CP7B 2VTFA 2AV1A 4P2RE 2V5TA 4YPGB 2J8UE 5GGSA 5DK3A 2E7MA 3A6OA 4M43L 3B8YA 4K8RC 4DK3A 1AP2A 3B83A 4OCXH 2YA0A 3VRJA 1I8IB 3VU2A 4Z8FL 4F15B 2W0FB 4IRJA 1MCPL 2F74A 2BVPA 2XZCH 1NFDF 3W5MA 2X4UA 1ZT4A 1NAKL 4WHTA 1J5OL 3UBXG 3NIFE 4D2NA 4YHPA 3VFWA 8CGTA 1KFAL 5ALCH 2VLRA 5DLMH 2OZ4L 4FQJL 4G3YH 1FL3A 3WFZA 2ZUSA 3DSNA 4NT6B 3V7MA 5GS0D 4NBZB 4BFIA 1JYNA 4KKCC 1JNLH 3QJHA 4XC3L 4E5XB 1D6VH 2E6PA 4HDIA 5BRZA 4YHIA 5SWQB 2AQ2A 2EKJA 3CUPA 2X4SA 1A64A 5FOBB 1NCAH 1U8LA 1CGSL 3OWEA 5D1QB 3HNVH 5BRZD 4WNQA 4HK3N 3BZEB 2CKBH 4RISH 5JW4Q 3VXRE 2X4RA 3I75B 1PQZA 3QIWC 1E4JA 3AREB 3DO7B 1LO3L 3MROA 4M5YH 1M1SA 1DLFH 3BFOA 4OTXL 3MV8A 1CT8B 3WSQL 3TFKD 5C92A 2HFGL 2H41A 1DFBH 5HGGS 5CINH 3WXWL 1CI5A 1RVFH 35C8H 4M48H 2MOVA 4AY0A 5I1KL 3DXAE 1IAIH 5JIPA 4OV5B 4JM2C 4YR6A 2AQ1A 1VEOA 1AI1H 2I5YL 1F2XK 1NQBA 5BQ7A 4K7FB 1EH9A 2X4OA 1UZ8A 2X1QA 4KJQC 3VMOA 32C2A 3WJJA 4HGKC 1FC2D 3A6CL 3KPLA 4U1KA 5DDHB 4CN1A 2AJUL 2BERA 3Q6GL 3RBSA 3GSUA 1A6ZA 3B9AA 5DQDH 4ETQA 3GJFA 3X12A 2RAMA 1H9VA 1WITA 1TZGH 1UWGL 1DBAH 4LHJB 4TNWF 4JRYA 4PP2A 5HPMA 1Z3GL 1UWXK 4UQ3B 5F1NA 4J4PD 5E70A 1WICA 5B38A 5KSAA 4S2SA 3VGDA 1ADQH 2E3VA 5DJ8A 5JXAH 3UDWC 4AL8L 5HPOA 1GZQA 2A2QT 4F7CB 4NUJA 3ZSTA 2DLTA 1QLEL 1RZKC 3OHXA 4OCYH 2ENYA 1T1XB 3IDMB 1RJLA 3PIQB 4MLIA 1ZLWH 2ZUTA 3GI8H 1QBML 4OD3H 4Z7NE 2C1OA 2Z31A 4X7CC 4NNXB 1MFNA 4GBXB 2A74A 2NY5C 1U92A 5D7JB 1KTDA 5IF0B 3BP6B 1LO2L 1IGCL 2YUXA 3P0VL 2DQTH 5C0FA 1KACB 4X6CB 1AGBA 3QQ3B 5ELIA 1DBBH 2O5ZH 3RX8A 3NCJH 2OQJA 1KENH 2D0FA 5IVXF 1IBGL 1OL0A 1G0YR 4ALAH 2WANA 5EORL 1YY9C 3O2DA 1TZHA 4OCSL 1I1FB 3F7VA 4A2LA 2VKXA 3KWWB 2HN7A 4AT6B 2W65B 3FB5A 4U6XA 2JB5L 3Q3GB 1R5IA 2YD1A 2FGWL 4Q58C 1EHLL 4XPGH 1MPAL 5C08A 3SJVA 4X6DA 1DQML 1KCSL 2EICA 1G7HB 2V5MA 1PEWA 4LCIH 3LHPL 3SJVD 5D5MF 1J10A 3BE1H 2R56H 3GUTA 1FNSH 2V5YA 