2P5KA

Crystal structure of the n-terminal domain of ahrc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
NKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title A high-resolution structure of the DNA-binding domain of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 22
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p5kA00
4HDUA 5LGNA 2P5VA 1IXCA 3DQVC 2NNYA 4B8XA 4ESFA 2ZJ2A 4A6DA 4PGHA 4IRHA 3BOQA 4UVBA 2O0YA 1R5HA 4HF0A 5K5RA 1FP2A 1NHAA 3ECOA 3CO7C 1IZ1A 3F6OA 1S7OA 3M7GA 4A2UA 5KVRA 1QBJA 1J2XA 4LLLA 1IN5A 1BC8C 3ZP5A 2MD5A 4OIRF 1HBXG 2YR2A 3DKWA 3WTXC 2XVCA 2KJBA 4RAZA 2GXBA 3K9TA 2P6TA 3REOA 4E70A 1G3TA 4CXFA 2HTSA 5CVJA 4GO1A 1FSEA 2LKPA 1DUXC 2IRFG 2HYGD 2HOEA 2XRNA 3K2ZA 1PP8F 1BBYA 1TQMA 4OIQF 2OZUA 1KQ8A 4BHPA 3RKWA 5LLQA 1I5ZA 2QM3A 1RNLA 1OYWA 2M87A 1ZLJA 1P2FA 2W24A 3M1EA 3WTUC 4RGRA 2O6GE 4IHSA 3F6VA 3KP5A 4FX4A 1K79A 3U2RA 5IT3A 4QWQA 2HDCA 4Q48A 2F5CA 2ZO4A 1IN4A 2YU3A 2W84A 4HX8A 3COAC 1T39A 2V1DA 4A6EA 4Q4ZF 5D5WB 3CUOA 4A0YA 3HUGA 3DP7A 1FPQA 2LNBA 4M9XA 1FC3A 3F22A 3PQKA 2MH9A 2QLZA 4NB5A 1ULYA 2P5LC 3I59B 5ILSA 1HXDA 2YX4A 5F64A 2WC2A 2LF8A 2V79A 1YW9A 4M71A 3V7SA 3HRMA 2BEOA 1XSDA 5HDNA 2STTA 4N9HA 4IRGA 4HV5A 1K78B 2PBIA 3M8EA 1XB4A 1LJ9A 2G7UA 4IF4A 1H9TA 1XCVA 4M9ZA 2JPBA 2XROA 4N0BA 1BN5A 3ECHA 4IVNA 4G6DA 3RIRA 3GFJA 2O8XA 4ON0A 2O61A 2A68F 3NQOA 2NAZA 2MBFA 3AAFA 3QPHA 4I01A 2A69F 2JTVA 2ZNZA 1LQ1A 4D0PA 4OU0A 1RIOH 1S7AA 3BJAA 3BPXA 1X3UA 2VBYA 3ABUA 1TNSA 3PFIA 4P9UA 1O3SA 1YLFA 1W7PB 3TDZC 5D4SA 2JZYA 3FM5A 4LB6B 4EGZA 1FYMA 1IN8A 4AIHA 1YS7A 1I27A 1IUYA 3SZPA 3RKXA 4MTDA 3KP6A 1S29A 5HLIA 5LRRA 3WGGA 1YFHA 2NYXA 2K02A 2HKOA 4LG0B 1JE8A 3FHZA 4ASNA 2Y75A 3F8MA 4R79A 5FFXA 6PAXA 1T98A 4AIKA 3G3ZA 2FNAA 3CTAA 4EJVA 3W6KB 1KQ9A 4UHTA 1D5VA 2LDUA 1R00A 2R7FA 2WWYA 3FXQA 1J7KA 2VN2A 3IRRA 1HKSA 5EEHA 3T5XA 3D0SA 3RPQA 5BS6A 3KEQA 2FOKA 1D8KA 1RUNA 1OYYA 4GYIA 1R23A 3GXOA 4L9NA 1T0FA 2Z99A 3F8FA 3MZHA 4RB0A 2CGPA 2VT3A 4ENKA 1ON1A 5LBQA 1E17A 1U8RA 3NRVA 1TQPA 4I98B 4I02A 1SMYF 3CUQA 2Q2EA 2CW0F 2DK8A 2EWNA 5E8IA 4XRFA 3SHFA 3IRQA 4PCQA 3EYYA 2F5DA 5LEKA 3F3XA 4I0BA 2STWA 3IKTA 5D6FA 5DUKA 3HSEA 2OZ6A 3DEUA 1TTYA 4ZZLA 2K86A 4FHTA 3MQ0A 4FT8A 2RV8A 2NS0A 3IKVA 1ZRFA 3J7AO 2HFHA 1P6RA 1XMKA 1WSUA 2XHKA 3ZMTA 2ACJA 1YYVA 2F2EA 2QZ8A 2MH2A 2QVOA 4OIPF 4DQ2A 1J59A 2GWRA 1B9MA 1VTNC 4S04A 4KIFA 4BH9A 1W5TA 4O3MA 3QOPA 1MJ9A 4HLXA 1BI2A 1P4XA 1JHHA 1B9NA 5JVTA 3FMSA 4RB1A 2VC0A 3HRUA 3QU6A 2XAQA 3GWZA 5HS7A 3LWFA 3M8FA 1FLIA 1WI9A 3SZTA 3BWGA 4JQFA 2L02A 4O6JA 3DFGA 3U1DA 3MAJA 1ZG1A 4EM1A 3WGHA 1U5TC 1R36A 4UV8A 3KP4A 4Y17A 3E6DA 2HQNA 2W57A 2MLGA 5DCMA 4WF2A 3E5QA 3HIFA 5A2QK 3F23A 2HQRA 2K4JA 1FYLA 2QBYA 5E1WA 4A0ZA 3SXYA 3LA3A 1J9IA 1GVJA 1OPCA 1IXRC 2DU9A 2L01A 2R7DA 2QQBA 2QWWA 3I59A 2XAGA 5DDGA 3S2WA 1XN7A 3F8CA 2KIMA 3DPTA 3JTHA 4BYYA 1R1TA 2FQ3A 3T8RA 2IW5A 1R5GA 3GYHX 1L3LA 3WE3A 1K78A 3WU0A 1MGTA 3J80K 3BZ6A 4A5NA 3EDPA 2DO7A 1DDNA 2VE8A 5TJJA 5BOXA 2FBHA 5DCFA 3H3UA 4RB3C 1FZPB 1HQCA 3E5XA 2Z3YA 1LEBA 3ABTA 1H0MA 5D5VB 2JT1A 1YO5C 2L3DA 2QUFA 3ROUA 3WG9A 2FEZA 4ETSA 4YFKF 4L5IA 2ZMEA 1YW8A 2P7VB 3P7NA 1ZYRF 2ZBKA 5FLXZ 4KN7X 3J81K 2M8EA 1W7PA 2D1VA 3BJ6A 5HLHA 5ICEA 2GQQA 2KJCA 3E3VA 4HZFA 1Z9CA 5D6EA 5KK1A 3KFWX 1TW3A 4WK8F 2BYVE 2HEOA 4XLPF 1J5YA 2GAUA 2HS5A 3C18A 2VXZA 4ZYHA 3K1NA 3V8KA 1G3YA 5E8GA 3KLOA 2HYFA 2DQLA 1HW2A 1RI7A 2UXNA 2ADUA 2VT2A 1EH8A 2ZXJA 3IHUA 3IWFA 4BHCA 1FBQA 1RZ4A 2Z5UA 4HQMA 4AIJA 3B73A 3T0YA 4HBLA 3L9FA 2M5WA 2COMA 3B02A 2RNJA 1R7JA 3WTSC 2VBZA 2VOPA 3F21A 3QRFF 1S8NA 3BY6A 4ENJA 2G7HA 3L7WA 4OMZA 2BV6A 3KETA 2TDXA 2EK5A 1CF7B 2V9VA 4ZYGA 2YSRA 3SFZA 2DI3A 3QAHA 3GZ5A 3DV8A 4OOIA 1SFXA 4AVPA 1YG2A 2WV0A 1ZGJA 3Q5FA 1JHFA 2EB7A 1HKQA 4KNYA 4M6XA 2Z33A 3I53A 1Y0UA 1HW1A 2OU2A 3HOSA 4GYGA 4OINF 2P7CB 2E7XA 1XSXA 5L3CA 3VFZA 1W7PD 1O57A 3E6BA 2PJPA 2CSOA 5D4RA 2WTEA 1BC7C 2UXXA 5FFZA 3V7CA 2AS5F 1PDNC 3F72A 1U3EM 1KU9A 4KT5C 2O3FA 1ZREA 3QP5A 2ELHA 2AXLA 3DXJF 3R6SA 3TOBA 1S6LA 3E6CC 1AWCA 1YTYA 1IN6A 4A12A 5IT9Z 4ZH4F 5E1ZB 2XAJA 1MDMB 3C3WA 1U5TB 4L0ZB 4EVIA 3LQQA 4KICA 1TLHB 3ZMUA 3R60A 3KEOA 2K7LA 1JGSA 4Q47A 2EFNA 2GA2A 4KA4A 3H92A 5L3EA 2RDPA 3DF8A 5LEJA 1KQ0A 2IA2A 4YFXF 3JAMZ 3FZVA 1G3WA 2OA4A 4M74A 5FD5A 2X0LA 5ILVA 3ZMVA 4BHBA 1LEAA 2JPCA 3KP7A 4M9SA 1YW7A 4AD9A 3LA2A 3LA7A 2F5EA 3SQNA 4EJTA 4AWXB 2EA2A 3WE2A 3VB2A 4I2OA 3J80Z 4WCGA 4ZZDA 2B0LA 3M9AA 2Y0MA 3BDDA 2FRHA 1STZA 3MZYA 5LRSA 1O7LA 5E17F 4WXCA 2KKOA 2E7WA 2PN6A 2FE3A 4DNCA 4MHGA 1SFEA 5D8LB 3E5UA 1GXPA 2E1CA 5FD6A 1KYZA 1FBSA 3I5UA 2FF4A 1GHCA 3HHHA 3LSTA 1YS6A 4RB2C 4Q5SF 2R3SA 3J81Z 4IRIA 1B6AA 1MJBA 3HRSA 1HW5A 2W85A 5ILUA 1KA8A 3ERED 1WKMA 1U78A 1BIAA 1A04A 4M6YA 1G6NA 2DPUA 4LMYA 2MLKA 3FF5A 1G3SA 3G73A 3R0AA 1XCBA 3WTTC 1LVAA 4I0AA 3JSOA 1HSTA 4HA8A 1BOAA 4ESBA 4EMSA 3HTUA 2FSWA 3GVAA 3KCCA 1QQIA 3T1BA 2FBKA 1KU3A 4MNUA 3HTSB 3BROA 3I54A 1UCRA 5DD4A 5JI6A 5J8FA 1P4WA 4BAYA 1LNWA 3GUDA 2OQRA 4Y13A 5BPDA 5EEGA 2M30A 1MD0A 1R1UA 4HQEA 5K1YA 1TW2A 3GFMA 4IPAA 1SD4A 1ZG3A 2CYYA 2V1XA 1J0RA 1J75A 5L3DA 2ISZA 3WTVC 4CO8A 1FP1D 4NQWA 3I4PA 5LGTA 2VODA 3LAJA 4HX7A 2RC4A 5CYVA 3ZMDA 4G94A 2CO5A 2VOOA 4G7HF 3VOEA 3H3ZA 4LD5A 2LF7A 3VEPA 4M72A 3U9GA 1F9NA 4BXUA 2OD5A 5HS9A 3EYIA 3Q9SA 3K1PA 5H6RA 4IHTA 2A6EF 4EGYA 5LGUA 3CO6C 1L0OC 2HKXA 3CDHA 2VONA 2J5PA 1SFUA 1YQAA 4LK1F 1D3YA 1SD5A 2ZKZA 2XAHA 4ZYDA 2DW4A 1O3RA 3BJOA 4ENNA 1ZHFA 1T2KA 2UWMA 3GFLA 1SAXA 4KMFA 2FNPA 4XSZF 2CWEA 2P4WA 3FWEA 1FT9A 1RUOA 2IA1A 2RKHA 3LAPA 3MWMA 2QENA 4UNOA 5K5OA 4O5VA 1R22A 1OKRA 1BI0A 4L18B 2HZTA 2GZWA 4EV0A 1ODDA 3W6JB 4HDVA 2EA4A 1B4AA 3CLOA 3C7JA 4MEXF 2Y48A 4B09A 1MJAA 1F4KA 3GX4X 1K6OA 1U5TA 3HRTA 4U0VA 1OYIA 2ZNYA 1IF1A 2O03A 1O7FA 3CJNA 5DYMA 4G6QA 2CFXA 1ZARA 2PI0A 1XSVA 2PLYA 1W4MA 3FMQA 3MCZA 2DFIA 3N4MA 4HAMA 1JXSA 3L00A 5JHUA 2EFOA 1ZH5A 2L4MA 1EV7A 5DEQA 4M73A 5ICCA 1OR7A 1DPUA 4KUMA 2P5KA 4RGUA 1R1VA 4UXNA 3D5LA 2IPQX 1WWXA 3TO9A 3E6MA 2IJLA 2YX7A 1LDJA 3TO7A 5HDKA 3L09A 3FM3A 2RQPA 3ML6A 1MZBA 1E2XA 3Q9VA 1UHMA 1WRJA 3BP8A 3K0LA 4L5JA 4KN4X 3KP3A 5HLGA 2M45A 5ICGA 2XIGA 4WXHA 2VBXA 5JR3A 1Z05A 5BQTA 3I64A 4U0YA 3O3KA 1QNTA 4JBAA 2A5YB 3WTZA 1TNTA 2NRAC 2FMLA 2ETHA 3OOPA 1FX7A 5E20A 4RS8A 2IA0A 1REPC 1IW7F 4LG0A 3WTWC 2HGCA 1Z7UA 5E1XA 3TOAA 4L0YB 4WX9A 2GA1A 1C0WA 3QPTA 1HKTA 3V8LA 1Z91A 5FB2A 4LB5A 3IL2A 4LLGF 1USTA 2LSOA 2VBWA 2C6YA 1I1GA 4CZZA 4HLYA 2XASA 4RGSA 4TV7A 3ZMSA 4MGRA 2BGCA 2DLLA 2H09A 3QU3A 2Q8KA 2UZKA 3GO5A 2MC3A 1FYKA 2F5FA 1Z6RA 2FMYA 1FWZA 3FMRA 1YIOA 3R61A 1I1SA 2DBBA 2PG4A 1F1ZA 1XGSA 4BNCA 4LGWA 4G7ZF 3IWZA 3JW4A 4P55A 2L54A 4K2EA 5F1RA 3ZN0A 1FNNA 4PGGA 1D8JA 2KRFA 1KYWA 3RI4A 4YIFA 4IXAA 2RGVA 1ZRDA 1FY7A 2W25A 5CVVA 3EUHA 4P5OA 2NNNA 5D5UB 5FO5A 4LJZF 1XGNA 5AIQA 1G4DA 1K7AA 4CHUA 3MFKA 1P92A 2EFPA 1XDUA 2RVCA 2IVMA 1T38A 4KIBA 4G7OF 4EQQA 3RKYA 2FBIA 3LFKA 3O6BB 1ZLKA 3R4KA 2XKOA 4EM2A 1FBUA 5DCMB 5DV5A 3RTRA 4IJAA 2E1NA 1B59A 1LDDA 1IN7A 3FXUA 3GEZA 2QBYB 2P6SA 4HF2A 1DP7P 4LFUA 5A2QZ 5TRDA 4XLNF 2FU4A 4U7BA 3GFIA 1V3FA 3RYRA 4OMYA 2ESHA 1AOYA 2V6CA 3KZZA 2VE9A 1B1BA 4HW0A 3F8BA 3QP6A 3OV8A 3HHGA 4MTEA 2K4BA 1UB9A 2BE5F 3VODA 5DUIA 5H6QA 2XGXA 1R58A 2PFBA 2A07F 2PMHA 1Q1HA 4RGXA 2DPDA 4Y15A 5ERIA 2KIUA 1T6SA 1U6GA 5E18F 3O2PE 4P96A 4U0WA 3I71A 2XUBA 4UVCA 1SMTA 4G9YA 3RPUA 1PUEE 4RAYA 1V4RA 4KFCA 3HYIA 3HSFA 4Z2YA 1FOKA 1H9GA 4P9FA 4I09A 3WU1B 3RYPA 1BI1A 1QPMA 5D8KB 2H6BA 3ISPA 2ZMEB 2ZFWA 4EM0B 2D1HA 2JSCA 3FXRA 1ZAOA 4EJOA 4A5MA 4BQAA 4NHJA 2ZCWA 1ZRCA 3KP2A 5ICFA 3DPLC 2DK5A 1OMIA 5L3BA 3RDIA 3T8TA 1BI3A 2H6CA 4L9TA 2L4AA 5HOOA 4FX0A 2DAOA 2EV6A 4GGGA 4ZYEA 3P9KA 4MEYF 2XV4S 2CQKA 1ZG5A 1KU2A 5AONA 4U7DA 2A3SA 3ZQ7A 1F5TA 5FLXK 5CJ9A 1KU7A 2DQRA 2OQGA 3KZYA 1SD7A 1PP7U 1LDKB 5FGMA 3TQNA 3CUQC 3P9CA 4HF1A 1I6XA 2HR3A 1S3JA 2K27A 2KIFA 2QQ9A 4UVAA 5H20A 4A0XA 3KLNA 4R1HA 1XMAA 1WQ2A 2P8TA 5J6XA 2MA3A 5BMZA 5LHHA 1EH6A 2EFQA 3JTGA 1GXQA 4GXOA 4L9JA 4F7ZA 2CG4A 1XD7A 4YIIA 5CVUA 2QQAA 2A61A 2X4HA 4HX4A 3WTYC 4CGZA 4XSXF 2RN7A 3GZ6A 3R0JA 4KDPA 4N9IA 4UUVA 5CLSA 1UHWA 4PDKA 2HTJA 3C1DA 5J8CA 3V7RA 1O3TA 1TQIA 4HOBA 1MKMA 1EH7A 5L3FA 2EJRA 3I58A 5HVQC 2JRTA 2EV5A 1CF7A 3GF2A 3FX3A 2H27A 1Z1DA 4R8HA 4CICA 5CVIA 2XKPA 2EV0A 1DPRA 3N97A 4JK1X 4XBFA 1P4AA 3ZN1A 3PQJA 4LK0F 1SD6A 3F8NA 5ED4A 1XGOA 1BM9A 3EQLF 2H94A 3GW2A 3HOTA 4G8XA 3EETA 2VC1A 2D45A 2BBYA 4S05A 3P9IA 4MQVA 1ZGAA 2Q0OA 3TO6A 2V1UA 3ELKA 4PZJA 4CYDA 2IT0A 3K69A 1UFMA 2G9WA 5IT9K 5K5QA 3TGNA 1LB2A 2D2WA 2GIVA 1BJAA 2IP2A 3V4GA 1ONVA 3ZPLA 3ULQB 5BPIA 4WWCA 4MQ9F 4YG2F 4KMUX 1ON2A 4KIGA 3K1MA 5LHIA 1MDMA 5CVRA 3BPVA 1CGPA 3L2CA 1U2WA 2M1BA 1W5SA 3RJPA 1HSJA 2A6HF 3JAMK 5F6FA 3HSRA 4EJUA 4ENMA 3ZMZA 1TBXA 1ZN2A 3WGIA 4KYWA 5JFRA 4QLCU 3MEXA 1QO0D 4HV6A 3NEUA 1XDSA 1IRGA 1IRFA 4UV9A 2EFWA 5D5XB 3LQRA 4I7HA 3V8JA 4YFNF 2YPRA 4LLNA 2DT5A 2OAZA 3WODF 4L9VA 3JSPA 1Z6TA 1O3QA 1KGSA 4U88A 2PMUA 1FSHA 1USSA 5L3GA 3IC7A 2FA5A 4ESJA 2ESNA 5DD8A 2GXGA 4OIOF 5HDGA 4HYEA 4GCVA 1BIBA 4H0EA 1QGPA 1XGMA 1QZZA 1IXSB 3GLXA 3E97A 2DTRA 2OBPA 2PEXA 4EJWA 4WXDA 1IAWA 3KE2A 3I0TA 5AIPA 5HS8A 2ISYA 2PQ8A 3TDUC 2J5OA 2Z9OA 1QZYA 3TKYA 2HWVA 2QYOA 2XAFA 3CUQB 4CDGA 2FXAA 5LHGA
chains in the Genus database with same CATH superfamily
4HDUA 5HNHA 1JKRC 1QHGA 5J3LA 5LGNA 2P5VA 1IXCA 3DQVC 1YJWI 2NNYA 4BDZA 3HDDA 4B8XA 4A3LJ 4ESFA 2ZJ2A 3H5NA 4A6DA 1JUPA 4PGHA 2R7OA 3CJQB 3HXLA 4NQWB 4IRHA 2DFHA 3BOQA 3OMYA 2KHMA 2O0YA 1R5HA 4UVBA 2M2EA 2NOGA 4CCNA 4HF0A 3TP3A 1FP2A 5K5RA 1NHAA 1WJCA 4ZC3A 3DWLE 3IH2A 1R4MB 3ECOA 3CO7C 1IZ1A 3CD6I 3F6OA 3WHCA 1S7OA 3ASOH 4QIWN 3M7GA 1X1CA 2K9SA 4A2UA 4AVZA 1VQLI 3BTLA 5KVRA 4RBOA 1QBJA 1J2XA 2W48A 3JCUC 3ONQA 4LLLA 1IN5A 2JA8J 4LIVA 1BC8C 4BY1J 3ZP5A 2BY2A 2MD5A 4OIRF 2X1EA 2YR2A 3DKWA 2F5VA 4BY7J 1HBXG 2JA6J 1MBKA 4C2TA 1VQPI 2E5NA 2Y0SN 3WTXC 3SFIA 4A3BJ 2XVCA 2KJBA 4RAZA 1W0TA 2GXBA 3K9TA 2P6TA 3M4OJ 2BZTA 4CA0A 3KZIC 2AHQA 3REOA 1G3TA 3M8JA 2WA0A 2X48A 4E70A 4CXFA 2HTSA 5CVJA 4GO1A 3CDIA 1FSEA 2DOEA 4II2A 2O7OA 4DGWB 2LKPA 1DUXC 3QYFA 3HEFA 2IRFG 2HYGD 2HOEA 2XRNA 4F93B 3K2ZA 1ZR4A 1PP8F 3BCAA 1BBYA 3OYJA 1TQMA 5FROA 4OIQF 2E2JJ 2WADA 2OZUA 1KQ8A 4BHPA 4IHYA 4D7MA 3CCEI 3SZGA 3RKWA 3ZR8X 2KIQA 2L7KA 3ZQFA 3S16J 5LLQA 1UJ8A 1X2NA 1I5ZA 1H89C 4X6AJ 3JRDA 2QM3A 1RNLA 1OYWA 1Y1WJ 5GADJ 2DA7A 2QQ8A 2M87A 2DA2A 1ZLJA 3ZRGA 1P2FA 2BW3A 2W24A 1LKXA 3L2UA 5M5WJ 3M1EA 3B6AA 3WTUC 2ZB9A 4RGRA 2DXIA 2O6GE 1EKEA 5LD2C 2BOLA 2MC4A 2HOAA 4IHSA 3PIOF 3PO3J 3F6VA 3KP5A 4FX4A 1K79A 3U2RA 3M3YJ 4ITVA 5IT3A 4QWQA 2N8GA 2HDCA 5EG0B 4Q48A 2F5CA 2ZO4A 3HOXJ 4E7JA 1QU3A 1IN4A 4IQ4A 2EINH 2YU3A 5HODA 5J1RA 2W84A 1W36C 2GIZA 4HX8A 3COAC 1ETXA 1IG7A 1YX3A 1T39A 2QSFX 2V1DA 4A6EA 4Q4ZF 5D5WB 4I99C 3CCUI 1SANA 3CUOA 2IS4A 4A0YA 3HUGA 3DP7A 5EF6A 3OYLA 5JLWA 5LFAA 1X19A 1FPQA 4BJ6C 3FBIB 2WB1N 1WPKA 2LNBA 2LKSA 5TISC 3PL8A 4M9XA 1FC3A 3VYRB 3ABKH 3F22A 3PQKA 2VPLA 2QCOA 2MH9A 2QLZA 4NB5A 4D5CA 4XQFA 1ULYA 4A3DJ 2JVHA 2P5LC 2E35A 3I59B 5ILSA 1HXDA 2YX4A 3CP2A 2P81A 5F64A 1WJDA 1F36A 2WC2A 4PJNA 2LF8A 2IS6A 2V79A 1YW9A 1TWFJ 4ANJA 4M71A 2JUCA 2VXDA 3V7SA 3HRMA 2BEOA 1ZK8A 3E1SA 5KAIC 1XSDA 5HDNA 2STTA 4N9HA 4F3QA 4IRGA 4HV5A 1Y39A 2XDVA 1K78B 2PBIA 3M8EA 1XB4A 1LJ9A 1UELB 2G7UA 2KRCA 4IF4A 1O4XA 1H9TA 3GTQJ 1BA5A 1XCVA 4M9ZA 1X1BA 2JPBA 3BR2A 2XROA 1BW5A 1VZ0A 4N0BA 1BN5A 3L2RA 3ECHA 4IVNA 4G6DA 3RIRA 3OS0A 2R7VA 3TP0A 3GFJA 2O8XA 4ON0A 2O61A 2A68F 3NQOA 2NAZA 4B48A 3PIPF 2NS8A 2HOSA 3VSKA 2MBFA 2QSHX 3BZKA 4XM3A 3VWBA 3AAFA 2CH0A 3QPHA 4I01A 2A69F 2JQ7A 2JTVA 2ZNZA 