2P5KA

Crystal structure of the n-terminal domain of ahrc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
NKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title A high-resolution structure of the DNA-binding domain of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 22
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p5kA00
4RGSA 3M9AA 4HW0A 2QVOA 2Q0OA 2NYXA 5CVVA 3R6SA 4P96A 3WTUC 2X0LA 1J59A 5IT9K 2HOEA 1FNNA 2ETHA 1QPMA 1Z6RA 2FF4A 3F72A 2ZNYA 1F1ZA 4HF0A 1MZBA 2UZKA 4BH9A 4O3MA 4P55A 2Z99A 4YFKF 5BPIA 3ERED 5J8CA 1R1VA 3BY6A 3LAPA 5ILUA 3F21A 4UV9A 1IN8A 1W4MA 5DDGA 2H27A 3HSRA 1USTA 2GA2A 4LK0F 3BDDA 1XGMA 6PAXA 4EMSA 4OIPF 2WV0A 2V9VA 3I53A 3O2PE 4HYEA 3G73A 1IZ1A 1U5TC 4PZJA 1OYIA 3FXQA 4CDGA 1DDNA 4KICA 1FZPB 4TV7A 1FOKA 4HA8A 1OR7A 1BOAA 4G6QA 4D0PA 2FNPA 1ZLJA 5K5RA 5A2QZ 3BJ6A 1WSUA 5D5VB 4I7HA 1KU9A 5EEHA 4OU0A 1H0MA 4P9UA 1TNSA 2CQKA 4NB5A 4DQ2A 2HGCA 3L2CA 2VT2A 3T8RA 3MZYA 4I0AA 3HYIA 5K5QA 3V4GA 1XD7A 1ZG5A 4MEYF 4FHTA 3JSOA 2L54A 3COAC 3K69A 4U0WA 1Z9CA 3V7CA 3T0YA 5LEKA 2GZWA 2C6YA 3C1DA 4RGUA 4L0YB 4KYWA 3GVAA 3GXOA 1TW3A 2MLKA 5K1YA 2XROA 2ADUA 2ZMEB 2RNJA 3B73A 1SAXA 3CO7C 1MKMA 4KIGA 4Y17A 3N4MA 1NHAA 4CGZA 1TW2A 1YS7A 1O3QA 5ICFA 3EETA 2FA5A 1USSA 1J75A 2R7DA 2QZ8A 1ZREA 2KIFA 3IWFA 5ILVA 1C0WA 3EYIA 3Q9VA 3HOTA 2V1UA 1YFHA 5EEGA 5IT9Z 2EJRA 3IRRA 1TBXA 1K78B 4I01A 3F8BA 1YTYA 4HQMA 2K7LA 1G3TA 1EV7A 2XGXA 4KFCA 2Q8KA 5BS6A 3JAMZ 4CO8A 1ZHFA 3QPHA 2Q2EA 3VOEA 3V8KA 3RI4A 1R22A 1WWXA 4N0BA 2L02A 1HQCA 3GFJA 3WTTC 3RIRA 3HRMA 1XMAA 2GXBA 2ZKZA 4FX4A 2P5LC 4G94A 2XAHA 1FBUA 1W7PB 2V6CA 3F3XA 5DD4A 4QLCU 1XDUA 4BNCA 4YIFA 4MEXF 2EFPA 4EJOA 3DPLC 1ZN2A 3E5UA 3W6KB 3CUQC 4L9TA 1JGSA 1XGSA 2H94A 4HZFA 1O3SA 1W5TA 1L3LA 2VBXA 3CJNA 1D8KA 1RI7A 3IWZA 3DF8A 2DPDA 2W84A 2IP2A 4OINF 2DI3A 2FU4A 5J8FA 2GQQA 1J9IA 2D1VA 2XAJA 2FMYA 5JI6A 3FM3A 2HYFA 4HDUA 2XIGA 4ESBA 2QBYB 3L7WA 5FLXZ 1R5HA 4A12A 3SFZA 4L5IA 2H6BA 2NAZA 1I1SA 3WU1B 4JQFA 2JSCA 2PFBA 5K5OA 4IVNA 3HTSB 1SD4A 4XBFA 1XB4A 4YFXF 1XSXA 4LLNA 3LAJA 5D6EA 2RN7A 2A07F 5DYMA 3V7RA 5E8IA 5JFRA 2FSWA 1T98A 2EB7A 1XN7A 2M5WA 2FBKA 3VB2A 4EM0B 4UVCA 3F8MA 4PCQA 3TO6A 1G4DA 1HKTA 4HV6A 1OYWA 1KU7A 1KYZA 3WTVC 4LFUA 5CVJA 1R23A 5FGMA 3CO6C 4HF1A 2VBZA 1S29A 2PMHA 2KJBA 2Y0MA 1LDDA 4B8XA 4UV8A 1IAWA 3TQNA 2HTJA 5LGUA 4RB0A 1HKSA 1V3FA 3E6DA 5HDKA 2AXLA 1RNLA 4BXUA 2O0YA 2V1XA 2H6CA 5DD8A 1RUOA 4EM2A 3C3WA 1XMKA 2DFIA 4CXFA 1KQ8A 2A68F 4N9IA 2EV5A 1KU3A 4R1HA 1MD0A 5LBQA 3PFIA 1WRJA 4LD5A 4M6YA 3GZ5A 4I98B 4PDKA 3BPXA 2HYGD 4WF2A 5DUIA 1HSJA 1LJ9A 2ZO4A 4IXAA 2EA2A 2E1CA 3IC7A 3PQKA 3VODA 3K9TA 3F6OA 4WX9A 2COMA 2XAGA 3ZMSA 1K7AA 2YU3A 1CGPA 2STWA 1YO5C 4Q48A 3F22A 2K86A 3ECOA 3TGNA 4Y15A 2EV0A 4A6DA 2P7VB 3K2ZA 2Y48A 3HRSA 2VOPA 1XGNA 3DEUA 3FMSA 1JE8A 4ESJA 3C18A 3MAJA 2FOKA 4G7OF 1DPRA 1F9NA 3E3VA 3L00A 3TDZC 3EUHA 4EJUA 1Z91A 5HVQC 4FT8A 3M7GA 1ULYA 3GW2A 3GZ6A 2YR2A 3R0AA 2JPCA 5BQTA 3LA3A 3HUGA 3KP2A 2KIUA 1KGSA 2O3FA 4ENNA 3BPVA 4CICA 2K27A 4KDPA 3GX4X 4LG0B 3I59B 5D8LB 3BROA 4KT5C 5DCFA 2QENA 2OA4A 2LF8A 2RKHA 1TLHB 3U1DA 3CLOA 2DTRA 4QWQA 1TQIA 4XSXF 4CHUA 4ZZLA 1TQPA 2EA4A 1KU2A 4AD9A 3GFIA 4HF2A 2IA0A 3LQRA 2XUBA 1BI3A 5D8KB 3QU6A 3HOSA 3RKWA 1ZG3A 1WQ2A 4LMYA 4OIOF 2XASA 3E6CC 2OZUA 2JTVA 5D5WB 4RS8A 1FX7A 1K78A 5ED4A 4HX4A 1QZZA 4RAZA 3J81Z 3HTUA 1XCVA 1IN5A 3J80K 4Y13A 1O57A 1QQIA 1D8JA 2L4AA 2Z33A 2V1DA 1KYWA 3J7AO 3ECHA 2K4JA 2QQBA 5FFZA 5HS7A 4WWCA 3O6BB 3OV8A 2NNNA 3B02A 4OMZA 1BC8C 2A69F 3KEOA 1W7PA 1VTNC 5ICCA 3TO9A 5CVIA 3ABTA 3L09A 3I54A 1YW8A 2ZFWA 1IRFA 3EQLF 1Z6TA 1QGPA 1H9GA 4HX8A 3FXUA 2QQAA 2VBYA 5FO5A 5E18F 2STTA 4ENMA 1F5TA 3KFWX 3QP6A 4U7DA 1V4RA 2ACJA 2QBYA 2YX4A 2NS0A 2KRFA 1MGTA 4KN4X 2PG4A 4KNYA 2DK8A 2V79A 2CW0F 3HIFA 4OOIA 3Q5FA 2HQRA 4ETSA 1I6XA 4KIFA 1RZ4A 1X3UA 4CZZA 3DV8A 2OD5A 3JTGA 2PMUA 3LFKA 2ZJ2A 1J7KA 4A0YA 4MQVA 4AWXB 3V7SA 2HS5A 3MWMA 2MA3A 2EFNA 1OYYA 2K4BA 4XLPF 3WTXC 4G6DA 3GFMA 5F6FA 3M1EA 5TRDA 1IW7F 2IVMA 3SQNA 4OMYA 5KVRA 2DAOA 3DKWA 3E5XA 4O6JA 2P6TA 3HSEA 1S7AA 4WCGA 5BOXA 3ZPLA 3OOPA 3REOA 1U78A 3TDUC 2VE9A 1F4KA 4ZYGA 1B59A 4ZH4F 5ERIA 4AIHA 2TDXA 4IPAA 2R7FA 5HLIA 3ULQB 4EV0A 4LB5A 1QZYA 4AIJA 1BI0A 1E2XA 1R00A 2ESNA 3KLNA 4G7HF 3GFLA 3M8FA 2YPRA 1OPCA 3TOBA 5ICGA 2F2EA 1LDKB 4MGRA 2QQ9A 1IXCA 4I0BA 4IRHA 4HQEA 2OBPA 4M72A 3I5UA 1O3RA 3K0LA 4L18B 4RB3C 3WU0A 1L0OC 2KIMA 4WXHA 3KCCA 1BJAA 4S05A 4JK1X 5D4SA 1SD6A 2A5YB 1IF1A 3KP7A 1ZH5A 1A04A 1SFUA 2VXZA 5LLQA 2HDCA 1FC3A 2EV6A 4PGHA 4HDVA 3EYYA 1UFMA 3RYPA 2XKPA 1CF7B 3V8JA 2A6HF 2CWEA 5HOOA 1JXSA 2FBHA 3ZMUA 5ICEA 1ZG1A 4Q47A 1FBQA 4EJWA 3NRVA 1TNTA 4G8XA 3ML6A 1U3EM 4ENKA 4U7BA 4R8HA 1FP2A 2IPQX 3G3ZA 3IKTA 5CVUA 5BPDA 4LLGF 3WGIA 3FWEA 5AONA 4GGGA 2H09A 1GXQA 5H6QA 1ZARA 2L3DA 1BI2A 1FSEA 3RPUA 5JR3A 4ZYHA 4M9SA 1YLFA 1P6RA 1WI9A 3C7JA 2XKOA 3JW4A 3ISPA 3VEPA 1ONVA 3DPTA 3FX3A 5DUKA 2HEOA 3WGGA 2GIVA 2OU2A 2WTEA 4LG0A 3IL2A 2BEOA 2HTSA 1SD7A 4GYGA 2VOOA 2DQLA 3I59A 4BQAA 2PI0A 1YS6A 1LNWA 4U0YA 4KMFA 5LHGA 1U6GA 1BN5A 3TO7A 2HQNA 3O3KA 1EH6A 1FY7A 5H6RA 2D1HA 5HS9A 1YW9A 5F1RA 5E1ZB 5CJ9A 2FXAA 4ZYEA 2VONA 3ZP5A 1O7LA 4LK1F 2IJLA 5HLGA 5DCMA 2HWVA 1I1GA 1HKQA 3EDPA 4EQQA 3ELKA 4AIKA 3QAHA 2XAFA 5E1XA 2P5VA 5D5UB 3ZN1A 4KIBA 4RGRA 1U8RA 2DPUA 2BE5F 2ISZA 2RQPA 4L5JA 3SZPA 3KP4A 3QU3A 4HLXA 1XDSA 4JBAA 5LGNA 1I5ZA 1WKMA 4WXDA 5AIPA 2DBBA 3CUOA 5DEQA 4G9YA 2G7UA 3HRUA 4LLLA 1QO0D 1S3JA 4M9XA 1T6SA 2ZNZA 2OQGA 3SZTA 5L3CA 3F23A 4L9NA 1B9NA 1FT9A 4HLYA 5L3FA 1T38A 3IHUA 3JTHA 1ZLKA 3ROUA 3AAFA 4HV5A 4ENJA 1LQ1A 1HSTA 3LSTA 5E17F 1ON2A 3TKYA 2PN6A 1FPQA 3R60A 2KKOA 2A6EF 5L3EA 2MLGA 3KEQA 2OAZA 1PDNC 3S2WA 1LEAA 4A5NA 5HDNA 2K02A 1R1TA 3LA7A 2DO7A 4OIRF 1Z7UA 1JHHA 1T2KA 2D45A 4RGXA 3RKYA 4UVBA 5L3DA 2CYYA 4P5OA 2Z3YA 2J5OA 2O6GE 3KP3A 1BM9A 2X4HA 2IA2A 3FZVA 4XRFA 5FFXA 2Y75A 3I58A 1Z1DA 4RAYA 2E7XA 1J2XA 2MH2A 4I2OA 3P9IA 1ZRFA 3QRFF 4IHSA 1FWZA 5E8GA 4IRIA 2MD5A 3NEUA 4MQ9F 3WGHA 1K79A 3FHZA 3GO5A 4XSZF 1AOYA 5A2QK 4MTDA 1UHWA 1HXDA 2G9WA 2XHKA 3GEZA 3RTRA 3U2RA 3GF2A 1ZRCA 4A5MA 3RPQA 1U5TB 1KQ0A 4ESFA 2J5PA 2ZMEA 1U2WA 5FB2A 2ZCWA 2DK5A 1R1UA 1T39A 2EK5A 1PP7U 4M71A 3KZZA 3E6MA 3I64A 1PUEE 4A6EA 2IA1A 3W6JB 4A2UA 1GXPA 3DFGA 2MC3A 1GVJA 2O8XA 3FXRA 2CG4A 3ZMZA 2VC1A 4M9ZA 4P9FA 1LDJA 4BHCA 3BWGA 4KUMA 2G7HA 4KMUX 3T8TA 1HBXG 1G3WA 5CYVA 1MDMB 4MNUA 1XCBA 4FX0A 3WTWC 5L3BA 2QLZA 1ZRDA 5CVRA 2FMLA 4Q4ZF 3E5QA 2P4WA 1OMIA 3HRTA 3D0SA 4YG2F 2UWMA 1Z05A 1AWCA 2XVCA 2F5CA 2MBFA 1YG2A 5LRSA 2W57A 2ESHA 2VN2A 5F64A 3JAMK 1SFEA 5E1WA 3SHFA 5AIQA 3NQOA 1IUYA 4NHJA 4DNCA 2VC0A 1EH8A 1CF7A 1BIAA 2F5EA 3HHHA 3L9FA 3R61A 1K6OA 3P9KA 4RB1A 4EVIA 4M73A 2LKPA 2GXGA 4GYIA 2HKXA 3QOPA 5ILSA 3WE2A 1FYKA 2P7CB 3JSPA 2EWNA 2JRTA 3I4PA 1MJBA 1IN4A 4I09A 1REPC 2L4MA 2WWYA 1HW2A 4IRGA 2IW5A 4IJAA 4KA4A 5LEJA 1LB2A 3F6VA 3I71A 4M6XA 4UVAA 4EM1A 4M74A 2QUFA 1HW5A 3HSFA 3QPTA 1MJ9A 4WK8F 3LWFA 4NQWA 1RUNA 2EFOA 3BP8A 4F7ZA 1SMTA 3KP6A 3CUQB 1DPUA 2UXNA 5FLXK 3MFKA 3R0JA 4S04A 2M45A 4UUVA 2QM3A 3GUDA 1LEBA 2DQRA 2FNAA 4B09A 1RIOH 3BJAA 3CDHA 1B1BA 3ZMDA 1J5YA 3DXJF 4IF4A 5J6XA 5KK1A 1XSDA 5CLSA 3RDIA 5JVTA 1G3SA 1ODDA 3J80Z 3WTZA 1D3YA 3ZQ7A 2F5FA 3WTSC 4E70A 1B9MA 4BAYA 1FLIA 1PP8F 4KN7X 5FD6A 1XGOA 3RKXA 2IRFG 3M8EA 2CGPA 2P8TA 2BBYA 2FE3A 1IN7A 1P2FA 4UHTA 2JT1A 4EJTA 5HS8A 2B0LA 3IRQA 3F8NA 3WE3A 2W25A 2XRNA 2FBIA 3IKVA 1XSVA 2CFXA 3DP7A 3MQ0A 4Z2YA 2KJCA 2CSOA 2GA1A 3GWZA 4I02A 1BIBA 5HLHA 4HAMA 4BHBA 2DLLA 1KQ9A 2RC4A 1YYVA 4LB6B 2NNYA 3T5XA 2RV8A 3ZMTA 2R3SA 4GCVA 5DV5A 3K1MA 2AS5F 4OIQF 2IT0A 3H3UA 2PLYA 1YIOA 1BC7C 1G6NA 2Z5UA 4UXNA 1STZA 1SMYF 1LVAA 