3BGFC 5HI5C 1S5IH 4C4KO 5KVEL 3S3PA 4NWUL 1P1ZA 3ULUD 4NO2A 4N0UE 4KZEL 4N8CL 2XIDA 1JGUH 5EU6B 1MNUL 1HCVA 4CJ0A 1E6JL 1S9VB 2RJMA 3MUHL 4GQ9L 4H88H 3O2WH 4PJFF 1X44A 2X4PB 1YEDB 1YPZE 4O2FA 5FGRA 1G9EA 3C9NA 4QXUH 5H35B 3CC5B 1IILE 3CVIH 3WDHA 1JTPA 1KGCE 4LSVH 3T0XA 3TNMA 4ZPTB 1BMGA 1LO0L 3C6LD 1GH7A 4X6BB 1FDLL 3WHXB 1ORQB 3H9HA 5EO9B 3GMLA 3V4VH 2EDOA 4K71B 3ARDB 2CKNA 2QHRL 4QWWD 3B6SB 4FFVD 4HIXL 4F7EB 2YD6A 5D7LD 5DUBB 2OYPA 4OI7A 2ARJQ 3O3BB 1BFSA 4Z95H 4M62L 5JHDB 4QHLB 3GSNL 4POUB 3FT4A 4CVUA 6FABL 1QYGH 3NPZB 4O58H 2VERN 2KDGA 1HXMB 4C59B 4J2XA 1NGPL 2VDRH 4OT1L 3L7FB 1C16B 3IAGC 4KK5C 4OZGF 4Y4KD 3KJ4C 5E2VL 3V6BR 1U93B 4S0SD 2A6DA 4RIRB 5LG1A 1Q1JL 1ZGLM 1YC8A 2O26U 5DZNA 3REWA 4S1QL 5I16B 5ESQA 4WI9A 1QSEE 4XTRD 5BZDA 1I8LC 3QRGH 3UC0H 1DQDL 4UTBL 4YHLH 4WFFD 4G8EB 3CNKA 5ACMA 1ZLSH 2CO6B 4M7LH 2FBJH 3QUXC 4W4OA 5DXWA 3R8QA 1JYWA 4M61A 4NQEB 3N50A 4F8QA 1I85C 4MXVE 5SWZD 1RMFH 3NCMA 4PYGA 4MSWA 4ZPVA 1LDPH 4H1LA 2FLRT 1XF5B 3EDFA 3WDJA 5ESAA 1TQBB 1PFCA 3NCBB 1NFDB 4L4VE 5D2LF 3U4EA 1DTUA 3MRQB 4JGJA 3NPSB 3GSOB 2R2BB 4RNRA 3DI2B 1CDGA 2ZG3A 4LLMB 1NGWA 4G3YL 1ULVA 5FK9B 1I7UB 3RDTD 3GJFH 2VLMD 3R06B 3WO3B 2YD7A 3MBXL 1JV5A 1U3HB 3QG6B 4U2YA 3WLWC 4MA1B 3OF6A 3DGCR 4I0KA 3MNVA 2NXYD 4MGXA 3MRFA 3QUKB 2HT2C 1BAFL 3OF6D 1SJXA 5D7KE 1NBZB 3DVGB 1CD9B 2CIIA 1CDCA 3Q0HA 2OL3L 2VABB 1VA9A 4YHZH 1KLFA 4HS8L 5IFAH 3TESA 1UJTA 4DCQA 5I1GH 4JKLA 3T77B 4E42A 4QGTA 2R69H 4JY6A 4M5YL 2ZP0T 4M7ZB 5F1SA 5EUOA 5KSUA 1M6OB 1AQDA 4IIQC 5GSVA 2R1WB 1D5XB 1S3KL 4DTGL 4Q97A 3DROA 5C3LD 1T03L 2QR0A 3KLAA 3QDMA 3T0EE 1KIPB 1L6XA 3X3GL 4NN6B 4HF5H 5D72H 4XMLL 5KSVA 1NCCH 1LVEA 4I18C 4UBDD 3BXNB 5LGJA 1CXLA 5LGHL 4ZUVA 3O4OC 3HE7C 4E41D 4U6HB 3C5JB 1A6AB 2VJXA 2IPKB 3O2DH 2Z35A 1ODAA 1J1XL 1OAKH 3LPFA 1JGEA 5TH2B 1UEMA 3W0WE 4TPRH 4K9EL 3RVTC 