4DYRA 1LQ1A 2M7BA 2Y31A 4D0PA 4OU0A 1RIOH 2Z2SB 1DP3A 1S7AA 3BJAA 4XKVA 3BPXA 3G1OA 1X3UA 2VBYA 3BC8A 4NC7A 3ABUA 5M5XJ 4M3BA 3OR1C 3OYFA 1TNSA 3PFIA 4P9UA 2BY1A 1O3SA 1YLFA 4HEA2 1W7PB 3TDZC 5D4SA 2JZYA 3FM5A 3G1MA 2VQCA 4LB6B 3H36A 4EGZA 1IN8A 1FYMA 4AIHA 2IS2A 1YS7A 2B7EA 4A3KJ 4M3DA 1I27A 3N05A 1IUYA 3SZPA 1X2MA 3RKXA 4HSRA 4MTDA 1E3OC 3KP6A 3OR2C 1S29A 2V4JC 3CCYA 1KONA 2GOXB 5F27A 5HLIA 4YIRX 5LRRA 3WGGA 1YFHA 2NYXA 2E60A 2K02A 2HKOA 1OCCH 4LG0B 3PO2J 4CYCA 1JE8A 3FHZA 4ASNA 3H9JA 1T33A 2Y75A 3F8MA 2VQGA 1TT0A 1D1CA 5FFXA 4R79A 4F91B 6PAXA 5M3MJ 1T98A 4AIKA 2R7ZJ 2CUEA 2GBYA 3G3ZA 2FNAA 3CTAA 3TL4X 1ENHA 4EJVA 1HOMA 4ABZA 3L2WA 2R5ZB 3W6KB 1KQ9A 4UHTA 4QTRA 3S2HJ 4C3JJ 3LSMA 3RZOJ 1D5VA 1K6YA 2LDUA 4MFDA 1R00A 2XF7A 2R7FA 2DYSH 3BQZA 2WWYA 3D5RC 4BEHA 1CQTA 2L0KA 3UKGA 4X0GA 3FXQA 1LE8A 4G12A 1J7KA 2VN2A 4A3MJ 5GAEJ 3IRRA 1HKSA 2Z16A 5EEHA 3T5XA 1WZ2A 1U9NA 3PJRA 3D0SA 3RPQA 5BS6A 3OYDA 2OJED 3KEQA 4E7LA 2VUMJ 2FOKA 3HM5A 3OYBA 3S1MJ 1D8KA 2K9LA 2M8GX 4XN3A 3RSNA 1RUNA 4Y3OA 1OYYA 4GYIA 1R23A 4BBRJ 3GXOA 4L9NA 1T0FA 2Z99A 2OTJI 2P0WA 3F8FA 3MZHA 4RB0A 2CGPA 1FTTA 1BR2A 3FKJA 2VT3A 1TP4A 4M3EA 3B6CA 1D1AA 3CCMI 2IBDA 4ENKA 1ON1A 1F43A 5IP9J 5LBQA 1E17A 1U8RA 3NRVA 1TQPA 4I98B 4I02A 2ZSIB 1SMYF 3A1YA 1YHQI 3CUQA 2IAIA 4IKFA 2Q2EA 2CW0F 2DK8A 2KLOA 3LSHA 4E7HA 2EWNA 5E8IA 4XRFA 3DPUA 3SHFA 3IRQA 2E1MC 4PCQA 1TT5B 2R0QC 3EYYA 3FISA 2F5DA 4XMYA 5LEKA 3F3XA 4I0BA 5EZGA 4GFBA 4LOCA 2OCEA 2STWA 3IKTA 2Q1ZB 5D6FA 5DUKA 3HSEA 4C3HJ 2M4KA 3GTJJ 2OZ6A 3DEUA 3OYHA 1TTYA 1R71A 4ZZLA 2K86A 2BXYA 4FHTA 3MQ0A 4FT8A 2RV8A 2NS0A 3CMEI 3BTJA 4V2FA 3IKVA 1ETOA 2ELKA 1ZRFA 3J7AO 2HFHA 1P6RA 1XMKA 2IGKA 3NWTA 2DA4A 2LY9A 1WSUA 5E3OA 1NH3A 2XHKA 3ZMTA 4PSWA 1K4TA 2ACJA 1YYVA 2F2EA 2QZ8A 2CRGA 2VKDA 3PFYA 5IY5H 3DEWA 2MH2A 2QVOA 4OIPF 4DQ2A 1J59A 1AKHB 5EYRA 2GWRA 1B9MA 1VTNC 1ORKA 2R7XA 3FXMA 4S04A 4KIFA 4BH9A 1BJZA 5J4VA 1W5TA 1BL0A 2LREA 4O3MA 2HVRA 3O8HA 3QOPA 2YUSA 1MJ9A 3H5RA 5GAHJ 1K4SA 1VF9A 2LP0A 4JX4A 2R7WA 4HLXA 3KPHA 3RQ4A 5B3SH 4J01A 1BI2A 1P4XA 1JHHA 1B9NA 3QPLA 2L5QA 2MFZA 2VL8A 5JVTA 2KQRA 1D5YA 3FMSA 4RB1A 1MMSA 2VC0A 3HRUA 3QU6A 2W7NA 5F1JA 1YJNI 2XAQA 3GWZA 3HKZN 1RPWA 5HS7A 1HLVA 3LWFA 3M8FA 2JJ7A 1FLIA 1WI9A 3SZTA 3BWGA 4JQFA 4CH7A 2ICWG 2L02A 2X85A 4O6JA 1S72I 3CJRB 2CMPA 3DFGA 3U1DA 3MAJA 4PJLA 3MKLA 3WGHA 2W00A 3CLQA 4EM1A 1ZG1A 3KYCB 4BS9A 2R7QA 1U5TC 1R36A 4UV8A 2V6EA 3KP4A 3PNVA 4XR6A 1Y6IA 4Y17A 3S93A 2Y9ZA 3E6DA 2HQNA 3Q0WA 2W57A 2MLGA 1V54H 4XLFA 5DCMA 4WF2A 3E5QA 3K4CA 3HIFA 1B8IA 2LOOA 2H1LA 5A2QK 3F23A 2HQRA 1HDDC 3CMAI 2K4JA 3HC7A 1FYLA 2GXAA 1MMAA 3KIOA 4F55A 2QBYA 1T8IA 5E1WA 4DBQA 4A0ZA 4QPQA 2W1OA 3SXYA 3LA3A 1B72A 4GDFA 1J9IA 1A31A 1TWGJ 1GVJA 1OPCA 1IV6A 1IXRC 2VJ5A 2O5RA 2DU9A 3JRBA 2L01A 2HI3A 4N4OB 2R7DA 2QQBA 2QWWA 3I59A 2XAGA 2X6XA 5DDGA 3S2WA 3PUFA 1XN7A 3OL3A 3F8CA 3K10A 2JA5J 4CSWA 2KIMA 3DPTA 3CCLI 1VQOI 1D0YA 3ZQHA 3KEYA 2JSPA 3MKYB 1IRXA 3JTHA 4BYYA 1HC8A 1JKQC 1R1TA 2FQ3A 4Y33A 3T8RA 2IW5A 1R5GA 3IH3A 5EEAA 1VFCA 3GYHX 3HOZJ 1L3LA 3WE3A 1K78A 4C3IJ 3WU0A 1GT0C 2M7AA 1MGTA 3J80K 3BG7A 3BZ6A 1PUFB 3DCFA 3H35A 4A5NA 2MG4A 3EDPA 5IYBJ 2DO7A 1DDNA 2VE8A 5TJJA 4DZJA 5BOXA 2FBHA 1TC3C 3A0BC 3PNYA 3H3UA 5DCFA 4YEJA 4RB3C 1FZPB 2DJIA 1HQCA 1U8BA 2KRHA 4A3FJ 1IDYA 2KPMA 2LD5A 3HB9A 3E5XA 1MNEA 2Z3YA 1LEBA 2X6OA 2FUG2 3ABTA 4ZTJA 1H0MA 3OS2A 1MBEA 4A3CJ 2OUMA 5D5VB 3BCBA 1P7JA 2JT1A 1YO5C 2L3DA 5IOZA 4JP0A 2QUFA 1SVMA 3ROUA 3UNGC 2RREA 3WG9A 2FEZA 4ETSA 4Y52J 2M34A 4A69C 1RR7A 4XRMA 2VJJA 4YFKF 4G6TB 4L5IA 2ZMEA 1YW8A 2FQ4A 3FK7A 2P7VB 3P7NA 4AIDA 1ZYRF 1ITYA 2DMNA 1FMWA 4MFEA 3A2KA 2ZBKA 5FLXZ 4KN7X 1QPIA 3J81K 2A05A 2KT0A 2M8EA 1W7PA 1D1BA 2D1VA 3K4JA 1LFBA 2Y30A 3BJ6A 2L2OA 2VKHA 5HLHA 5ICEA 5E3NA 1FJLA 2GQQA 2V1NA 2KJCA 1R4NB 1R9TJ 3E3VA 4HZFA 1Z9CA 3BLYA 5D6EA 5KK1A 2K9QA 3KFWX 1YI2I 1TW3A 2CQNA 3M07A 1S7EA 4WK8F 3M1CA 2BYVE 3FKIJ 2MGQA 2HEOA 1H88C 2NVQJ 4XLPF 1BW6A 1J5YA 2GAUA 2HS5A 1EF4A 3C18A 2VXZA 2KL4A 4BXFA 4ZYHA 3K1NA 4XLAA 3V8KA 1G3YA 5E8GA 3KLOA 2HYFA 4CCLA 2DQLA 1HW2A 1RI7A 2UXNA 2ADUA 2VT2A 1EH8A 1SVOA 1WHUA 2ZXJA 3BR6A 3IHUA 3IWFA 4BHCA 1FBQA 1RZ4A 2Z5UA 1H8AC 4XKBA 4HQMA 5FRMA 1UHSA 2HU9A 4AIJA 3I55I 1XPXA 3B73A 3T0YA 4HBLA 3K70C 2AQFA 3L9FA 2M5WA 2COMA 3PM1A 2E1MB 3L2QA 3B02A 2RNJA 1R7JA 3I9V2 3WTSC 2VBZA 2VOPA 3F21A 3QRFF 3DBHB 3S1QJ 3JRIA 1D0XA 1S8NA 2E36A 2KMUA 4XL9A 3BY6A 3PNTA 1UAAA 3CF5F 2R5YA 1FEXA 4ENJA 2G7HA 1IGNA 3L7WA 4OMZA 2BV6A 3KETA 3ZQCA 2TDXA 2EK5A 1CF7B 2V9VA 4ZYGA 2YSRA 3SFZA 4AYBA 3BT9A 2DI3A 5CQEA 3QAHA 2ID6A 3GZ5A 4KT6A 2L9RA 1W1WE 1ZGWA 3DV8A 4OOIA 1SFXA 4AVPA 1JTXA 1YG2A 2Y2ZA 2XGCA 2WV0A 3D5SC 3EUHC 3OYIA 1ZGJA 5CPRB 3Q5FA 1JHFA 1T08B 1GV5A 2EB7A 1HKQA 2LTPA 4KNYA 4M6XA 3JREA 2Z33A 3I53A 1Y0UA 3VPRA 1HW1A 1P9QC 2LFBA 2OU2A 3BR1A 1UMQA 3HOSA 2NVYJ 1GV2A 2K3FA 4GYGA 4OINF 2XPUA 2CW7A 2P7CB 2E7XA 1XSXA 5L3CA 3Q3SA 1V55H 2F4OB 1W7PD 3VFZA 3S1NJ 1O57A 2MD0A 3E6BA 3HZJA 2PJPA 1OCZH 2QKMB 5KNLA 3OSGA 3GLLA 1OJLA 2CSOA 5D4RA 2WTEA 1BC7C 2UXXA 5FFZA 3V7CA 3CCVI 1NK3P 2AS5F 1PDNC 3F72A 1NK2P 1U3EM 1KU9A 4KT5C 3LL7A 2RQQA 3AG1H 2O3FA 2GM4A 1ZREA 1OCOH 3QP5A 5GP9A 1OQYA 2ELHA 2AXLA 3DXJF 4PJMA 3R6SA 1VQ4I 3DTKA 2M0CA 1S6LA 3TOBA 3E6CC 1AWCA 1YTYA 3OIPA 1IN6A 2CS3A 4A12A 5IT9Z 4ZH4F 5E1ZB 1GLNA 5LHGA 2XAJA 3GTLJ 3ZGKA 1G2HA 2A5WA 1MDMB 3C3WA 4YRVA 2DT7B 1U5TB 3OYAA 3GTPJ 1TZLA 4RLQA 4L0ZB 4EVIA 1V5FA 2L9SA 2R7TA 3LQQA 2K9NA 4KICA 3LSRA 1TLHB 3HOVJ 3ZMUA 2H8RA 3R60A 4OWRB 3KEOA 3O8GA 2MABA 5DM7F 5M3FJ 3OYKA 4J00A 2K7LA 1JGSA 4Q47A 1QA6A 4C2UA 1N78A 2EFNA 2GA2A 4KA4A 3H92A 5C4JJ 5L3EA 2RDPA 3DF8A 4W1UA 5LEJA 1KQ0A 2IA2A 4YFXF 4M3GA 1SC7A 3JAMZ 3FZVA 2CUZA 3S3OA 2TRTA 4MIMA 1G3WA 2OA4A 4DW6A 4M74A 4LITA 5FD5A 1RR8C 4BDYA 2X0LA 1YX5A 4UUTA 4ZDOA 4IHXA 3DTIA 5ILVA 1BR4A 5GTIC 4Z6YA 2LKXA 3ZMVA 4BHBA 1LEAA 2JPCA 1ACIA 1LFUP 3KP7A 3RQIA 3HOUJ 2HVSA 3DKYA 4LG3A 4M9SA 5EGOA 2UUZA 1T56A 2L9VA 1YW7A 4NC8A 4B47A 4NC6A 4AD9A 1ZQ3P 3LA2A 3LA7A 2F5EA 3SQNA 4EJTA 4AWXB 1NTCA 2EA2A 1VQ8I 5E79C 3WE2A 3VB2A 3TMOA 4I2OA 3JRFA 5C4XJ 1MMDA 5EZHA 5KAFC 3J80Z 1MBGA 4WCGA 3ESWB 4ZZDA 3U21A 2B0LA 2NS7A 4BGDA 3CCSI 1Y1VJ 3M9AA 4IEJA 2Y0MA 3BDDA 4AYBN 2FRHA 1STZA 3MZYA 2LBFA 2AXTC 2HOTA 1QHHD 5LRSA 1O7LA 2DMTA 5E17F 1D0ZA 4E4HA 4WXCA 3VSLA 4UB6C 2KKOA 4H4KC 2ZFUA 5IYCJ 2KDZA 2D5VA 1YRNB 2E7WA 2EZIA 2FE3A 2PN6A 3K4LA 1Z67A 2PMZA 3LSJA 4DNCA 1YITI 1IV8A 1MMGA 1SFEA 4MHGA 5D8LB 1GVDA 2VJ4A 5HLTA 1Z3XA 3E5UA 1GXPA 3ERMA 2E1CA 5FD6A 1RESA 4DJAA 3H9QA 1KYZA 1FBSA 4BQOA 3I5UA 1Y8QB 4QSHA 3OYEA 1WJFA 2FF4A 2X1DA 4IOAF 4BE0A 3CCQI 3H0GJ 1GHCA 3HHHA 3K6GA 3LSTA 2XB5A 3FXJA 4HNVA 2EIKH 3MZ8A 1YS6A 4RB2C 4Q5SF 2R3SA 2WAQA 2ZXHA 3J81Z 1IUFA 4IRIA 1B6AA 1MJBA 1QZEA 2BXZA 3DLAA 1BR1A 3HRSA 1HW5A 2W85A 5ILUA 2XF5A 1KA8A 3IV5A 5FRNA 4BQNA 3H3VK 1ZELA 1YJ9I 4CUGA 3ERED 1WKMA 1U78A 2X6WA 3BTCA 4I6ZA 2VPRA 2EPFA 3AL0C 1BIAA 1A04A 2CUJA 4M6YA 4Y4RA 1RETA 1G6NA 1X3WB 3QYEA 3OYGA 2DPUA 4LMYA 2MLKA 3FF5A 2HDWA 2HVQA 4XKWA 1G3SA 3I56I 3G73A 3R0AA 3D1NI 1XS9A 2MW8A 1XCBA 2BVLA 3WTTC 4EATA 4XLHA 1LVAA 4I0AA 3JSOA 5J40A 1HSTA 3K4KA 4HA8A 2EZLA 1BOAA 1WCMJ 4ESBA 5IOYA 1ETWA 4EMSA 3HTUA 2FSWA 3GVAA 3KCCA 3ZOBA 4AM3A 2PJRB 1QQIA 3SEQA 3T1BA 3VYTB 3HPHA 1M1EB 1KU3A 1MNDA 2FBKA 3S3MA 4MNUA 1X1PA 2DDBA 3HTSB 1MH4A 3BROA 3I54A 1UCRA 5DD4A 5JI6A 4A3JJ 2O9LA 1LVKA 5J8FA 2XF6A 3F9KA 1P4WA 4RAGA 4BE1A 3L1PA 4BAYA 1LNWA 3GUDA 2OQRA 4DYQA 4Y13A 3RKQA 5BPDA 1X58A 5EEGA 3LNQA 2M30A 1MD0A 2IS1A 1R1UA 3RPUD 4HQEA 2FD5A 5K1YA 3CJTB 1TW2A 3GFMA 4IPAA 1SD4A 1ZG3A 2CYYA 2R7SA 3UR3C 2V1XA 2OTLI 1J0RA 2DTZA 2VJIA 4PJJA 1J75A 5L3DA 1VQKI 4NBQA 2DCEA 3A01B 1X1AA 2ISZA 3WTVC 3AG2H 4CO8A 1FTZA 3S1RJ 4W97A 4IOCF 3ABLH 1GDTA 2BHZA 1FP1D 4NQWA 3I4PA 5LGTA 2LRDA 2VODA 3LAJA 2JUGA 4DBRA 2EILH 4HX7A 1PYVA 2RC4A 5CYVA 1DQUA 2L7ZA 3BTIA 3ZMDA 4G94A 1Q1VA 2CO5A 4FISA 2VOOA 2B63J 4G7HF 3VOEA 3MN2A 3H3ZA 4LD5A 2LF7A 3VEPA 5C44J 4M72A 3W6VA 3G1LA 2KDOA 4B43A 3U9GA 1F9NA 4BXUA 2OD5A 3EPZA 4CCMA 3VYUB 1ZTRA 5HS9A 4BJ5C 2EZKA 4E6KG 3BR0A 3CF2A 1EJ9A 3EYIA 2EZHA 1JJ6C 3Q9SA 2DA3A 3K1PA 5H6RA 4IHTA 1X4OA 2A6EF 3G71I 1OISA 5LGUA 4EGYA 3CO6C 1L0OC 2HKXA 2WAEA 3CDHA 3SDBA 4AC0A 2VONA 3OYMA 2QGUA 2J5PA 2XC7A 1UG2A 2DFEA 1SFUA 3CC2I 1YQAA 2HZDA 4LK1F 2F4IA 1D3YA 1SD5A 3JRHA 1ETQA 2ZKZA 2XAHA 2ZXWH 4ZYDA 5CKTA 2DW4A 4DZPA 1O3RA 3BJOA 1VQ9I 4ENNA 5F04A 1ZHFA 4DIQA 1ZR2A 2V7FA 1T2KA 3MKZA 2UWMA 3J7AY 3VDXA 2Z1DA 3GFLA 5F08A 2VLAA 3WG7H 1SAXA 3BR5A 4KMFA 2VQHA 2FNPA 4XSZF 5F0HA 3G6EI 4ZYAA 2CWEA 1S9HA 2P4WA 2HNHA 3FWEA 3IAS2 1JT6A 1RRJA 2LK2A 2GLOA 1FOWA 1FT9A 3I3LA 1RUOA 1WH7A 2IA1A 2RKHA 3MMYB 3OY9A 3IP4B 3MWMA 3K7AJ 3LAPA 2QENA 4UNOA 2E5ZA 3EUAA 5K5OA 3DKXA 4O5VA 1R22A 1Z0XA 1SFKA 1OKRA 3WU2C 1BI0A 4KISA 3Q0VA 4PK4A 2CFOA 4L18B 3OYNA 1V5GA 3C2BA 2QEXI 5FKNA 2E19A 5EG0A 2HZTA 4IHVA 5GPAA 4BQQA 2GZWA 4EV0A 1N25A 3ABMH 1ODDA 5B1BH 4F52A 4UUSB 1RKWA 3W6JB 4HDVA 2EA4A 1B4AA 3CLOA 2B9SA 3C7JA 4V19K 2DDAA 4NNJA 4MEXF 3JRGA 4J19A 4C2MJ 2Y48A 4B09A 1MJAA 1AA7A 1F4KA 1NG7A 3GX4X 4A93J 2M0MA 3K4BA 4C9YA 1K6OA 1U5TA 2ME0A 3FXKA 3HRTA 4U0VA 1OYIA 2LC2A 3BG5A 2ECBA 2ZNYA 1IF1A 2QKLB 2O03A 1O7FA 3CJNA 5DYMA 4G6QA 3OS1A 2CFXA 3OYCA 1ZARA 2PI0A 3W2WA 2DT6A 1XSVA 2PLYA 1W4MA 3FMQA 3OWTA 2K3PA 3MCZA 2DFIA 2Y0SA 1KZHA 1I39A 3CZ6A 2ZC2A 3N4MA 1U0JA 4HAMA 2UV1A 3BG3A 3L00A 5F0CA 1JXSA 5JHFA 2XPWA 5JHUA 2EFOA 1ZH5A 2L4MA 4U87A 1S5LC 4D7NA 2VQLA 1EV7A 2OPTA 5DEQA 4M73A 3NWSA 1OFCX 5ICCA 1OR7A 1DPUA 4KUMA 2P5KA 4RGUA 1R1VA 4UXNA 2WV1A 3D5LA 4BJTA 3AKZA 2IPQX 2XRLA 5IYDJ 1WWXA 2DA1A 5CQGA 4CYCB 3BG9A 2OF7A 1UZCA 4RM3A 2LG4A 2XSJC 3E6MA 4XONA 3TO9A 2LR8A 2IJLA 2YX7A 1LDJA 3TO7A 2W82A 3FXLA 5HDKA 3L09A 3FM3A 2RQPA 3ML6A 4E7KA 1MZBA 1E2XA 1OCRH 1POGA 3HG9A 2ZMEC 3Q9VA 1UHMA 1WRJA 3BP8A 3K0LA 4JYKA 4L5JA 4MO7A 2XSDC 3ZQLA 1LUJB 2EH3A 2F48A 4KN4X 2YU9J 4D1QA 4FTHA 3KP3A 4BEHB 5HLGA 1LE8B 2M45A 5ICGA 3K4MA 2XIGA 4FE7A 4WXHA 1N75A 2VBXA 3QQAA 2IGOA 5JR3A 4M6VA 1I3AA 1Z05A 3AL0B 2BY3A 5BQTA 3I64A 4U0YA 3O3KA 3HOWJ 4IO9F 1QNTA 3CESA 4JBAA 1WFXA 4XLCA 4XIDA 2A5YB 5B66C 3G4SI 3C2GA 3WTZA 2YS9A 1DU0A 1WJAA 1TNTA 4D5FA 2NRAC 2FMLA 4GRIA 3CMYA 1E3HA 2QSGX 2ETHA 1OCTC 1EA3A 5FLMJ 2DOFA 1XTAA 3K4NA 3OOPA 1FX7A 5E20A 4IHWA 4XNFA 4RS8A 1ERDA 1JT0A 4JX6A 2IA0A 5FJ8J 1REPC 1IW7F 4LG0A 3S3NA 5TGTA 3WTWC 1MH3A 2HGCA 1Z7UA 5E1XA 3TOAA 5EJCA 4II3A 4BKXA 4L0YB 2H8WA 1R6RA 4ZDLA 1IRZA 1SAUA 4WX9A 2EQRA 3LSGA 1PVEA 3GTGJ 4AUXA 2AO9A 2Q2EB 1A5JA 3FHNA 2R5ZA 2GA1A 2WY8Q 2WY7Q 1C0WA 2X9DA 1OCPA 3QPTA 1HKTA 3V8LA 1Z91A 5FB2A 3S8PA 4LIUA 2R92J 1WJEA 4LB5A 2KZVA 2XB0X 2RNGA 1WH5A 1FMVA 1SVLA 4S0HB 3IL2A 4LLGF 1JJ8C 5E3MA 1USTA 2LSOA 3GCMA 2VBWA 2C6YA 1I1GA 3OL4A 3L2VA 2GOMA 4CZZA 1VI0A 2XASA 4RGSA 3ZQIA 4HLYA 4TV7A 3ZMSA 4MGRA 2E2HJ 2BGCA 2DLLA 4DYCA 3TBIA 2NVUB 2H09A 3QU3A 2K40A 3H5AA 3QWLA 2Q8KA 2ZJRF 4A3IJ 2ZJPF 2V26A 2UZKA 3SDGA 5IPAA 2R4GA 3GO5A 2MC3A 1FYKA 2F5FA 2PJRA 4C30A 1Z6RA 1TWHJ 1FWZA 2FMYA 3FMRA 1YIOA 2ECCA 3R61A 2VKVA 1I1SA 2DBBA 2PG4A 1F1ZA 1WJ5A 1XGSA 4MLOA 4BNCA 3GMEA 4NUBA 4LGWA 1VQ7I 4PFPA 3E7LA 2I5UA 4G7ZF 3IWZA 4IQJA 1A36A 3JW4A 1XMXA 4P55A 4OAZA 2L54A 4K2EA 5F1RA 5C3EJ 1IO2A 3GBGA 3ZN0A 2DMUA 3A01A 1FNNA 2DA6A 3ZXSA 4PGGA 2XGDA 1D8JA 4BUPA 3DEEA 2BVMA 2AQEA 2KRFA 1KYWA 4BU2A 3RI4A 4YIFA 4IXAA 3W2VA 3MKWB 2RGVA 2LYCA 3KYDB 4V2GA 1ZRDA 1FY7A 3AG3H 2W25A 5CVVA 3EUHA 4P5OA 3H0DA 3FIWA 2NNNA 5D5UB 2DYRH 5FO5A 1V5EA 4LJZF 2NVXJ 1Z77A 3HBLA 1XGNA 2CQXA 4E7ZA 2VI6A 3TW7A 5AIQA 1G4DA 1K7AA 3CCJI 4CHUA 3MFKA 3BR3A 1P92A 2EFPA 4B4CA 1XDUA 2RVCA 2IVMA 5K7FA 