3FF5A 2RGVA 2P5KA 1Q1HA 1G3YA 3KE2A 3FM5A 2ISYA 1FBSA 3P7NA 1UB9A 2BYVE 1ZGAA 2FQ3A 1P92A 2F5DA 4WXCA 3F8CA 2A3SA 2M1BA 3K1PA 1O3TA 1IXRC 2M87A 1BI1A 2ELHA 2HKOA 1IRGA 2LF7A 1FP1D 3KLOA 3CTAA 1ON1A 2DW4A 1OKRA 3KETA 4L9VA 5L3GA 3I0TA 2UXXA 3TOAA 3F8FA 1U5TA 3R4KA 2YSRA 3ZN0A 4XLNF 2O03A 3MCZA 1UCRA 1FSHA 2OQRA 1P4WA 4AVPA 5FD5A 1TTYA 1UHMA 2DT5A 5D6FA 1B6AA 3E97A 4Q5SF 4IHTA 2XAQA 2WC2A 3KP5A 2CO5A 2VODA 3U9GA 1GHCA 4HOBA 1R36A 3BZ6A 2E7WA 1B4AA 5LHHA 2FEZA 5LHIA 3BJOA 3K1NA 1MDMA 3RYRA 1Y0UA 5HDGA 2OZ6A 5TJJA 4GO1A 5D4RA 1I27A 2EFWA 1S8NA 2LSOA 1ZYRF 3HHGA 4R79A 4G7ZF 2GWRA 2RVCA 4YIIA 3ZMVA 2JZYA 4O5VA 2MH9A 2D2WA 2HFHA 4MTEA 4RB2C 3H3ZA 3V8LA 1QBJA 3WODF 3RJPA 2PEXA 3J81K 1O7FA 3WTYC 5D5XB 5JHUA 1R7JA 2M8EA 2GAUA 2O61A 2ZXJA 3H92A 4N9HA 4U88A 3LQQA 4CYDA 2W24A 4YFNF 2PBIA 4A0XA 3PQJA 1T0FA 4L0ZB 4ZYDA 1R5GA 2JPBA 2PQ8A 2ZBKA 4PGGA 2A61A 4BYYA 3QP5A 2QYOA 2RDPA 1HW1A 3T1BA 4L9JA 5LGTA 1H9TA 3FMQA 2HR3A 3KZYA 4HX7A 1KA8A 2YX7A 2BV6A 5H20A 4A0ZA 2M30A 2VE8A 1D5VA 1S7OA 3N97A 1IXSB 1W5SA 2W85A 4U0VA 4LGWA 3MEXA 2XV4S 2LDUA 3ABUA 5LRRA 1W7PD 3E6BA 5IT3A 1SD5A 3VFZA 4ASNA 3CUQA 3FMRA 4HBLA 1TQMA 1J0RA 4BHPA 1IN6A 3D5LA 3Q9SA 2P6SA 2LNBA 1P4XA 1QNTA 4ON0A 1YW7A 4LJZF 2L01A 2VT3A 1JHFA 2Z9OA 1R58A 1BBYA 1ZGJA 1MJAA 3BOQA 3SXYA 2DU9A 4EJVA 4EGZA 1YQAA 4UNOA 5E20A 2HZTA 1DP7P 1SFXA 2NRAC 2QWWA 3GYHX 1E17A 3LA2A 3DQVC 1P4AA 2FRHA 3WG9A 1ZAOA 4GXOA 2E1NA 4EGYA 3GLXA 5BMZA 2VBWA 1EH7A 1DUXC 4K2EA 5DCMB 4ZZDA 4MHGA 2BGCA 1S6LA 1FYMA 2EFQA 4H0EA 1FYLA 3MZHA 2PJPA 3P9CA
chains in the Genus database with same CATH superfamily
4RGSA 3M9AA 4HW0A 2QVOA 2Q0OA 2NYXA 5CVVA 3R6SA 4P96A 2NOJB 4X6AJ 3WTUC 2E35A 2R7SA 2X0LA 1J59A 2F5VA 2R7RA 1R4MB 5B66C 5IT9K 2HOEA 2XB5A 3I9V2 4F52A 2R7UA 3S3NA 1FNNA 2ETHA 1QPMA 2BXZA 1Z6RA 2EH3A 1HLVA 2FF4A 3F72A 5JLXA 2M0MA 1WI3A 3G2BA 4HG2A 1UJ8A 2BW3A 3TW6A 4E4HA 1S7EA 3CCMI 2ZNYA 4BACA 2M3AA 4XM3A 4AYBA 4XQFA 1F1ZA 4HF0A 1MZBA 2ZXHA 2UZKA 3DTEA 4BH9A 2X6XA 4P55A 4O3MA 4BE1A 4J00A 2Z99A 3DKXA 4YFKF 5BPIA 3ERED 5J8CA 1FEXA 1R1VA 3BY6A 3LAPA 3GTOJ 2K9SA 1W5CC 1BJZA 4QPQA 5ILUA 3OYAA 3F21A 5TISC 4BY1J 5CPRB 4UV9A 2NVUB 1IN8A 5CKTA 4BE0A 1W4MA 2MW8A 5DDGA 2H27A 1P9QC 2PJRB 2JVHA 3HSRA 3LSPA 1QHGA 1USTA 3HEFA 2DT6A 2GA2A 4LK0F 3BDDA 1XGMA 3CP2A 6PAXA 4EMSA 4OIPF 2K9QA 2MABA 2WV0A 5K7HA 2V9VA 3PNYA 3I53A 3O2PE 4HYEA 4BJ5C 3G73A 2MSYA 4BY7J 1IZ1A 1FTZA 1TT5B 2LOOA 3QODA 1U5TC 4PZJA 1OYIA 3FXQA 4CDGA 1DDNA 4KICA 4F92B 2WAQN 1FZPB 4TV7A 1GUUA 1FOKA 1QU3A 4HA8A 1OR7A 2RREA 2X6WA 1BOAA 4G6QA 2V6EA 4D0PA 2MGQA 3ZCOA 2FNPA 1WFXA 1ZLJA 3CCRI 5K5RA 3JRBA 2E5ZA 5A2QZ 3JRCA 3BJ6A 2R93J 1WSUA 5D5VB 4I7HA 5FKLA 5GAHJ 1KU9A 1U0JA 4PK4A 3JRDA 4LOCA 5EEHA 3BT9A 4OU0A 4DZJA 1SVOA 3FXOA 1H0MA 4P9UA 3OSFA 3S17J 1FOWA 1TNSA 2CQKA 1QVTA 4NB5A 4DQ2A 2HGCA 3L2CA 3CCVI 3OYCA 1BR1A 2X9DA 4HPQA 4DBQA 2VT2A 4Y33A 1HF0A 3T8RA 1VQ9I 3MZYA 3ZOBA 3B6AA 3HUGB 4I0AA 1R6RA 2EBIA 4PFPA 3HYIA 3FXJA 2MFZA 5K5QA 3V4GA 2BXYA 1XD7A 5K7FA 1ZG5A 4LIUA 4MEYF 2ELKA 4FHTA 3JSOA 2L54A 2IGOA 3COAC 3OYFA 5J1YA 3K69A 2Y9YA 4U0WA 5FRNA 1ZTRA 5GP9A 1W1WE 1Z9CA 4D5CA 3V7CA 3T0YA 5LEKA 2GZWA 4M3EA 2C6YA 3C1DA 5IPAA 2HVSA 4BJ6C 2Y30A 4JX5A 4RGUA 4L0YB 4RLQA 4KYWA 3GVAA 5LD2C 3NARA 3GXOA 2DOFA 1DQUA 1TW3A 2MLKA 3LMMA 5K1YA 1KZHA 2XROA 1A31A 2ADUA 2ZMEB 1V5EA 2RNJA 3B73A 1SAXA 3CO7C 1MKMA 3H1CA 4KIGA 4Y17A 1TC3C 3N4MA 3DBHB 4F93B 1NHAA 4CGZA 2GLOA 4DYRA 1TW2A 4A3EJ 2F4IA 1YS7A 1N25A 5ICFA 1O3QA 1WPKA 3EETA 2FA5A 1QRYA 3RPUD 1USSA 1J75A 1T0FC 2QZ8A 2R7DA 4E7LA 1ZREA 1N75A 3VYTB 2KIFA 3IWFA 5ILVA 1C0WA 3EYIA 3Q9VA 1MBFA 2IAIA 3HOTA 1YFHA 5EEGA 2V1UA 5IT9Z 1IRZA 3MKWB 2EJRA 4ZDPA 2CUJA 4JX6A 4E7ZA 1TBXA 3IRRA 4I01A 1K78B 2DXIA 3GTGJ 3F8BA 1YTYA 4HQMA 2LK2A 2LC2A 2K7LA 1HA8A 2KRHA 3FBNB 1G3TA 1TWGJ 4C3HJ 1EV7A 3FXMA 2XGXA 4KFCA 2Q8KA 5BS6A 2PMZN 3JAMZ 5E3MA 1E3HA 4CO8A 2ZJPF 1SAUA 1ZHFA 3QPHA 2VQHA 2Q2EA 3VOEA 3V8KA 3RI4A 1R22A 3ZQGA 1WWXA 4C30A 4N0BA 2L02A 1YJ9I 1HQCA 2A6TA 3GFJA 4F3QA 3RIRA 3WTTC 3UKGA 1H89C 3HRMA 3ZQFA 2DA5A 1XMAA 1UMQA 4IQ4A 2ZKZA 2GXBA 1AA7A 4FX4A 1XPXA 2JA6J 2YU9J 2ZXIA 4CH7A 2P5LC 4G94A 2XAHA 1FBUA 3LL7A 1W7PB 2V6CA 5IYCJ 5DM6F 2AHQA 4F55A 3F3XA 5DD4A 4QLCU 1XDUA 4J19A 4BNCA 1RKWA 2XDVA 4YIFA 4MEXF 2EILH 2EFPA 1SVMA 3OYNA 4EJOA 3DPLC 4HSRA 2VIXA 1ZN2A 3I4NJ 4XL9A 3E5UA 4BU2A 3W6KB 3CUQC 4L9TA 3HPGA 4XK4A 1JGSA 4B4CA 1XGSA 1R49A 2H94A 4HZFA 1O3SA 2K40A 5FKKA 1W5TA 1L3LA 1JJ6C 3PNTA 2VBXA 3CJNA 2R7ZJ 2KL4A 2BHYA 3SEZA 4DW6A 1D8KA 4IX7A 1RI7A 2WB1A 4DJAA 3IWZA 3DF8A 4B3AA 2DPDA 2DA6A 2W84A 4Z6YA 3S1RJ 1NK3P 3AL0B 2IP2A 4OINF 2DI3A 4Y52J 2FU4A 3U21A 2E34A 5J8FA 5EG0A 5K7ZA 2ZSIB 2E2JJ 2GQQA 1IG7A 3AG3H 1J9IA 3DBLB 3SFIA 2D1VA 2DFEA 2XAJA 2Z2SB 2FMYA 4CCLA 5JI6A 3FM3A 2HYFA 4HDUA 2XF6A 3K4NA 3KEYA 3RQ4A 2XIGA 2XPVA 3KIOA 4ESBA 2QBYB 1RR8C 3MVPA 3L7WA 5FLXZ 1R5HA 4A12A 4GFBA 3SFZA 1MIJA 5JHFA 4L5IA 2H6BA 2XGCA 2NAZA 1I1SA 1U9NA 2ZJRF 3WU1B 4JQFA 1X2NA 1IV6A 2KP6A 2JSCA 2PFBA 2DMTA 4A3KJ 5K5OA 1VQ5I 4IVNA 1K4TA 1G59A 1SD4A 3HTSB 5IYBJ 2HU9A 4XBFA 4C9YA 1FOYA 1XB4A 4YFXF 1XSXA 4LLNA 2OTJI 1MW7A 3LAJA 1ETXA 2R5YA 4A3CJ 5D6EA 2RN7A 3EUKL 4XLHA 2A07F 3I3LA 5DYMA 4ABZA 5F04A 3V7RA 5E8IA 4MFDA 3S93A 2EZHA 4I76A 5JFRA 3M3YJ 3HZJA 2KFDA 2FSWA 1TT0A 3O8HA 1T98A 2EB7A 4NQWB 1ETOA 3HBLA 1Z7LA 4PJMA 1XN7A 2M5WA 2FBKA 2LMDA 3VB2A 4EM0B 4UVCA 2UUZA 3F8MA 4MLOA 4PCQA 3SDBA 3TO6A 4QSHA 2M4KA 1G4DA 4EEFG 1HKTA 3LSJA 4HV6A 1HOMA 1OYWA 4C3IJ 1KU7A 1KYZA 2IGNA 3WTVC 4LFUA 1H8AC 1U9OA 1R23A 5CVJA 1Y8QB 5F08A 3Q0UA 5FGMA 3BZCA 3CO6C 1RPWA 4HF1A 2VBZA 1A6QA 4PFOA 1S29A 2V4JC 3QQAA 3BQYA 4JP0A 4M6VA 4ITVA 1Y1VJ 2PMHA 1ZKGA 2KJBA 2QF7A 1LFUP 2F48A 2Y0MA 1LDDA 2R4GA 4B8XA 3ZGKA 2E36A 3GLLA 4UV8A 1IAWA 2HTJA 3TQNA 1ERDA 5LGUA 2CH0A 5FKMA 4NC6A 4RB0A 1DP3A 3LFUA 4BEHB 1HKSA 1V3FA 3HGYA 2L2OA 2WADA 3E6DA 5HDKA 4XLEA 3OL3A 2AXLA 5KHDA 2MG4A 1RNLA 2NOGA 1YRNA 2XGEA 4BXUA 2O0YA 2V1XA 3K7AJ 1OCOH 2H6CA 3TP0A 5DD8A 1A36A 4AM3A 1RUOA 2KLOA 4EM2A 3C3WA 3LSIA 1XMKA 2O5RA 2DFIA 2IS1A 4CXFA 1KQ8A 2A68F 4N9IA 1GVDA 1OJLA 2EV5A 1K61A 1KU3A 1JUPA 1UG2A 4R1HA 1GV5A 1X4OA 1F43A 1Y8RB 1MD0A 1Z77A 5LBQA 1Y56A 2EIJH 1WRJA 3PFIA 4LD5A 3J7ZI 2XF5A 4M6YA 4JOMA 3GZ5A 3G1MA 4I98B 2RQQA 1DGRM 4PDKA 3BPXA 1OR7C 4BQOA 3BQZA 5B5EC 2X6YA 1YX3A 2HYGD 2OCCH 2LY9A 4WF2A 5DUIA 1HSJA 4XRSA 1LJ9A 3L2RA 2ZO4A 1FJLA 4IXAA 2EA2A 3Q3SA 1DU6A 3TMOA 2E1CA 3IC7A 3PQKA 3KPHA 3VODA 2XB0X 4BQNA 2LP0A 3K9TA 2Z1DA 1ETYA 2COMA 1WHUA 3F6OA 4WX9A 1IRGA 2LREA 2XAGA 2R7TA 3ZMSA 2Y9ZA 2YU3A 1K7AA 1JT6A 2PJRA 1CGPA 1G8XA 3Q0WA 2V7FA 1F36A 5B1AH 1I6HJ 2STWA 1YO5C 2L9RA 2N8GA 4Q48A 4P1WA 3F22A 2K86A 3V42A 3ECOA 3OYLA 3TGNA 4Y15A 5HLTA 2W7NA 2EV0A 5JVGF 3PJRA 4A6DA 2P7VB 2OJED 3ESWB 3K2ZA 1W0TA 1JGGA 2Y48A 3HRSA 3K4MA 4FE4A 3L2VA 2VOPA 5J1UA 1XGNA 3DEUA 3FMSA 1YE9A 4XKWA 1JE8A 4ESJA 1E0EA 2X51A 3VSKA 3C18A 3MAJA 3K4CA 5CQEA 2E5NA 2K3FA 2LH9A 2FOKA 2W82A 4G7OF 3DTKA 1DPRA 2X48A 3IAS2 2ELJA 4A3DJ 1GDTA 1VF9A 5DTDA 2WAQA 4S0HB 1OISA 4A3MJ 1F9NA 2O7OA 3E3VA 2VQLA 2IEKA 3L00A 3TDZC 3I55I 5EYRA 3EUHA 4EJUA 4M3FA 1Z91A 3ASOH 5HVQC 4NC7A 4FT8A 3M7GA 4YRVA 4B1RA 4FCYA 1ULYA 4BBSJ 2KQRA 4DYQA 4M3DA 4UUSB 2LFBA 3GW2A 2EZKA 3GZ6A 3BC8A 3WHBA 3HJEA 4IKFA 1LFBA 5EEAA 2YR2A 2V1NA 2L9VA 2HI3A 2JJ7A 3R0AA 4XN0A 2JPCA 5BQTA 1APLC 3CJQB 3QOEA 3LA3A 3HUGA 3KP2A 2KIUA 3JCUC 5GTHC 3BZKA 1KGSA 3L2UA 1LKXA 2O3FA 4ENNA 3BPVA 4CICA 2GIZA 5LFAA 3OYIA 2ID6A 2HZDA 2K27A 4KDPA 3GX4X 4EATA 4LG0B 5TGTA 1VZ0A 1MMDA 3I59B 5D8LB 2BVMA 3NAUA 3BROA 4BBRJ 3G4SI 2HDDA 2XPWA 2A5WA 1PVEA 1ETKA 3CESA 3DLAA 2DA7A 4KT5C 5DCFA 2QENA 2OA4A 2LF8A 2RKHA 5KNLA 1TLHB 3U1DA 2HXOA 2DTRA 2K5CA 