4JQXA 3DGGB 3PP4L 4IRSB 5ICXA 2V7NA 1WFUA 4XAKE 3W82A 1F4WL 5IBUB 1CN4A 5CJQL 1I7TB 3AROA 3VA2C 3N9GL 3K2MC 4X7SH 4KKAC 4WFHD 2IBBA 4XNXL 5L88L 1BVKA 3ULUH 4XCFL 5I1IL 2Z9TA 3H7BB 5ACZA 1ONQA 1MHPH 1LEGB 1P5VA 4OCYL 3G08A 4OZFG 3SY0A 3CSBA 1MAKA 4KROB 5AG9A 5HHOE 4P2RA 5ABDE 2J8UA 2AEIT 4D94A 4HS6A 4KK9C 3FO0H 3RWIA 4P9HL 1QBAA 4WV1B 2XQBH 1AHWB 2FL5A 4LCCB 3EOYG 1AD0B 4DFHA 1AGCB 4YGAB 3EYVB 1Y6MR 1FSKB 3BQUD 43CAB 5IVXB 5F9JA 2G75A 4QYOA 1CFTA 3RWJA 1JHTB 1I1AD 3L3DB 4FQXB 4KJPC 1WCBB 4URTB 4XPAH 4JZJA 4JGUA 4EBQL 3QR2A 4Q6IA 2C3XA 4MJIE 1RZFL 4DK6A 4PJGB 3SCMD 1F90L 3THMH 5SX5H 4QHKJ 4ZFGL 1JHKL 2IWGA 3EYOB 2BHUA 3HI6L 5JR1L 3DX6B 1TTGA 4DN4H 4PTUA 3QPXL 3QXDA 3BWUC 4K7PL 4XBGA 4XH2A 1S5HB 3VXRA 1XH3A 4ZFOA 5D5MB 2WV3A 4M6OL 3NZ8B 3UJJH 4OCRL 4D9QE 1Y18A 4PV9B 1P7KA 3KXFE 3MLXH 4G5ZH 1C5DB 1NMBL 4I3SH 5DHVB 4H5SA 5LXGH 1ES0B 3TWCH 1AKJB 2CLZA 2EZ0C 3CLEH 5DVLA 2P5WA 3INUL 3MV7D 1UH2A 1GGTA 3N1FC 2GTWB 1UB6B 4EIGB 3TO4C 4PJFB 3DXAA 4N9OB 1I1YA 1C5BH 2Z91B 4KUCF 2EKSA 2WBJB 3MA7A 3SE8L 1RUPH 4AEIH 4Z77A 2F53B 2KQMA 3QUYC 3I6GB 15C8H 4NSKA 3HG1B 4DZBA 4U1SA 4XWGL 5HVGB 4I48A 1BWWA 3D85B 4H1LH 4UTAL 4XC1H 2PCPB 1OP3K 4AYFA 1KBGL 1D5ZB 4TOYH 2V17L 3D1MC 4WI4A 1JJUA 5DEGA 5FO7A 3FQWA 1ETZA 3PWVB 2A9MH 4O00A 1YUHB 5C3TA 1WK0A 3RA7L 4KDVA 2FJGB 5C0CB 3MFFB 2HJLB 1QA9B 4MHHI 1MVUA 1VFMA 3A67L 1F00I 1TNMA 2IADB 1LGVA 5GIRB 3VDAA 2HFFB 4JN2B 1BF2A 3MR9B 2VN4A 1WC7B 3AXLA 3Q2CA 4M1DH 4UQ2B 5FDWA 3BDBA 4U1HB 2ENSA 4HKXA 1VFBB 1UWEH 4MJ6A 3SEPA 5KSBE 3IDYB 4OZGB 4Y5YB 3M07A 3B9KD 4NZDA 5FF6A 2AJSL 4AG4L 2BSRA 3O45A 3PWJB 1P4IL 4PJXF 4HXBL 4DKAA 3WIHA 1A7BA 1UM5H 3HI1A 1IM9B 1NANI 3ESVF 5DRWB 4Z76B 3REVA 5AWNL 4QRTB 4CADA 1I1RA 3DUSB 3EO1B 1OAZH 1JN6B 5D1XB 4X4XA 1ZLSL 2ZOKA 4OCLC 1I8MB 4HWBA 2HFTA 1OSZA 1OVZA 4PJEF 2XTJE 4QRRB 3OGCA 4DN3H 3TCLA 