2JWTA 1T38A 4KIBA 4G7OF 4RDUA 4EQQA 2EBIA 3RKYA 1G8XA 2FBIA 3LFKA 3O6BB 1ZLKA 2L9NA 1AKHA 3R4KA 2XKOA 4EM2A 2DOAA 1FBUA 5DCMB 5DV5A 1TWAJ 1MBJA 1NG6A 1B8IB 3RTRA 4UY8I 4IJAA 1XX5A 2E1NA 1B59A 1IDZA 1LDDA 3LOCA 1IN7A 3FXUA 2HXIA 3GEZA 2QBYB 2P6SA 1YIJI 2W4SA 1JUSA 4HF2A 2R7UA 1DP7P 4LFUA 5A2QZ 2JA2A 5TRDA 2K5CA 4XICA 4XLNF 2FU4A 1B72B 4U7BA 3GFIA 1N77A 2CV0A 1V3FA 2M4GA 3RYRA 4N4NB 4OMYA 2ESHA 2XAUA 3PSFA 5GPCA 1AOYA 4HG2A 4CZCA 2V6CA 5E3LA 3KZZA 2VE9A 1B1BA 1AU7A 4HW0A 1JKPC 3F8BA 3GTKJ 3QP6A 3OV8A 5J4YA 3HHGA 4MTEA 3LSPA 3EUKL 2K4BA 4IX7A 3X2QH 3K70D 4I76A 1MW7A 2V9KA 1UB9A 1HA8A 1MBHA 3CQZJ 2BE5F 3VODA 5GTHC 2OV7A 5DUIA 3IUOA 3H1CA 1A35A 3U1KA 5H6QA 2XGXA 4HNUA 3BZCA 1R58A 2PFBA 2A07F 2COBA 2PMHA 2CQQA 5J1YA 2Y69H 4KJZA 1DGRM 1X4PA 1Q1HA 1HF0A 2I10A 4RGXA 2DPDA 2QA4I 3GZNB 4Y15A 5ERIA 2KIUA 1VQNI 1T6SA 1U6GA 5E18F 3O2PE 2IEKA 4P96A 4U0WA 4UUSA 3I71A 2BHYA 5K7HA 4X1EA 2XUBA 4UVCA 1SMTA 2K9MA 4G9YA 1T95A 3RPUA 4RAYA 1V4RA 1PUEE 3QOEA 1QVUA 4RMNA 2DFFA 1RKTA 2HQ5A 4KFCA 3HYIA 3OIQA 2NOJB 3HSFA 4M3FA 1H9GA 4Z2YA 1MBFA 4CCKA 1FOKA 3FDYA 4P9FA 4PFOA 3A0HC 2TCTA 3QPSA 4I09A 4QPOA 2CV1A 3WHBA 1FIPA 3MD2A 2XGEA 3WU1B 2CJJA 1SFOJ 1Y8RB 3TEDA 3RYPA 1BI1A 5H2FC 1QPMA 2JMWA 5D8KB 3CMMA 2H6BA 2HPMA 1JI8A 3IAM2 3ISPA 3BG6A 2ZMEB 4BXXJ 2XPVA 4XOTA 2ZFWA 4F92B 5FKLA 3ZCOA 4EM0B 2D1HA 2JSCA 3FXRA 3JRAA 4ZTFA 1FOXA 1ETVA 1X1DA 1ZAOA 4EJOA 2LMDA 4A5MA 1AHDP 4BQAA 4NHJA 1Z3YA 4XRSG 2IXSA 4ZDPA 2FJ1A 2ZCWA 4DOZA 1ZRCA 3KP2A 3SYTA 1PUFA 5ICFA 3DPLC 2DK5A 4RA2A 1OMIA 5L3BA 3RDIA 3AFHA 3T8TA 9ANTA 1PJRA 1BI3A 3CC4I 2DMPA 1A6IA 2H6CA 1W36D 1ETKA 4L9TA 2L4AA 3MVPA 3G2BA 5HOOA 4BACA 1ZKGA 5B1AH 4FX0A 2DAOA 2ZJQF 2EV6A 4P1WA 3FXOA 4GGGA 3BQYA 3P9KA 4MEYF 3DBRB 4ZYEA 5M5YJ 3W2AA 3HKZA 2XV4S 1K83J 4RAFA 2CQKA 1ZG5A 1KU2A 2LH9A 5AONA 2L7FP 4U7DA 2A3SA 1LFPA 3ZQ7A 4CCOA 5CJ9A 5EDNA 1F5TA 5FLXK 1W5CC 1KU7A 2FX0A 3VYSB 3GTMJ 1T0FC 2M9HA 2DQRA 3FBNB 5FKMA 2HXOA 4IL6C 2OQGA 3KZYA 4XN0A 1SD7A 3HL2A 4HSTA 1PP7U 4UB8C 3ZQGA 1LDKB 4PJ0C 5FGMA 3TQNA 3CCRI 2R5YB 1MNMC 2NXNB 3CUQC 1VNDA 3P9CA 4HF1A 1FIAA 3SJMA 1I6XA 2HR3A 1S3JA 2CQ7A 2K27A 2KIFA 2QQ9A 5FKKA 4UVAA 2CUFA 5HNFA 4AU7A 1JGGA 4HNTA 5H20A 4JOMA 4E7SA 3KLNA 2DMQA 4R1HA 4A0XA 1FOYA 3HJEA 1XMAA 1WQ2A 2P8TA 5J6XA 2MA3A 3J7ZI 5BMZA 5LHHA 4IZZA 2VB6A 1EH6A 2EFQA 5DTDA 5IP7J 3JTGA 4HPQA 5FLVA 1GXQA 4GXOA 1TWCJ 3GTOJ 4L9JA 1UG0A 1WGXA 1WJBA 4F7ZA 2CG4A 1XD7A 3P5JA 5JVGF 3I4MJ 4YIIA 5CVUA 4FETA 2QQAA 2E71A 1I3QJ 3F0CA 4B44A 2A61A 2X4HA 2OC6A 2Y9YA 4HX4A 1RC9A 3A03A 3WTYC 4CGZA 4XSXF 2QF7A 2LLKA 2BW3B 2KP6A 1W0UA 2X1CA 3NARA 3TW6A 3A02A 2HQAA 2H1KA 2RN7A 3OOUA 3GZ6A 3FK6A 3K2AA 1R5ID 1WVRA 4ZJZA 3R0JA 3RZDJ 4KDPA 4N9IA 4HRIA 1E3PA 5J1UA 5GAGJ 1XG1A 4UUVA 5CLSA 1UHWA 5BNGA 1MMNA 2HTJA 4PDKA 1DGWY 3C1DA 1G59A 3OSFA 1YE9A 2KFDA 5J8CA 4XORA 3V7RA 1O3TA 1TQIA 4HOBA 1MKMA 1GUUA 4A3EJ 3CC7I 1JKOC 5K7ZA 2PMZN 1EH7A 5L3FA 2EJRA 3I58A 5HVQC 2JRTA 2F6CA 2EV5A 3KX2A 2ELJA 4KITB 1CF7A 3GF2A 4YELA 2HDDA 3FX3A 2H27A 4FCYA 1Z1DA 3HUGB 1OLTA 2NVTJ 2IGNA 4R8HA 2JVGA 4CICA 5JLXA 2VKEA 5CVIA 2HPIA 2XKPA 3KYLA 2EV0A 3HPGA 1DPRA 3N97A 4JK1X 3S2DJ 2WAQN 4XBFA 1P4AA 2G0EA 1X3ZB 3ZN1A 2JK3A 4Y7NJ 5KCMA 1VQ5I 3PQJA 4LK0F 1SD6A 2A6TA 3F8NA 5ED4A 3S15J 2DJNA 1XGOA 2CV2A 4PSXA 1BM9A 3EQLF 2H94A 3J7YJ 3GW2A 3HOTA 4G8XA 3EETA 2VC1A 4B1RA 5J47A 2D45A 2BBYA 4S05A 3P9IA 4MQVA 2EIMH 1HDPA 1ZGAA 3PUBA 1IJWC 1A6QA 2KZGA 2Q0OA 3CDLA 3PSIA 3TO6A 2V1UA 2LY1A 1DU6A 3ELKA 4PZJA 4XLEA 4CYDA 1K61A 1VQ6I 2IT0A 3K69A 3DBLB 1UFMA 2G9WA 5IT9K 5K5QA 3TGNA 1LB2A 2D2WA 2GIVA 1BJAA 2IP2A 1HCRA 3V4GA 3HGGA 3C2HA 1ONVA 3ZPLA 3ULQB 5EGOB 5BPIA 4NDLA 4WWCA 2E1OA 4MQ9F 3S17J 2VIXA 4XOPA 4KMUX 4YG2F 1ON2A 4KIGA 3K1MA 5LHIA 4FQGA 1MDMA 5CVRA 2OCCH 4BBSJ 1Y0NA 2X51A 3BPVA 1Z7LA 1CGPA 1WI3A 5F0FA 3L2CA 1QVTA 1U2WA 2M1BA 3DU6A 1W5SA 3NAUA 2ME6A 3RJPA 2WAFA 1HSJA 2A6HF 3QODA 2E34A 2VASA 3JAMK 3CP8A 1I50J 2ZSHB 5F6FA 3LMMA 4RLFA 3HSRA 5DM6F 2CW8A 3DU5A 4BL0B 3S14J 3HOYJ 3QYBA 4EJUA 4ENMA 2RAEA 3ZMZA 2LBFB 1TBXA 3OIOA 2LVSA 3HGYA 2R7RA 2FOWA 1ZN2A 3WGIA 4KYWA 2DN0A 3E0JB 5JFRA 4QLCU 1QRYA 4OAYA 4RM2A 1OR7C 3DLLF 2CU7A 3W3CA 2JRMA 1MSEC 3MEXA 1QO0D 4HV6A 4JX5A 2L7MP 2ZXIA 3NEUA 3V42A 1VQMI 1XDSA 2DODA 1SEUA 1U9OA 3S32A 5B5EC 1R49A 1IRFA 4UV9A 1I6HJ 1IRGA 2EFWA 2BY0A 4XKCA 2DA5A 2JA7J 5D5XB 3LQRA 3ZQQA 4I7HA 1P7IA 3V8JA 4YFNF 4FE4A 1LPQA 1J09A 2YPRA 4LLNA 2DT5A 4E7IA 4XRSA 2OAZA 2F4MB 3WODF 3Q0UA 2LY2A 2EIJH 3A4CA 4PUSA 3LSKA 4L9VA 2V9PA 3JSPA 1Z6TA 1O3QA 4XK4A 3JRCA 1KGSA 1XC5A 4U88A 2PMUA 1FSHA 1USSA 5L3GA 4L5EA 3IC7A 4CCJA 2ID3A 2FA5A 4ESJA 4A3GJ 2ESNA 5DD8A 5DS9A 2GXGA 1TL8A 2I8DA 4OIOF 5HDGA 1JUMA 1IC8A 5KHDA 1MIJA 3I4NJ 4HYEA 2E2IJ 1YOVB 4GCVA 5FKOA 2JN6A 3SEZA 2WBMA 1BIBA 4H0EA 2HYJA 1QGPA 1YRNA 1XGMA 2O8KA 1APLC 1QZZA 1JTYA 1IXSB 3JR9A 3H9GA 3GLXA 3E97A 2MSYA 2MYSA 2R93J 1E0EA 1MSFC 2DTRA 3AG4H 2OBPA 4B3AA 2PEXA 3LSIA 3LFUA 3RCOA 2IGMA 1ETYA 3IH4A 4EJWA 4WXDA 1IAWA 3KE2A 2WB1A 2PX9A 3I0TA 2K85A 2M3AA 2KISA 5AIPA 5HS8A 3ASNH 2ISYA 2PQ8A 3TDUC 1Z21A 1Y56A 2J5OA 3DTEA 4D9JA 4BE2A 2Z9OA 1QZYA 3TKYA 5IP6A 2HWVA 2X6YA 2QYOA 2XAFA 3CUQB 4B3XA 4CDGA 4EEFG 4FASD 2FXAA 1BOBA
chains in the Genus database with same CATH topology
4HDUA 5LGNA 2P5VA 1IXCA 3DQVC 2NNYA 4B8XA 4ESFA 2ZJ2A 4A6DA 4PGHA 4IRHA 3BOQA 4UVBA 2O0YA 1R5HA 4HF0A 5K5RA 1FP2A 1NHAA 3ECOA 3CO7C 1IZ1A 3F6OA 1S7OA 3M7GA 4A2UA 5KVRA 1QBJA 1J2XA 4LLLA 1IN5A 1BC8C 3ZP5A 2MD5A 4OIRF 1HBXG 2YR2A 3DKWA 3WTXC 2XVCA 2KJBA 4RAZA 2GXBA 3K9TA 2P6TA 3REOA 4E70A 1G3TA 4CXFA 2HTSA 5CVJA 4GO1A 1FSEA 2LKPA 1DUXC 2IRFG 2HYGD 2HOEA 2XRNA 3K2ZA 1PP8F 1BBYA 1TQMA 4OIQF 2OZUA 1KQ8A 4BHPA 3RKWA 5LLQA 1I5ZA 2QM3A 1RNLA 1OYWA 2M87A 1ZLJA 1P2FA 2W24A 3M1EA 3WTUC 4RGRA 2O6GE 4IHSA 3F6VA 3KP5A 4FX4A 1K79A 3U2RA 5IT3A 4QWQA 2HDCA 4Q48A 2F5CA 2ZO4A 1IN4A 2YU3A 2W84A 4HX8A 3COAC 1T39A 2V1DA 4A6EA 4Q4ZF 5D5WB 3CUOA 4A0YA 3HUGA 3DP7A 1FPQA 2LNBA 4M9XA 1FC3A 3F22A 3PQKA 2MH9A 2QLZA 4NB5A 1ULYA 2P5LC 3I59B 5ILSA 1HXDA 2YX4A 5F64A 2WC2A 2LF8A 2V79A 1YW9A 4M71A 3V7SA 3HRMA 2BEOA 1XSDA 5HDNA 2STTA 4N9HA 4IRGA 4HV5A 1K78B 2PBIA 3M8EA 1XB4A 1LJ9A 2G7UA 4IF4A 1H9TA 1XCVA 4M9ZA 2JPBA 2XROA 4N0BA 1BN5A 3ECHA 4IVNA 4G6DA 3RIRA 3GFJA 2O8XA 4ON0A 2O61A 2A68F 3NQOA 2NAZA 2MBFA 3AAFA 3QPHA 4I01A 2A69F 2JTVA 2ZNZA 1LQ1A 4D0PA 4OU0A 1RIOH 1S7AA 3BJAA 3BPXA 1X3UA 2VBYA 3ABUA 1TNSA 3PFIA 4P9UA 1O3SA 1YLFA 1W7PB 3TDZC 5D4SA 2JZYA 3FM5A 4LB6B 4EGZA 1FYMA 1IN8A 4AIHA 1YS7A 1I27A 1IUYA 3SZPA 3RKXA 4MTDA 3KP6A 1S29A 5HLIA 5LRRA 3WGGA 1YFHA 2NYXA 2K02A 2HKOA 4LG0B 1JE8A 3FHZA 4ASNA 2Y75A 3F8MA 4R79A 5FFXA 6PAXA 1T98A 4AIKA 3G3ZA 2FNAA 3CTAA 4EJVA 3W6KB 1KQ9A 4UHTA 1D5VA 2LDUA 1R00A 2R7FA 2WWYA 3FXQA 1J7KA 2VN2A 3IRRA 1HKSA 5EEHA 3T5XA 3D0SA 3RPQA 5BS6A 3KEQA 2FOKA 1D8KA 1RUNA 1OYYA 4GYIA 1R23A 3GXOA 4L9NA 1T0FA 2Z99A 3F8FA 3MZHA 4RB0A 2CGPA 2VT3A 4ENKA 1ON1A 5LBQA 1E17A 1U8RA 3NRVA 1TQPA 4I98B 4I02A 1SMYF 3CUQA 2Q2EA 2CW0F 2DK8A 2EWNA 5E8IA 4XRFA 3SHFA 3IRQA 4PCQA 3EYYA 2F5DA 5LEKA 3F3XA 4I0BA 2STWA 3IKTA 5D6FA 5DUKA 3HSEA 2OZ6A 3DEUA 1TTYA 4ZZLA 2K86A 4FHTA 3MQ0A 4FT8A 2RV8A 2NS0A 3IKVA 1ZRFA 3J7AO 2HFHA 1P6RA 1XMKA 1WSUA 2XHKA 3ZMTA 2ACJA 1YYVA 2F2EA 2QZ8A 2MH2A 2QVOA 4OIPF 4DQ2A 1J59A 2GWRA 1B9MA 1VTNC 4S04A 4KIFA 4BH9A 1W5TA 4O3MA 3QOPA 1MJ9A 4HLXA 1BI2A 1P4XA 1JHHA 1B9NA 5JVTA 3FMSA 4RB1A 2VC0A 3HRUA 3QU6A 2XAQA 3GWZA 5HS7A 3LWFA 3M8FA 1FLIA 1WI9A 3SZTA 3BWGA 4JQFA 2L02A 4O6JA 3DFGA 3U1DA 3MAJA 1ZG1A 4EM1A 3WGHA 1U5TC 1R36A 4UV8A 3KP4A 4Y17A 3E6DA 2HQNA 2W57A 2MLGA 5DCMA 4WF2A 3E5QA 3HIFA 5A2QK 3F23A 2HQRA 2K4JA 1FYLA 2QBYA 5E1WA 4A0ZA 3SXYA 3LA3A 1J9IA 1GVJA 1OPCA 1IXRC 2DU9A 2L01A 2R7DA 2QQBA 2QWWA 3I59A 2XAGA 5DDGA 3S2WA 1XN7A 3F8CA 2KIMA 3DPTA 3JTHA 4BYYA 1R1TA 2FQ3A 3T8RA 2IW5A 1R5GA 3GYHX 1L3LA 3WE3A 1K78A 3WU0A 1MGTA 3J80K 3BZ6A 4A5NA 3EDPA 2DO7A 1DDNA 2VE8A 5TJJA 5BOXA 2FBHA 5DCFA 3H3UA 4RB3C 1FZPB 1HQCA 3E5XA 2Z3YA 1LEBA 3ABTA 1H0MA 5D5VB 2JT1A 1YO5C 2L3DA 2QUFA 3ROUA 3WG9A 2FEZA 4ETSA 4YFKF 4L5IA 2ZMEA 1YW8A 2P7VB 3P7NA 1ZYRF 2ZBKA 5FLXZ 4KN7X 3J81K 2M8EA 1W7PA 2D1VA 3BJ6A 5HLHA 5ICEA 2GQQA 2KJCA 3E3VA 4HZFA 1Z9CA 5D6EA 5KK1A 3KFWX 1TW3A 4WK8F 2BYVE 2HEOA 4XLPF 1J5YA 2GAUA 2HS5A 3C18A 2VXZA 4ZYHA 3K1NA 3V8KA 1G3YA 5E8GA 3KLOA 2HYFA 2DQLA 1HW2A 1RI7A 2UXNA 2ADUA 2VT2A 1EH8A 2ZXJA 3IHUA 3IWFA 4BHCA 1FBQA 1RZ4A 2Z5UA 4HQMA 4AIJA 3B73A 3T0YA 4HBLA 3L9FA 2M5WA 2COMA 3B02A 2RNJA 1R7JA 3WTSC 2VBZA 2VOPA 3F21A 3QRFF 1S8NA 3BY6A 4ENJA 2G7HA 3L7WA 4OMZA 2BV6A 3KETA 2TDXA 2EK5A 1CF7B 2V9VA 4ZYGA 2YSRA 3SFZA 2DI3A 3QAHA 3GZ5A 3DV8A 4OOIA 1SFXA 4AVPA 1YG2A 2WV0A 1ZGJA 3Q5FA 1JHFA 2EB7A 1HKQA 4KNYA 4M6XA 2Z33A 3I53A 1Y0UA 1HW1A 2OU2A 3HOSA 4GYGA 4OINF 2P7CB 2E7XA 1XSXA 5L3CA 3VFZA 1W7PD 1O57A 3E6BA 2PJPA 2CSOA 5D4RA 2WTEA 1BC7C 2UXXA 5FFZA 3V7CA 2AS5F 1PDNC 3F72A 1U3EM 1KU9A 4KT5C 2O3FA 1ZREA 3QP5A 2ELHA 2AXLA 3DXJF 3R6SA 3TOBA 1S6LA 3E6CC 1AWCA 1YTYA 1IN6A 4A12A 5IT9Z 4ZH4F 5E1ZB 2XAJA 1MDMB 3C3WA 1U5TB 4L0ZB 4EVIA 3LQQA 4KICA 1TLHB 3ZMUA 3R60A 3KEOA 2K7LA 1JGSA 4Q47A 2EFNA 2GA2A 4KA4A 3H92A 5L3EA 2RDPA 3DF8A 5LEJA 1KQ0A 2IA2A 4YFXF 3JAMZ 3FZVA 1G3WA 2OA4A 4M74A 5FD5A 2X0LA 5ILVA 3ZMVA 4BHBA 1LEAA 2JPCA 3KP7A 4M9SA 1YW7A 4AD9A 3LA2A 3LA7A 2F5EA 3SQNA 4EJTA 4AWXB 2EA2A 3WE2A 3VB2A 4I2OA 3J80Z 4WCGA 4ZZDA 2B0LA 3M9AA 2Y0MA 3BDDA 2FRHA 1STZA 3MZYA 5LRSA 1O7LA 5E17F 4WXCA 2KKOA 2E7WA 2PN6A 2FE3A 4DNCA 4MHGA 1SFEA 5D8LB 3E5UA 1GXPA 2E1CA 5FD6A 1KYZA 1FBSA 3I5UA 2FF4A 1GHCA 3HHHA 3LSTA 1YS6A 4RB2C 4Q5SF 2R3SA 3J81Z 4IRIA 1B6AA 1MJBA 3HRSA 1HW5A 2W85A 5ILUA 1KA8A 3ERED 1WKMA 1U78A 1BIAA 1A04A 4M6YA 1G6NA 2DPUA 4LMYA 2MLKA 3FF5A 1G3SA 3G73A 3R0AA 1XCBA 3WTTC 1LVAA 4I0AA 3JSOA 1HSTA 4HA8A 1BOAA 4ESBA 4EMSA 3HTUA 2FSWA 3GVAA 3KCCA 1QQIA 3T1BA 2FBKA 1KU3A 4MNUA 3HTSB 3BROA 3I54A 1UCRA 5DD4A 5JI6A 5J8FA 1P4WA 4BAYA 1LNWA 3GUDA 2OQRA 4Y13A 5BPDA 5EEGA 2M30A 1MD0A 1R1UA 4HQEA 5K1YA 1TW2A 3GFMA 4IPAA 1SD4A 1ZG3A 2CYYA 2V1XA 1J0RA 1J75A 5L3DA 2ISZA 3WTVC 4CO8A 1FP1D 4NQWA 3I4PA 5LGTA 2VODA 3LAJA 4HX7A 2RC4A 5CYVA 3ZMDA 4G94A 2CO5A 2VOOA 4G7HF 3VOEA 3H3ZA 4LD5A 2LF7A 3VEPA 4M72A 3U9GA 1F9NA 4BXUA 2OD5A 5HS9A 3EYIA 3Q9SA 3K1PA 5H6RA 4IHTA 2A6EF 4EGYA 5LGUA 3CO6C 1L0OC 2HKXA 3CDHA 2VONA 2J5PA 1SFUA 1YQAA 4LK1F 1D3YA 1SD5A 2ZKZA 2XAHA 4ZYDA 2DW4A 1O3RA 3BJOA 4ENNA 1ZHFA 1T2KA 2UWMA 3GFLA 1SAXA 4KMFA 2FNPA 4XSZF 2CWEA 2P4WA 3FWEA 1FT9A 1RUOA 2IA1A 2RKHA 3LAPA 3MWMA 2QENA 4UNOA 5K5OA 4O5VA 1R22A 1OKRA 1BI0A 4L18B 2HZTA 2GZWA 4EV0A 1ODDA 3W6JB 4HDVA 2EA4A 1B4AA 3CLOA 3C7JA 4MEXF 2Y48A 4B09A 1MJAA 1F4KA 3GX4X 1K6OA 1U5TA 3HRTA 4U0VA 1OYIA 2ZNYA 1IF1A 2O03A 1O7FA 3CJNA 5DYMA 4G6QA 2CFXA 1ZARA 2PI0A 1XSVA 2PLYA 1W4MA 3FMQA 3MCZA 2DFIA 3N4MA 4HAMA 1JXSA 3L00A 5JHUA 2EFOA 1ZH5A 2L4MA 1EV7A 5DEQA 4M73A 5ICCA 1OR7A 1DPUA 4KUMA 2P5KA 4RGUA 1R1VA 4UXNA 3D5LA 2IPQX 1WWXA 3TO9A 3E6MA 2IJLA 2YX7A 1LDJA 3TO7A 5HDKA 3L09A 3FM3A 2RQPA 3ML6A 1MZBA 1E2XA 3Q9VA 1UHMA 1WRJA 3BP8A 3K0LA 4L5JA 4KN4X 3KP3A 5HLGA 2M45A 5ICGA 2XIGA 4WXHA 2VBXA 5JR3A 1Z05A 5BQTA 3I64A 4U0YA 3O3KA 1QNTA 4JBAA 2A5YB 3WTZA 1TNTA 2NRAC 2FMLA 2ETHA 3OOPA 1FX7A 5E20A 4RS8A 2IA0A 1REPC 1IW7F 4LG0A 3WTWC 2HGCA 1Z7UA 5E1XA 3TOAA 4L0YB 4WX9A 2GA1A 1C0WA 3QPTA 1HKTA 3V8LA 1Z91A 5FB2A 4LB5A 3IL2A 4LLGF 1USTA 2LSOA 2VBWA 2C6YA 1I1GA 4CZZA 4HLYA 2XASA 4RGSA 4TV7A 3ZMSA 4MGRA 2BGCA 2DLLA 2H09A 3QU3A 2Q8KA 2UZKA 3GO5A 2MC3A 1FYKA 2F5FA 1Z6RA 2FMYA 1FWZA 3FMRA 1YIOA 3R61A 1I1SA 2DBBA 2PG4A 1F1ZA 1XGSA 4BNCA 4LGWA 4G7ZF 3IWZA 3JW4A 4P55A 2L54A 4K2EA 5F1RA 3ZN0A 1FNNA 4PGGA 1D8JA 2KRFA 1KYWA 3RI4A 