2KPMA 3CLOA 4QWQA 3OIOA 2VJ5A 4HNVA 1TQIA 2VKVA 3BG3A 1X58A 1VQ7I 4XSXF 2LG4A 3QYFA 4YEJA 4CHUA 4ZZLA 1TQPA 2EA4A 1KU2A 1IRXA 4XKVA 2PX9A 3H5NA 4AD9A 3GTQJ 3GFIA 2XGDA 1Z67A 4HF2A 2IA0A 3KYLA 1RKTA 4E7HA 3LQRA 4BQQA 3S16J 3JRAA 3OMYA 2XUBA 3K4LA 3RCOA 2QKLB 1BI3A 5D8KB 3OYDA 2L5QA 4L5EA 3QU6A 3M1CA 3HOSA 3RKWA 1ZG3A 1WQ2A 4LMYA 1HCRA 2BY0A 4OIOF 2VKEA 2XASA 3Q0VA 4AVZA 2BOLA 3W2WA 3E6CC 2R7WA 1I39A 2OZUA 2JTVA 3W6VA 5D5WB 4RS8A 1FX7A 1K78A 5EJCA 2L0KA 5ED4A 4HX4A 1QZZA 4RAZA 3J81Z 2JA5J 4IHVA 3HTUA 2AQFA 1T08B 1XCVA 2I10A 1IN5A 3VDXA 3J80K 4Y13A 1O57A 5GPCA 1QQIA 2R7XA 2L4AA 2Z33A 1D8JA 2V1DA 1FOXA 1KYWA 3FISA 4A3FJ 3TW7A 2CUFA 1V54H 3VYRB 2B7EA 1JI8A 3J7AO 4NC8A 1LE8B 2YUSA 1BW6A 1RETA 3ECHA 3ERMA 5FLVA 2W1OA 2K4JA 2QQBA 3K4JA 5FFZA 4N4OB 5HS7A 2XAUA 4CA0A 3HOWJ 2E2IJ 4WWCA 3AG1H 3X2QH 1X4PA 3O6BB 3PM1A 2WA0A 3C2HA 3OV8A 2NNNA 5JLWA 2PMZA 3B02A 2X6OA 5IOZA 4OMZA 1BC8C 2ZXWH 2A69F 2KZGA 3KEOA 3NWTA 1W7PA 2BY1A 1VTNC 3SEQA 4D7MA 2H1KA 5ICCA 3A4CA 4QIWN 3TO9A 2P0WA 4PJNA 5CVIA 3ABTA 1UG0A 3L09A 4D9JA 1ETQA 1YW8A 3I54A 4C2UA 2ZFWA 1IRFA 3EQLF 2IS6A 1V5GA 2E71A 1Z6TA 1QGPA 2MYSA 4DGWB 1BA5A 2L9SA 3S2HJ 1H9GA 1ETWA 5H2FC 4HX8A 3FXUA 3EUAA 2QQAA 2VBYA 2WY8Q 5FO5A 5E18F 5EGOB 4BXFA 1NTCA 3DPUA 2STTA 4ENMA 1F5TA 4IHWA 3ZR8X 2LY2A 1BW5A 3KFWX 3QP6A 1DU0A 2KISA 1MBEA 4MIMA 2JUGA 3DKYA 4U7DA 4YIRX 1V4RA 1OCZH 3K2AA 2ACJA 2QBYA 3HL2A 2YX4A 3OYMA 2NS0A 2DA4A 1POGA 2KRFA 3CMYA 3ZQHA 2R92J 4PSWA 2P81A 1MGTA 4KN4X 5C4XJ 2BZTA 5J47A 2PG4A 1JTXA 3UNGC 4KNYA 2DK8A 2V79A 2CW0F 4BXXJ 3A1YA 3HIFA 3LSHA 3JREA 3CD6I 4OOIA 3GZNB 3BG6A 4W97A 1MSFC 3Q5FA 2HQRA 4ETSA 1I6XA 2VL8A 4KIFA 1RZ4A 2KRCA 4OAZA 1SANA 1X3UA 4JYKA 4CZZA 3DV8A 2OD5A 3JTGA 2PMUA 3LFKA 2NVYJ 4II2A 1VQKI 2ZJ2A 5GAGJ 1J7KA 4A0YA 4MQVA 2LTPA 3K70D 4AWXB 4PJJA 3OYKA 3V7SA 2HS5A 1ZR4A 1K4SA 1JT0A 3MWMA 2MA3A 2EFNA 1UELB 1OYYA 2K4BA 4XLPF 4KJZA 3WTXC 4G6DA 2ME0A 3GFMA 5F6FA 3M1EA 5TRDA 2CMPA 2V9PA 1IW7F 2IVMA 3SQNA 1UAAA 4OMYA 5KVRA 2HYJA 3EPZA 3MZ8A 2DAOA 3DKWA 4RAFA 3CMEI 3E5XA 2OC6A 5FKNA 4O6JA 2VASA 2P6TA 3HSEA 4XOPA 1S7AA 3SZGA 4WCGA 5BOXA 3ZPLA 2M4GA 4B48A 3BTLA 3OOPA 3REOA 5GTIC 5M3MJ 1YJNI 1U78A 4UY8I 3TDUC 2VE9A 2E1OA 5KAFC 1F4KA 2VPLA 3MN2A 3LSGA 3PIPF 1VQOI 4ZYGA 3S1NJ 2X1EA 1B59A 4BEHA 4ZH4F 3U1KA 5ERIA 4AIHA 1IC8A 3FXLA 2Y0SN 1E3PA 2ZSHB 5E79C 2VKDA 1BOBA 2TDXA 3GTMJ 4IPAA 2R7FA 1JUSA 1NK2P 3ZQIA 5C4JJ 4BGDA 1B8IB 3A01B 5HLIA 3ULQB 4EV0A 4LB5A 4UB8C 1KONA 3CMAI 4XIDA 1QZYA 5GAEJ 1ZR2A 4AIJA 1BI0A 1E2XA 4RM2A 1R00A 5DS9A 2ESNA 1W36C 1PYVA 3KLNA 2E2HJ 4IQJA 3HOUJ 3BTIA 4QPOA 4G7HF 3GFLA 3W2VA 2Y31A 2VJIA 3M8FA 2YPRA 1OPCA 3TOBA 3TL4X 5ICGA 3DCFA 1P7IA 2VJJA 2F2EA 1LDKB 4MGRA 2QQ9A 1IXCA 4I0BA 4IRHA 5IY5H 4HQEA 2OBPA 1AKHB 4M72A 3I5UA 1O3RA 3K0LA 1YITI 4AYBN 4CUGA 4L18B 1HC8A 3DU5A 4RB3C 3WU0A 1L0OC 1WJBA 1Z21A 2X1CA 2KIMA 4ANJA 4M3GA 3KCCA 4WXHA 3QWLA 1TWHJ 1BJAA 2W4SA 2GXAA 3DWLE 4S05A 4GDFA 3EUHC 4JK1X 3H0DA 5D4SA 2BW3B 1SD6A 2A5YB 4BL0B 2ZC2A 3TBIA 1IF1A 3KP7A 1ZH5A 1A04A 2O9LA 1LVKA 1SFUA 3S1MJ 2VXZA 2NVTJ 5LLQA 1RC9A 4HSTA 2XRLA 2HDCA 1FC3A 2ICWG 2EV6A 1Y1WJ 4M3BA 4PGHA 1NG7A 2NXNB 4HDVA 1T56A 3EYYA 2ECBA 4G6TB 1UFMA 3CCYA 2M7AA 3RYPA 2XKPA 1CF7B 3HGGA 3V8JA 2A6HF 2CWEA 5HOOA 3ASNH 1JXSA 4CYCB 2FBHA 3ZMUA 4XRMA 5ICEA 1X1AA 1ZG1A 2NVXJ 5J3LA 4RM3A 2KDOA 4Q47A 1FBQA 4EJWA 4HEA2 3HKZN 3NRVA 1TNTA 4G8XA 3ML6A 1U3EM 4DYCA 4ENKA 1EA3A 2M34A 1VQMI 4U7BA 4R8HA 1FP2A 3OSGA 4UB6C 2IPQX 5CQGA 3G3ZA 4FISA 2ZMEC 3IKTA 5CVUA 5BPDA 4LLGF 3WGIA 3FWEA 5AONA 3BR1A 4GGGA 1MH4A 2H09A 5BNGA 1GXQA 4UUSA 5H6QA 4A3BJ 1ZARA 3H36A 1EKEA 1VQ6I 2L3DA 1BI2A 1FSEA 3RPUA 2K9NA 4ZYHA 5JR3A 3WHCA 1ORKA 4M9SA 1D0XA 1GLNA 1YLFA 2IXSA 3JRHA 3OYBA 1MNEA 2CW7A 4A3GJ 3LSRA 1P6RA 2WY7Q 1WI9A 3C7JA 4PSXA 2XKOA 1X1PA 3JW4A 1XTAA 3ABLH 2QGUA 3ISPA 3VEPA 1ONVA 1MBKA 1IV8A 3DPTA 3FX3A 5DUKA 5F27A 2HEOA 1JKPC 3WGGA 2ID3A 2GIVA 4V2FA 3LOCA 2OU2A 2WTEA 3CJRB 2ZFUA 2QKMB 4LG0A 3IL2A 3G1OA 2BEOA 2HTSA 1SD7A 4GYGA 2VOOA 2DQLA 3I59A 4BQAA 2LY1A 2HPIA 1MNMC 5GPAA 2NVQJ 1WZ2A 2PI0A 1YS6A 1LNWA 4U0YA 4KMFA 5LHGA 1U6GA 1BN5A 3TO7A 2BHZA 2HQNA 2Q1ZB 3DBRB 3HC7A 3O3KA 1EH6A 1FY7A 5H6RA 2H8WA 4CZCA 3CCUI 4DOZA 2D1HA 5HS9A 1YW9A 5F1RA 1Y39A 5E1ZB 2GM4A 2B63J 2EZLA 3AG2H 5CJ9A 2FXAA 3BTJA 4ZYEA 2HXIA 2VONA 3CCLI 4XKCA 3OWTA 3ZP5A 1TWFJ 1O7LA 4BDZA 3RKQA 1T33A 4LK1F 2IJLA 5HLGA 5DCMA 1B72B 1FMVA 1VQ4I 2HWVA 1I1GA 3GCMA 2KDZA 1HKQA 3EDPA 3UR3C 4EQQA 3H9GA 3ELKA 4AIKA 1ETVA 1MMSA 4V19K 3FXKA 3QAHA 1E3OC 2XAFA 5E1XA 2P5VA 4BS9A 5D5UB 3ZN1A 4KIBA 4RGRA 1U8RA 4UUTA 2AXTC 3S32A 1ZK8A 2DPUA 2BE5F 2ISZA 2RQPA 4L5JA 3SZPA 2LLKA 3KP4A 3QU3A 4HLXA 1DGWY 1XDSA 2BY3A 2JMWA 2JVGA 3AL0C 4JBAA 5F0HA 5LGNA 1LE8A 1I5ZA 3GTLJ 2E1MB 1WKMA 4WXDA 2QQ8A 4RMNA 2R7OA 1TWAJ 2CQXA 3E0JB 2HNHA 4DBRA 5AIPA 1Y0NA 4FASD 2L7MP 2DBBA 3CUOA 3HOVJ 5DEQA 4F91B 2DOEA 4BKXA 4G9YA 2CQQA 2G7UA 3HRUA 4LLLA 1QO0D 3K4KA 1S3JA 4M9XA 1T6SA 2ZNZA 2OQGA 3SZTA 5L3CA 3F23A 3MMYB 4L9NA 4DIQA 2VQCA 1B9NA 3F9KA 1D0YA 4DZPA 3BTCA 4ZYAA 1FT9A 4HLYA 2HQAA 2XSJC 1N78A 5L3FA 1T38A 3IHUA 3JTHA 1ZLKA 3BG9A 3ROUA 4AU7A 5FLMJ 3AAFA 2OTLI 4HV5A 4ENJA 3FKIJ 1LQ1A 2I8DA 1HSTA 3A03A 3LSTA 5E17F 1QVUA 1ON2A 4XMYA 3TKYA 4LIVA 4AC0A 2DJNA 3GTKJ 2PN6A 1FPQA 3R60A 2KKOA 2DODA 2A6EF 1ZGWA 5L3EA 2WAFA 3DTIA 3S1QJ 2MLGA 3KEQA 2WB1N 5EGOA 2OAZA 1PDNC 3S2WA 2DA2A 2RNGA 1LEAA 2DN0A 4A5NA 5HDNA 4XR6A 2K02A 1WH7A 1R1TA 2CW8A 2FD5A 5FROA 4CCKA 4RAGA 3LA7A 2DO7A 4OIRF 3CCJI 1VNDA 3D1NI 1Z7UA 1IGNA 1JHHA 2DMQA 1T2KA 2D45A 3OIQA 2YS9A 1MH3A 4RGXA 3RKYA 4UVBA 5L3DA 3W2AA 4PJLA 2CYYA 4P5OA 2Z3YA 4MO7A 3HDDA 2J5OA 5GADJ 3RZDJ 2O6GE 3KP3A 1BM9A 5J1RA 1PUFB 2X4HA 2DMPA 2IA2A 3FZVA 4XRFA 3S2DJ 5FFXA 2Y75A 3I58A 1Z1DA 3QYBA 4RAYA 2VPRA 2TCTA 3CCSI 3KX2A 5IYDJ 4KITB 4E7KA 2E7XA 1J2XA 2MH2A 3ZRGA 3MD2A 4I2OA 3P9IA 1ZRFA 3QRFF 4ZTJA 3S15J 4IHSA 1FWZA 3HG9A 5E8GA 4IRIA 2MD5A 3A2KA 3IUOA 1FIAA 2M8GX 3NEUA 1YX5A 4MQ9F 3PUFA 3QPLA 4PJ0C 3WGHA 1K79A 3FHZA 2JN6A 4IL6C 3GO5A 1QZEA 4IEJA 4XSZF 4A3LJ 2CS3A 3GTJJ 1AOYA 2X85A 3OYJA 5A2QK 4MTDA 1UHWA 2VLAA 1X3WB 1HXDA 2G9WA 2XHKA 2FQ4A 3GEZA 1I3QJ 3RTRA 4B47A 1GV2A 2QA4I 3U2RA 3WG7H 3GF2A 1OCPA 2BVLA 1ZRCA 3H35A 4A5MA 3RPQA 1U5TB 3OR2C 1KQ0A 4OWRB 3BCBA 4ESFA 3FBIB 2QSFX 4XICA 2J5PA 2ZMEA 1U2WA 5FB2A 3I4MJ 2ZCWA 2AQEA 2DK5A 4N4NB 1R1UA 2DT7B 1T39A 2EK5A 1CQTA 1PP7U 1YJWI 4M71A 4Y7NJ 3KZZA 3E6MA 3I64A 4I99C 5EZHA 1PUEE 1TP4A 3CDIA 4A6EA 2IA1A 3W6JB 3I56I 4A2UA 3CC7I 1H88C 1GXPA 1QA6A 4XKBA 1R5ID 3BR6A 2F6CA 1NH3A 3DFGA 2MC3A 1GVJA 2O8XA 3FXRA 3PL8A 2CG4A 1G2HA 3ZMZA 2XF7A 3A01A 2VC1A 1B8IA 1LPQA 2XPUA 4M9ZA 4P9FA 1BR4A 5B1BH 1LDJA 4BHCA 3BWGA 5FJ8J 1S9HA 1VFCA 4KUMA 3OS0A 2Y0SA 3L1PA 2G7HA 4KMUX 3T8TA 1HBXG 3RSNA 5IP6A 4RLFA 1G3WA 1D1AA 5CYVA 1MDMB 2K9MA 4MNUA 2EZIA 4LG3A 1XG1A 4XLAA 4BE2A 3A02A 1XCBA 3M8JA 4FX0A 5M5XJ 3WTWC 4XORA 5L3BA 2M9HA 2OCEA 2QLZA 3HB9A 1ZRDA 5CVRA 2FMLA 4Q4ZF 1ENHA 3CJTB 3E5QA 1AKHA 3P5JA 2P4WA 1OMIA 3HRTA 1JKRC 3D0SA 4YG2F 2CV0A 2UWMA 1Z05A 2CJJA 1BR2A 9ANTA 1AWCA 2XVCA 2WBMA 1A6IA 2F5CA 2MBFA 1OCCH 3L2QA 1YG2A 5LRSA 2W57A 4A3IJ 2M2EA 4C2TA 2ESHA 2VN2A 3PSFA 5F64A 1OCTC 3OS2A 1JUMA 3A0BC 5M3FJ 3JAMK 1SFEA 3ZQQA 3FK7A 1SFKA 5E3LA 5DM7F 5E1WA 2M0CA 3SHFA 5AIQA 1XC5A 4QTRA 3NQOA 1IUYA 5F1JA 1X1DA 4CCJA 3JRIA 1A5JA 4NHJA 4DNCA 2OF7A 2VC0A 3MKLA 3KZIC 3OYEA 1EH8A 1CF7A 2CQ7A 3M4OJ 1IDZA 2EPFA 3TP3A 1BIAA 1MNDA 2F5EA 3HHHA 3L9FA 2CRGA 4CYCA 4IZZA 1K83J 2LRDA 4C2MJ 2LBFB 1I50J 3R61A 3LSMA 5M5WJ 1K6OA 4JX4A 3P9KA 2LYCA 4RB1A 4EVIA 1MMAA 4M73A 1Q1VA 2JK3A 2LKPA 2GXGA 2R5ZB 4GYIA 4E6KG 1YIJI 2HKXA 3AKZA 3B6CA 3QOPA 2V9KA 5ILSA 3WE2A 1FYKA 2BY2A 3S3OA 2DJIA 4V2GA 