2NY1C 2W38A 4LRIA 4XP4L 4UT6H 3GI9L 1A7PH 4Y5XC 3PV6A 2FHBA 1PKQB 2R2HA 5F7FA 1K85A 3CFDB 5D2LB 4LLDA 5JZ7D 1VHPA 4OM1H 2IF7A 3P0GB 4GUPB 4XXDA 4X5WB 4Y19A 3SDCC 3P9LB 4Y4HA 5E8OB 2YHGA 1FFNA 4HC1L 1HSAA 3SO3C 5GPRA 5FECA 4P3DA 4DVRH 3MRBB 5LQBL 1G6RA 4Y4HD 2OBGA 3V95A 3UEZA 4BUGA 1JL8A 3LVEA 3DURA 1A6TA 3RGVD 2XXMB 1I75A 3EO0B 3ARBB 3QQ9C 3PWUB 2NCMA 3S34H 4M6ML 1YEJH 4OZ4A 1DBML 2JJSC 5F96H 2EC9T 5HGAA 2D9CA 4GW5B 1HSBB 4JDZB 4LPXA 5A16A 5IVZA 4Z7QE 2AXHA 3L7EB 4MVBC 1J86A 5ID1A 1FL5B 4LAQL 3ILQC 1LEKB 3BEWA 4IDLA 1WQVT 2FR4A 4DJMA 1EFXB 1YPZA 4MXQC 3UTPE 4QRUA 2V5SA 3ROOA 4BKLB 1U36A 4QY8B 3WFEH 5DJAA 2OI9B 5IFHH 5M94B 4PP1C 5DURB 1E4XI 5J6GB 4YDLB 5I1LB 1AY1H 4P23D 1KGCD 5IJVB 2ZCKL 3SDXA 3JV4A 2N7BA 2GCYB 3LN9A 3HAEA 5JTWA 3UO1H 1E4WH 1Z6JT 4PS4L 5IP4A 5DJ0A 1WWAX 1G7PB 2R1YB 3QWQB 4ORGB 5GISL 1Q0YL 2D7TL 3OR6A 2RFXB 1HH6A 2GITA 5I76A 2OTWA 4Y16A 1URLA 3ZKND 3GMOB 1ZGLB 5KAQF 2Q86A 3VH8B 2R1XA 4DVBA 4S1RH 1J0YA 5JIKA 2OS7A 3WKML 5D6CA 1YNLH 1NEZB 2EYTA 1RUAH 3BPCB 4Y16D 3TIEA 3T8XB 3T2NL 4B0MM 1A7OL 3S36H 4L9LB 2NX5B 5BW7C 4ELKA 2AKRA 2IGFH 4XI5D 4KK8C 4L29B 1QSEA 3U6RA 4I13B 3BW9A 3D39E 1FC1A 2YA1A 1I3RB 1RK1A 1N6QH 4R7DB 1C5CH 1AR1D 4ZXBC 1QSED 1NEUA 1T2QL 1Q9WB 5F1OB 2C4XA 1KEGL 1Q9OA 1CXFA 5I75C 2FB4L 1TVBB 4JO3L 5BZWB 1MHHB 2YD2A 3O11A 1OP5H 1HYSC 4G6AC 3LH2L 4P9ML 1NLBH 1XF3A 2FO4A 5T1LD 3U9PH 4L4VA 1NKRA 2YC1B 1G9NL 4MNGB 1QACA 3WNNA 2IBZY 1UFUA 1IARB 4L3AA 4L4VD 4NRYA 1C08B 5BVJB 2K7QA 2E7LC 3P30H 4TN9A 4ODUA 2HTLC 3UTTE 4X6EA 4EN3C 5EO0A 1NC4D 3HMWH 2X1PA 3MFGB 1N64H 2J1KA 3IU3B 3RAJH 3EJYD 2VXUL 1P9MC 1ZANL 1NUGA 3ALPA 3CPLB 3SGJA 5CJ5A 5D1ZA 5BJTA 2DI7A 4TUOA 4GG6E 4LP5A 1F11B 2Q8BH 1K8IB 4E0RA 3CXDL 4WY7L 1OB1A 5CD3A 4HWEH 4M7JH 5F70A 1OW0A 3B2UD 4X8JB 2I07B 5D1ZD 5D7KD 4OKVA 2YPLB 4ZDHA 5KN5A 1FZKA 1S9WB 3MUGA 