4YIFA 4IXAA 2RGVA 1ZRDA 1FY7A 2W25A 5CVVA 3EUHA 4P5OA 2NNNA 5D5UB 5FO5A 4LJZF 1XGNA 5AIQA 1G4DA 1K7AA 4CHUA 3MFKA 1P92A 2EFPA 1XDUA 2RVCA 2IVMA 1T38A 4KIBA 4G7OF 4EQQA 3RKYA 2FBIA 3LFKA 3O6BB 1ZLKA 3R4KA 2XKOA 4EM2A 1FBUA 5DCMB 5DV5A 3RTRA 4IJAA 2E1NA 1B59A 1LDDA 1IN7A 3FXUA 3GEZA 2QBYB 2P6SA 4HF2A 1DP7P 4LFUA 5A2QZ 5TRDA 4XLNF 2FU4A 4U7BA 3GFIA 1V3FA 3RYRA 4OMYA 2ESHA 1AOYA 2V6CA 3KZZA 2VE9A 1B1BA 4HW0A 3F8BA 3QP6A 3OV8A 3HHGA 4MTEA 2K4BA 1UB9A 2BE5F 3VODA 5DUIA 5H6QA 2XGXA 1R58A 2PFBA 2A07F 2PMHA 1Q1HA 4RGXA 2DPDA 4Y15A 5ERIA 2KIUA 1T6SA 1U6GA 5E18F 3O2PE 4P96A 4U0WA 3I71A 2XUBA 4UVCA 1SMTA 4G9YA 3RPUA 1PUEE 4RAYA 1V4RA 4KFCA 3HYIA 3HSFA 4Z2YA 1FOKA 1H9GA 4P9FA 4I09A 3WU1B 3RYPA 1BI1A 1QPMA 5D8KB 2H6BA 3ISPA 2ZMEB 2ZFWA 4EM0B 2D1HA 2JSCA 3FXRA 1ZAOA 4EJOA 4A5MA 4BQAA 4NHJA 2ZCWA 1ZRCA 3KP2A 5ICFA 3DPLC 2DK5A 1OMIA 5L3BA 3RDIA 3T8TA 1BI3A 2H6CA 4L9TA 2L4AA 5HOOA 4FX0A 2DAOA 2EV6A 4GGGA 4ZYEA 3P9KA 4MEYF 2XV4S 2CQKA 1ZG5A 1KU2A 5AONA 4U7DA 2A3SA 3ZQ7A 1F5TA 5FLXK 5CJ9A 1KU7A 2DQRA 2OQGA 3KZYA 1SD7A 1PP7U 1LDKB 5FGMA 3TQNA 3CUQC 3P9CA 4HF1A 1I6XA 2HR3A 1S3JA 2K27A 2KIFA 2QQ9A 4UVAA 5H20A 4A0XA 3KLNA 4R1HA 1XMAA 1WQ2A 2P8TA 5J6XA 2MA3A 5BMZA 5LHHA 1EH6A 2EFQA 3JTGA 1GXQA 4GXOA 4L9JA 4F7ZA 2CG4A 1XD7A 4YIIA 5CVUA 2QQAA 2A61A 2X4HA 4HX4A 3WTYC 4CGZA 4XSXF 2RN7A 3GZ6A 3R0JA 4KDPA 4N9IA 4UUVA 5CLSA 1UHWA 4PDKA 2HTJA 3C1DA 5J8CA 3V7RA 1O3TA 1TQIA 4HOBA 1MKMA 1EH7A 5L3FA 2EJRA 3I58A 5HVQC 2JRTA 2EV5A 1CF7A 3GF2A 3FX3A 2H27A 1Z1DA 4R8HA 4CICA 5CVIA 2XKPA 2EV0A 1DPRA 3N97A 4JK1X 4XBFA 1P4AA 3ZN1A 3PQJA 4LK0F 1SD6A 3F8NA 5ED4A 1XGOA 1BM9A 3EQLF 2H94A 3GW2A 3HOTA 4G8XA 3EETA 2VC1A 2D45A 2BBYA 4S05A 3P9IA 4MQVA 1ZGAA 2Q0OA 3TO6A 2V1UA 3ELKA 4PZJA 4CYDA 2IT0A 3K69A 1UFMA 2G9WA 5IT9K 5K5QA 3TGNA 1LB2A 2D2WA 2GIVA 1BJAA 2IP2A 3V4GA 1ONVA 3ZPLA 3ULQB 5BPIA 4WWCA 4MQ9F 4YG2F 4KMUX 1ON2A 4KIGA 3K1MA 5LHIA 1MDMA 5CVRA 3BPVA 1CGPA 3L2CA 1U2WA 2M1BA 1W5SA 3RJPA 1HSJA 2A6HF 3JAMK 5F6FA 3HSRA 4EJUA 4ENMA 3ZMZA 1TBXA 1ZN2A 3WGIA 4KYWA 5JFRA 4QLCU 3MEXA 1QO0D 4HV6A 3NEUA 1XDSA 1IRGA 1IRFA 4UV9A 2EFWA 5D5XB 3LQRA 4I7HA 3V8JA 4YFNF 2YPRA 4LLNA 2DT5A 2OAZA 3WODF 4L9VA 3JSPA 1Z6TA 1O3QA 1KGSA 4U88A 2PMUA 1FSHA 1USSA 5L3GA 3IC7A 2FA5A 4ESJA 2ESNA 5DD8A 2GXGA 4OIOF 5HDGA 4HYEA 4GCVA 1BIBA 4H0EA 1QGPA 1XGMA 1QZZA 1IXSB 3GLXA 3E97A 2DTRA 2OBPA 2PEXA 4EJWA 4WXDA 1IAWA 3KE2A 3I0TA 5AIPA 5HS8A 2ISYA 2PQ8A 3TDUC 2J5OA 2Z9OA 1QZYA 3TKYA 2HWVA 2QYOA 2XAFA 3CUQB 4CDGA 2FXAA 5LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDU A;  5LGN A;  2P5V A;  1IXC A;  3DQV C;  2NNY A;  4B8X A;  4ESF A;  2ZJ2 A;  4A6D A;  4PGH A;  4IRH A;  3BOQ A;  4UVB A;  2O0Y A;  1R5H A;  4HF0 A;  5K5R A;  1FP2 A;  1NHA A;  3ECO A;  3CO7 C;  1IZ1 A;  3F6O A;  1S7O A;  3M7G A;  4A2U A;  5KVR A;  1QBJ A;  1J2X A;  4LLL A;  1IN5 A;  1BC8 C;  3ZP5 A;  2MD5 A;  4OIR F;  1HBX G;  2YR2 A;  3DKW A;  3WTX C;  2XVC A;  2KJB A;  4RAZ A;  2GXB A;  3K9T A;  2P6T A;  3REO A;  4E70 A;  1G3T A;  4CXF A;  2HTS A;  5CVJ A;  4GO1 A;  1FSE A;  2LKP A;  1DUX C;  2IRF G;  2HYG D;  2HOE A;  2XRN A;  3K2Z A;  1PP8 F;  1BBY A;  1TQM A;  4OIQ F;  2OZU A;  1KQ8 A;  4BHP A;  3RKW A;  5LLQ A;  1I5Z A;  2QM3 A;  1RNL A;  1OYW A;  2M87 A;  1ZLJ A;  1P2F A;  2W24 A;  3M1E A;  3WTU C;  4RGR A;  2O6G E;  4IHS A;  3F6V A;  3KP5 A;  4FX4 A;  1K79 A;  3U2R A;  5IT3 A;  4QWQ A;  2HDC A;  4Q48 A;  2F5C A;  2ZO4 A;  1IN4 A;  2YU3 A;  2W84 A;  4HX8 A;  3COA C;  1T39 A;  2V1D A;  4A6E A;  4Q4Z F;  5D5W B;  3CUO A;  4A0Y A;  3HUG A;  3DP7 A;  1FPQ A;  2LNB A;  4M9X A;  1FC3 A;  3F22 A;  3PQK A;  2MH9 A;  2QLZ A;  4NB5 A;  1ULY A;  2P5L C;  3I59 B;  5ILS A;  1HXD A;  2YX4 A;  5F64 A;  2WC2 A;  2LF8 A;  2V79 A;  1YW9 A;  4M71 A;  3V7S A;  3HRM A;  2BEO A;  1XSD A;  5HDN A;  2STT A;  4N9H A;  4IRG A;  4HV5 A;  1K78 B;  2PBI A;  3M8E A;  1XB4 A;  1LJ9 A;  2G7U A;  4IF4 A;  1H9T A;  1XCV A;  4M9Z A;  2JPB A;  2XRO A;  4N0B A;  1BN5 A;  3ECH A;  4IVN A;  4G6D A;  3RIR A;  3GFJ A;  2O8X A;  4ON0 A;  2O61 A;  2A68 F;  3NQO A;  2NAZ A;  2MBF A;  3AAF A;  3QPH A;  4I01 A;  2A69 F;  2JTV A;  2ZNZ A;  1LQ1 A;  4D0P A;  4OU0 A;  1RIO H;  1S7A A;  3BJA A;  3BPX A;  1X3U A;  2VBY A;  3ABU A;  1TNS A;  3PFI A;  4P9U A;  1O3S A;  1YLF A;  1W7P B;  3TDZ C;  5D4S A;  2JZY A;  3FM5 A;  4LB6 B;  4EGZ A;  1FYM A;  1IN8 A;  4AIH A;  1YS7 A;  1I27 A;  1IUY A;  3SZP A;  3RKX A;  4MTD A;  3KP6 A;  1S29 A;  5HLI A;  5LRR A;  3WGG A;  1YFH A;  2NYX A;  2K02 A;  2HKO A;  4LG0 B;  1JE8 A;  3FHZ A;  4ASN A;  2Y75 A;  3F8M A;  4R79 A;  5FFX A;  6PAX A;  1T98 A;  4AIK A;  3G3Z A;  2FNA A;  3CTA A;  4EJV A;  3W6K B;  1KQ9 A;  4UHT A;  1D5V A;  2LDU A;  1R00 A;  2R7F A;  2WWY A;  3FXQ A;  1J7K A;  2VN2 A;  3IRR A;  1HKS A;  5EEH A;  3T5X A;  3D0S A;  3RPQ A;  5BS6 A;  3KEQ A;  2FOK A;  1D8K A;  1RUN A;  1OYY A;  4GYI A;  1R23 A;  3GXO A;  4L9N A;  1T0F A;  2Z99 A;  3F8F A;  3MZH A;  4RB0 A;  2CGP A;  2VT3 A;  4ENK A;  1ON1 A;  5LBQ A;  1E17 A;  1U8R A;  3NRV A;  1TQP A;  4I98 B;  4I02 A;  1SMY F;  3CUQ A;  2Q2E A;  2CW0 F;  2DK8 A;  2EWN A;  5E8I A;  4XRF A;  3SHF A;  3IRQ A;  4PCQ A;  3EYY A;  2F5D A;  5LEK A;  3F3X A;  4I0B A;  2STW A;  3IKT A;  5D6F A;  5DUK A;  3HSE A;  2OZ6 A;  3DEU A;  1TTY A;  4ZZL A;  2K86 A;  4FHT A;  3MQ0 A;  4FT8 A;  2RV8 A;  2NS0 A;  3IKV A;  1ZRF A;  3J7A O;  2HFH A;  1P6R A;  1XMK A;  1WSU A;  2XHK A;  3ZMT A;  2ACJ A;  1YYV A;  2F2E A;  2QZ8 A;  2MH2 A;  2QVO A;  4OIP F;  4DQ2 A;  1J59 A;  2GWR A;  1B9M A;  1VTN C;  4S04 A;  4KIF A;  4BH9 A;  1W5T A;  4O3M A;  3QOP A;  1MJ9 A;  4HLX A;  1BI2 A;  1P4X A;  1JHH A;  1B9N A;  5JVT A;  3FMS A;  4RB1 A;  2VC0 A;  3HRU A;  3QU6 A;  2XAQ A;  3GWZ A;  5HS7 A;  3LWF A;  3M8F A;  1FLI A;  1WI9 A;  3SZT A;  3BWG A;  4JQF A;  2L02 A;  4O6J A;  3DFG A;  3U1D A;  3MAJ A;  1ZG1 A;  4EM1 A;  3WGH A;  1U5T C;  1R36 A;  4UV8 A;  3KP4 A;  4Y17 A;  3E6D A;  2HQN A;  2W57 A;  2MLG A;  5DCM A;  4WF2 A;  3E5Q A;  3HIF A;  5A2Q K;  3F23 A;  2HQR A;  2K4J A;  1FYL A;  2QBY A;  5E1W A;  4A0Z A;  3SXY A;  3LA3 A;  1J9I A;  1GVJ A;  1OPC A;  1IXR C;  2DU9 A;  2L01 A;  2R7D A;  2QQB A;  2QWW A;  3I59 A;  2XAG A;  5DDG A;  3S2W A;  1XN7 A;  3F8C A;  2KIM A;  3DPT A;  3JTH A;  4BYY A;  1R1T A;  2FQ3 A;  3T8R A;  2IW5 A;  1R5G A;  3GYH X;  1L3L A;  3WE3 A;  1K78 A;  3WU0 A;  1MGT A;  3J80 K;  3BZ6 A;  4A5N A;  3EDP A;  2DO7 A;  1DDN A;  2VE8 A;  5TJJ A;  5BOX A;  2FBH A;  5DCF A;  3H3U A;  4RB3 C;  1FZP B;  1HQC A;  3E5X A;  2Z3Y A;  1LEB A;  3ABT A;  1H0M A;  5D5V B;  2JT1 A;  1YO5 C;  2L3D A;  2QUF A;  3ROU A;  3WG9 A;  2FEZ A;  4ETS A;  4YFK F;  4L5I A;  2ZME A;  1YW8 A;  2P7V B;  3P7N A;  1ZYR F;  2ZBK A;  5FLX Z;  4KN7 X;  3J81 K;  2M8E A;  1W7P A;  2D1V A;  3BJ6 A;  5HLH A;  5ICE A;  2GQQ A;  2KJC A;  3E3V A;  4HZF A;  1Z9C A;  5D6E A;  5KK1 A;  3KFW X;  1TW3 A;  4WK8 F;  2BYV E;  2HEO A;  4XLP F;  1J5Y A;  2GAU A;  2HS5 A;  3C18 A;  2VXZ A;  4ZYH A;  3K1N A;  3V8K A;  1G3Y A;  5E8G A;  3KLO A;  2HYF A;  2DQL A;  1HW2 A;  1RI7 A;  2UXN A;  2ADU A;  2VT2 A;  1EH8 A;  2ZXJ A;  3IHU A;  3IWF A;  4BHC A;  1FBQ A;  1RZ4 A;  2Z5U A;  4HQM A;  4AIJ A;  3B73 A;  3T0Y A;  4HBL A;  3L9F A;  2M5W A;  2COM A;  3B02 A;  2RNJ A;  1R7J A;  3WTS C;  2VBZ A;  2VOP A;  3F21 A;  3QRF F;  1S8N A;  3BY6 A;  4ENJ A;  2G7H A;  3L7W A;  4OMZ A;  2BV6 A;  3KET A;  2TDX A;  2EK5 A;  1CF7 B;  2V9V A;  4ZYG A;  2YSR A;  3SFZ A;  2DI3 A;  3QAH A;  3GZ5 A;  3DV8 A;  4OOI A;  1SFX A;  4AVP A;  1YG2 A;  2WV0 A;  1ZGJ A;  3Q5F A;  1JHF A;  2EB7 A;  1HKQ A;  4KNY A;  4M6X A;  2Z33 A;  3I53 A;  1Y0U A;  1HW1 A;  2OU2 A;  3HOS A;  4GYG A;  4OIN F;  2P7C B;  2E7X A;  1XSX A;  5L3C A;  3VFZ A;  1W7P D;  1O57 A;  3E6B A;  2PJP A;  2CSO A;  5D4R A;  2WTE A;  1BC7 C;  2UXX A;  5FFZ A;  3V7C A;  2AS5 F;  1PDN C;  3F72 A;  1U3E M;  1KU9 A;  4KT5 C;  2O3F A;  1ZRE A;  3QP5 A;  2ELH A;  2AXL A;  3DXJ F;  3R6S A;  3TOB A;  1S6L A;  3E6C C;  1AWC A;  1YTY A;  1IN6 A;  4A12 A;  5IT9 Z;  4ZH4 F;  5E1Z B;  2XAJ A;  1MDM B;  3C3W A;  1U5T B;  4L0Z B;  4EVI A;  3LQQ A;  4KIC A;  1TLH B;  3ZMU A;  3R60 A;  3KEO A;  2K7L A;  1JGS A;  4Q47 A;  2EFN A;  2GA2 A;  4KA4 A;  3H92 A;  5L3E A;  2RDP A;  3DF8 A;  5LEJ A;  1KQ0 A;  2IA2 A;  4YFX F;  3JAM Z;  3FZV A;  1G3W A;  2OA4 A;  4M74 A;  5FD5 A;  2X0L A;  5ILV A;  3ZMV A;  4BHB A;  1LEA A;  2JPC A;  3KP7 A;  4M9S A;  1YW7 A;  4AD9 A;  3LA2 A;  3LA7 A;  2F5E A;  3SQN A;  4EJT A;  4AWX B;  2EA2 A;  3WE2 A;  3VB2 A;  4I2O A;  3J80 Z;  4WCG A;  4ZZD A;  2B0L A;  3M9A A;  2Y0M A;  3BDD A;  2FRH A;  1STZ A;  3MZY A;  5LRS A;  1O7L A;  5E17 F;  4WXC A;  2KKO A;  2E7W A;  2PN6 A;  2FE3 A;  4DNC A;  4MHG A;  1SFE A;  5D8L B;  3E5U A;  1GXP A;  2E1C A;  5FD6 A;  1KYZ A;  1FBS A;  3I5U A;  2FF4 A;  1GHC A;  3HHH A;  3LST A;  1YS6 A;  4RB2 C;  4Q5S F;  2R3S A;  3J81 Z;  4IRI A;  1B6A A;  1MJB A;  3HRS A;  1HW5 A;  2W85 A;  5ILU A;  1KA8 A;  3ERE D;  1WKM A;  1U78 A;  1BIA A;  1A04 A;  4M6Y A;  1G6N A;  2DPU A;  4LMY A;  2MLK A;  3FF5 A;  1G3S A;  3G73 A;  3R0A A;  1XCB A;  3WTT C;  1LVA A;  4I0A A;  3JSO A;  1HST A;  4HA8 A;  1BOA A;  4ESB A;  4EMS A;  3HTU A;  2FSW A;  3GVA A;  3KCC A;  1QQI A;  3T1B A;  2FBK A;  1KU3 A;  4MNU A;  3HTS B;  3BRO A;  3I54 A;  1UCR A;  5DD4 A;  5JI6 A;  5J8F A;  1P4W A;  4BAY A;  1LNW A;  3GUD A;  2OQR A;  4Y13 A;  5BPD A;  5EEG A;  2M30 A;  1MD0 A;  1R1U A;  4HQE A;  5K1Y A;  1TW2 A;  3GFM A;  4IPA A;  1SD4 A;  1ZG3 A;  2CYY A;  2V1X A;  1J0R A;  1J75 A;  5L3D A;  2ISZ A;  3WTV C;  4CO8 A;  1FP1 D;  4NQW A;  3I4P A;  5LGT A;  2VOD A;  3LAJ A;  4HX7 A;  2RC4 A;  5CYV A;  3ZMD A;  4G94 A;  2CO5 A;  2VOO A;  4G7H F;  3VOE A;  3H3Z A;  4LD5 A;  2LF7 A;  3VEP A;  4M72 A;  3U9G A;  1F9N A;  4BXU A;  2OD5 A;  5HS9 A;  3EYI A;  3Q9S A;  3K1P A;  5H6R A;  4IHT A;  2A6E F;  4EGY A;  5LGU A;  3CO6 C;  1L0O C;  2HKX A;  3CDH A;  2VON A;  2J5P A;  1SFU A;  1YQA A;  4LK1 F;  1D3Y A;  1SD5 A;  2ZKZ A;  2XAH A;  4ZYD A;  2DW4 A;  1O3R A;  3BJO A;  4ENN A;  1ZHF A;  1T2K A;  2UWM A;  3GFL A;  1SAX A;  4KMF A;  2FNP A;  4XSZ F;  2CWE A;  2P4W A;  3FWE A;  1FT9 A;  1RUO A;  2IA1 A;  2RKH A;  3LAP A;  3MWM A;  2QEN A;  4UNO A;  5K5O A;  4O5V A;  1R22 A;  1OKR A;  1BI0 A;  4L18 B;  2HZT A;  2GZW A;  4EV0 A;  1ODD A;  3W6J B;  4HDV A;  2EA4 A;  1B4A A;  3CLO A;  3C7J A;  4MEX F;  2Y48 A;  4B09 A;  1MJA A;  1F4K A;  3GX4 X;  1K6O A;  1U5T A;  3HRT A;  4U0V A;  1OYI A;  2ZNY A;  1IF1 A;  2O03 A;  1O7F A;  3CJN A;  5DYM A;  4G6Q A;  2CFX A;  1ZAR A;  2PI0 A;  1XSV A;  2PLY A;  1W4M A;  3FMQ A;  3MCZ A;  2DFI A;  3N4M A;  4HAM A;  1JXS A;  3L00 A;  5JHU A;  2EFO A;  1ZH5 A;  2L4M A;  1EV7 A;  5DEQ A;  4M73 A;  5ICC A;  1OR7 A;  1DPU A;  4KUM A;  2P5K A;  4RGU A;  1R1V A;  4UXN A;  3D5L A;  2IPQ X;  1WWX A;  3TO9 A;  3E6M A;  2IJL A;  2YX7 A;  1LDJ A;  3TO7 A;  5HDK A;  3L09 A;  3FM3 A;  2RQP A;  3ML6 A;  1MZB A;  1E2X A;  3Q9V A;  1UHM A;  1WRJ A;  3BP8 A;  3K0L A;  4L5J A;  4KN4 X;  3KP3 A;  5HLG A;  2M45 A;  5ICG A;  2XIG A;  4WXH A;  2VBX A;  5JR3 A;  1Z05 A;  5BQT A;  3I64 A;  4U0Y A;  3O3K A;  1QNT A;  4JBA A;  2A5Y B;  3WTZ A;  1TNT A;  2NRA C;  2FML A;  2ETH A;  3OOP A;  1FX7 A;  5E20 A;  4RS8 A;  2IA0 A;  1REP C;  1IW7 F;  4LG0 A;  3WTW C;  2HGC A;  1Z7U A;  5E1X A;  3TOA A;  4L0Y B;  4WX9 A;  2GA1 A;  1C0W A;  3QPT A;  1HKT A;  3V8L A;  1Z91 A;  