2P7CB 4D5FA 3JSPA 3D5RC 4FE7A 2EWNA 2JRTA 3I4PA 4BJTA 1MJBA 1IN4A 4I09A 1REPC 2L4MA 3BCAA 4ZC3A 4ZJZA 3MKYB 2WWYA 1HW2A 3HKZA 4IRGA 5J4YA 2IW5A 4IJAA 4KA4A 4HNTA 5LEJA 1LB2A 3F6VA 3I71A 4M6XA 1V5FA 4UVAA 2RAEA 4EM1A 2OV7A 1IO2A 2Y2ZA 3BR3A 2QUFA 4M74A 1HW5A 3HSFA 3QPTA 1MJ9A 2FUG2 4WK8F 3LWFA 4NQWA 2DA1A 1RUNA 2EFOA 3BP8A 4PUSA 4F7ZA 4J01A 3J7AY 3PO2J 1SMTA 2A05A 3FK6A 3KP6A 3SYTA 4LITA 1VQPI 3CUQB 2Z16A 2UXNA 1DPUA 5FLXK 1YOVB 3PIOF 3MFKA 4RA2A 1Z3XA 3R0JA 4S04A 2M45A 4UUVA 3DEEA 1JTYA 1WGXA 2EIKH 5IOYA 2QM3A 3GUDA 2JWTA 3G6EI 3ZQCA 1LEBA 2DQRA 1TL8A 4BDYA 2FNAA 4B09A 1RIOH 3CF2A 3H9JA 1D1BA 5KCMA 1WJAA 3WU2C 3IH2A 3BJAA 2X1DA 3H9QA 2HOTA 2CQNA 2EIMH 3CDHA 1B1BA 3S8PA 3ZMDA 1J5YA 4E7SA 3DXJF 4IF4A 3CQZJ 3BLYA 5HODA 1WJDA 5J6XA 5KK1A 2JA2A 1XSDA 3TEDA 1MMGA 5CLSA 3RDIA 5JVTA 5HNHA 1G3SA 1T8IA 1ODDA 1W0UA 4FQGA 2WAEA 3J80Z 1XX5A 2L7FP 3WTZA 1FIPA 2JA7J 1HDPA 1D3YA 3ZQ7A 1B72A 2QSGX 2F5FA 3WTSC 4E70A 4A3JJ 1QPIA 1B9MA 2ME6A 4BAYA 2GBYA 4XN3A 1FLIA 3JR9A 1PP8F 4KN7X 5FD6A 1XGOA 3RKXA 4MFEA 3DEWA 4X0GA 1YHQI 2IRFG 3M8EA 3CC2I 2E19A 2CGPA 1IDYA 3BG5A 2DTZA 2IGKA 2P8TA 1MSEC 3GMEA 2DYRH 2BBYA 2FE3A 1IN7A 3PSIA 1P2FA 4UHTA 2JT1A 4EJTA 4NUBA 3OYGA 2ZJQF 3PUBA 1WCMJ 5HS8A 3E7LA 2B0LA 4ZDOA 3QPSA 1P7JA 3VWBA 3IRQA 3F8NA 2JUCA 3WE3A 2H1LA 2W25A 3O8GA 1ZELA 2XRNA 2FBIA 3IKVA 1XSVA 2CFXA 3DP7A 1RESA 3OOUA 3MQ0A 1T95A 1M1EB 4Z2YA 5B3SH 2KJCA 2MD0A 3HM5A 2CSOA 2G0EA 1VQLI 2GA1A 3N05A 3GWZA 4I02A 1BIBA 2L7ZA 1OQYA 5HLHA 2DA3A 1UHSA 4HAMA 4BHBA 2DLLA 2LD5A 4HNUA 3M07A 5EF6A 3OL4A 3GBGA 1KQ9A 2RC4A 1YYVA 1WJEA 5HNFA 4LB6B 2NNYA 3T5XA 3CZ6A 2RV8A 3QYEA 2R3SA 3ZMTA 4GCVA 5DV5A 3HPHA 1SFOJ 3K1MA 2QEXI 2W00A 1YI2I 1D0ZA 2AS5F 4OIQF 2IT0A 3SDGA 3HOZJ 2HPMA 5J40A 3H3UA 1TZLA 3OY9A 2PLYA 1YIOA 1BC7C 2D5VA 1G6NA 1EF4A 5F0FA 2Z5UA 4UXNA 3HOXJ 1STZA 1XMXA 1SMYF 3ONQA 1AU7A 1LVAA 3FF5A 2RGVA 2P5KA 2E60A 1Q1HA 1G3YA 1R4NB 4XNFA 3KYDB 4B43A 1PUFA 3OS1A 1D5YA 2HOAA 1IJWC 3A0HC 3KE2A 3FM5A 3H5RA 4FETA 2ISYA 2CU7A 2VB6A 1FBSA 3P7NA 1MMNA 3K4BA 1GT0C 1X3ZB 1UB9A 2BYVE 2I5UA 1ACIA 3KYCB 1ZGAA 2OUMA 2FQ3A 2M7BA 2NS8A 1P92A 4OAYA 4ZDLA 4A93J 2R7VA 2F5DA 5FKOA 4WXCA 2LKXA 3F8CA 1JKOC 2W48A 1R71A 2B9SA 5IP7J 2A3SA 2M1BA 4KT6A 3K1PA 4HRIA 1O3TA 2LVSA 4H4KC 1IXRC 2DYSH 2M87A 3ABKH 1BI1A 2ELHA 2HKOA 2L9NA 2LF7A 1FP1D 2UV1A 3IH3A 3KLOA 5EDNA 3DLLF 3CTAA 2H8RA 1QHHD 2VKHA 2DFHA 1ON1A 1D1CA 3NWSA 1LUJB 2F4OB 1WJFA 2DW4A 1OKRA 4L9VA 5L3GA 3KETA 3I0TA 1SC7A 1TWCJ 5M5YJ 2UXXA 1W36D 3TOAA 2HVRA 2LR8A 5C3EJ 3F8FA 1SEUA 1U5TA 3R4KA 1FMWA 2YSRA 3ZN0A 2R0QC 1OCRH 4D1QA 1VI0A 4XLNF 1LFPA 4NNJA 2COBA 3BR0A 2O03A 2CV1A 3MCZA 2CFOA 1UCRA 3CP8A 4XONA 1FSHA 2OQRA 1P4WA 3FDYA 4AVPA 5FD5A 1TTYA 2JA8J 2DDBA 1UHMA 2DT5A 5D6FA 4FTHA 1B6AA 4YELA 2KZVA 3E97A 4Q5SF 4AUXA 4IHTA 2XAQA 2WC2A 3IP4B 3KP5A 3VYSB 2CO5A 2VODA 1HDDC 4RBOA 3U9GA 4XLFA 1SVLA 1RRJA 3K6GA 4HOBA 4E7JA 1GHCA 1R36A 3BZ6A 2CV2A 2E7WA 1B4AA 5LHHA 5E3OA 1N77A 4IHXA 2FEZA 5LHIA 2GOXB 4D7NA 3BJOA 3K1NA 1MDMA 2Y69H 3K10A 4CCMA 3H3VK 2DMNA 3RYRA 1Y0UA 5HDGA 2OZ6A 5TJJA 4G12A 4GO1A 5KAIC 1U8BA 3LSKA 5D4RA 4Y3OA 1I27A 2EFWA 3LNQA 2VI6A 3SJMA 1S8NA 2LSOA 1ZYRF 3HHGA 4R79A 4G7ZF 3S3MA 2GWRA 2RVCA 5FRMA 4YIIA 1A35A 2GOMA 3ZMVA 4W1UA 3E1SA 2JZYA 4O5VA 3L2WA 2MH9A 3VSLA 2D2WA 2ECCA 1EJ9A 3D5SC 2Q2EB 4BUPA 2HFHA 4MTEA 4C3JJ 4RB2C 2LKSA 3H3ZA 3V8LA 1QBJA 4A69C 3RZOJ 4IOAF 3WODF 3RJPA 5C44J 2PEXA 3RQIA 3OYHA 1AHDP 3J81K 2TRTA 1O7FA 2EINH 5EZGA 3WTYC 5D5XB 1JJ8C 5JHUA 1R7JA 3IH4A 4Y4RA 2VJ4A 2M8EA 2GAUA 2O61A 2ZXJA 3AFHA 2DCEA 3H92A 4N9HA 4U88A 2OPTA 3LQQA 4CCNA 4CYDA 2W24A 4YFNF 3MKZA 3G1LA 2PBIA 4A0XA 1S72I 3PQJA 1T0FA 4L0ZB 1X2MA 3CLQA 4ZYDA 1WJCA 1R5GA 2JPBA 2PQ8A 1IUFA 3FKJA 2JRMA 2QSHX 2ZBKA 4PGGA 2KMUA 2A61A 2IBDA 4BYYA 3QP5A 2QYOA 2RDPA 1HW1A 2O8KA 3T1BA 3H0GJ 3G71I 4IOCF 2K85A 4L9JA 1Z3YA 5LGTA 2F4MB 1H9TA 1RR7A 2VUMJ 2LBFA 4U87A 3FMQA 2HR3A 3KZYA 4HX7A 1VQNI 1KA8A 2YX7A 4GRIA 2JQ7A 2BV6A 1UZCA 2R5ZA 1J09A 5H20A 4A0ZA 1MBJA 2M30A 2VE8A 3OIPA 5EG0B 1D5VA 3BR5A 1S7OA 2KHMA 4B3XA 3N97A 2AO9A 3IAM2 1O4XA 1IXSB 1W5SA 2W85A 2HVQA 4U0VA 4LGWA 2FOWA 2KIQA 3MEXA 4XLCA 1X1CA 3CCEI 2XV4S 3PFYA 1OLTA 2LDUA 3ABUA 1OFCX 2XC7A 4KISA 1WVRA 2WV1A 3S14J 3CC4I 1V55H 2NS7A 1Y6IA 5LRRA 1W7PD 4XRSG 3ZXSA 4ZTFA 2CUZA 3CF5F 3E6BA 1BL0A 3F0CA 3VPRA 5IT3A 1SD5A 3BR2A 4AIDA 1JKQC 3VFZA 4ASNA 2DMUA 3CUQA 3FMRA 2IGMA 1Z0XA 4HBLA 2QCOA 1TQMA 2R5YB 3JRFA 2DFFA 4II3A 1J0RA 4BHPA 1IN6A 3VYUB 3D5LA 3Q9SA 2P6SA 4IO9F 2VQGA 4I6ZA 1FTTA 2LNBA 1XS9A 1P4XA 3OR1C 1QNTA 1NG6A 4ON0A 2V26A 1YW7A 4LJZF 3AG4H 5J4VA 3PO3J 2L01A 1ITYA 2K3PA 1ZQ3P 2VT3A 1X1BA 1JHFA 5F0CA 2Z9OA 2E1MC 1R58A 1BBYA 1ZGJA 1MJAA 2HQ5A 2HDWA 3BOQA 2DOAA 3SXYA 3C2GA 3PNVA 2R7QA 4B44A 2DU9A 4RDUA 4EJVA 2HOSA 3JRGA 2KT0A 1R9TJ 4EGZA 1YQAA 3CMMA 4UNOA 5E20A 2HZTA 1DP7P 3HOYJ 1SFXA 3FHNA 3CDLA 3ZQLA 1WH5A 2FJ1A 4NBQA 2NRAC 3ABMH 2QWWA 3CCQI 3GYHX 2CUEA 2L7KA 2MC4A 1E17A 3LA2A 2EQRA 2FX0A 1I3AA 3DQVC 1PJRA 1P4AA 2ZB9A 3W3CA 1X19A 4NDLA 2FRHA 3FIWA 3DU6A 3BG7A 3WG9A 2IS2A 1ZAOA 3J7YJ 4GXOA 2K9LA 3H5AA 2E1NA 4XOTA 4CCOA 3HXLA 1K6YA 4EGYA 3GTPJ 3GLXA 4IHYA 2IS4A 5BMZA 4X1EA 2VBWA 2VXDA 4E7IA 1EH7A 1DUXC 2JSPA 1MBGA 4K2EA 5DCMB 3K70C 5E3NA 4ZZDA 1MBHA 3C2BA 1YRNB 4MHGA 1S5LC 2BGCA 1S6LA 5IP9J 4CSWA 2DDAA 1FYMA 3IV5A 2EFQA 4H0EA 1VQ8I 1FYLA 3MZHA 2PJPA 3P9CA 1WJ5A 2XSDC
chains in the Genus database with same CATH topology
4RGSA 3M9AA 4HW0A 2QVOA 2Q0OA 2NYXA 5CVVA 3R6SA 4P96A 3WTUC 2X0LA 1J59A 5IT9K 2HOEA 1FNNA 2ETHA 1QPMA 1Z6RA 2FF4A 3F72A 2ZNYA 1F1ZA 4HF0A 1MZBA 2UZKA 4BH9A 4O3MA 4P55A 2Z99A 4YFKF 5BPIA 3ERED 5J8CA 1R1VA 3BY6A 3LAPA 5ILUA 3F21A 4UV9A 1IN8A 1W4MA 5DDGA 2H27A 3HSRA 1USTA 2GA2A 4LK0F 3BDDA 1XGMA 6PAXA 4EMSA 4OIPF 2WV0A 2V9VA 3I53A 3O2PE 4HYEA 3G73A 1IZ1A 1U5TC 4PZJA 1OYIA 3FXQA 4CDGA 1DDNA 4KICA 1FZPB 4TV7A 1FOKA 4HA8A 1OR7A 1BOAA 4G6QA 4D0PA 2FNPA 1ZLJA 5K5RA 5A2QZ 3BJ6A 1WSUA 5D5VB 4I7HA 1KU9A 5EEHA 4OU0A 1H0MA 4P9UA 1TNSA 2CQKA 4NB5A 4DQ2A 2HGCA 3L2CA 2VT2A 3T8RA 3MZYA 4I0AA 3HYIA 5K5QA 3V4GA 1XD7A 1ZG5A 4MEYF 4FHTA 3JSOA 2L54A 3COAC 3K69A 4U0WA 1Z9CA 3V7CA 3T0YA 5LEKA 2GZWA 2C6YA 3C1DA 4RGUA 4L0YB 4KYWA 3GVAA 3GXOA 1TW3A 2MLKA 5K1YA 2XROA 2ADUA 2ZMEB 2RNJA 3B73A 1SAXA 3CO7C 1MKMA 4KIGA 4Y17A 3N4MA 1NHAA 4CGZA 1TW2A 1YS7A 1O3QA 5ICFA 3EETA 2FA5A 1USSA 1J75A 2R7DA 2QZ8A 1ZREA 2KIFA 3IWFA 5ILVA 1C0WA 3EYIA 3Q9VA 3HOTA 2V1UA 1YFHA 5EEGA 5IT9Z 2EJRA 3IRRA 1TBXA 1K78B 4I01A 3F8BA 1YTYA 4HQMA 2K7LA 1G3TA 1EV7A 2XGXA 4KFCA 2Q8KA 5BS6A 3JAMZ 4CO8A 1ZHFA 3QPHA 2Q2EA 3VOEA 3V8KA 3RI4A 1R22A 1WWXA 4N0BA 2L02A 1HQCA 3GFJA 3WTTC 3RIRA 3HRMA 1XMAA 2GXBA 2ZKZA 4FX4A 2P5LC 4G94A 2XAHA 1FBUA 1W7PB 2V6CA 3F3XA 5DD4A 4QLCU 1XDUA 4BNCA 4YIFA 4MEXF 2EFPA 4EJOA 3DPLC 1ZN2A 3E5UA 3W6KB 3CUQC 4L9TA 1JGSA 1XGSA 2H94A 4HZFA 1O3SA 1W5TA 1L3LA 2VBXA 3CJNA 1D8KA 1RI7A 3IWZA 3DF8A 2DPDA 2W84A 2IP2A 4OINF 2DI3A 2FU4A 5J8FA 2GQQA 1J9IA 2D1VA 2XAJA 2FMYA 5JI6A 3FM3A 2HYFA 4HDUA 2XIGA 4ESBA 2QBYB 3L7WA 5FLXZ 1R5HA 4A12A 3SFZA 4L5IA 2H6BA 2NAZA 1I1SA 3WU1B 4JQFA 2JSCA 2PFBA 5K5OA 4IVNA 3HTSB 1SD4A 4XBFA 1XB4A 4YFXF 1XSXA 4LLNA 3LAJA 5D6EA 2RN7A 2A07F 5DYMA 3V7RA 5E8IA 5JFRA 2FSWA 1T98A 2EB7A 1XN7A 2M5WA 2FBKA 3VB2A 4EM0B 4UVCA 3F8MA 4PCQA 3TO6A 1G4DA 1HKTA 4HV6A 1OYWA 1KU7A 1KYZA 3WTVC 4LFUA 5CVJA 1R23A 5FGMA 3CO6C 4HF1A 2VBZA 1S29A 2PMHA 2KJBA 2Y0MA 1LDDA 4B8XA 4UV8A 1IAWA 3TQNA 2HTJA 5LGUA 4RB0A 1HKSA 1V3FA 3E6DA 5HDKA 2AXLA 1RNLA 4BXUA 2O0YA 2V1XA 2H6CA 5DD8A 1RUOA 4EM2A 3C3WA 1XMKA 2DFIA 4CXFA 1KQ8A 2A68F 4N9IA 2EV5A 1KU3A 4R1HA 1MD0A 5LBQA 3PFIA 1WRJA 4LD5A 4M6YA 3GZ5A 4I98B 4PDKA 3BPXA 2HYGD 4WF2A 5DUIA 1HSJA 1LJ9A 2ZO4A 