4K7PY 2VLKA 1GGBL 1IFHL 4R4FH 3PGFH 1RK0A 4WTXA 3UJJL 3O81A 4M9OA 2BVOA 1J8HE 3MLXL 3QIWB 4HAGA 1UM6H 4MD5A 1NLDH 3WIHH 7CGTA 5FDYA 1CGWA 4HFWA 4LARL 1R3HA 3T0EA 4LCYB 3QDJB 4QXGL 4BYHA 5DRNB 1RUMH 1JZ8A 4H26A 1GAFL 1QFUL 2F8OA 4HWBH 3L1OL 5IM7B 3T0ED 4FMKA 2FX7H 4PJCF 1QFWL 3TYGL 1RUPL 4JM2B 4D0DB 5IB3A 3L3GB 2FATL 3SKJH 2H1PL 3IGAA 5GGSY 1WJ3A 4HK0B 4QRPA 2NW3A 4H20L 1J0KA 3DBXB 2I26N 3O4LE 1BX2A 3QEGL 5D7IF 1JCKA 4I0PD 4RWYH 1QKZH 2NW2A 5F7DB 4ZFFB 5LBSL 4EOWH 3W0WD 1W72B 1FJ1B 1INEL 1G6RH 2GHWB 3GRWA 4XGZA 2ESVB 2P45B 1YEIL 4MAYA 4OF3A 4G42B 4XAKD 2DLEA 3H3PL 4OCWH 2H32H 5CILH 5FCUL 1FGNL 3P9WB 4I5BB 3U46A 3PGCB 1NCWH 1H5BA 4AEHH 2I9LA 5DTFA 2EDQA 1UCBL 4WTZA 5DD6B 3S4SB 5EC2A 4ZD3L 5J13C 4U6VH 5D96C 5HHOA 5CFHA 5D7SH 5MEQB 2ICWB 4PJXB 1PKOA 2BY1A 2MNUA 5HD8C 2G5BB 5ID0A 2XKNB 1DL7L 2N1KA 5HHOD 5AZ2H 4R2GD 1KJ2B 4PRHA 3K8LA 2UVEA 4YE4H 3PWLA 2XN9A 3HE6C 5DMYA 1LK3H 1G7JB 1N4XH 4UIMA 4PJEB 3QEQE 3SQBA 1PSKL 5IIEB 1ZTXH 3CFEB 4P5MA 4QO1A 3LB6C 1T66D 3HAEH 3HNTL 4TNWK 4EUPA 4TTGA 4NRZB 4P4KA 5EN2A 1I8KA 3JWNC 4MJIA 3LEXB 3VWJA 4OM1L 3WLBB 4P4KD 3MRRA 4MD0A 4OF6A 3OKEB 4BM7A 4KPHH 2IG2L 1UWXH 4FOMA 4I77L 2YXMA 2JIXA 4Y4FA 1PZ5A 4YDJA 1DBJL 1T80A 3JWDL 2UZIL 4G6KH 2JIXD 3KXFA 3GEWB 1LO5B 2B8OT 5EZOH 4D8PB 4Y4FD 4U1GC 2HRPH 2W07A 3IJYA 4PTTB 1ZSDA 1P2CA 3DHJA 3IVKA 4U3CA 5F21B 2EIDA 4D9QD 1QSVA 2DI8A 2FYYB 5IB4B 2JJUA 2BNQE 3VXMB 5E8EB 4LMQI 1AXTH 1BFOB 4KRPC 3QWOB 3QUZA 3U30B 1DVFC 3MGTB 4JHAH 4HHAB 5DZOA 5FKPB 2BY3A 3LIZL 3L5WB 5SX4I 3QUZD 1OTUC 3PQYB 2MTPA 1TPXC 2R8SL 3D6GA 1N59A 4KXZH 5CBAA 4MWFA 2UVFA 4DAGL 2EXYC 3EOTH 3VE0B 1UYWL 2VDLL 1RHFA 4NZUL 3FQTB 4NKQB 4WO4C 4Z78A 1AQKL 1JVKA 1MJUH 5ITBL 2D7PA 2I60H 2X09A 1NL0H 2EH8H 3MRHA 1S78D 1XGRA 2GJZA 3PWPE 3QEUB 4LU5H 3TM6A 1U8MB 1A6VH 2A6IA 3TJHC 1C1EL 1E27A 1V3LA 4KUZL 2IPTL 3DLQR 