5FB2 A;  4LB5 A;  3IL2 A;  4LLG F;  1UST A;  2LSO A;  2VBW A;  2C6Y A;  1I1G A;  4CZZ A;  4HLY A;  2XAS A;  4RGS A;  4TV7 A;  3ZMS A;  4MGR A;  2BGC A;  2DLL A;  2H09 A;  3QU3 A;  2Q8K A;  2UZK A;  3GO5 A;  2MC3 A;  1FYK A;  2F5F A;  1Z6R A;  2FMY A;  1FWZ A;  3FMR A;  1YIO A;  3R61 A;  1I1S A;  2DBB A;  2PG4 A;  1F1Z A;  1XGS A;  4BNC A;  4LGW A;  4G7Z F;  3IWZ A;  3JW4 A;  4P55 A;  2L54 A;  4K2E A;  5F1R A;  3ZN0 A;  1FNN A;  4PGG A;  1D8J A;  2KRF A;  1KYW A;  3RI4 A;  4YIF A;  4IXA A;  2RGV A;  1ZRD A;  1FY7 A;  2W25 A;  5CVV A;  3EUH A;  4P5O A;  2NNN A;  5D5U B;  5FO5 A;  4LJZ F;  1XGN A;  5AIQ A;  1G4D A;  1K7A A;  4CHU A;  3MFK A;  1P92 A;  2EFP A;  1XDU A;  2RVC A;  2IVM A;  1T38 A;  4KIB A;  4G7O F;  4EQQ A;  3RKY A;  2FBI A;  3LFK A;  3O6B B;  1ZLK A;  3R4K A;  2XKO A;  4EM2 A;  1FBU A;  5DCM B;  5DV5 A;  3RTR A;  4IJA A;  2E1N A;  1B59 A;  1LDD A;  1IN7 A;  3FXU A;  3GEZ A;  2QBY B;  2P6S A;  4HF2 A;  1DP7 P;  4LFU A;  5A2Q Z;  5TRD A;  4XLN F;  2FU4 A;  4U7B A;  3GFI A;  1V3F A;  3RYR A;  4OMY A;  2ESH A;  1AOY A;  2V6C A;  3KZZ A;  2VE9 A;  1B1B A;  4HW0 A;  3F8B A;  3QP6 A;  3OV8 A;  3HHG A;  4MTE A;  2K4B A;  1UB9 A;  2BE5 F;  3VOD A;  5DUI A;  5H6Q A;  2XGX A;  1R58 A;  2PFB A;  2A07 F;  2PMH A;  1Q1H A;  4RGX A;  2DPD A;  4Y15 A;  5ERI A;  2KIU A;  1T6S A;  1U6G A;  5E18 F;  3O2P E;  4P96 A;  4U0W A;  3I71 A;  2XUB A;  4UVC A;  1SMT A;  4G9Y A;  3RPU A;  1PUE E;  4RAY A;  1V4R A;  4KFC A;  3HYI A;  3HSF A;  4Z2Y A;  1FOK A;  1H9G A;  4P9F A;  4I09 A;  3WU1 B;  3RYP A;  1BI1 A;  1QPM A;  5D8K B;  2H6B A;  3ISP A;  2ZME B;  2ZFW A;  4EM0 B;  2D1H A;  2JSC A;  3FXR A;  1ZAO A;  4EJO A;  4A5M A;  4BQA A;  4NHJ A;  2ZCW A;  1ZRC A;  3KP2 A;  5ICF A;  3DPL C;  2DK5 A;  1OMI A;  5L3B A;  3RDI A;  3T8T A;  1BI3 A;  2H6C A;  4L9T A;  2L4A A;  5HOO A;  4FX0 A;  2DAO A;  2EV6 A;  4GGG A;  4ZYE A;  3P9K A;  4MEY F;  2XV4 S;  2CQK A;  1ZG5 A;  1KU2 A;  5AON A;  4U7D A;  2A3S A;  3ZQ7 A;  1F5T A;  5FLX K;  5CJ9 A;  1KU7 A;  2DQR A;  2OQG A;  3KZY A;  1SD7 A;  1PP7 U;  1LDK B;  5FGM A;  3TQN A;  3CUQ C;  3P9C A;  4HF1 A;  1I6X A;  2HR3 A;  1S3J A;  2K27 A;  2KIF A;  2QQ9 A;  4UVA A;  5H20 A;  4A0X A;  3KLN A;  4R1H A;  1XMA A;  1WQ2 A;  2P8T A;  5J6X A;  2MA3 A;  5BMZ A;  5LHH A;  1EH6 A;  2EFQ A;  3JTG A;  1GXQ A;  4GXO A;  4L9J A;  4F7Z A;  2CG4 A;  1XD7 A;  4YII A;  5CVU A;  2QQA A;  2A61 A;  2X4H A;  4HX4 A;  3WTY C;  4CGZ A;  4XSX F;  2RN7 A;  3GZ6 A;  3R0J A;  4KDP A;  4N9I A;  4UUV A;  5CLS A;  1UHW A;  4PDK A;  2HTJ A;  3C1D A;  5J8C A;  3V7R A;  1O3T A;  1TQI A;  4HOB A;  1MKM A;  1EH7 A;  5L3F A;  2EJR A;  3I58 A;  5HVQ C;  2JRT A;  2EV5 A;  1CF7 A;  3GF2 A;  3FX3 A;  2H27 A;  1Z1D A;  4R8H A;  4CIC A;  5CVI A;  2XKP A;  2EV0 A;  1DPR A;  3N97 A;  4JK1 X;  4XBF A;  1P4A A;  3ZN1 A;  3PQJ A;  4LK0 F;  1SD6 A;  3F8N A;  5ED4 A;  1XGO A;  1BM9 A;  3EQL F;  2H94 A;  3GW2 A;  3HOT A;  4G8X A;  3EET A;  2VC1 A;  2D45 A;  2BBY A;  4S05 A;  3P9I A;  4MQV A;  1ZGA A;  2Q0O A;  3TO6 A;  2V1U A;  3ELK A;  4PZJ A;  4CYD A;  2IT0 A;  3K69 A;  1UFM A;  2G9W A;  5IT9 K;  5K5Q A;  3TGN A;  1LB2 A;  2D2W A;  2GIV A;  1BJA A;  2IP2 A;  3V4G A;  1ONV A;  3ZPL A;  3ULQ B;  5BPI A;  4WWC A;  4MQ9 F;  4YG2 F;  4KMU X;  1ON2 A;  4KIG A;  3K1M A;  5LHI A;  1MDM A;  5CVR A;  3BPV A;  1CGP A;  3L2C A;  1U2W A;  2M1B A;  1W5S A;  3RJP A;  1HSJ A;  2A6H F;  3JAM K;  5F6F A;  3HSR A;  4EJU A;  4ENM A;  3ZMZ A;  1TBX A;  1ZN2 A;  3WGI A;  4KYW A;  5JFR A;  4QLC U;  3MEX A;  1QO0 D;  4HV6 A;  3NEU A;  1XDS A;  1IRG A;  1IRF A;  4UV9 A;  2EFW A;  5D5X B;  3LQR A;  4I7H A;  3V8J A;  4YFN F;  2YPR A;  4LLN A;  2DT5 A;  2OAZ A;  3WOD F;  4L9V A;  3JSP A;  1Z6T A;  1O3Q A;  1KGS A;  4U88 A;  2PMU A;  1FSH A;  1USS A;  5L3G A;  3IC7 A;  2FA5 A;  4ESJ A;  2ESN A;  5DD8 A;  2GXG A;  4OIO F;  5HDG A;  4HYE A;  4GCV A;  1BIB A;  4H0E A;  1QGP A;  1XGM A;  1QZZ A;  1IXS B;  3GLX A;  3E97 A;  2DTR A;  2OBP A;  2PEX A;  4EJW A;  4WXD A;  1IAW A;  3KE2 A;  3I0T A;  5AIP A;  5HS8 A;  2ISY A;  2PQ8 A;  3TDU C;  2J5O A;  2Z9O A;  1QZY A;  3TKY A;  2HWV A;  2QYO A;  2XAF A;  3CUQ B;  4CDG A;  2FXA A;  5LHG A; 
#chains in the Genus database with same CATH topology
 4HDU A;  5HNH A;  1JKR C;  1QHG A;  5J3L A;  5LGN A;  2P5V A;  1IXC A;  3DQV C;  1YJW I;  2NNY A;  4BDZ A;  3HDD A;  4B8X A;  4A3L J;  4ESF A;  2ZJ2 A;  3H5N A;  4A6D A;  1JUP A;  4PGH A;  2R7O A;  3CJQ B;  3HXL A;  4NQW B;  4IRH A;  2DFH A;  3BOQ A;  3OMY A;  2KHM A;  2O0Y A;  1R5H A;  4UVB A;  2M2E A;  2NOG A;  4CCN A;  4HF0 A;  3TP3 A;  1FP2 A;  5K5R A;  1NHA A;  1WJC A;  4ZC3 A;  3DWL E;  3IH2 A;  1R4M B;  3ECO A;  3CO7 C;  1IZ1 A;  3CD6 I;  3F6O A;  3WHC A;  1S7O A;  3ASO H;  4QIW N;  3M7G A;  1X1C A;  2K9S A;  4A2U A;  4AVZ A;  1VQL I;  3BTL A;  5KVR A;  4RBO A;  1QBJ A;  1J2X A;  2W48 A;  3JCU C;  3ONQ A;  4LLL A;  1IN5 A;  2JA8 J;  4LIV A;  1BC8 C;  4BY1 J;  3ZP5 A;  2BY2 A;  2MD5 A;  4OIR F;  2X1E A;  2YR2 A;  3DKW A;  2F5V A;  4BY7 J;  1HBX G;  2JA6 J;  1MBK A;  4C2T A;  1VQP I;  2E5N A;  2Y0S N;  3WTX C;  3SFI A;  4A3B J;  2XVC A;  2KJB A;  4RAZ A;  1W0T A;  2GXB A;  3K9T A;  2P6T A;  3M4O J;  2BZT A;  4CA0 A;  3KZI C;  2AHQ A;  3REO A;  1G3T A;  3M8J A;  2WA0 A;  2X48 A;  4E70 A;  4CXF A;  2HTS A;  5CVJ A;  4GO1 A;  3CDI A;  1FSE A;  2DOE A;  4II2 A;  2O7O A;  4DGW B;  2LKP A;  1DUX C;  3QYF A;  3HEF A;  2IRF G;  2HYG D;  2HOE A;  2XRN A;  4F93 B;  3K2Z A;  1ZR4 A;  1PP8 F;  3BCA A;  1BBY A;  3OYJ A;  1TQM A;  5FRO A;  4OIQ F;  2E2J J;  2WAD A;  2OZU A;  1KQ8 A;  4BHP A;  4IHY A;  4D7M A;  3CCE I;  3SZG A;  3RKW A;  3ZR8 X;  2KIQ A;  2L7K A;  3ZQF A;  3S16 J;  5LLQ A;  1UJ8 A;  1X2N A;  1I5Z A;  1H89 C;  4X6A J;  3JRD A;  2QM3 A;  1RNL A;  1OYW A;  1Y1W J;  5GAD J;  2DA7 A;  2QQ8 A;  2M87 A;  2DA2 A;  1ZLJ A;  3ZRG A;  1P2F A;  2BW3 A;  2W24 A;  1LKX A;  3L2U A;  5M5W J;  3M1E A;  3B6A A;  3WTU C;  2ZB9 A;  4RGR A;  2DXI A;  2O6G E;  1EKE A;  5LD2 C;  2BOL A;  2MC4 A;  2HOA A;  4IHS A;  3PIO F;  3PO3 J;  3F6V A;  3KP5 A;  4FX4 A;  1K79 A;  3U2R A;  3M3Y J;  4ITV A;  5IT3 A;  4QWQ A;  2N8G A;  2HDC A;  5EG0 B;  4Q48 A;  2F5C A;  2ZO4 A;  3HOX J;  4E7J A;  1QU3 A;  1IN4 A;  4IQ4 A;  2EIN H;  2YU3 A;  5HOD A;  5J1R A;  2W84 A;  1W36 C;  2GIZ A;  4HX8 A;  3COA C;  1ETX A;  1IG7 A;  1YX3 A;  1T39 A;  2QSF X;  2V1D A;  4A6E A;  4Q4Z F;  5D5W B;  4I99 C;  3CCU I;  1SAN A;  3CUO A;  2IS4 A;  4A0Y A;  3HUG A;  3DP7 A;  5EF6 A;  3OYL A;  5JLW A;  5LFA A;  1X19 A;  1FPQ A;  4BJ6 C;  3FBI B;  2WB1 N;  1WPK A;  2LNB A;  2LKS A;  5TIS C;  3PL8 A;  4M9X A;  1FC3 A;  3VYR B;  3ABK H;  3F22 A;  3PQK A;  2VPL A;  2QCO A;  2MH9 A;  2QLZ A;  4NB5 A;  4D5C A;  4XQF A;  1ULY A;  4A3D J;  2JVH A;  2P5L C;  2E35 A;  3I59 B;  5ILS A;  1HXD A;  2YX4 A;  3CP2 A;  2P81 A;  5F64 A;  1WJD A;  1F36 A;  2WC2 A;  4PJN A;  2LF8 A;  2IS6 A;  2V79 A;  1YW9 A;  1TWF J;  4ANJ A;  4M71 A;  2JUC A;  2VXD A;  3V7S A;  3HRM A;  2BEO A;  1ZK8 A;  3E1S A;  5KAI C;  1XSD A;  5HDN A;  2STT A;  4N9H A;  4F3Q A;  4IRG A;  4HV5 A;  1Y39 A;  2XDV A;  1K78 B;  2PBI A;  3M8E A;  1XB4 A;  1LJ9 A;  1UEL B;  2G7U A;  2KRC A;  4IF4 A;  1O4X A;  1H9T A;  3GTQ J;  1BA5 A;  1XCV A;  4M9Z A;  1X1B A;  2JPB A;  3BR2 A;  2XRO A;  1BW5 A;  1VZ0 A;  4N0B A;  1BN5 A;  3L2R A;  3ECH A;  4IVN A;  4G6D A;  3RIR A;  3OS0 A;  2R7V A;  3TP0 A;  3GFJ A;  2O8X A;  4ON0 A;  2O61 A;  2A68 F;  3NQO A;  2NAZ A;  4B48 A;  3PIP F;  2NS8 A;  2HOS A;  3VSK A;  2MBF A;  2QSH X;  3BZK A;  4XM3 A;  3VWB A;  3AAF A;  2CH0 A;  3QPH A;  4I01 A;  2A69 F;  2JQ7 A;  2JTV A;  2ZNZ A;  4DYR A;  1LQ1 A;  2M7B A;  2Y31 A;  4D0P A;  4OU0 A;  1RIO H;  2Z2S B;  1DP3 A;  1S7A A;  3BJA A;  4XKV A;  3BPX A;  3G1O A;  1X3U A;  2VBY A;  3BC8 A;  4NC7 A;  3ABU A;  5M5X J;  4M3B A;  3OR1 C;  3OYF A;  1TNS A;  3PFI A;  4P9U A;  2BY1 A;  1O3S A;  1YLF A;  4HEA 2;  1W7P B;  3TDZ C;  5D4S A;  2JZY A;  3FM5 A;  3G1M A;  2VQC A;  4LB6 B;  3H36 A;  4EGZ A;  1IN8 A;  1FYM A;  4AIH A;  2IS2 A;  1YS7 A;  2B7E A;  4A3K J;  4M3D A;  1I27 A;  3N05 A;  1IUY A;  3SZP A;  1X2M A;  3RKX A;  4HSR A;  4MTD A;  1E3O C;  3KP6 A;  3OR2 C;  1S29 A;  2V4J C;  3CCY A;  1KON A;  2GOX B;  5F27 A;  5HLI A;  4YIR X;  5LRR A;  3WGG A;  1YFH A;  2NYX A;  2E60 A;  2K02 A;  2HKO A;  1OCC H;  4LG0 B;  3PO2 J;  4CYC A;  1JE8 A;  3FHZ A;  4ASN A;  3H9J A;  1T33 A;  2Y75 A;  3F8M A;  2VQG A;  1TT0 A;  1D1C A;  5FFX A;  4R79 A;  4F91 B;  6PAX A;  5M3M J;  1T98 A;  4AIK A;  2R7Z J;  2CUE A;  2GBY A;  3G3Z A;  2FNA A;  3CTA A;  3TL4 X;  1ENH A;  4EJV A;  1HOM A;  4ABZ A;  3L2W A;  2R5Z B;  3W6K B;  1KQ9 A;  4UHT A;  4QTR A;  3S2H J;  4C3J J;  3LSM A;  3RZO J;  1D5V A;  1K6Y A;  2LDU A;  4MFD A;  1R00 A;  2XF7 A;  2R7F A;  2DYS H;  3BQZ A;  2WWY A;  3D5R C;  4BEH A;  1CQT A;  2L0K A;  3UKG A;  4X0G A;  3FXQ A;  1LE8 A;  4G12 A;  1J7K A;  2VN2 A;  4A3M J;  5GAE J;  3IRR A;  1HKS A;  2Z16 A;  5EEH A;  3T5X A;  1WZ2 A;  1U9N A;  3PJR A;  3D0S A;  3RPQ A;  5BS6 A;  3OYD A;  2OJE D;  3KEQ A;  4E7L A;  2VUM J;  2FOK A;  3HM5 A;  3OYB A;  3S1M J;  1D8K A;  2K9L A;  2M8G X;  4XN3 A;  3RSN A;  1RUN A;  4Y3O A;  1OYY A;  4GYI A;  1R23 A;  4BBR J;  3GXO A;  4L9N A;  1T0F A;  2Z99 A;  2OTJ I;  2P0W A;  3F8F A;  3MZH A;  4RB0 A;  2CGP A;  1FTT A;  1BR2 A;  3FKJ A;  2VT3 A;  1TP4 A;  4M3E A;  3B6C A;  1D1A A;  3CCM I;  2IBD A;  4ENK A;  1ON1 A;  1F43 A;  5IP9 J;  5LBQ A;  1E17 A;  1U8R A;  3NRV A;  1TQP A;  4I98 B;  4I02 A;  2ZSI B;  1SMY F;  3A1Y A;  1YHQ I;  3CUQ A;  2IAI A;  4IKF A;  2Q2E A;  2CW0 F;  2DK8 A;  2KLO A;  3LSH A;  4E7H A;  2EWN A;  5E8I A;  4XRF A;  3DPU A;  3SHF A;  3IRQ A;  2E1M C;  4PCQ A;  1TT5 B;  2R0Q C;  3EYY A;  3FIS A;  2F5D A;  4XMY A;  5LEK A;  3F3X A;  4I0B A;  5EZG A;  4GFB A;  4LOC A;  2OCE A;  2STW A;  3IKT A;  2Q1Z B;  5D6F A;  5DUK A;  3HSE A;  4C3H J;  2M4K A;  3GTJ J;  2OZ6 A;  3DEU A;  3OYH A;  1TTY A;  1R71 A;  4ZZL A;  2K86 A;  2BXY A;  4FHT A;  3MQ0 A;  4FT8 A;  2RV8 A;  2NS0 A;  3CME I;  3BTJ A;  4V2F A;  3IKV A;  1ETO A;  2ELK A;  1ZRF A;  3J7A O;  2HFH A;  1P6R A;  1XMK A;  2IGK A;  3NWT A;  2DA4 A;  2LY9 A;  1WSU A;  5E3O A;  1NH3 A;  2XHK A;  3ZMT A;  4PSW A;  1K4T A;  2ACJ A;  1YYV A;  2F2E A;  2QZ8 A;  2CRG A;  2VKD A;  3PFY A;  5IY5 H;  3DEW A;  2MH2 A;  2QVO A;  4OIP F;  4DQ2 A;  1J59 A;  1AKH B;  5EYR A;  2GWR A;  1B9M A;  1VTN C;  1ORK A;  2R7X A;  3FXM A;  4S04 A;  4KIF A;  4BH9 A;  1BJZ A;  5J4V A;  1W5T A;  1BL0 A;  2LRE A;  4O3M A;  2HVR A;  3O8H A;  3QOP A;  2YUS A;  1MJ9 A;  3H5R A;  5GAH J;  1K4S A;  1VF9 A;  2LP0 A;  4JX4 A;  2R7W A;  4HLX A;  3KPH A;  3RQ4 A;  5B3S H;  4J01 A;  1BI2 A;  1P4X A;  1JHH A;  1B9N A;  3QPL A;  2L5Q A;  2MFZ A;  2VL8 A;  5JVT A;  2KQR A;  1D5Y A;  3FMS A;  4RB1 A;  1MMS A;  2VC0 A;  3HRU A;  3QU6 A;  2W7N A;  5F1J A;  1YJN I;  2XAQ A;  3GWZ A;  3HKZ N;  1RPW A;  5HS7 A;  1HLV A;  3LWF A;  3M8F A;  2JJ7 A;  1FLI A;  1WI9 A;  3SZT A;  3BWG A;  4JQF A;  4CH7 A;  2ICW G;  2L02 A;  2X85 A;  4O6J A;  1S72 I;  3CJR B;  2CMP A;  3DFG A;  3U1D A;  3MAJ A;  4PJL A;  3MKL A;  3WGH A;  2W00 A;  3CLQ A;  4EM1 A;  1ZG1 A;  3KYC B;  4BS9 A;  2R7Q A;  1U5T C;  1R36 A;  4UV8 A;  2V6E A;  3KP4 A;  3PNV A;  4XR6 A;  1Y6I A;  4Y17 A;  3S93 A;  2Y9Z A;  3E6D A;  2HQN A;  3Q0W A;  2W57 A;  2MLG A;  1V54 H;  4XLF