4IXAA 2EA2A 2E1CA 3IC7A 3PQKA 3VODA 3K9TA 3F6OA 4WX9A 2COMA 2XAGA 3ZMSA 1K7AA 2YU3A 1CGPA 2STWA 1YO5C 4Q48A 3F22A 2K86A 3ECOA 3TGNA 4Y15A 2EV0A 4A6DA 2P7VB 3K2ZA 2Y48A 3HRSA 2VOPA 1XGNA 3DEUA 3FMSA 1JE8A 4ESJA 3C18A 3MAJA 2FOKA 4G7OF 1DPRA 1F9NA 3E3VA 3L00A 3TDZC 3EUHA 4EJUA 1Z91A 5HVQC 4FT8A 3M7GA 1ULYA 3GW2A 3GZ6A 2YR2A 3R0AA 2JPCA 5BQTA 3LA3A 3HUGA 3KP2A 2KIUA 1KGSA 2O3FA 4ENNA 3BPVA 4CICA 2K27A 4KDPA 3GX4X 4LG0B 3I59B 5D8LB 3BROA 4KT5C 5DCFA 2QENA 2OA4A 2LF8A 2RKHA 1TLHB 3U1DA 3CLOA 2DTRA 4QWQA 1TQIA 4XSXF 4CHUA 4ZZLA 1TQPA 2EA4A 1KU2A 4AD9A 3GFIA 4HF2A 2IA0A 3LQRA 2XUBA 1BI3A 5D8KB 3QU6A 3HOSA 3RKWA 1ZG3A 1WQ2A 4LMYA 4OIOF 2XASA 3E6CC 2OZUA 2JTVA 5D5WB 4RS8A 1FX7A 1K78A 5ED4A 4HX4A 1QZZA 4RAZA 3J81Z 3HTUA 1XCVA 1IN5A 3J80K 4Y13A 1O57A 1QQIA 1D8JA 2L4AA 2Z33A 2V1DA 1KYWA 3J7AO 3ECHA 2K4JA 2QQBA 5FFZA 5HS7A 4WWCA 3O6BB 3OV8A 2NNNA 3B02A 4OMZA 1BC8C 2A69F 3KEOA 1W7PA 1VTNC 5ICCA 3TO9A 5CVIA 3ABTA 3L09A 3I54A 1YW8A 2ZFWA 1IRFA 3EQLF 1Z6TA 1QGPA 1H9GA 4HX8A 3FXUA 2QQAA 2VBYA 5FO5A 5E18F 2STTA 4ENMA 1F5TA 3KFWX 3QP6A 4U7DA 1V4RA 2ACJA 2QBYA 2YX4A 2NS0A 2KRFA 1MGTA 4KN4X 2PG4A 4KNYA 2DK8A 2V79A 2CW0F 3HIFA 4OOIA 3Q5FA 2HQRA 4ETSA 1I6XA 4KIFA 1RZ4A 1X3UA 4CZZA 3DV8A 2OD5A 3JTGA 2PMUA 3LFKA 2ZJ2A 1J7KA 4A0YA 4MQVA 4AWXB 3V7SA 2HS5A 3MWMA 2MA3A 2EFNA 1OYYA 2K4BA 4XLPF 3WTXC 4G6DA 3GFMA 5F6FA 3M1EA 5TRDA 1IW7F 2IVMA 3SQNA 4OMYA 5KVRA 2DAOA 3DKWA 3E5XA 4O6JA 2P6TA 3HSEA 1S7AA 4WCGA 5BOXA 3ZPLA 3OOPA 3REOA 1U78A 3TDUC 2VE9A 1F4KA 4ZYGA 1B59A 4ZH4F 5ERIA 4AIHA 2TDXA 4IPAA 2R7FA 5HLIA 3ULQB 4EV0A 4LB5A 1QZYA 4AIJA 1BI0A 1E2XA 1R00A 2ESNA 3KLNA 4G7HF 3GFLA 3M8FA 2YPRA 1OPCA 3TOBA 5ICGA 2F2EA 1LDKB 4MGRA 2QQ9A 1IXCA 4I0BA 4IRHA 4HQEA 2OBPA 4M72A 3I5UA 1O3RA 3K0LA 4L18B 4RB3C 3WU0A 1L0OC 2KIMA 4WXHA 3KCCA 1BJAA 4S05A 4JK1X 5D4SA 1SD6A 2A5YB 1IF1A 3KP7A 1ZH5A 1A04A 1SFUA 2VXZA 5LLQA 2HDCA 1FC3A 2EV6A 4PGHA 4HDVA 3EYYA 1UFMA 3RYPA 2XKPA 1CF7B 3V8JA 2A6HF 2CWEA 5HOOA 1JXSA 2FBHA 3ZMUA 5ICEA 1ZG1A 4Q47A 1FBQA 4EJWA 3NRVA 1TNTA 4G8XA 3ML6A 1U3EM 4ENKA 4U7BA 4R8HA 1FP2A 2IPQX 3G3ZA 3IKTA 5CVUA 5BPDA 4LLGF 3WGIA 3FWEA 5AONA 4GGGA 2H09A 1GXQA 5H6QA 1ZARA 2L3DA 1BI2A 1FSEA 3RPUA 5JR3A 4ZYHA 4M9SA 1YLFA 1P6RA 1WI9A 3C7JA 2XKOA 3JW4A 3ISPA 3VEPA 1ONVA 3DPTA 3FX3A 5DUKA 2HEOA 3WGGA 2GIVA 2OU2A 2WTEA 4LG0A 3IL2A 2BEOA 2HTSA 1SD7A 4GYGA 2VOOA 2DQLA 3I59A 4BQAA 2PI0A 1YS6A 1LNWA 4U0YA 4KMFA 5LHGA 1U6GA 1BN5A 3TO7A 2HQNA 3O3KA 1EH6A 1FY7A 5H6RA 2D1HA 5HS9A 1YW9A 5F1RA 5E1ZB 5CJ9A 2FXAA 4ZYEA 2VONA 3ZP5A 1O7LA 4LK1F 2IJLA 5HLGA 5DCMA 2HWVA 1I1GA 1HKQA 3EDPA 4EQQA 3ELKA 4AIKA 3QAHA 2XAFA 5E1XA 2P5VA 5D5UB 3ZN1A 4KIBA 4RGRA 1U8RA 2DPUA 2BE5F 2ISZA 2RQPA 4L5JA 3SZPA 3KP4A 3QU3A 4HLXA 1XDSA 4JBAA 5LGNA 1I5ZA 1WKMA 4WXDA 5AIPA 2DBBA 3CUOA 5DEQA 4G9YA 2G7UA 3HRUA 4LLLA 1QO0D 1S3JA 4M9XA 1T6SA 2ZNZA 2OQGA 3SZTA 5L3CA 3F23A 4L9NA 1B9NA 1FT9A 4HLYA 5L3FA 1T38A 3IHUA 3JTHA 1ZLKA 3ROUA 3AAFA 4HV5A 4ENJA 1LQ1A 1HSTA 3LSTA 5E17F 1ON2A 3TKYA 2PN6A 1FPQA 3R60A 2KKOA 2A6EF 5L3EA 2MLGA 3KEQA 2OAZA 1PDNC 3S2WA 1LEAA 4A5NA 5HDNA 2K02A 1R1TA 3LA7A 2DO7A 4OIRF 1Z7UA 1JHHA 1T2KA 2D45A 4RGXA 3RKYA 4UVBA 5L3DA 2CYYA 4P5OA 2Z3YA 2J5OA 2O6GE 3KP3A 1BM9A 2X4HA 2IA2A 3FZVA 4XRFA 5FFXA 2Y75A 3I58A 1Z1DA 4RAYA 2E7XA 1J2XA 2MH2A 4I2OA 3P9IA 1ZRFA 3QRFF 4IHSA 1FWZA 5E8GA 4IRIA 2MD5A 3NEUA 4MQ9F 3WGHA 1K79A 3FHZA 3GO5A 4XSZF 1AOYA 5A2QK 4MTDA 1UHWA 1HXDA 2G9WA 2XHKA 3GEZA 3RTRA 3U2RA 3GF2A 1ZRCA 4A5MA 3RPQA 1U5TB 1KQ0A 4ESFA 2J5PA 2ZMEA 1U2WA 5FB2A 2ZCWA 2DK5A 1R1UA 1T39A 2EK5A 1PP7U 4M71A 3KZZA 3E6MA 3I64A 1PUEE 4A6EA 2IA1A 3W6JB 4A2UA 1GXPA 3DFGA 2MC3A 1GVJA 2O8XA 3FXRA 2CG4A 3ZMZA 2VC1A 4M9ZA 4P9FA 1LDJA 4BHCA 3BWGA 4KUMA 2G7HA 4KMUX 3T8TA 1HBXG 1G3WA 5CYVA 1MDMB 4MNUA 1XCBA 4FX0A 3WTWC 5L3BA 2QLZA 1ZRDA 5CVRA 2FMLA 4Q4ZF 3E5QA 2P4WA 1OMIA 3HRTA 3D0SA 4YG2F 2UWMA 1Z05A 1AWCA 2XVCA 2F5CA 2MBFA 1YG2A 5LRSA 2W57A 2ESHA 2VN2A 5F64A 3JAMK 1SFEA 5E1WA 3SHFA 5AIQA 3NQOA 1IUYA 4NHJA 4DNCA 2VC0A 1EH8A 1CF7A 1BIAA 2F5EA 3HHHA 3L9FA 3R61A 1K6OA 3P9KA 4RB1A 4EVIA 4M73A 2LKPA 2GXGA 4GYIA 2HKXA 3QOPA 5ILSA 3WE2A 1FYKA 2P7CB 3JSPA 2EWNA 2JRTA 3I4PA 1MJBA 1IN4A 4I09A 1REPC 2L4MA 2WWYA 1HW2A 4IRGA 2IW5A 4IJAA 4KA4A 5LEJA 1LB2A 3F6VA 3I71A 4M6XA 4UVAA 4EM1A 4M74A 2QUFA 1HW5A 3HSFA 3QPTA 1MJ9A 4WK8F 3LWFA 4NQWA 1RUNA 2EFOA 3BP8A 4F7ZA 1SMTA 3KP6A 3CUQB 1DPUA 2UXNA 5FLXK 3MFKA 3R0JA 4S04A 2M45A 4UUVA 2QM3A 3GUDA 1LEBA 2DQRA 2FNAA 4B09A 1RIOH 3BJAA 3CDHA 1B1BA 3ZMDA 1J5YA 3DXJF 4IF4A 5J6XA 5KK1A 1XSDA 5CLSA 3RDIA 5JVTA 1G3SA 1ODDA 3J80Z 3WTZA 1D3YA 3ZQ7A 2F5FA 3WTSC 4E70A 1B9MA 4BAYA 1FLIA 1PP8F 4KN7X 5FD6A 1XGOA 3RKXA 2IRFG 3M8EA 2CGPA 2P8TA 2BBYA 2FE3A 1IN7A 1P2FA 4UHTA 2JT1A 4EJTA 5HS8A 2B0LA 3IRQA 3F8NA 3WE3A 2W25A 2XRNA 2FBIA 3IKVA 1XSVA 2CFXA 3DP7A 3MQ0A 4Z2YA 2KJCA 2CSOA 2GA1A 3GWZA 4I02A 1BIBA 5HLHA 4HAMA 4BHBA 2DLLA 1KQ9A 2RC4A 1YYVA 4LB6B 2NNYA 3T5XA 2RV8A 3ZMTA 2R3SA 4GCVA 5DV5A 3K1MA 2AS5F 4OIQF 2IT0A 3H3UA 2PLYA 1YIOA 1BC7C 1G6NA 2Z5UA 4UXNA 1STZA 1SMYF 1LVAA 3FF5A 2RGVA 2P5KA 1Q1HA 1G3YA 3KE2A 3FM5A 2ISYA 1FBSA 3P7NA 1UB9A 2BYVE 1ZGAA 2FQ3A 1P92A 2F5DA 4WXCA 3F8CA 2A3SA 2M1BA 3K1PA 1O3TA 1IXRC 2M87A 1BI1A 2ELHA 2HKOA 1IRGA 2LF7A 1FP1D 3KLOA 3CTAA 1ON1A 2DW4A 1OKRA 3KETA 4L9VA 5L3GA 3I0TA 2UXXA 3TOAA 3F8FA 1U5TA 3R4KA 2YSRA 3ZN0A 4XLNF 2O03A 3MCZA 1UCRA 1FSHA 2OQRA 1P4WA 4AVPA 5FD5A 1TTYA 1UHMA 2DT5A 5D6FA 1B6AA 3E97A 4Q5SF 4IHTA 2XAQA 2WC2A 3KP5A 2CO5A 2VODA 3U9GA 1GHCA 4HOBA 1R36A 3BZ6A 2E7WA 1B4AA 5LHHA 2FEZA 5LHIA 3BJOA 3K1NA 1MDMA 3RYRA 1Y0UA 5HDGA 2OZ6A 5TJJA 4GO1A 5D4RA 1I27A 2EFWA 1S8NA 2LSOA 1ZYRF 3HHGA 4R79A 4G7ZF 2GWRA 2RVCA 4YIIA 3ZMVA 2JZYA 4O5VA 2MH9A 2D2WA 2HFHA 4MTEA 4RB2C 3H3ZA 3V8LA 1QBJA 3WODF 3RJPA 2PEXA 3J81K 1O7FA 3WTYC 5D5XB 5JHUA 1R7JA 2M8EA 2GAUA 2O61A 2ZXJA 3H92A 4N9HA 4U88A 3LQQA 4CYDA 2W24A 4YFNF 2PBIA 4A0XA 3PQJA 1T0FA 4L0ZB 4ZYDA 1R5GA 2JPBA 2PQ8A 2ZBKA 4PGGA 2A61A 4BYYA 3QP5A 2QYOA 2RDPA 1HW1A 3T1BA 4L9JA 5LGTA 1H9TA 3FMQA 2HR3A 3KZYA 4HX7A 1KA8A 2YX7A 2BV6A 5H20A 4A0ZA 2M30A 2VE8A 1D5VA 1S7OA 3N97A 1IXSB 1W5SA 2W85A 4U0VA 4LGWA 3MEXA 2XV4S 2LDUA 3ABUA 5LRRA 1W7PD 3E6BA 5IT3A 1SD5A 3VFZA 4ASNA 3CUQA 3FMRA 4HBLA 1TQMA 1J0RA 4BHPA 1IN6A 3D5LA 3Q9SA 2P6SA 2LNBA 1P4XA 1QNTA 4ON0A 1YW7A 4LJZF 2L01A 2VT3A 1JHFA 2Z9OA 1R58A 1BBYA 1ZGJA 1MJAA 3BOQA 3SXYA 2DU9A 4EJVA 4EGZA 1YQAA 4UNOA 5E20A 2HZTA 1DP7P 1SFXA 2NRAC 2QWWA 3GYHX 1E17A 3LA2A 3DQVC 1P4AA 2FRHA 3WG9A 1ZAOA 4GXOA 2E1NA 4EGYA 3GLXA 5BMZA 2VBWA 1EH7A 1DUXC 4K2EA 5DCMB 4ZZDA 4MHGA 2BGCA 1S6LA 1FYMA 2EFQA 4H0EA 1FYLA 3MZHA 2PJPA 3P9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGS A;  3M9A A;  4HW0 A;  2QVO A;  2Q0O A;  2NYX A;  5CVV A;  3R6S A;  4P96 A;  3WTU C;  2X0L A;  1J59 A;  5IT9 K;  2HOE A;  1FNN A;  2ETH A;  1QPM A;  1Z6R A;  2FF4 A;  3F72 A;  2ZNY A;  1F1Z A;  4HF0 A;  1MZB A;  2UZK A;  4BH9 A;  4O3M A;  4P55 A;  2Z99 A;  4YFK F;  5BPI A;  3ERE D;  5J8C A;  1R1V A;  3BY6 A;  3LAP A;  5ILU A;  3F21 A;  4UV9 A;  1IN8 A;  1W4M A;  5DDG A;  2H27 A;  3HSR A;  1UST A;  2GA2 A;  4LK0 F;  3BDD A;  1XGM A;  6PAX A;  4EMS A;  4OIP F;  2WV0 A;  2V9V A;  3I53 A;  3O2P E;  4HYE A;  3G73 A;  1IZ1 A;  1U5T C;  4PZJ A;  1OYI A;  3FXQ A;  4CDG A;  1DDN A;  4KIC A;  1FZP B;  4TV7 A;  1FOK A;  4HA8 A;  1OR7 A;  1BOA A;  4G6Q A;  4D0P A;  2FNP A;  1ZLJ A;  5K5R A;  5A2Q Z;  3BJ6 A;  1WSU A;  5D5V B;  4I7H A;  1KU9 A;  5EEH A;  4OU0 A;  1H0M A;  4P9U A;  1TNS A;  2CQK A;  4NB5 A;  4DQ2 A;  2HGC A;  3L2C A;  2VT2 A;  3T8R A;  3MZY A;  4I0A A;  3HYI A;  5K5Q A;  3V4G A;  1XD7 A;  1ZG5 A;  4MEY F;  4FHT A;  3JSO A;  2L54 