3VWKD 3MJ6A 1LNUA 1T04B 3HRZB 3DV6A 1TZIB 3MTRA 3K3QA 2EO1A 4H0GA 5KSBA 3HN3A 4QTIH 3ZL4L 5IEKB 1G0XA 5CLTA 5AYUL 5C2BH 1KLGA 3KJ4B 3NA4A 5JHLL 4GQPH 5FA4A 2OCFD 2L4OA 2VL5B 4IRJC 1GGIL 3BUYA 5GS0C 1C5CL 5EOQH 3NIGE 3MRNA 3STLA 5IG7A 1B6DA 4X98A 4OLWH 4PGDB 4ZOCA 1P4LA 1UZ6E 3CD4A 5E2TL 4XWOD 3P4LA 5KS9E 2WBKA 1YYLL 1XR9B 2IAMA 4K3EL 1KIRA 2Y36L 1F4HA 1CFVH 4FQQA 2XTJD 2AJ3B 5DFTA 1G1CA 1JF1B 5FGCE 1U8HA 1MLCB 2C1PA 5CSBA 2IAMD 1FO0L 3L3OA 3RWGA 2WUCH 3VD3A 2AXGB 3BPOC 3E6HA 3HC4H 3TFKC 1II4E 3TPUB 3P30L 5ECJE 3O6LL 1HE7A 4MJ5B 1CZ8H 3GRWH 4H25B 4FQHB 3RAJL 4G43B 4LVEA 3UZEA 2HLFD 3JZ7A 4WU5B 5KOVC 3VMNA 3WN5A 5BS0B 4XP6H 4CUCA 3HNSL 3MOBH 1FN4A 1A7NH 2ZSWB 2AI0H 1HOCA 3O8XB 1Q94B 5GS1A 4G9FB 4HWEL 3QFJE 1RV6X 4JFEE 5FGSA 1KPVB 1KXQE 5I30L 3RZCA 5IVOA 3GSQA 4F7MB 1Q9KA 1N0XH 2D7MA 3FRPA 1FYHB 5DJ6A 3MUJA 1S9KC 4XMKL 5IBUG 2BOCB 5L9DH 4GKZB 5DQJA 3V6ZB 4APQB 3WJJC 4K3DL 1FG9C 1GZPA 1QR4A 3UTPD 5JQ6L 4IMKA 3WMSA 2ZPKL 4JO2L 2Z8RA 3ZTNL 3VD7A 2W60A 2R4SH 4J4PC 4N9GB 3PDGA 3GHBH 2HG5B 4P2QB 2VQ1B 4PJCB 2DOCA 3DHMA 2Z4QB 2R2EB 4Z7UE 1WLHA 2XFXA 2WINB 4EUPH 3ARYA 3HE7B 1U42A 1T89A 3UTSE 4U7SA 4L4TB 3S88H 1Y0LA 4WI5A 4FFZL 4ONHA 4DW2H 3GMPA 2Q20A 1AGFB 1N8ZA 4N0CD 1F4YL 1BPVA 4NOBA 4Y2OA 1IGTB 2BNRE 3KPOA 1QHPA 2XNAA 1IC7H 2MQCA 1EIBA 3M1BB 4GXUM 1JI2A 4Z7OE 3T1WA 2VQUA 2KPNA 2WBWB 2X9XA 5IMLA 1EEZB 4UNTA 3D39D 2F9BT 4M8QB 3U2SA 4LEXL 2DM7A 1MJJB 5EO1B 1YNTA 1UACL 2E27L 5GGUB 3FQUB 1B3JA 4KI5E 2PR4H 4RMQA 1KB5A 3QHTC 4JN1L 2GJJA 2MCG1 4JHBA 3CSYB 3QFDB 2GEEA 1BBDH 5T5FL 3F6LA 1T7WA 2PO6A 5HHVL 4QHNA 1IAIM 3QIUA 5FM5M 3HFML 5F3HA 4NDMB 2A77L 3VXTB 2O5YL 3QIUD 4NWTH 5F7EH 4JFXB 5E03A 4OIIL 3UTTA 3V6OE 4HKZA 3ULUC 3VGEA 1EEQA 1L0YA 3QPQD 4F7TB 5EC1A 3SOBH 3RNQA 3I6LE 4MQ7B 4TNVK 3CJJA 4MCYB 4PRID 4GG6A 3MRGB 3QUMA 5EU4B 4M7LT 1E4KA 1A9EB 2C7UA 