A;  5DCM A;  4WF2 A;  3E5Q A;  3K4C A;  3HIF A;  1B8I A;  2LOO A;  2H1L A;  5A2Q K;  3F23 A;  2HQR A;  1HDD C;  3CMA I;  2K4J A;  3HC7 A;  1FYL A;  2GXA A;  1MMA A;  3KIO A;  4F55 A;  2QBY A;  1T8I A;  5E1W A;  4DBQ A;  4A0Z A;  4QPQ A;  2W1O A;  3SXY A;  3LA3 A;  1B72 A;  4GDF A;  1J9I A;  1A31 A;  1TWG J;  1GVJ A;  1OPC A;  1IV6 A;  1IXR C;  2VJ5 A;  2O5R A;  2DU9 A;  3JRB A;  2L01 A;  2HI3 A;  4N4O B;  2R7D A;  2QQB A;  2QWW A;  3I59 A;  2XAG A;  2X6X A;  5DDG A;  3S2W A;  3PUF A;  1XN7 A;  3OL3 A;  3F8C A;  3K10 A;  2JA5 J;  4CSW A;  2KIM A;  3DPT A;  3CCL I;  1VQO I;  1D0Y A;  3ZQH A;  3KEY A;  2JSP A;  3MKY B;  1IRX A;  3JTH A;  4BYY A;  1HC8 A;  1JKQ C;  1R1T A;  2FQ3 A;  4Y33 A;  3T8R A;  2IW5 A;  1R5G A;  3IH3 A;  5EEA A;  1VFC A;  3GYH X;  3HOZ J;  1L3L A;  3WE3 A;  1K78 A;  4C3I J;  3WU0 A;  1GT0 C;  2M7A A;  1MGT A;  3J80 K;  3BG7 A;  3BZ6 A;  1PUF B;  3DCF A;  3H35 A;  4A5N A;  2MG4 A;  3EDP A;  5IYB J;  2DO7 A;  1DDN A;  2VE8 A;  5TJJ A;  4DZJ A;  5BOX A;  2FBH A;  1TC3 C;  3A0B C;  3PNY A;  3H3U A;  5DCF A;  4YEJ A;  4RB3 C;  1FZP B;  2DJI A;  1HQC A;  1U8B A;  2KRH A;  4A3F J;  1IDY A;  2KPM A;  2LD5 A;  3HB9 A;  3E5X A;  1MNE A;  2Z3Y A;  1LEB A;  2X6O A;  2FUG 2;  3ABT A;  4ZTJ A;  1H0M A;  3OS2 A;  1MBE A;  4A3C J;  2OUM A;  5D5V B;  3BCB A;  1P7J A;  2JT1 A;  1YO5 C;  2L3D A;  5IOZ A;  4JP0 A;  2QUF A;  1SVM A;  3ROU A;  3UNG C;  2RRE A;  3WG9 A;  2FEZ A;  4ETS A;  4Y52 J;  2M34 A;  4A69 C;  1RR7 A;  4XRM A;  2VJJ A;  4YFK F;  4G6T B;  4L5I A;  2ZME A;  1YW8 A;  2FQ4 A;  3FK7 A;  2P7V B;  3P7N A;  4AID A;  1ZYR F;  1ITY A;  2DMN A;  1FMW A;  4MFE A;  3A2K A;  2ZBK A;  5FLX Z;  4KN7 X;  1QPI A;  3J81 K;  2A05 A;  2KT0 A;  2M8E A;  1W7P A;  1D1B A;  2D1V A;  3K4J A;  1LFB A;  2Y30 A;  3BJ6 A;  2L2O A;  2VKH A;  5HLH A;  5ICE A;  5E3N A;  1FJL A;  2GQQ A;  2V1N A;  2KJC A;  1R4N B;  1R9T J;  3E3V A;  4HZF A;  1Z9C A;  3BLY A;  5D6E A;  5KK1 A;  2K9Q A;  3KFW X;  1YI2 I;  1TW3 A;  2CQN A;  3M07 A;  1S7E A;  4WK8 F;  3M1C A;  2BYV E;  3FKI J;  2MGQ A;  2HEO A;  1H88 C;  2NVQ J;  4XLP F;  1BW6 A;  1J5Y A;  2GAU A;  2HS5 A;  1EF4 A;  3C18 A;  2VXZ A;  2KL4 A;  4BXF A;  4ZYH A;  3K1N A;  4XLA A;  3V8K A;  1G3Y A;  5E8G A;  3KLO A;  2HYF A;  4CCL A;  2DQL A;  1HW2 A;  1RI7 A;  2UXN A;  2ADU A;  2VT2 A;  1EH8 A;  1SVO A;  1WHU A;  2ZXJ A;  3BR6 A;  3IHU A;  3IWF A;  4BHC A;  1FBQ A;  1RZ4 A;  2Z5U A;  1H8A C;  4XKB A;  4HQM A;  5FRM A;  1UHS A;  2HU9 A;  4AIJ A;  3I55 I;  1XPX A;  3B73 A;  3T0Y A;  4HBL A;  3K70 C;  2AQF A;  3L9F A;  2M5W A;  2COM A;  3PM1 A;  2E1M B;  3L2Q A;  3B02 A;  2RNJ A;  1R7J A;  3I9V 2;  3WTS C;  2VBZ A;  2VOP A;  3F21 A;  3QRF F;  3DBH B;  3S1Q J;  3JRI A;  1D0X A;  1S8N A;  2E36 A;  2KMU A;  4XL9 A;  3BY6 A;  3PNT A;  1UAA A;  3CF5 F;  2R5Y A;  1FEX A;  4ENJ A;  2G7H A;  1IGN A;  3L7W A;  4OMZ A;  2BV6 A;  3KET A;  3ZQC A;  2TDX A;  2EK5 A;  1CF7 B;  2V9V A;  4ZYG A;  2YSR A;  3SFZ A;  4AYB A;  3BT9 A;  2DI3 A;  5CQE A;  3QAH A;  2ID6 A;  3GZ5 A;  4KT6 A;  2L9R A;  1W1W E;  1ZGW A;  3DV8 A;  4OOI A;  1SFX A;  4AVP A;  1JTX A;  1YG2 A;  2Y2Z A;  2XGC A;  2WV0 A;  3D5S C;  3EUH C;  3OYI A;  1ZGJ A;  5CPR B;  3Q5F A;  1JHF A;  1T08 B;  1GV5 A;  2EB7 A;  1HKQ A;  2LTP A;  4KNY A;  4M6X A;  3JRE A;  2Z33 A;  3I53 A;  1Y0U A;  3VPR A;  1HW1 A;  1P9Q C;  2LFB A;  2OU2 A;  3BR1 A;  1UMQ A;  3HOS A;  2NVY J;  1GV2 A;  2K3F A;  4GYG A;  4OIN F;  2XPU A;  2CW7 A;  2P7C B;  2E7X A;  1XSX A;  5L3C A;  3Q3S A;  1V55 H;  2F4O B;  1W7P D;  3VFZ A;  3S1N J;  1O57 A;  2MD0 A;  3E6B A;  3HZJ A;  2PJP A;  1OCZ H;  2QKM B;  5KNL A;  3OSG A;  3GLL A;  1OJL A;  2CSO A;  5D4R A;  2WTE A;  1BC7 C;  2UXX A;  5FFZ A;  3V7C A;  3CCV I;  1NK3 P;  2AS5 F;  1PDN C;  3F72 A;  1NK2 P;  1U3E M;  1KU9 A;  4KT5 C;  3LL7 A;  2RQQ A;  3AG1 H;  2O3F A;  2GM4 A;  1ZRE A;  1OCO H;  3QP5 A;  5GP9 A;  1OQY A;  2ELH A;  2AXL A;  3DXJ F;  4PJM A;  3R6S A;  1VQ4 I;  3DTK A;  2M0C A;  1S6L A;  3TOB A;  3E6C C;  1AWC A;  1YTY A;  3OIP A;  1IN6 A;  2CS3 A;  4A12 A;  5IT9 Z;  4ZH4 F;  5E1Z B;  1GLN A;  5LHG A;  2XAJ A;  3GTL J;  3ZGK A;  1G2H A;  2A5W A;  1MDM B;  3C3W A;  4YRV A;  2DT7 B;  1U5T B;  3OYA A;  3GTP J;  1TZL A;  4RLQ A;  4L0Z B;  4EVI A;  1V5F A;  2L9S A;  2R7T A;  3LQQ A;  2K9N A;  4KIC A;  3LSR A;  1TLH B;  3HOV J;  3ZMU A;  2H8R A;  3R60 A;  4OWR B;  3KEO A;  3O8G A;  2MAB A;  5DM7 F;  5M3F J;  3OYK A;  4J00 A;  2K7L A;  1JGS A;  4Q47 A;  1QA6 A;  4C2U A;  1N78 A;  2EFN A;  2GA2 A;  4KA4 A;  3H92 A;  5C4J J;  5L3E A;  2RDP A;  3DF8 A;  4W1U A;  5LEJ A;  1KQ0 A;  2IA2 A;  4YFX F;  4M3G A;  1SC7 A;  3JAM Z;  3FZV A;  2CUZ A;  3S3O A;  2TRT A;  4MIM A;  1G3W A;  2OA4 A;  4DW6 A;  4M74 A;  4LIT A;  5FD5 A;  1RR8 C;  4BDY A;  2X0L A;  1YX5 A;  4UUT A;  4ZDO A;  4IHX A;  3DTI A;  5ILV A;  1BR4 A;  5GTI C;  4Z6Y A;  2LKX A;  3ZMV A;  4BHB A;  1LEA A;  2JPC A;  1ACI A;  1LFU P;  3KP7 A;  3RQI A;  3HOU J;  2HVS A;  3DKY A;  4LG3 A;  4M9S A;  5EGO A;  2UUZ A;  1T56 A;  2L9V A;  1YW7 A;  4NC8 A;  4B47 A;  4NC6 A;  4AD9 A;  1ZQ3 P;  3LA2 A;  3LA7 A;  2F5E A;  3SQN A;  4EJT A;  4AWX B;  1NTC A;  2EA2 A;  1VQ8 I;  5E79 C;  3WE2 A;  3VB2 A;  3TMO A;  4I2O A;  3JRF A;  5C4X J;  1MMD A;  5EZH A;  5KAF C;  3J80 Z;  1MBG A;  4WCG A;  3ESW B;  4ZZD A;  3U21 A;  2B0L A;  2NS7 A;  4BGD A;  3CCS I;  1Y1V J;  3M9A A;  4IEJ A;  2Y0M A;  3BDD A;  4AYB N;  2FRH A;  1STZ A;  3MZY A;  2LBF A;  2AXT C;  2HOT A;  1QHH D;  5LRS A;  1O7L A;  2DMT A;  5E17 F;  1D0Z A;  4E4H A;  4WXC A;  3VSL A;  4UB6 C;  2KKO A;  4H4K C;  2ZFU A;  5IYC J;  2KDZ A;  2D5V A;  1YRN B;  2E7W A;  2EZI A;  2FE3 A;  2PN6 A;  3K4L A;  1Z67 A;  2PMZ A;  3LSJ A;  4DNC A;  1YIT I;  1IV8 A;  1MMG A;  1SFE A;  4MHG A;  5D8L B;  1GVD A;  2VJ4 A;  5HLT A;  1Z3X A;  3E5U A;  1GXP A;  3ERM A;  2E1C A;  5FD6 A;  1RES A;  4DJA A;  3H9Q A;  1KYZ A;  1FBS A;  4BQO A;  3I5U A;  1Y8Q B;  4QSH A;  3OYE A;  1WJF A;  2FF4 A;  2X1D A;  4IOA F;  4BE0 A;  3CCQ I;  3H0G J;  1GHC A;  3HHH A;  3K6G A;  3LST A;  2XB5 A;  3FXJ A;  4HNV A;  2EIK H;  3MZ8 A;  1YS6 A;  4RB2 C;  4Q5S F;  2R3S A;  2WAQ A;  2ZXH A;  3J81 Z;  1IUF A;  4IRI A;  1B6A A;  1MJB A;  1QZE A;  2BXZ A;  3DLA A;  1BR1 A;  3HRS A;  1HW5 A;  2W85 A;  5ILU A;  2XF5 A;  1KA8 A;  3IV5 A;  5FRN A;  4BQN A;  3H3V K;  1ZEL A;  1YJ9 I;  4CUG A;  3ERE D;  1WKM A;  1U78 A;  2X6W A;  3BTC A;  4I6Z A;  2VPR A;  2EPF A;  3AL0 C;  1BIA A;  1A04 A;  2CUJ A;  4M6Y A;  4Y4R A;  1RET A;  1G6N A;  1X3W B;  3QYE A;  3OYG A;  2DPU A;  4LMY A;  2MLK A;  3FF5 A;  2HDW A;  2HVQ A;  4XKW A;  1G3S A;  3I56 I;  3G73 A;  3R0A A;  3D1N I;  1XS9 A;  2MW8 A;  1XCB A;  2BVL A;  3WTT C;  4EAT A;  4XLH A;  1LVA A;  4I0A A;  3JSO A;  5J40 A;  1HST A;  3K4K A;  4HA8 A;  2EZL A;  1BOA A;  1WCM J;  4ESB A;  5IOY A;  1ETW A;  4EMS A;  3HTU A;  2FSW A;  3GVA A;  3KCC A;  3ZOB A;  4AM3 A;  2PJR B;  1QQI A;  3SEQ A;  3T1B A;  3VYT B;  3HPH A;  1M1E B;  1KU3 A;  1MND A;  2FBK A;  3S3M A;  4MNU A;  1X1P A;  2DDB A;  3HTS B;  1MH4 A;  3BRO A;  3I54 A;  1UCR A;  5DD4 A;  5JI6 A;  4A3J J;  2O9L A;  1LVK A;  5J8F A;  2XF6 A;  3F9K A;  1P4W A;  4RAG A;  4BE1 A;  3L1P A;  4BAY A;  1LNW A;  3GUD A;  2OQR A;  4DYQ A;  4Y13 A;  3RKQ A;  5BPD A;  1X58 A;  5EEG A;  3LNQ A;  2M30 A;  1MD0 A;  2IS1 A;  1R1U A;  3RPU D;  4HQE A;  2FD5 A;  5K1Y A;  3CJT B;  1TW2 A;  3GFM A;  4IPA A;  1SD4 A;  1ZG3 A;  2CYY A;  2R7S A;  3UR3 C;  2V1X A;  2OTL I;  1J0R A;  2DTZ A;  2VJI A;  4PJJ A;  1J75 A;  5L3D A;  1VQK I;  4NBQ A;  2DCE A;  3A01 B;  1X1A A;  2ISZ A;  3WTV C;  3AG2 H;  4CO8 A;  1FTZ A;  3S1R J;  4W97 A;  4IOC F;  3ABL H;  1GDT A;  2BHZ A;  1FP1 D;  4NQW A;  3I4P A;  5LGT A;  2LRD A;  2VOD A;  3LAJ A;  2JUG A;  4DBR A;  2EIL H;  4HX7 A;  1PYV A;  2RC4 A;  5CYV A;  1DQU A;  2L7Z A;  3BTI A;  3ZMD A;  4G94 A;  1Q1V A;  2CO5 A;  4FIS A;  2VOO A;  2B63 J;  4G7H F;  3VOE A;  3MN2 A;  3H3Z A;  4LD5 A;  2LF7 A;  3VEP A;  5C44 J;  4M72 A;  3W6V A;  3G1L A;  2KDO A;  4B43 A;  3U9G A;  1F9N A;  4BXU A;  2OD5 A;  3EPZ A;  4CCM A;  3VYU B;  1ZTR A;  5HS9 A;  4BJ5 C;  2EZK A;  4E6K G;  3BR0 A;  3CF2 A;  1EJ9 A;  3EYI A;  2EZH A;  1JJ6 C;  3Q9S A;  2DA3 A;  3K1P A;  5H6R A;  4IHT A;  1X4O A;  2A6E F;  3G71 I;  1OIS A;  5LGU A;  4EGY A;  3CO6 C;  1L0O C;  2HKX A;  2WAE A;  3CDH A;  3SDB A;  4AC0 A;  2VON A;  3OYM A;  2QGU A;  2J5P A;  2XC7 A;  1UG2 A;  2DFE A;  1SFU A;  3CC2 I;  1YQA A;  2HZD A;  4LK1 F;  2F4I A;  1D3Y A;  1SD5 A;  3JRH A;  1ETQ A;  2ZKZ A;  2XAH A;  2ZXW H;  4ZYD A;  5CKT A;  2DW4 A;  4DZP A;  1O3R A;  3BJO A;  1VQ9 I;  4ENN A;  5F04 A;  1ZHF A;  4DIQ A;  1ZR2 A;  2V7F A;  1T2K A;  3MKZ A;  2UWM A;  3J7A Y;  3VDX A;  2Z1D A;  3GFL A;  5F08 A;  2VLA A;  3WG7 H;  1SAX A;  3BR5 A;  4KMF A;  2VQH A;  2FNP A;  4XSZ F;  5F0H A;  3G6E I;  4ZYA A;  2CWE A;  1S9H A;  2P4W A;  2HNH A;  3FWE A;  3IAS 2;  1JT6 A;  1RRJ A;  2LK2 A;  2GLO A;  1FOW A;  1FT9 A;  3I3L A;  1RUO A;  1WH7 A;  2IA1 A;  2RKH A;  3MMY B;  3OY9 A;  3IP4 B;  3MWM A;  3K7A J;  3LAP A;  2QEN A;  4UNO A;  2E5Z A;  3EUA A;  5K5O A;  3DKX A;  4O5V A;  1R22 A;  1Z0X A;  1SFK A;  1OKR A;  3WU2 C;  1BI0 A;  4KIS A;  3Q0V A;  4PK4 A;  2CFO A;  4L18 B;  3OYN A;  1V5G A;  3C2B A;  2QEX I;  5FKN A;  2E19 A;  5EG0 A;  2HZT A;  4IHV A;  5GPA A;  4BQQ A;  2GZW A;  4EV0 A;  1N25 A;  3ABM H;  1ODD A;  5B1B H;  4F52 A;  4UUS B;  1RKW A;  3W6J B;  4HDV A;  2EA4 A;  1B4A A;  3CLO A;  2B9S A;  3C7J A;  4V19 K;  2DDA A;  4NNJ A;  4MEX F;  3JRG A;  4J19 A;  4C2M J;  2Y48 A;  4B09 A;  1MJA A;  1AA7 A;  1F4K A;  1NG7 A;  3GX4 X;  4A93 J;  2M0M A;  3K4B A;  4C9Y A;  1K6O A;  1U5T A;  2ME0 A;  3FXK A;  3HRT A;  4U0V A;  1OYI A;  2LC2 A;  3BG5 A;  2ECB A;  2ZNY A;  1IF1 A;  2QKL B;  2O03 A;  1O7F A;  3CJN A;  5DYM A;  4G6Q A;  3OS1 A;  2CFX A;  3OYC A;  1ZAR A;  2PI0 A;  3W2W A;  2DT6 A;  1XSV A;  2PLY A;  1W4M A;  3FMQ A;  3OWT A;  2K3P A;  3MCZ A;  2DFI A;  2Y0S A;  1KZH A;  1I39 A;  3CZ6 A;  2ZC2 A;  3N4M A;  1U0J A;  4HAM A;  2UV1 A;  3BG3 A;  3L00 A;  5F0C A;  1JXS A;  5JHF A;  2XPW A;  5JHU A;  2EFO A;  1ZH5 A;  2L4M A;  4U87 A;  1S5L C;  4D7N A;  2VQL A;  1EV7 A;  2OPT A;  5DEQ A;  4M73 A;  3NWS A;  1OFC X;  5ICC A;  1OR7 A;  1DPU A;  4KUM A;  2P5K A;  4RGU A;  1R1V A;  4UXN A;  2WV1 A;  3D5L A;  4BJT A;  3AKZ A;  2IPQ X;  2XRL A;  5IYD J;  1WWX A;  2DA1 A;  5CQG A;  4CYC B;  3BG9 A;  2OF7 A;  1UZC A;  4RM3 A;  2LG4 A;  2XSJ C;  3E6M A;  4XON A;  3TO9 A;  2LR8 A;  2IJL A;  2YX7 A;  1LDJ A;  3TO7 A;  2W82 A;  3FXL A;  5HDK A;  3L09 A;  3FM3 A;  2RQP A;  3ML6 A;  4E7K A;  1MZB A;  1E2X A;  1OCR H;  1POG A;  3HG9 A;  2ZME C;  3Q9V A;  1UHM A;  1WRJ A;  3BP8 A;  3K0L A;  4JYK A;  4L5J A;  4MO7 A;  2XSD C;  3ZQL A;  1LUJ B;  2EH3 A;  2F48 A;  4KN4 X;  2YU9 J;  4D1Q A;  4FTH A;  3KP3 A;  4BEH B;  5HLG A;  1LE8 B;  2M45 A;  5ICG A;  3K4M A;  2XIG A;  4FE7 A;  4WXH A;  1N75 A;  2VBX A;  3QQA A;  2IGO A;  5JR3 A;  4M6V A;  1I3A A;  1Z05 A;  3AL0 B;  2BY3 A;  5BQT A;  3I64 A;  4U0Y A;  3O3K A;  3HOW J;  4IO9 F;  1QNT A;  3CES A;  4JBA A;  1WFX A;  4XLC A;  4XID A;  2A5Y B;  5B66 C;  3G4S I;  3C2G A;  3WTZ A;  2YS9 A;  1DU0 A;  1WJA A;  1TNT A;  4D5F A;  2NRA C;  2FML A;  4GRI A;  3CMY A;  1E3H A;  2QSG X;  2ETH A;  1OCT C;  1EA3 A;  5FLM J;  2DOF A;  1XTA A;  3K4N A;  3OOP A;  1FX7 A;  5E20 A;  4IHW