A;  3COA C;  3K69 A;  4U0W A;  1Z9C A;  3V7C A;  3T0Y A;  5LEK A;  2GZW A;  2C6Y A;  3C1D A;  4RGU A;  4L0Y B;  4KYW A;  3GVA A;  3GXO A;  1TW3 A;  2MLK A;  5K1Y A;  2XRO A;  2ADU A;  2ZME B;  2RNJ A;  3B73 A;  1SAX A;  3CO7 C;  1MKM A;  4KIG A;  4Y17 A;  3N4M A;  1NHA A;  4CGZ A;  1TW2 A;  1YS7 A;  1O3Q A;  5ICF A;  3EET A;  2FA5 A;  1USS A;  1J75 A;  2R7D A;  2QZ8 A;  1ZRE A;  2KIF A;  3IWF A;  5ILV A;  1C0W A;  3EYI A;  3Q9V A;  3HOT A;  2V1U A;  1YFH A;  5EEG A;  5IT9 Z;  2EJR A;  3IRR A;  1TBX A;  1K78 B;  4I01 A;  3F8B A;  1YTY A;  4HQM A;  2K7L A;  1G3T A;  1EV7 A;  2XGX A;  4KFC A;  2Q8K A;  5BS6 A;  3JAM Z;  4CO8 A;  1ZHF A;  3QPH A;  2Q2E A;  3VOE A;  3V8K A;  3RI4 A;  1R22 A;  1WWX A;  4N0B A;  2L02 A;  1HQC A;  3GFJ A;  3WTT C;  3RIR A;  3HRM A;  1XMA A;  2GXB A;  2ZKZ A;  4FX4 A;  2P5L C;  4G94 A;  2XAH A;  1FBU A;  1W7P B;  2V6C A;  3F3X A;  5DD4 A;  4QLC U;  1XDU A;  4BNC A;  4YIF A;  4MEX F;  2EFP A;  4EJO A;  3DPL C;  1ZN2 A;  3E5U A;  3W6K B;  3CUQ C;  4L9T A;  1JGS A;  1XGS A;  2H94 A;  4HZF A;  1O3S A;  1W5T A;  1L3L A;  2VBX A;  3CJN A;  1D8K A;  1RI7 A;  3IWZ A;  3DF8 A;  2DPD A;  2W84 A;  2IP2 A;  4OIN F;  2DI3 A;  2FU4 A;  5J8F A;  2GQQ A;  1J9I A;  2D1V A;  2XAJ A;  2FMY A;  5JI6 A;  3FM3 A;  2HYF A;  4HDU A;  2XIG A;  4ESB A;  2QBY B;  3L7W A;  5FLX Z;  1R5H A;  4A12 A;  3SFZ A;  4L5I A;  2H6B A;  2NAZ A;  1I1S A;  3WU1 B;  4JQF A;  2JSC A;  2PFB A;  5K5O A;  4IVN A;  3HTS B;  1SD4 A;  4XBF A;  1XB4 A;  4YFX F;  1XSX A;  4LLN A;  3LAJ A;  5D6E A;  2RN7 A;  2A07 F;  5DYM A;  3V7R A;  5E8I A;  5JFR A;  2FSW A;  1T98 A;  2EB7 A;  1XN7 A;  2M5W A;  2FBK A;  3VB2 A;  4EM0 B;  4UVC A;  3F8M A;  4PCQ A;  3TO6 A;  1G4D A;  1HKT A;  4HV6 A;  1OYW A;  1KU7 A;  1KYZ A;  3WTV C;  4LFU A;  5CVJ A;  1R23 A;  5FGM A;  3CO6 C;  4HF1 A;  2VBZ A;  1S29 A;  2PMH A;  2KJB A;  2Y0M A;  1LDD A;  4B8X A;  4UV8 A;  1IAW A;  3TQN A;  2HTJ A;  5LGU A;  4RB0 A;  1HKS A;  1V3F A;  3E6D A;  5HDK A;  2AXL A;  1RNL A;  4BXU A;  2O0Y A;  2V1X A;  2H6C A;  5DD8 A;  1RUO A;  4EM2 A;  3C3W A;  1XMK A;  2DFI A;  4CXF A;  1KQ8 A;  2A68 F;  4N9I A;  2EV5 A;  1KU3 A;  4R1H A;  1MD0 A;  5LBQ A;  3PFI A;  1WRJ A;  4LD5 A;  4M6Y A;  3GZ5 A;  4I98 B;  4PDK A;  3BPX A;  2HYG D;  4WF2 A;  5DUI A;  1HSJ A;  1LJ9 A;  2ZO4 A;  4IXA A;  2EA2 A;  2E1C A;  3IC7 A;  3PQK A;  3VOD A;  3K9T A;  3F6O A;  4WX9 A;  2COM A;  2XAG A;  3ZMS A;  1K7A A;  2YU3 A;  1CGP A;  2STW A;  1YO5 C;  4Q48 A;  3F22 A;  2K86 A;  3ECO A;  3TGN A;  4Y15 A;  2EV0 A;  4A6D A;  2P7V B;  3K2Z A;  2Y48 A;  3HRS A;  2VOP A;  1XGN A;  3DEU A;  3FMS A;  1JE8 A;  4ESJ A;  3C18 A;  3MAJ A;  2FOK A;  4G7O F;  1DPR A;  1F9N A;  3E3V A;  3L00 A;  3TDZ C;  3EUH A;  4EJU A;  1Z91 A;  5HVQ C;  4FT8 A;  3M7G A;  1ULY A;  3GW2 A;  3GZ6 A;  2YR2 A;  3R0A A;  2JPC A;  5BQT A;  3LA3 A;  3HUG A;  3KP2 A;  2KIU A;  1KGS A;  2O3F A;  4ENN A;  3BPV A;  4CIC A;  2K27 A;  4KDP A;  3GX4 X;  4LG0 B;  3I59 B;  5D8L B;  3BRO A;  4KT5 C;  5DCF A;  2QEN A;  2OA4 A;  2LF8 A;  2RKH A;  1TLH B;  3U1D A;  3CLO A;  2DTR A;  4QWQ A;  1TQI A;  4XSX F;  4CHU A;  4ZZL A;  1TQP A;  2EA4 A;  1KU2 A;  4AD9 A;  3GFI A;  4HF2 A;  2IA0 A;  3LQR A;  2XUB A;  1BI3 A;  5D8K B;  3QU6 A;  3HOS A;  3RKW A;  1ZG3 A;  1WQ2 A;  4LMY A;  4OIO F;  2XAS A;  3E6C C;  2OZU A;  2JTV A;  5D5W B;  4RS8 A;  1FX7 A;  1K78 A;  5ED4 A;  4HX4 A;  1QZZ A;  4RAZ A;  3J81 Z;  3HTU A;  1XCV A;  1IN5 A;  3J80 K;  4Y13 A;  1O57 A;  1QQI A;  1D8J A;  2L4A A;  2Z33 A;  2V1D A;  1KYW A;  3J7A O;  3ECH A;  2K4J A;  2QQB A;  5FFZ A;  5HS7 A;  4WWC A;  3O6B B;  3OV8 A;  2NNN A;  3B02 A;  4OMZ A;  1BC8 C;  2A69 F;  3KEO A;  1W7P A;  1VTN C;  5ICC A;  3TO9 A;  5CVI A;  3ABT A;  3L09 A;  3I54 A;  1YW8 A;  2ZFW A;  1IRF A;  3EQL F;  1Z6T A;  1QGP A;  1H9G A;  4HX8 A;  3FXU A;  2QQA A;  2VBY A;  5FO5 A;  5E18 F;  2STT A;  4ENM A;  1F5T A;  3KFW X;  3QP6 A;  4U7D A;  1V4R A;  2ACJ A;  2QBY A;  2YX4 A;  2NS0 A;  2KRF A;  1MGT A;  4KN4 X;  2PG4 A;  4KNY A;  2DK8 A;  2V79 A;  2CW0 F;  3HIF A;  4OOI A;  3Q5F A;  2HQR A;  4ETS A;  1I6X A;  4KIF A;  1RZ4 A;  1X3U A;  4CZZ A;  3DV8 A;  2OD5 A;  3JTG A;  2PMU A;  3LFK A;  2ZJ2 A;  1J7K A;  4A0Y A;  4MQV A;  4AWX B;  3V7S A;  2HS5 A;  3MWM A;  2MA3 A;  2EFN A;  1OYY A;  2K4B A;  4XLP F;  3WTX C;  4G6D A;  3GFM A;  5F6F A;  3M1E A;  5TRD A;  1IW7 F;  2IVM A;  3SQN A;  4OMY A;  5KVR A;  2DAO A;  3DKW A;  3E5X A;  4O6J A;  2P6T A;  3HSE A;  1S7A A;  4WCG A;  5BOX A;  3ZPL A;  3OOP A;  3REO A;  1U78 A;  3TDU C;  2VE9 A;  1F4K A;  4ZYG A;  1B59 A;  4ZH4 F;  5ERI A;  4AIH A;  2TDX A;  4IPA A;  2R7F A;  5HLI A;  3ULQ B;  4EV0 A;  4LB5 A;  1QZY A;  4AIJ A;  1BI0 A;  1E2X A;  1R00 A;  2ESN A;  3KLN A;  4G7H F;  3GFL A;  3M8F A;  2YPR A;  1OPC A;  3TOB A;  5ICG A;  2F2E A;  1LDK B;  4MGR A;  2QQ9 A;  1IXC A;  4I0B A;  4IRH A;  4HQE A;  2OBP A;  4M72 A;  3I5U A;  1O3R A;  3K0L A;  4L18 B;  4RB3 C;  3WU0 A;  1L0O C;  2KIM A;  4WXH A;  3KCC A;  1BJA A;  4S05 A;  4JK1 X;  5D4S A;  1SD6 A;  2A5Y B;  1IF1 A;  3KP7 A;  1ZH5 A;  1A04 A;  1SFU A;  2VXZ A;  5LLQ A;  2HDC A;  1FC3 A;  2EV6 A;  4PGH A;  4HDV A;  3EYY A;  1UFM A;  3RYP A;  2XKP A;  1CF7 B;  3V8J A;  2A6H F;  2CWE A;  5HOO A;  1JXS A;  2FBH A;  3ZMU A;  5ICE A;  1ZG1 A;  4Q47 A;  1FBQ A;  4EJW A;  3NRV A;  1TNT A;  4G8X A;  3ML6 A;  1U3E M;  4ENK A;  4U7B A;  4R8H A;  1FP2 A;  2IPQ X;  3G3Z A;  3IKT A;  5CVU A;  5BPD A;  4LLG F;  3WGI A;  3FWE A;  5AON A;  4GGG A;  2H09 A;  1GXQ A;  5H6Q A;  1ZAR A;  2L3D A;  1BI2 A;  1FSE A;  3RPU A;  5JR3 A;  4ZYH A;  4M9S A;  1YLF A;  1P6R A;  1WI9 A;  3C7J A;  2XKO A;  3JW4 A;  3ISP A;  3VEP A;  1ONV A;  3DPT A;  3FX3 A;  5DUK A;  2HEO A;  3WGG A;  2GIV A;  2OU2 A;  2WTE A;  4LG0 A;  3IL2 A;  2BEO A;  2HTS A;  1SD7 A;  4GYG A;  2VOO A;  2DQL A;  3I59 A;  4BQA A;  2PI0 A;  1YS6 A;  1LNW A;  4U0Y A;  4KMF A;  5LHG A;  1U6G A;  1BN5 A;  3TO7 A;  2HQN A;  3O3K A;  1EH6 A;  1FY7 A;  5H6R A;  2D1H A;  5HS9 A;  1YW9 A;  5F1R A;  5E1Z B;  5CJ9 A;  2FXA A;  4ZYE A;  2VON A;  3ZP5 A;  1O7L A;  4LK1 F;  2IJL A;  5HLG A;  5DCM A;  2HWV A;  1I1G A;  1HKQ A;  3EDP A;  4EQQ A;  3ELK A;  4AIK A;  3QAH A;  2XAF A;  5E1X A;  2P5V A;  5D5U B;  3ZN1 A;  4KIB A;  4RGR A;  1U8R A;  2DPU A;  2BE5 F;  2ISZ A;  2RQP A;  4L5J A;  3SZP A;  3KP4 A;  3QU3 A;  4HLX A;  1XDS A;  4JBA A;  5LGN A;  1I5Z A;  1WKM A;  4WXD A;  5AIP A;  2DBB A;  3CUO A;  5DEQ A;  4G9Y A;  2G7U A;  3HRU A;  4LLL A;  1QO0 D;  1S3J A;  4M9X A;  1T6S A;  2ZNZ A;  2OQG A;  3SZT A;  5L3C A;  3F23 A;  4L9N A;  1B9N A;  1FT9 A;  4HLY A;  5L3F A;  1T38 A;  3IHU A;  3JTH A;  1ZLK A;  3ROU A;  3AAF A;  4HV5 A;  4ENJ A;  1LQ1 A;  1HST A;  3LST A;  5E17 F;  1ON2 A;  3TKY A;  2PN6 A;  1FPQ A;  3R60 A;  2KKO A;  2A6E F;  5L3E A;  2MLG A;  3KEQ A;  2OAZ A;  1PDN C;  3S2W A;  1LEA A;  4A5N A;  5HDN A;  2K02 A;  1R1T A;  3LA7 A;  2DO7 A;  4OIR F;  1Z7U A;  1JHH A;  1T2K A;  2D45 A;  4RGX A;  3RKY A;  4UVB A;  5L3D A;  2CYY A;  4P5O A;  2Z3Y A;  2J5O A;  2O6G E;  3KP3 A;  1BM9 A;  2X4H A;  2IA2 A;  3FZV A;  4XRF A;  5FFX A;  2Y75 A;  3I58 A;  1Z1D A;  4RAY A;  2E7X A;  1J2X A;  2MH2 A;  4I2O A;  3P9I A;  1ZRF A;  3QRF F;  4IHS A;  1FWZ A;  5E8G A;  4IRI A;  2MD5 A;  3NEU A;  4MQ9 F;  3WGH A;  1K79 A;  3FHZ A;  3GO5 A;  4XSZ F;  1AOY A;  5A2Q K;  4MTD A;  1UHW A;  1HXD A;  2G9W A;  2XHK A;  3GEZ A;  3RTR A;  3U2R A;  3GF2 A;  1ZRC A;  4A5M A;  3RPQ A;  1U5T B;  1KQ0 A;  4ESF A;  2J5P A;  2ZME A;  1U2W A;  