3R0NA 4HV8A 3JUZA 4FXKB 2JJWA 1A6PA 1YMMB 2C9AA 3ZE2E 3F62A 4MZ3A 3ULVE 2UWEA 4NC2B 3IF1A 4HT1L 4KVNH 1MAJA 1X5ZA 1IC4H 4G6KL 2H45A 1J8HA 3FO2B 2V9TA 2XTLA 1G7QB 3K4DA 1KJMA 4TVSa 3WJLA 3K2UH 4QWWC 4CMHC 4FFVC 3FOMA 1J8KA 5JXED 4PLKD 4RGOL 4HUUA 1BZ9A 5TE4H 3RWEB 3P4NB 4YQXL 2HJFB 5C0BE 1D5BB 2W59A 3TZVA 3EW3B 3G5YA 5FAAA 2ADIA 4OLUL 5LKNA 5F7KC 4U1NB 1JPSL 3CH1A 5HDOA 3QUYB 1LP9E 3O4LA 2VZOA 4Y4KC 3GKZA 1QLFA 4Y7MA 2CDGA 1Z9MA 2QBWA 2J6EA 1HHHB 3MUY1 1OLZA 4YAQB 1MRFH 1QG3A 4X4YA 2UUDK 4PRBB 3O4LD 4XTRC 1DDHB 2BMKB 3MLUH 2ZCLL 4JZNB 3ALWA 4RZCA 1AJ7L 2Y4SA 3CMGA 2XXCB 4KY1L 3EYFB 3RPKA 5AUMA 3G9AB 5I2IB 4Z9KB 4YLQT 4TSBH 4W4OC 1MCOH 1P69B 3PG2A 1PD6A 2IALA 1A14L 3MO1A 1JMXA 4I2XE 2PXYA 5DK2A 5I18H 3C2AH 4R97C 5C07B 4CDHA 4NHCL 5EBMA 2PXYD 1U58A 5CEYA 1CGYA 1HNFA 1BJ1H 4KC3B 1MHCB 5DRZB 1QBLH 5I8CA 2P5EE 1MJ7L 4FTVE 2XPGA 3RDTC 2VXSL 4OUUA 3KLDA 1C7TA 1P4BH 3WL9B 5T3XL 1EO7A 1CU4H 3AY4A 4WJ5B 2NXYC 3LZFH 5EUKB 3CCHA 5EB9A 3UZVB 5CKGA 1T5WB 2A73A 3O3EB 2EDTA 4Z0XB 3QEQD 4GRWF 5IMMB 1YJDL 2EIZB 3G6JE 1CFVL 3IDNA 5FFLA 2NY1B 4FP8L 3WFBL 2VAAA 4Y5XB 2IAND 3DX7B 3WYRA 5FO8A 4JFDA 5ETUB 5C0RL 3NIDF 5IW3A 4M3JA 2JK5B 4N5ED 5J1AB 4P59L 4P46D 3SDCB 2NPLX 1KC5L 3IRZA 2WIMA 4B41A 2WQ8A 4YWGL 4HUVA 2G2RA 4PPTA 5D93C 3GRWL 4HQQL 1VEPA 4X5LA 3STZB 1TJIH 1NBVL 4LSRH 3I02B 4X5XB 5DMKA 4BZ2H 3ARTA 5JO5A 1HHJA 3TEUA 4NM8L 3O9WA 2MHAB 3CFBB 4XP6L 4UBDC 2AEQH 3B4NA 2YRPA 3AU1B 4F33A 25C8L 3C60B 1R5VA 1CGTA 1VFUA 5JLZB 3VH8G 3QNYB 1RJCA 4Z7WE 5L2JB 5IHLB 4FQ2L 5CD5D 1NEZG 2BNQD 3DMMD 3N0PB 4LNRB 1ZT7A 1ZEAH 1U6AL 4LLWB 1FNEB 2QKIB 2MCPL 1F8TH 4WI6A 1ZVHA 3TN0A 1QSFB 3SKMA 1CDYA 4YHNB 3TN0D 3OKOA 4MCZA 2DQGL 2VUOA 2Y06L 3BZ4B 2XYCA 1MRDL 2CXGA 4J23A 4NIKB 3H0TB 2VQTA 2X4NB 5I17B 1KPUA 1DQJA 2F54E 1GGCL 4L3EB 3PWPA 2XZAH 4DQOL 1M71A 4R3SB 3CFKA 1A2YB 3FN0H