A;  4XNF A;  4RS8 A;  1ERD A;  1JT0 A;  4JX6 A;  2IA0 A;  5FJ8 J;  1REP C;  1IW7 F;  4LG0 A;  3S3N A;  5TGT A;  3WTW C;  1MH3 A;  2HGC A;  1Z7U A;  5E1X A;  3TOA A;  5EJC A;  4II3 A;  4BKX A;  4L0Y B;  2H8W A;  1R6R A;  4ZDL A;  1IRZ A;  1SAU A;  4WX9 A;  2EQR A;  3LSG A;  1PVE A;  3GTG J;  4AUX A;  2AO9 A;  2Q2E B;  1A5J A;  3FHN A;  2R5Z A;  2GA1 A;  2WY8 Q;  2WY7 Q;  1C0W A;  2X9D A;  1OCP A;  3QPT A;  1HKT A;  3V8L A;  1Z91 A;  5FB2 A;  3S8P A;  4LIU A;  2R92 J;  1WJE A;  4LB5 A;  2KZV A;  2XB0 X;  2RNG A;  1WH5 A;  1FMV A;  1SVL A;  4S0H B;  3IL2 A;  4LLG F;  1JJ8 C;  5E3M A;  1UST A;  2LSO A;  3GCM A;  2VBW A;  2C6Y A;  1I1G A;  3OL4 A;  3L2V A;  2GOM A;  4CZZ A;  1VI0 A;  2XAS A;  4RGS A;  3ZQI A;  4HLY A;  4TV7 A;  3ZMS A;  4MGR A;  2E2H J;  2BGC A;  2DLL A;  4DYC A;  3TBI A;  2NVU B;  2H09 A;  3QU3 A;  2K40 A;  3H5A A;  3QWL A;  2Q8K A;  2ZJR F;  4A3I J;  2ZJP F;  2V26 A;  2UZK A;  3SDG A;  5IPA A;  2R4G A;  3GO5 A;  2MC3 A;  1FYK A;  2F5F A;  2PJR A;  4C30 A;  1Z6R A;  1TWH J;  1FWZ A;  2FMY A;  3FMR A;  1YIO A;  2ECC A;  3R61 A;  2VKV A;  1I1S A;  2DBB A;  2PG4 A;  1F1Z A;  1WJ5 A;  1XGS A;  4MLO A;  4BNC A;  3GME A;  4NUB A;  4LGW A;  1VQ7 I;  4PFP A;  3E7L A;  2I5U A;  4G7Z F;  3IWZ A;  4IQJ A;  1A36 A;  3JW4 A;  1XMX A;  4P55 A;  4OAZ A;  2L54 A;  4K2E A;  5F1R A;  5C3E J;  1IO2 A;  3GBG A;  3ZN0 A;  2DMU A;  3A01 A;  1FNN A;  2DA6 A;  3ZXS A;  4PGG A;  2XGD A;  1D8J A;  4BUP A;  3DEE A;  2BVM A;  2AQE A;  2KRF A;  1KYW A;  4BU2 A;  3RI4 A;  4YIF A;  4IXA A;  3W2V A;  3MKW B;  2RGV A;  2LYC A;  3KYD B;  4V2G A;  1ZRD A;  1FY7 A;  3AG3 H;  2W25 A;  5CVV A;  3EUH A;  4P5O A;  3H0D A;  3FIW A;  2NNN A;  5D5U B;  2DYR H;  5FO5 A;  1V5E A;  4LJZ F;  2NVX J;  1Z77 A;  3HBL A;  1XGN A;  2CQX A;  4E7Z A;  2VI6 A;  3TW7 A;  5AIQ A;  1G4D A;  1K7A A;  3CCJ I;  4CHU A;  3MFK A;  3BR3 A;  1P92 A;  2EFP A;  4B4C A;  1XDU A;  2RVC A;  2IVM A;  5K7F A;  2JWT A;  1T38 A;  4KIB A;  4G7O F;  4RDU A;  4EQQ A;  2EBI A;  3RKY A;  1G8X A;  2FBI A;  3LFK A;  3O6B B;  1ZLK A;  2L9N A;  1AKH A;  3R4K A;  2XKO A;  4EM2 A;  2DOA A;  1FBU A;  5DCM B;  5DV5 A;  1TWA J;  1MBJ A;  1NG6 A;  1B8I B;  3RTR A;  4UY8 I;  4IJA A;  1XX5 A;  2E1N A;  1B59 A;  1IDZ A;  1LDD A;  3LOC A;  1IN7 A;  3FXU A;  2HXI A;  3GEZ A;  2QBY B;  2P6S A;  1YIJ I;  2W4S A;  1JUS A;  4HF2 A;  2R7U A;  1DP7 P;  4LFU A;  5A2Q Z;  2JA2 A;  5TRD A;  2K5C A;  4XIC A;  4XLN F;  2FU4 A;  1B72 B;  4U7B A;  3GFI A;  1N77 A;  2CV0 A;  1V3F A;  2M4G A;  3RYR A;  4N4N B;  4OMY A;  2ESH A;  2XAU A;  3PSF A;  5GPC A;  1AOY A;  4HG2 A;  4CZC A;  2V6C A;  5E3L A;  3KZZ A;  2VE9 A;  1B1B A;  1AU7 A;  4HW0 A;  1JKP C;  3F8B A;  3GTK J;  3QP6 A;  3OV8 A;  5J4Y A;  3HHG A;  4MTE A;  3LSP A;  3EUK L;  2K4B A;  4IX7 A;  3X2Q H;  3K70 D;  4I76 A;  1MW7 A;  2V9K A;  1UB9 A;  1HA8 A;  1MBH A;  3CQZ J;  2BE5 F;  3VOD A;  5GTH C;  2OV7 A;  5DUI A;  3IUO A;  3H1C A;  1A35 A;  3U1K A;  5H6Q A;  2XGX A;  4HNU A;  3BZC A;  1R58 A;  2PFB A;  2A07 F;  2COB A;  2PMH A;  2CQQ A;  5J1Y A;  2Y69 H;  4KJZ A;  1DGR M;  1X4P A;  1Q1H A;  1HF0 A;  2I10 A;  4RGX A;  2DPD A;  2QA4 I;  3GZN B;  4Y15 A;  5ERI A;  2KIU A;  1VQN I;  1T6S A;  1U6G A;  5E18 F;  3O2P E;  2IEK A;  4P96 A;  4U0W A;  4UUS A;  3I71 A;  2BHY A;  5K7H A;  4X1E A;  2XUB A;  4UVC A;  1SMT A;  2K9M A;  4G9Y A;  1T95 A;  3RPU A;  4RAY A;  1V4R A;  1PUE E;  3QOE A;  1QVU A;  4RMN A;  2DFF A;  1RKT A;  2HQ5 A;  4KFC A;  3HYI A;  3OIQ A;  2NOJ B;  3HSF A;  4M3F A;  1H9G A;  4Z2Y A;  1MBF A;  4CCK A;  1FOK A;  3FDY A;  4P9F A;  4PFO A;  3A0H C;  2TCT A;  3QPS A;  4I09 A;  4QPO A;  2CV1 A;  3WHB A;  1FIP A;  3MD2 A;  2XGE A;  3WU1 B;  2CJJ A;  1SFO J;  1Y8R B;  3TED A;  3RYP A;  1BI1 A;  5H2F C;  1QPM A;  2JMW A;  5D8K B;  3CMM A;  2H6B A;  2HPM A;  1JI8 A;  3IAM 2;  3ISP A;  3BG6 A;  2ZME B;  4BXX J;  2XPV A;  4XOT A;  2ZFW A;  4F92 B;  5FKL A;  3ZCO A;  4EM0 B;  2D1H A;  2JSC A;  3FXR A;  3JRA A;  4ZTF A;  1FOX A;  1ETV A;  1X1D A;  1ZAO A;  4EJO A;  2LMD A;  4A5M A;  1AHD P;  4BQA A;  4NHJ A;  1Z3Y A;  4XRS G;  2IXS A;  4ZDP A;  2FJ1 A;  2ZCW A;  4DOZ A;  1ZRC A;  3KP2 A;  3SYT A;  1PUF A;  5ICF A;  3DPL C;  2DK5 A;  4RA2 A;  1OMI A;  5L3B A;  3RDI A;  3AFH A;  3T8T A;  9ANT A;  1PJR A;  1BI3 A;  3CC4 I;  2DMP A;  1A6I A;  2H6C A;  1W36 D;  1ETK A;  4L9T A;  2L4A A;  3MVP A;  3G2B A;  5HOO A;  4BAC A;  1ZKG A;  5B1A H;  4FX0 A;  2DAO A;  2ZJQ F;  2EV6 A;  4P1W A;  3FXO A;  4GGG A;  3BQY A;  3P9K A;  4MEY F;  3DBR B;  4ZYE A;  5M5Y J;  3W2A A;  3HKZ A;  2XV4 S;  1K83 J;  4RAF A;  2CQK A;  1ZG5 A;  1KU2 A;  2LH9 A;  5AON A;  2L7F P;  4U7D A;  2A3S A;  1LFP A;  3ZQ7 A;  4CCO A;  5CJ9 A;  5EDN A;  1F5T A;  5FLX K;  1W5C C;  1KU7 A;  2FX0 A;  3VYS B;  3GTM J;  1T0F C;  2M9H A;  2DQR A;  3FBN B;  5FKM A;  2HXO A;  4IL6 C;  2OQG A;  3KZY A;  4XN0 A;  1SD7 A;  3HL2 A;  4HST A;  1PP7 U;  4UB8 C;  3ZQG A;  1LDK B;  4PJ0 C;  5FGM A;  3TQN A;  3CCR I;  2R5Y B;  1MNM C;  2NXN B;  3CUQ C;  1VND A;  3P9C A;  4HF1 A;  1FIA A;  3SJM A;  1I6X A;  2HR3 A;  1S3J A;  2CQ7 A;  2K27 A;  2KIF A;  2QQ9 A;  5FKK A;  4UVA A;  2CUF A;  5HNF A;  4AU7 A;  1JGG A;  4HNT A;  5H20 A;  4JOM A;  4E7S A;  3KLN A;  2DMQ A;  4R1H A;  4A0X A;  1FOY A;  3HJE A;  1XMA A;  1WQ2 A;  2P8T A;  5J6X A;  2MA3 A;  3J7Z I;  5BMZ A;  5LHH A;  4IZZ A;  2VB6 A;  1EH6 A;  2EFQ A;  5DTD A;  5IP7 J;  3JTG A;  4HPQ A;  5FLV A;  1GXQ A;  4GXO A;  1TWC J;  3GTO J;  4L9J A;  1UG0 A;  1WGX A;  1WJB A;  4F7Z A;  2CG4 A;  1XD7 A;  3P5J A;  5JVG F;  3I4M J;  4YII A;  5CVU A;  4FET A;  2QQA A;  2E71 A;  1I3Q J;  3F0C A;  4B44 A;  2A61 A;  2X4H A;  2OC6 A;  2Y9Y A;  4HX4 A;  1RC9 A;  3A03 A;  3WTY C;  4CGZ A;  4XSX F;  2QF7 A;  2LLK A;  2BW3 B;  2KP6 A;  1W0U A;  2X1C A;  3NAR A;  3TW6 A;  3A02 A;  2HQA A;  2H1K A;  2RN7 A;  3OOU A;  3GZ6 A;  3FK6 A;  3K2A A;  1R5I D;  1WVR A;  4ZJZ A;  3R0J A;  3RZD J;  4KDP A;  4N9I A;  4HRI A;  1E3P A;  5J1U A;  5GAG J;  1XG1 A;  4UUV A;  5CLS A;  1UHW A;  5BNG A;  1MMN A;  2HTJ A;  4PDK A;  1DGW Y;  3C1D A;  1G59 A;  3OSF A;  1YE9 A;  2KFD A;  5J8C A;  4XOR A;  3V7R A;  1O3T A;  1TQI A;  4HOB A;  1MKM A;  1GUU A;  4A3E J;  3CC7 I;  1JKO C;  5K7Z A;  2PMZ N;  1EH7 A;  5L3F A;  2EJR A;  3I58 A;  5HVQ C;  2JRT A;  2F6C A;  2EV5 A;  3KX2 A;  2ELJ A;  4KIT B;  1CF7 A;  3GF2 A;  4YEL A;  2HDD A;  3FX3 A;  2H27 A;  4FCY A;  1Z1D A;  3HUG B;  1OLT A;  2NVT J;  2IGN A;  4R8H A;  2JVG A;  4CIC A;  5JLX A;  2VKE A;  5CVI A;  2HPI A;  2XKP A;  3KYL A;  2EV0 A;  3HPG A;  1DPR A;  3N97 A;  4JK1 X;  3S2D J;  2WAQ N;  4XBF A;  1P4A A;  2G0E A;  1X3Z B;  3ZN1 A;  2JK3 A;  4Y7N J;  5KCM A;  1VQ5 I;  3PQJ A;  4LK0 F;  1SD6 A;  2A6T A;  3F8N A;  5ED4 A;  3S15 J;  2DJN A;  1XGO A;  2CV2 A;  4PSX A;  1BM9 A;  3EQL F;  2H94 A;  3J7Y J;  3GW2 A;  3HOT A;  4G8X A;  3EET A;  2VC1 A;  4B1R A;  5J47 A;  2D45 A;  2BBY A;  4S05 A;  3P9I A;  4MQV A;  2EIM H;  1HDP A;  1ZGA A;  3PUB A;  1IJW C;  1A6Q A;  2KZG A;  2Q0O A;  3CDL A;  3PSI A;  3TO6 A;  2V1U A;  2LY1 A;  1DU6 A;  3ELK A;  4PZJ A;  4XLE A;  4CYD A;  1K61 A;  1VQ6 I;  2IT0 A;  3K69 A;  3DBL B;  1UFM A;  2G9W A;  5IT9 K;  5K5Q A;  3TGN A;  1LB2 A;  2D2W A;  2GIV A;  1BJA A;  2IP2 A;  1HCR A;  3V4G A;  3HGG A;  3C2H A;  1ONV A;  3ZPL A;  3ULQ B;  5EGO B;  5BPI A;  4NDL A;  4WWC A;  2E1O A;  4MQ9 F;  3S17 J;  2VIX A;  4XOP A;  4KMU X;  4YG2 F;  1ON2 A;  4KIG A;  3K1M A;  5LHI A;  4FQG A;  1MDM A;  5CVR A;  2OCC H;  4BBS J;  1Y0N A;  2X51 A;  3BPV A;  1Z7L A;  1CGP A;  1WI3 A;  5F0F A;  3L2C A;  1QVT A;  1U2W A;  2M1B A;  3DU6 A;  1W5S A;  3NAU A;  2ME6 A;  3RJP A;  2WAF A;  1HSJ A;  2A6H F;  3QOD A;  2E34 A;  2VAS A;  3JAM K;  3CP8 A;  1I50 J;  2ZSH B;  5F6F A;  3LMM A;  4RLF A;  3HSR A;  5DM6 F;  2CW8 A;  3DU5 A;  4BL0 B;  3S14 J;  3HOY J;  3QYB A;  4EJU A;  4ENM A;  2RAE A;  3ZMZ A;  2LBF B;  1TBX A;  3OIO A;  2LVS A;  3HGY A;  2R7R A;  2FOW A;  1ZN2 A;  3WGI A;  4KYW A;  2DN0 A;  3E0J B;  5JFR A;  4QLC U;  1QRY A;  4OAY A;  4RM2 A;  1OR7 C;  3DLL F;  2CU7 A;  3W3C A;  2JRM A;  1MSE C;  3MEX A;  1QO0 D;  4HV6 A;  4JX5 A;  2L7M P;  2ZXI A;  3NEU A;  3V42 A;  1VQM I;  1XDS A;  2DOD A;  1SEU A;  1U9O A;  3S32 A;  5B5E C;  1R49 A;  1IRF A;  4UV9 A;  1I6H J;  1IRG A;  2EFW A;  2BY0 A;  4XKC A;  2DA5 A;  2JA7 J;  5D5X B;  3LQR A;  3ZQQ A;  4I7H A;  1P7I A;  3V8J A;  4YFN F;  4FE4 A;  1LPQ A;  1J09 A;  2YPR A;  4LLN A;  2DT5 A;  4E7I A;  4XRS A;  2OAZ A;  2F4M B;  3WOD F;  3Q0U A;  2LY2 A;  2EIJ H;  3A4C A;  4PUS A;  3LSK A;  4L9V A;  2V9P A;  3JSP A;  1Z6T A;  1O3Q A;  4XK4 A;  3JRC A;  1KGS A;  1XC5 A;  4U88 A;  2PMU A;  1FSH A;  1USS A;  5L3G A;  4L5E A;  3IC7 A;  4CCJ A;  2ID3 A;  2FA5 A;  4ESJ A;  4A3G J;  2ESN A;  5DD8 A;  5DS9 A;  2GXG A;  1TL8 A;  2I8D A;  4OIO F;  5HDG A;  1JUM A;  1IC8 A;  5KHD A;  1MIJ A;  3I4N J;  4HYE A;  2E2I J;  1YOV B;  4GCV A;  5FKO A;  2JN6 A;  3SEZ A;  2WBM A;  1BIB A;  4H0E A;  2HYJ A;  1QGP A;  1YRN A;  1XGM A;  2O8K A;  1APL C;  1QZZ A;  1JTY A;  1IXS B;  3JR9 A;  3H9G A;  3GLX A;  3E97 A;  2MSY A;  2MYS A;  2R93 J;  1E0E A;  1MSF C;  2DTR A;  3AG4 H;  2OBP A;  4B3A A;  2PEX A;  3LSI A;  3LFU A;  3RCO A;  2IGM A;  1ETY A;  3IH4 A;  4EJW A;  4WXD A;  1IAW A;  3KE2 A;  2WB1 A;  2PX9 A;  3I0T A;  2K85 A;  2M3A A;  2KIS A;  5AIP A;  5HS8 A;  3ASN H;  2ISY A;  2PQ8 A;  3TDU C;  1Z21 A;  1Y56 A;  2J5O A;  3DTE A;  4D9J A;  4BE2 A;  2Z9O A;  1QZY A;  3TKY A;  5IP6 A;  2HWV A;  2X6Y A;  2QYO A;  2XAF A;  3CUQ B;  4B3X A;  4CDG A;  4EEF G;  4FAS D;  2FXA A;  1BOB A; 
#chains in the Genus database with same CATH homology
 4HDU A;  5LGN A;  2P5V A;  1IXC A;  3DQV C;  2NNY A;  4B8X A;  4ESF A;  2ZJ2 A;  4A6D A;  4PGH A;  4IRH A;  3BOQ A;  4UVB A;  2O0Y A;  1R5H A;  4HF0 A;  5K5R A;  1FP2 A;  1NHA A;  3ECO A;  3CO7 C;  1IZ1 A;  3F6O A;  1S7O A;  3M7G A;  4A2U A;  5KVR A;  1QBJ A;  1J2X A;  4LLL A;  1IN5 A;  1BC8 C;  3ZP5 A;  2MD5 A;  4OIR F;  1HBX G;  2YR2 A;  3DKW A;  3WTX C;  2XVC A;  2KJB A;  4RAZ A;  2GXB A;  3K9T A;  2P6T A;  3REO A;  4E70 A;  1G3T A;  4CXF A;  2HTS A;  5CVJ A;  4GO1 A;  1FSE A;  2LKP A;  1DUX C;  2IRF G;  2HYG D;  2HOE A;  2XRN A;  3K2Z A;  1PP8 F;  1BBY A;  1TQM A;  4OIQ F;  2OZU A;  1KQ8 A;  4BHP A;  3RKW A;  5LLQ A;  1I5Z A;  2QM3 A;  1RNL A;  1OYW A;  2M87 A;  1ZLJ A;  1P2F A;  2W24 A;  3M1E A;  3WTU C;  4RGR A;  2O6G E;  4IHS A;  3F6V A;  3KP5 A;  4FX4 A;  1K79 A;  3U2R A;  5IT3 A;  4QWQ A;  2HDC A;  4Q48 A;  2F5C A;  2ZO4 A;  1IN4 A;  2YU3 A;  2W84 A;  4HX8 A;  3COA C;  1T39 A;  2V1D A;  4A6E A;  4Q4Z F;  5D5W B;  3CUO A;  4A0Y A;  3HUG A;  3DP7 A;  1FPQ A;  2LNB A;  4M9X A;  1FC3 A;  3F22 A;  3PQK A;  2MH9 A;  2QLZ A;  4NB5 A;  1ULY A;  2P5L C;  3I59 B;  5ILS A;  1HXD A;  2YX4 A;  5F64 A;  2WC2 A;  2LF8 A;  2V79 A;  1YW9 A;  4M71 A;  3V7S A;  3HRM A;  2BEO A;  1XSD A;  5HDN A;  2STT A;  4N9H A;  4IRG A;  4HV5 A;  1K78 B;  2PBI A;  3M8E A;  1XB4 A;  1LJ9 A;  2G7U A;  4IF4 A;  1H9T A;  1XCV A;  4M9Z A;  2JPB A;  2XRO A;  4N0B A;  1BN5 A;  3ECH A;  4IVN A;  4G6D A;  3RIR A;  3GFJ A;  2O8X A;  4ON0 A;  2O61 A;  2A68 F;  3NQO A;  2NAZ A;  2MBF A;  3AAF A;  3QPH A;  4I01 A;  2A69 F;  2JTV A;  2ZNZ A;  1LQ1 A;  4D0P A;  4OU0 A;  1RIO H;  1S7A A;  3BJA A;  3BPX A;  1X3U A;  2VBY A;  3ABU A;  1TNS A;  3PFI A;  4P9U A;  1O3S A;  1YLF A;  1W7P