5FB2 A;  2ZCW A;  2DK5 A;  1R1U A;  1T39 A;  2EK5 A;  1PP7 U;  4M71 A;  3KZZ A;  3E6M A;  3I64 A;  1PUE E;  4A6E A;  2IA1 A;  3W6J B;  4A2U A;  1GXP A;  3DFG A;  2MC3 A;  1GVJ A;  2O8X A;  3FXR A;  2CG4 A;  3ZMZ A;  2VC1 A;  4M9Z A;  4P9F A;  1LDJ A;  4BHC A;  3BWG A;  4KUM A;  2G7H A;  4KMU X;  3T8T A;  1HBX G;  1G3W A;  5CYV A;  1MDM B;  4MNU A;  1XCB A;  4FX0 A;  3WTW C;  5L3B A;  2QLZ A;  1ZRD A;  5CVR A;  2FML A;  4Q4Z F;  3E5Q A;  2P4W A;  1OMI A;  3HRT A;  3D0S A;  4YG2 F;  2UWM A;  1Z05 A;  1AWC A;  2XVC A;  2F5C A;  2MBF A;  1YG2 A;  5LRS A;  2W57 A;  2ESH A;  2VN2 A;  5F64 A;  3JAM K;  1SFE A;  5E1W A;  3SHF A;  5AIQ A;  3NQO A;  1IUY A;  4NHJ A;  4DNC A;  2VC0 A;  1EH8 A;  1CF7 A;  1BIA A;  2F5E A;  3HHH A;  3L9F A;  3R61 A;  1K6O A;  3P9K A;  4RB1 A;  4EVI A;  4M73 A;  2LKP A;  2GXG A;  4GYI A;  2HKX A;  3QOP A;  5ILS A;  3WE2 A;  1FYK A;  2P7C B;  3JSP A;  2EWN A;  2JRT A;  3I4P A;  1MJB A;  1IN4 A;  4I09 A;  1REP C;  2L4M A;  2WWY A;  1HW2 A;  4IRG A;  2IW5 A;  4IJA A;  4KA4 A;  5LEJ A;  1LB2 A;  3F6V A;  3I71 A;  4M6X A;  4UVA A;  4EM1 A;  4M74 A;  2QUF A;  1HW5 A;  3HSF A;  3QPT A;  1MJ9 A;  4WK8 F;  3LWF A;  4NQW A;  1RUN A;  2EFO A;  3BP8 A;  4F7Z A;  1SMT A;  3KP6 A;  3CUQ B;  1DPU A;  2UXN A;  5FLX K;  3MFK A;  3R0J A;  4S04 A;  2M45 A;  4UUV A;  2QM3 A;  3GUD A;  1LEB A;  2DQR A;  2FNA A;  4B09 A;  1RIO H;  3BJA A;  3CDH A;  1B1B A;  3ZMD A;  1J5Y A;  3DXJ F;  4IF4 A;  5J6X A;  5KK1 A;  1XSD A;  5CLS A;  3RDI A;  5JVT A;  1G3S A;  1ODD A;  3J80 Z;  3WTZ A;  1D3Y A;  3ZQ7 A;  2F5F A;  3WTS C;  4E70 A;  1B9M A;  4BAY A;  1FLI A;  1PP8 F;  4KN7 X;  5FD6 A;  1XGO A;  3RKX A;  2IRF G;  3M8E A;  2CGP A;  2P8T A;  2BBY A;  2FE3 A;  1IN7 A;  1P2F A;  4UHT A;  2JT1 A;  4EJT A;  5HS8 A;  2B0L A;  3IRQ A;  3F8N A;  3WE3 A;  2W25 A;  2XRN A;  2FBI A;  3IKV A;  1XSV A;  2CFX A;  3DP7 A;  3MQ0 A;  4Z2Y A;  2KJC A;  2CSO A;  2GA1 A;  3GWZ A;  4I02 A;  1BIB A;  5HLH A;  4HAM A;  4BHB A;  2DLL A;  1KQ9 A;  2RC4 A;  1YYV A;  4LB6 B;  2NNY A;  3T5X A;  2RV8 A;  3ZMT A;  2R3S A;  4GCV A;  5DV5 A;  3K1M A;  2AS5 F;  4OIQ F;  2IT0 A;  3H3U A;  2PLY A;  1YIO A;  1BC7 C;  1G6N A;  2Z5U A;  4UXN A;  1STZ A;  1SMY F;  1LVA A;  3FF5 A;  2RGV A;  2P5K A;  1Q1H A;  1G3Y A;  3KE2 A;  3FM5 A;  2ISY A;  1FBS A;  3P7N A;  1UB9 A;  2BYV E;  1ZGA A;  2FQ3 A;  1P92 A;  2F5D A;  4WXC A;  3F8C A;  2A3S A;  2M1B A;  3K1P A;  1O3T A;  1IXR C;  2M87 A;  1BI1 A;  2ELH A;  2HKO A;  1IRG A;  2LF7 A;  1FP1 D;  3KLO A;  3CTA A;  1ON1 A;  2DW4 A;  1OKR A;  3KET A;  4L9V A;  5L3G A;  3I0T A;  2UXX A;  3TOA A;  3F8F A;  1U5T A;  3R4K A;  2YSR A;  3ZN0 A;  4XLN F;  2O03 A;  3MCZ A;  1UCR A;  1FSH A;  2OQR A;  1P4W A;  4AVP A;  5FD5 A;  1TTY A;  1UHM A;  2DT5 A;  5D6F A;  1B6A A;  3E97 A;  4Q5S F;  4IHT A;  2XAQ A;  2WC2 A;  3KP5 A;  2CO5 A;  2VOD A;  3U9G A;  1GHC A;  4HOB A;  1R36 A;  3BZ6 A;  2E7W A;  1B4A A;  5LHH A;  2FEZ A;  5LHI A;  3BJO A;  3K1N A;  1MDM A;  3RYR A;  1Y0U A;  5HDG A;  2OZ6 A;  5TJJ A;  4GO1 A;  5D4R A;  1I27 A;  2EFW A;  1S8N A;  2LSO A;  1ZYR F;  3HHG A;  4R79 A;  4G7Z F;  2GWR A;  2RVC A;  4YII A;  3ZMV A;  2JZY A;  4O5V A;  2MH9 A;  2D2W A;  2HFH A;  4MTE A;  4RB2 C;  3H3Z A;  3V8L A;  1QBJ A;  3WOD F;  3RJP A;  2PEX A;  3J81 K;  1O7F A;  3WTY C;  5D5X B;  5JHU A;  1R7J A;  2M8E A;  2GAU A;  2O61 A;  2ZXJ A;  3H92 A;  4N9H A;  4U88 A;  3LQQ A;  4CYD A;  2W24 A;  4YFN F;  2PBI A;  4A0X A;  3PQJ A;  1T0F A;  4L0Z B;  4ZYD A;  1R5G A;  2JPB A;  2PQ8 A;  2ZBK A;  4PGG A;  2A61 A;  4BYY A;  3QP5 A;  2QYO A;  2RDP A;  1HW1 A;  3T1B A;  4L9J A;  5LGT A;  1H9T A;  3FMQ A;  2HR3 A;  3KZY A;  4HX7 A;  1KA8 A;  2YX7 A;  2BV6 A;  5H20 A;  4A0Z A;  2M30 A;  2VE8 A;  1D5V A;  1S7O A;  3N97 A;  1IXS B;  1W5S A;  2W85 A;  4U0V A;  4LGW A;  3MEX A;  2XV4 S;  2LDU A;  3ABU A;  5LRR A;  1W7P D;  3E6B A;  5IT3 A;  1SD5 A;  3VFZ A;  4ASN A;  3CUQ A;  3FMR A;  4HBL A;  1TQM A;  1J0R A;  4BHP A;  1IN6 A;  3D5L A;  3Q9S A;  2P6S A;  2LNB A;  1P4X A;  1QNT A;  4ON0 A;  1YW7 A;  4LJZ F;  2L01 A;  2VT3 A;  1JHF A;  2Z9O A;  1R58 A;  1BBY A;  1ZGJ A;  1MJA A;  3BOQ A;  3SXY A;  2DU9 A;  4EJV A;  4EGZ A;  1YQA A;  4UNO A;  5E20 A;  2HZT A;  1DP7 P;  1SFX A;  2NRA C;  2QWW A;  3GYH X;  1E17 A;  3LA2 A;  3DQV C;  1P4A A;  2FRH A;  3WG9 A;  1ZAO A;  4GXO A;  2E1N A;  4EGY A;  3GLX A;  5BMZ A;  2VBW A;  1EH7 A;  1DUX C;  4K2E A;  5DCM B;  4ZZD A;  4MHG A;  2BGC A;  1S6L A;  1FYM A;  2EFQ A;  4H0E A;  1FYL A;  3MZH A;  2PJP A;  3P9C A; 
#chains in the Genus database with same CATH topology
 4RGS A;  3M9A A;  4HW0 A;  2QVO A;  2Q0O A;  2NYX A;  5CVV A;  3R6S A;  4P96 A;  2NOJ B;  4X6A J;  3WTU C;  2E35 A;  2R7S A;  2X0L A;  1J59 A;  2F5V A;  2R7R A;  1R4M B;  5B66 C;  5IT9 K;  2HOE A;  2XB5 A;  3I9V 2;  4F52 A;  2R7U A;  3S3N A;  1FNN A;  2ETH A;  1QPM A;  2BXZ A;  1Z6R A;  2EH3 A;  1HLV A;  2FF4 A;  3F72 A;  5JLX A;  2M0M A;  1WI3 A;  3G2B A;  4HG2 A;  1UJ8 A;  2BW3 A;  3TW6 A;  4E4H A;  1S7E A;  3CCM I;  2ZNY A;  4BAC A;  2M3A A;  4XM3 A;  4AYB A;  4XQF A;  1F1Z A;  4HF0 A;  1MZB A;  2ZXH A;  2UZK A;  3DTE A;  4BH9 A;  2X6X A;  4P55 A;  4O3M A;  4BE1 A;  4J00 A;  2Z99 A;  3DKX A;  4YFK F;  5BPI A;  3ERE D;  5J8C A;  1FEX A;  1R1V A;  3BY6 A;  3LAP A;  3GTO J;  2K9S A;  1W5C C;  1BJZ A;  4QPQ A;  5ILU A;  3OYA A;  3F21 A;  5TIS C;  4BY1 J;  5CPR B;  4UV9 A;  2NVU B;  1IN8 A;  5CKT A;  4BE0 A;  1W4M A;  2MW8 A;  5DDG A;  2H27 A;  1P9Q C;  2PJR B;  2JVH A;  3HSR A;  3LSP A;  1QHG A;  1UST A;  3HEF A;  2DT6 A;  2GA2 A;  4LK0 F;  3BDD A;  1XGM A;  3CP2 A;  6PAX A;  4EMS A;  4OIP F;  2K9Q A;  2MAB A;  2WV0 A;  5K7H A;  2V9V A;  3PNY A;  3I53 A;  3O2P E;  4HYE A;  4BJ5 C;  3G73 A;  2MSY A;  4BY7 J;  1IZ1 A;  1FTZ A;  1TT5 B;  2LOO A;  3QOD A;  1U5T C;  4PZJ A;  1OYI A;  3FXQ A;  4CDG A;  1DDN A;  4KIC A;  4F92 B;  2WAQ N;  1FZP B;  4TV7 A;  1GUU A;  1FOK A;  1QU3 A;  4HA8 A;  1OR7 A;  2RRE A;  2X6W A;  1BOA A;  4G6Q A;  2V6E A;  4D0P A;  2MGQ A;  3ZCO A;  2FNP A;  1WFX A;  1ZLJ A;  3CCR I;  5K5R A;  3JRB A;  2E5Z A;  5A2Q Z;  3JRC A;  3BJ6 A;  2R93 J;  1WSU A;  5D5V B;  4I7H A;  5FKL A;  5GAH J;  1KU9 A;  1U0J A;  4PK4 A;  3JRD A;  4LOC A;  5EEH A;  3BT9 A;  4OU0 A;  4DZJ A;  1SVO A;  3FXO A;  1H0M A;  4P9U A;  3OSF A;  3S17 J;  1FOW A;  1TNS A;  2CQK A;  1QVT A;  4NB5 A;  4DQ2 A;  2HGC A;  3L2C A;  3CCV I;  3OYC A;  1BR1 A;  2X9D A;  4HPQ A;  4DBQ A;  2VT2 A;  4Y33 A;  1HF0 A;  3T8R A;  1VQ9 I;  3MZY A;  3ZOB A;  3B6A A;  3HUG B;  4I0A A;  1R6R A;  2EBI A;  4PFP A;  3HYI A;  3FXJ A;  2MFZ A;  5K5Q A;  3V4G A;  2BXY A;  1XD7 A;  5K7F A;  1ZG5 A;  4LIU A;  4MEY F;  2ELK A;  4FHT A;  3JSO A;  2L54 A;  2IGO A;  3COA C;  3OYF A;  5J1Y A;  3K69 A;  2Y9Y A;  4U0W A;  5FRN A;  1ZTR A;  5GP9 A;  1W1W E;  1Z9C A;  4D5C A;  3V7C A;  3T0Y A;  5LEK A;  2GZW A;  4M3E A;  2C6Y A;  3C1D A;  5IPA A;  2HVS A;  4BJ6 C;  2Y30 A;  4JX5 A;  4RGU A;  4L0Y B;  4RLQ A;  4KYW A;  3GVA A;  5LD2 C;  3NAR A;  3GXO A;  2DOF A;  1DQU A;  1TW3 A;  2MLK A;  3LMM A;  5K1Y A;  1KZH A;  2XRO A;  1A31 A;  2ADU A;  2ZME B;  1V5E A;  2RNJ A;  3B73 A;  1SAX A;  3CO7 C;  1MKM A;  3H1C A;  4KIG A;  4Y17 A;  1TC3 C;  3N4M A;  3DBH B;  4F93 B;  1NHA A;  4CGZ A;  2GLO A;  4DYR A;  1TW2 A;  4A3E J;  2F4I A;  1YS7 A;  1N25 A;  5ICF A;  1O3Q A;  1WPK A;  3EET A;  2FA5 A;  1QRY A;  3RPU D;  1USS A;  1J75 A;  1T0F C;  2QZ8 A;  2R7D A;  4E7L A;  1ZRE A;  1N75 A;  3VYT B;  2KIF A;  3IWF A;  5ILV A;  1C0W A;  