B;  3TDZ C;  5D4S A;  2JZY A;  3FM5 A;  4LB6 B;  4EGZ A;  1FYM A;  1IN8 A;  4AIH A;  1YS7 A;  1I27 A;  1IUY A;  3SZP A;  3RKX A;  4MTD A;  3KP6 A;  1S29 A;  5HLI A;  5LRR A;  3WGG A;  1YFH A;  2NYX A;  2K02 A;  2HKO A;  4LG0 B;  1JE8 A;  3FHZ A;  4ASN A;  2Y75 A;  3F8M A;  4R79 A;  5FFX A;  6PAX A;  1T98 A;  4AIK A;  3G3Z A;  2FNA A;  3CTA A;  4EJV A;  3W6K B;  1KQ9 A;  4UHT A;  1D5V A;  2LDU A;  1R00 A;  2R7F A;  2WWY A;  3FXQ A;  1J7K A;  2VN2 A;  3IRR A;  1HKS A;  5EEH A;  3T5X A;  3D0S A;  3RPQ A;  5BS6 A;  3KEQ A;  2FOK A;  1D8K A;  1RUN A;  1OYY A;  4GYI A;  1R23 A;  3GXO A;  4L9N A;  1T0F A;  2Z99 A;  3F8F A;  3MZH A;  4RB0 A;  2CGP A;  2VT3 A;  4ENK A;  1ON1 A;  5LBQ A;  1E17 A;  1U8R A;  3NRV A;  1TQP A;  4I98 B;  4I02 A;  1SMY F;  3CUQ A;  2Q2E A;  2CW0 F;  2DK8 A;  2EWN A;  5E8I A;  4XRF A;  3SHF A;  3IRQ A;  4PCQ A;  3EYY A;  2F5D A;  5LEK A;  3F3X A;  4I0B A;  2STW A;  3IKT A;  5D6F A;  5DUK A;  3HSE A;  2OZ6 A;  3DEU A;  1TTY A;  4ZZL A;  2K86 A;  4FHT A;  3MQ0 A;  4FT8 A;  2RV8 A;  2NS0 A;  3IKV A;  1ZRF A;  3J7A O;  2HFH A;  1P6R A;  1XMK A;  1WSU A;  2XHK A;  3ZMT A;  2ACJ A;  1YYV A;  2F2E A;  2QZ8 A;  2MH2 A;  2QVO A;  4OIP F;  4DQ2 A;  1J59 A;  2GWR A;  1B9M A;  1VTN C;  4S04 A;  4KIF A;  4BH9 A;  1W5T A;  4O3M A;  3QOP A;  1MJ9 A;  4HLX A;  1BI2 A;  1P4X A;  1JHH A;  1B9N A;  5JVT A;  3FMS A;  4RB1 A;  2VC0 A;  3HRU A;  3QU6 A;  2XAQ A;  3GWZ A;  5HS7 A;  3LWF A;  3M8F A;  1FLI A;  1WI9 A;  3SZT A;  3BWG A;  4JQF A;  2L02 A;  4O6J A;  3DFG A;  3U1D A;  3MAJ A;  1ZG1 A;  4EM1 A;  3WGH A;  1U5T C;  1R36 A;  4UV8 A;  3KP4 A;  4Y17 A;  3E6D A;  2HQN A;  2W57 A;  2MLG A;  5DCM A;  4WF2 A;  3E5Q A;  3HIF A;  5A2Q K;  3F23 A;  2HQR A;  2K4J A;  1FYL A;  2QBY A;  5E1W A;  4A0Z A;  3SXY A;  3LA3 A;  1J9I A;  1GVJ A;  1OPC A;  1IXR C;  2DU9 A;  2L01 A;  2R7D A;  2QQB A;  2QWW A;  3I59 A;  2XAG A;  5DDG A;  3S2W A;  1XN7 A;  3F8C A;  2KIM A;  3DPT A;  3JTH A;  4BYY A;  1R1T A;  2FQ3 A;  3T8R A;  2IW5 A;  1R5G A;  3GYH X;  1L3L A;  3WE3 A;  1K78 A;  3WU0 A;  1MGT A;  3J80 K;  3BZ6 A;  4A5N A;  3EDP A;  2DO7 A;  1DDN A;  2VE8 A;  5TJJ A;  5BOX A;  2FBH A;  5DCF A;  3H3U A;  4RB3 C;  1FZP B;  1HQC A;  3E5X A;  2Z3Y A;  1LEB A;  3ABT A;  1H0M A;  5D5V B;  2JT1 A;  1YO5 C;  2L3D A;  2QUF A;  3ROU A;  3WG9 A;  2FEZ A;  4ETS A;  4YFK F;  4L5I A;  2ZME A;  1YW8 A;  2P7V B;  3P7N A;  1ZYR F;  2ZBK A;  5FLX Z;  4KN7 X;  3J81 K;  2M8E A;  1W7P A;  2D1V A;  3BJ6 A;  5HLH A;  5ICE A;  2GQQ A;  2KJC A;  3E3V A;  4HZF A;  1Z9C A;  5D6E A;  5KK1 A;  3KFW X;  1TW3 A;  4WK8 F;  2BYV E;  2HEO A;  4XLP F;  1J5Y A;  2GAU A;  2HS5 A;  3C18 A;  2VXZ A;  4ZYH A;  3K1N A;  3V8K A;  1G3Y A;  5E8G A;  3KLO A;  2HYF A;  2DQL A;  1HW2 A;  1RI7 A;  2UXN A;  2ADU A;  2VT2 A;  1EH8 A;  2ZXJ A;  3IHU A;  3IWF A;  4BHC A;  1FBQ A;  1RZ4 A;  2Z5U A;  4HQM A;  4AIJ A;  3B73 A;  3T0Y A;  4HBL A;  3L9F A;  2M5W A;  2COM A;  3B02 A;  2RNJ A;  1R7J A;  3WTS C;  2VBZ A;  2VOP A;  3F21 A;  3QRF F;  1S8N A;  3BY6 A;  4ENJ A;  2G7H A;  3L7W A;  4OMZ A;  2BV6 A;  3KET A;  2TDX A;  2EK5 A;  1CF7 B;  2V9V A;  4ZYG A;  2YSR A;  3SFZ A;  2DI3 A;  3QAH A;  3GZ5 A;  3DV8 A;  4OOI A;  1SFX A;  4AVP A;  1YG2 A;  2WV0 A;  1ZGJ A;  3Q5F A;  1JHF A;  2EB7 A;  1HKQ A;  4KNY A;  4M6X A;  2Z33 A;  3I53 A;  1Y0U A;  1HW1 A;  2OU2 A;  3HOS A;  4GYG A;  4OIN F;  2P7C B;  2E7X A;  1XSX A;  5L3C A;  3VFZ A;  1W7P D;  1O57 A;  3E6B A;  2PJP A;  2CSO A;  5D4R A;  2WTE A;  1BC7 C;  2UXX A;  5FFZ A;  3V7C A;  2AS5 F;  1PDN C;  3F72 A;  1U3E M;  1KU9 A;  4KT5 C;  2O3F A;  1ZRE A;  3QP5 A;  2ELH A;  2AXL A;  3DXJ F;  3R6S A;  3TOB A;  1S6L A;  3E6C C;  1AWC A;  1YTY A;  1IN6 A;  4A12 A;  5IT9 Z;  4ZH4 F;  5E1Z B;  2XAJ A;  1MDM B;  3C3W A;  1U5T B;  4L0Z B;  4EVI A;  3LQQ A;  4KIC A;  1TLH B;  3ZMU A;  3R60 A;  3KEO A;  2K7L A;  1JGS A;  4Q47 A;  2EFN A;  2GA2 A;  4KA4 A;  3H92 A;  5L3E A;  2RDP A;  3DF8 A;  5LEJ A;  1KQ0 A;  2IA2 A;  4YFX F;  3JAM Z;  3FZV A;  1G3W A;  2OA4 A;  4M74 A;  5FD5 A;  2X0L A;  5ILV A;  3ZMV A;  4BHB A;  1LEA A;  2JPC A;  3KP7 A;  4M9S A;  1YW7 A;  4AD9 A;  3LA2 A;  3LA7 A;  2F5E A;  3SQN A;  4EJT A;  4AWX B;  2EA2 A;  3WE2 A;  3VB2 A;  4I2O A;  3J80 Z;  4WCG A;  4ZZD A;  2B0L A;  3M9A A;  2Y0M A;  3BDD A;  2FRH A;  1STZ A;  3MZY A;  5LRS A;  1O7L A;  5E17 F;  4WXC A;  2KKO A;  2E7W A;  2PN6 A;  2FE3 A;  4DNC A;  4MHG A;  1SFE A;  5D8L B;  3E5U A;  1GXP A;  2E1C A;  5FD6 A;  1KYZ A;  1FBS A;  3I5U A;  2FF4 A;  1GHC A;  3HHH A;  3LST A;  1YS6 A;  4RB2 C;  4Q5S F;  2R3S A;  3J81 Z;  4IRI A;  1B6A A;  1MJB A;  3HRS A;  1HW5 A;  2W85 A;  5ILU A;  1KA8 A;  3ERE D;  1WKM A;  1U78 A;  1BIA A;  1A04 A;  4M6Y A;  1G6N A;  2DPU A;  4LMY A;  2MLK A;  3FF5 A;  1G3S A;  3G73 A;  3R0A A;  1XCB A;  3WTT C;  1LVA A;  4I0A A;  3JSO A;  1HST A;  4HA8 A;  1BOA A;  4ESB A;  4EMS A;  3HTU A;  2FSW A;  3GVA A;  3KCC A;  1QQI A;  3T1B A;  2FBK A;  1KU3 A;  4MNU A;  3HTS B;  3BRO A;  3I54 A;  1UCR A;  5DD4 A;  5JI6 A;  5J8F A;  1P4W A;  4BAY A;  1LNW A;  3GUD A;  2OQR A;  4Y13 A;  5BPD A;  5EEG A;  2M30 A;  1MD0 A;  1R1U A;  4HQE A;  5K1Y A;  1TW2 A;  3GFM A;  4IPA A;  1SD4 A;  1ZG3 A;  2CYY A;  2V1X A;  1J0R A;  1J75 A;  5L3D A;  2ISZ A;  3WTV C;  4CO8 A;  1FP1 D;  4NQW A;  3I4P A;  5LGT A;  2VOD A;  3LAJ A;  4HX7 A;  2RC4 A;  5CYV A;  3ZMD A;  4G94 A;  2CO5 A;  2VOO A;  4G7H F;  3VOE A;  3H3Z A;  4LD5 A;  2LF7 A;  3VEP A;  4M72 A;  3U9G A;  1F9N A;  4BXU A;  2OD5 A;  5HS9 A;  3EYI A;  3Q9S A;  3K1P A;  5H6R A;  4IHT A;  2A6E F;  4EGY A;  5LGU A;  3CO6 C;  1L0O C;  2HKX A;  3CDH A;  2VON A;  2J5P A;  1SFU A;  1YQA A;  4LK1 F;  1D3Y A;  1SD5 A;  2ZKZ A;  2XAH A;  4ZYD A;  2DW4 A;  1O3R A;  3BJO A;  4ENN A;  1ZHF A;  1T2K A;  2UWM A;  3GFL A;  1SAX A;  4KMF A;  2FNP A;  4XSZ F;  2CWE A;  2P4W A;  3FWE A;  1FT9 A;  1RUO A;  2IA1 A;  2RKH A;  3LAP A;  3MWM A;  2QEN A;  4UNO A;  5K5O A;  4O5V A;  1R22 A;  1OKR A;  1BI0 A;  4L18 B;  2HZT A;  2GZW A;  4EV0 A;  1ODD A;  3W6J B;  4HDV A;  2EA4 A;  1B4A A;  3CLO A;  3C7J A;  4MEX F;  2Y48 A;  4B09 A;  1MJA A;  1F4K A;  3GX4 X;  1K6O A;  1U5T A;  3HRT A;  4U0V A;  1OYI A;  2ZNY A;  1IF1 A;  2O03 A;  1O7F A;  3CJN A;  5DYM A;  4G6Q A;  2CFX A;  1ZAR A;  2PI0 A;  1XSV A;  2PLY A;  1W4M A;  3FMQ A;  3MCZ A;  2DFI A;  3N4M A;  4HAM A;  1JXS A;  3L00 A;  5JHU A;  2EFO A;  1ZH5 A;  2L4M A;  1EV7 A;  5DEQ A;  4M73 A;  5ICC A;  1OR7 A;  1DPU A;  4KUM A;  2P5K A;  4RGU A;  1R1V A;  4UXN A;  3D5L A;  2IPQ X;  1WWX A;  3TO9 A;  3E6M A;  2IJL A;  2YX7 A;  1LDJ A;  3TO7 A;  5HDK A;  3L09 A;  3FM3 A;  2RQP A;  3ML6 A;  1MZB A;  1E2X A;  3Q9V A;  1UHM A;  1WRJ A;  3BP8 A;  3K0L A;  4L5J A;  4KN4 X;  3KP3 A;  5HLG A;  2M45 A;  5ICG A;  2XIG A;  4WXH A;  2VBX A;  5JR3 A;  1Z05 A;  5BQT A;  3I64 A;  4U0Y A;  3O3K A;  1QNT A;  4JBA A;  2A5Y B;  3WTZ A;  1TNT A;  2NRA C;  2FML A;  2ETH A;  3OOP A;  1FX7 A;  5E20 A;  4RS8 A;  2IA0 A;  1REP C;  1IW7 F;  4LG0 A;  3WTW C;  2HGC A;  1Z7U A;  5E1X A;  3TOA A;  4L0Y B;  4WX9 A;  2GA1 A;  1C0W A;  3QPT A;  1HKT A;  3V8L A;  1Z91 A;  5FB2 A;  4LB5 A;  3IL2 A;  4LLG F;  1UST A;  2LSO A;  2VBW A;  2C6Y A;  1I1G A;  4CZZ A;  4HLY A;  2XAS A;  4RGS A;  4TV7 A;  3ZMS A;  4MGR A;  2BGC A;  2DLL A;  2H09 A;  3QU3 A;  2Q8K A;  2UZK A;  3GO5 A;  2MC3 A;  1FYK A;  2F5F A;  1Z6R A;  2FMY A;  1FWZ A;  3FMR A;  1YIO A;  3R61 A;  1I1S A;  2DBB A;  2PG4 A;  1F1Z A;  1XGS A;  4BNC A;  4LGW A;  4G7Z F;  3IWZ A;  3JW4 A;  4P55 A;  2L54 A;  4K2E A;  5F1R A;  3ZN0 A;  1FNN A;  4PGG A;  1D8J A;  2KRF A;  1KYW A;  3RI4 A;  4YIF A;  4IXA A;  2RGV A;  1ZRD A;  1FY7 A;  2W25 A;  5CVV A;  3EUH A;  4P5O A;  2NNN A;  5D5U B;  5FO5 A;  4LJZ F;  1XGN A;  5AIQ A;  1G4D A;  1K7A A;  4CHU A;  3MFK A;  1P92 A;  2EFP A;  1XDU A;  2RVC A;  2IVM A;  1T38 A;  4KIB A;  4G7O F;  4EQQ A;  3RKY A;  2FBI A;  3LFK A;  3O6B B;  1ZLK A;  3R4K A;  2XKO A;  4EM2 A;  1FBU A;  5DCM B;  5DV5 A;  3RTR A;  4IJA A;  2E1N A;  1B59 A;  1LDD A;  1IN7 A;  3FXU A;  3GEZ A;  2QBY B;  2P6S A;  4HF2 A;  1DP7 P;  4LFU A;  5A2Q Z;  5TRD A;  4XLN F;  2FU4 A;  4U7B A;  3GFI A;  1V3F A;  3RYR A;  4OMY A;  2ESH A;  1AOY A;  2V6C A;  3KZZ A;  2VE9 A;  1B1B A;  4HW0 A;  3F8B A;  3QP6 A;  3OV8 A;  3HHG A;  4MTE A;  2K4B A;  1UB9 A;  2BE5 F;  3VOD A;  5DUI A;  5H6Q A;  2XGX A;  1R58 A;  2PFB A;  2A07 F;  2PMH A;  1Q1H A;  4RGX A;  2DPD A;  4Y15 A;  5ERI A;  2KIU A;  1T6S A;  1U6G A;  5E18 F;  3O2P E;  4P96 A;  4U0W A;  3I71 A;  2XUB A;  4UVC A;  1SMT A;  4G9Y A;  3RPU A;  1PUE E;  4RAY A;  1V4R A;  4KFC A;  3HYI A;  3HSF A;  4Z2Y A;  1FOK A;  1H9G A;  4P9F A;  4I09 A;  3WU1 B;  3RYP A;  1BI1 A;  1QPM A;  5D8K B;  2H6B A;  3ISP A;  2ZME B;  2ZFW A;  4EM0 B;  2D1H A;  2JSC A;  3FXR A;  1ZAO A;  4EJO A;  4A5M A;  4BQA A;  4NHJ A;  2ZCW A;  1ZRC A;  3KP2 A;  5ICF A;  3DPL C;  2DK5 A;  1OMI A;  5L3B A;  3RDI A;  3T8T A;  1BI3 A;  2H6C A;  4L9T A;  2L4A A;  5HOO A;  4FX0 A;  2DAO A;  2EV6 A;  4GGG A;  4ZYE A;  3P9K A;  4MEY F;  2XV4 S;  2CQK A;  1ZG5 A;  1KU2 A;  5AON A;  4U7D A;  2A3S A;  3ZQ7 A;  1F5T A;  5FLX K;  5CJ9 A;  1KU7 A;  2DQR A;  2OQG A;  3KZY A;  1SD7 A;  1PP7 U;  1LDK B;  5FGM A;  3TQN A;  3CUQ C;  3P9C A;  4HF1 A;  1I6X A;  2HR3 A;  1S3J A;  2K27 A;  2KIF A;  2QQ9 A;  4UVA A;  5H20 A;  4A0X A;  3KLN A;  4R1H A;  1XMA A;  1WQ2 A;  2P8T A;  5J6X A;  2MA3 A;  5BMZ A;  5LHH A;  1EH6 A;  2EFQ A;  3JTG A;  1GXQ A;  4GXO A;  4L9J A;  4F7Z A;  2CG4 A;  1XD7 A;  4YII A;  5CVU A;  2QQA A;  2A61 A;  2X4H A;  4HX4 A;  3WTY C;  4CGZ A;  4XSX F;  2RN7 A;  3GZ6 A;  3R0J A;  4KDP A;  4N9I A;  4UUV A;  5CLS A;  1UHW A;  4PDK A;  2HTJ A;  3C1D A;  5J8C A;  3V7R A;  1O3T A;  1TQI A;  4HOB A;  1MKM A;  1EH7 A;  5L3F A;  2EJR A;  3I58 A;  5HVQ C;  2JRT A;  2EV5 A;  1CF7 A;  3GF2 A;  3FX3 A;  2H27 A;  1Z1D A;  4R8H A;  4CIC A;  5CVI A;  2XKP A;  2EV0 A;  1DPR A;  3N97 A;  4JK1 X;  4XBF A;  1P4A A;  3ZN1 A;  3PQJ A;  4LK0 F;  1SD6 A;  3F8N A;  5ED4 A;  1XGO A;  1BM9 A;  3EQL F;  2H94 A;  3GW2 A;  3HOT A;  4G8X A;  3EET A;  2VC1 A;  2D45 A;  2BBY A;  4S05 A;  3P9I A;  4MQV A;  1ZGA A;  2Q0O A;  3TO6 A;  2V1U A;  3ELK A;  4PZJ A;  4CYD A;  2IT0 A;  3K69 A;  1UFM A;  2G9W A;  5IT9 K;  5K5Q A;  3TGN A;  1LB2 A;  2D2W A;  2GIV A;  1BJA A;  2IP2 A;  3V4G A;  1ONV A;  3ZPL A;  3ULQ B;  5BPI A;  4WWC A;  4MQ9 F;  4YG2 F;  4KMU X;  1ON2 A;  4KIG A;  3K1M A;  5LHI A;  1MDM A;  5CVR A;  3BPV A;  1CGP A;  3L2C A;  1U2W A;  2M1B A;  1W5S A;  3RJP A;  1HSJ A;  2A6H F;  3JAM K;  5F6F A;  3HSR A;  4EJU A;  4ENM A;  3ZMZ A;  1TBX A;  1ZN2 A;  3WGI A;  4KYW A;  5JFR A;  4QLC U;  3MEX A;  1QO0 D;  4HV6 A;  3NEU A;  1XDS A;  1IRG A;  1IRF A;  4UV9 A;  2EFW A;  5D5X B;  3LQR A;  4I7H A;  3V8J A;  4YFN F;  2YPR A;  4LLN A;  2DT5 A;  2OAZ A;  3WOD F;  4L9V A;  3JSP A;  1Z6T A;  1O3Q A;  1KGS A;  4U88 A;  2PMU A;  1FSH A;  1USS A;  5L3G A;  3IC7 A;  2FA5 A;  4ESJ A;  2ESN A;  5DD8 A;  2GXG A;  4OIO F;  5HDG A;  4HYE A;  4GCV A;  1BIB A;  4H0E A;  1QGP A;  1XGM A;  1QZZ A;  1IXS B;  3GLX A;  3E97 A;  2DTR A;  2OBP A;  2PEX A;  4EJW A;  4WXD A;  1IAW A;  3KE2 A;  3I0T A;  5AIP A;  5HS8 A;  2ISY A;  2PQ8 A;  3TDU C;  2J5O A;  2Z9O A;  1QZY A;  3TKY A;  2HWV A;  2QYO A;  2XAF A;  3CUQ B;  4CDG A;  2FXA A;  5LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...