3EYI A;  3Q9V A;  1MBF A;  2IAI A;  3HOT A;  1YFH A;  5EEG A;  2V1U A;  5IT9 Z;  1IRZ A;  3MKW B;  2EJR A;  4ZDP A;  2CUJ A;  4JX6 A;  4E7Z A;  1TBX A;  3IRR A;  4I01 A;  1K78 B;  2DXI A;  3GTG J;  3F8B A;  1YTY A;  4HQM A;  2LK2 A;  2LC2 A;  2K7L A;  1HA8 A;  2KRH A;  3FBN B;  1G3T A;  1TWG J;  4C3H J;  1EV7 A;  3FXM A;  2XGX A;  4KFC A;  2Q8K A;  5BS6 A;  2PMZ N;  3JAM Z;  5E3M A;  1E3H A;  4CO8 A;  2ZJP F;  1SAU A;  1ZHF A;  3QPH A;  2VQH A;  2Q2E A;  3VOE A;  3V8K A;  3RI4 A;  1R22 A;  3ZQG A;  1WWX A;  4C30 A;  4N0B A;  2L02 A;  1YJ9 I;  1HQC A;  2A6T A;  3GFJ A;  4F3Q A;  3RIR A;  3WTT C;  3UKG A;  1H89 C;  3HRM A;  3ZQF A;  2DA5 A;  1XMA A;  1UMQ A;  4IQ4 A;  2ZKZ A;  2GXB A;  1AA7 A;  4FX4 A;  1XPX A;  2JA6 J;  2YU9 J;  2ZXI A;  4CH7 A;  2P5L C;  4G94 A;  2XAH A;  1FBU A;  3LL7 A;  1W7P B;  2V6C A;  5IYC J;  5DM6 F;  2AHQ A;  4F55 A;  3F3X A;  5DD4 A;  4QLC U;  1XDU A;  4J19 A;  4BNC A;  1RKW A;  2XDV A;  4YIF A;  4MEX F;  2EIL H;  2EFP A;  1SVM A;  3OYN A;  4EJO A;  3DPL C;  4HSR A;  2VIX A;  1ZN2 A;  3I4N J;  4XL9 A;  3E5U A;  4BU2 A;  3W6K B;  3CUQ C;  4L9T A;  3HPG A;  4XK4 A;  1JGS A;  4B4C A;  1XGS A;  1R49 A;  2H94 A;  4HZF A;  1O3S A;  2K40 A;  5FKK A;  1W5T A;  1L3L A;  1JJ6 C;  3PNT A;  2VBX A;  3CJN A;  2R7Z J;  2KL4 A;  2BHY A;  3SEZ A;  4DW6 A;  1D8K A;  4IX7 A;  1RI7 A;  2WB1 A;  4DJA A;  3IWZ A;  3DF8 A;  4B3A A;  2DPD A;  2DA6 A;  2W84 A;  4Z6Y A;  3S1R J;  1NK3 P;  3AL0 B;  2IP2 A;  4OIN F;  2DI3 A;  4Y52 J;  2FU4 A;  3U21 A;  2E34 A;  5J8F A;  5EG0 A;  5K7Z A;  2ZSI B;  2E2J J;  2GQQ A;  1IG7 A;  3AG3 H;  1J9I A;  3DBL B;  3SFI A;  2D1V A;  2DFE A;  2XAJ A;  2Z2S B;  2FMY A;  4CCL A;  5JI6 A;  3FM3 A;  2HYF A;  4HDU A;  2XF6 A;  3K4N A;  3KEY A;  3RQ4 A;  2XIG A;  2XPV A;  3KIO A;  4ESB A;  2QBY B;  1RR8 C;  3MVP A;  3L7W A;  5FLX Z;  1R5H A;  4A12 A;  4GFB A;  3SFZ A;  1MIJ A;  5JHF A;  4L5I A;  2H6B A;  2XGC A;  2NAZ A;  1I1S A;  1U9N A;  2ZJR F;  3WU1 B;  4JQF A;  1X2N A;  1IV6 A;  2KP6 A;  2JSC A;  2PFB A;  2DMT A;  4A3K J;  5K5O A;  1VQ5 I;  4IVN A;  1K4T A;  1G59 A;  1SD4 A;  3HTS B;  5IYB J;  2HU9 A;  4XBF A;  4C9Y A;  1FOY A;  1XB4 A;  4YFX F;  1XSX A;  4LLN A;  2OTJ I;  1MW7 A;  3LAJ A;  1ETX A;  2R5Y A;  4A3C J;  5D6E A;  2RN7 A;  3EUK L;  4XLH A;  2A07 F;  3I3L A;  5DYM A;  4ABZ A;  5F04 A;  3V7R A;  5E8I A;  4MFD A;  3S93 A;  2EZH A;  4I76 A;  5JFR A;  3M3Y J;  3HZJ A;  2KFD A;  2FSW A;  1TT0 A;  3O8H A;  1T98 A;  2EB7 A;  4NQW B;  1ETO A;  3HBL A;  1Z7L A;  4PJM A;  1XN7 A;  2M5W A;  2FBK A;  2LMD A;  3VB2 A;  4EM0 B;  4UVC A;  2UUZ A;  3F8M A;  4MLO A;  4PCQ A;  3SDB A;  3TO6 A;  4QSH A;  2M4K A;  1G4D A;  4EEF G;  1HKT A;  3LSJ A;  4HV6 A;  1HOM A;  1OYW A;  4C3I J;  1KU7 A;  1KYZ A;  2IGN A;  3WTV C;  4LFU A;  1H8A C;  1U9O A;  1R23 A;  5CVJ A;  1Y8Q B;  5F08 A;  3Q0U A;  5FGM A;  3BZC A;  3CO6 C;  1RPW A;  4HF1 A;  2VBZ A;  1A6Q A;  4PFO A;  1S29 A;  2V4J C;  3QQA A;  3BQY A;  4JP0 A;  4M6V A;  4ITV A;  1Y1V J;  2PMH A;  1ZKG A;  2KJB A;  2QF7 A;  1LFU P;  2F48 A;  2Y0M A;  1LDD A;  2R4G A;  4B8X A;  3ZGK A;  2E36 A;  3GLL A;  4UV8 A;  1IAW A;  2HTJ A;  3TQN A;  1ERD A;  5LGU A;  2CH0 A;  5FKM A;  4NC6 A;  4RB0 A;  1DP3 A;  3LFU A;  4BEH B;  1HKS A;  1V3F A;  3HGY A;  2L2O A;  2WAD A;  3E6D A;  5HDK A;  4XLE A;  3OL3 A;  2AXL A;  5KHD A;  2MG4 A;  1RNL A;  2NOG A;  1YRN A;  2XGE A;  4BXU A;  2O0Y A;  2V1X A;  3K7A J;  1OCO H;  2H6C A;  3TP0 A;  5DD8 A;  1A36 A;  4AM3 A;  1RUO A;  2KLO A;  4EM2 A;  3C3W A;  3LSI A;  1XMK A;  2O5R A;  2DFI A;  2IS1 A;  4CXF A;  1KQ8 A;  2A68 F;  4N9I A;  1GVD A;  1OJL A;  2EV5 A;  1K61 A;  1KU3 A;  1JUP A;  1UG2 A;  4R1H A;  1GV5 A;  1X4O A;  1F43 A;  1Y8R B;  1MD0 A;  1Z77 A;  5LBQ A;  1Y56 A;  2EIJ H;  1WRJ A;  3PFI A;  4LD5 A;  3J7Z I;  2XF5 A;  4M6Y A;  4JOM A;  3GZ5 A;  3G1M A;  4I98 B;  2RQQ A;  1DGR M;  4PDK A;  3BPX A;  1OR7 C;  4BQO A;  3BQZ A;  5B5E C;  2X6Y A;  1YX3 A;  2HYG D;  2OCC H;  2LY9 A;  4WF2 A;  5DUI A;  1HSJ A;  4XRS A;  1LJ9 A;  3L2R A;  2ZO4 A;  1FJL A;  4IXA A;  2EA2 A;  3Q3S A;  1DU6 A;  3TMO A;  2E1C A;  3IC7 A;  3PQK A;  3KPH A;  3VOD A;  2XB0 X;  4BQN A;  2LP0 A;  3K9T A;  2Z1D A;  1ETY A;  2COM A;  1WHU A;  3F6O A;  4WX9 A;  1IRG A;  2LRE A;  2XAG A;  2R7T A;  3ZMS A;  2Y9Z A;  2YU3 A;  1K7A A;  1JT6 A;  2PJR A;  1CGP A;  1G8X A;  3Q0W A;  2V7F A;  1F36 A;  5B1A H;  1I6H J;  2STW A;  1YO5 C;  2L9R A;  2N8G A;  4Q48 A;  4P1W A;  3F22 A;  2K86 A;  3V42 A;  3ECO A;  3OYL A;  3TGN A;  4Y15 A;  5HLT A;  2W7N A;  2EV0 A;  5JVG F;  3PJR A;  4A6D A;  2P7V B;  2OJE D;  3ESW B;  3K2Z A;  1W0T A;  1JGG A;  2Y48 A;  3HRS A;  3K4M A;  4FE4 A;  3L2V A;  2VOP A;  5J1U A;  1XGN A;  3DEU A;  3FMS A;  1YE9 A;  4XKW A;  1JE8 A;  4ESJ A;  1E0E A;  2X51 A;  3VSK A;  3C18 A;  3MAJ A;  3K4C A;  5CQE A;  2E5N A;  2K3F A;  2LH9 A;  2FOK A;  2W82 A;  4G7O F;  3DTK A;  1DPR A;  2X48 A;  3IAS 2;  2ELJ A;  4A3D J;  1GDT A;  1VF9 A;  5DTD A;  2WAQ A;  4S0H B;  1OIS A;  4A3M J;  1F9N A;  2O7O A;  3E3V A;  2VQL A;  2IEK A;  3L00 A;  3TDZ C;  3I55 I;  5EYR A;  3EUH A;  4EJU A;  4M3F A;  1Z91 A;  3ASO H;  5HVQ C;  4NC7 A;  4FT8 A;  3M7G A;  4YRV A;  4B1R A;  4FCY A;  1ULY A;  4BBS J;  2KQR A;  4DYQ A;  4M3D A;  4UUS B;  2LFB A;  3GW2 A;  2EZK A;  3GZ6 A;  3BC8 A;  3WHB A;  3HJE A;  4IKF A;  1LFB A;  5EEA A;  2YR2 A;  2V1N A;  2L9V A;  2HI3 A;  2JJ7 A;  3R0A A;  4XN0 A;  2JPC A;  5BQT A;  1APL C;  3CJQ B;  3QOE A;  3LA3 A;  3HUG A;  3KP2 A;  2KIU A;  3JCU C;  5GTH C;  3BZK A;  1KGS A;  3L2U A;  1LKX A;  2O3F A;  4ENN A;  3BPV A;  4CIC A;  2GIZ A;  5LFA A;  3OYI A;  2ID6 A;  2HZD A;  2K27 A;  4KDP A;  3GX4 X;  4EAT A;  4LG0 B;  5TGT A;  1VZ0 A;  1MMD A;  3I59 B;  5D8L B;  2BVM A;  3NAU A;  3BRO A;  4BBR J;  3G4S I;  2HDD A;  2XPW A;  2A5W A;  1PVE A;  1ETK A;  3CES A;  3DLA A;  2DA7 A;  4KT5 C;  5DCF A;  2QEN A;  2OA4 A;  2LF8 A;  2RKH A;  5KNL A;  1TLH B;  3U1D A;  2HXO A;  2DTR A;  2K5C A;  2KPM A;  3CLO A;  4QWQ A;  3OIO A;  2VJ5 A;  4HNV A;  1TQI A;  2VKV A;  3BG3 A;  1X58 A;  1VQ7 I;  4XSX F;  2LG4 A;  3QYF A;  4YEJ A;  4CHU A;  4ZZL A;  1TQP A;  2EA4 A;  1KU2 A;  1IRX A;  4XKV A;  2PX9 A;  3H5N A;  4AD9 A;  3GTQ J;  3GFI A;  2XGD A;  1Z67 A;  4HF2 A;  2IA0 A;  3KYL A;  1RKT A;  4E7H A;  3LQR A;  4BQQ A;  3S16 J;  3JRA A;  3OMY A;  2XUB A;  3K4L A;  3RCO A;  2QKL B;  1BI3 A;  5D8K B;  3OYD A;  2L5Q A;  4L5E A;  3QU6 A;  3M1C A;  3HOS A;  3RKW A;  1ZG3 A;  1WQ2 A;  4LMY A;  1HCR A;  2BY0 A;  4OIO F;  2VKE A;  2XAS A;  3Q0V A;  4AVZ A;  2BOL A;  3W2W A;  3E6C C;  2R7W A;  1I39 A;  2OZU A;  2JTV A;  3W6V A;  5D5W B;  4RS8 A;  1FX7 A;  1K78 A;  5EJC A;  2L0K A;  5ED4 A;  4HX4 A;  1QZZ A;  4RAZ A;  3J81 Z;  2JA5 J;  4IHV A;  3HTU A;  2AQF A;  1T08 B;  1XCV A;  2I10 A;  1IN5 A;  3VDX A;  3J80 K;  4Y13 A;  1O57 A;  5GPC A;  1QQI A;  2R7X A;  2L4A A;  2Z33 A;  1D8J A;  2V1D A;  1FOX A;  1KYW A;  3FIS A;  4A3F J;  3TW7 A;  2CUF A;  1V54 H;  3VYR B;  2B7E A;  1JI8 A;  3J7A O;  4NC8 A;  1LE8 B;  2YUS A;  1BW6 A;  1RET A;  3ECH A;  3ERM A;  5FLV A;  2W1O A;  2K4J A;  2QQB A;  3K4J A;  5FFZ A;  4N4O B;  5HS7 A;  2XAU A;  4CA0 A;  3HOW J;  2E2I J;  4WWC A;  3AG1 H;  3X2Q H;  1X4P A;  3O6B B;  3PM1 A;  2WA0 A;  3C2H A;  3OV8 A;  2NNN A;  5JLW A;  2PMZ A;  3B02 A;  2X6O A;  5IOZ A;  4OMZ A;  1BC8 C;  2ZXW H;  2A69 F;  2KZG A;  3KEO A;  3NWT A;  1W7P A;  2BY1 A;  1VTN C;  3SEQ A;  4D7M A;  2H1K A;  5ICC A;  3A4C A;  4QIW N;  3TO9 A;  2P0W A;  4PJN A;  5CVI A;  3ABT A;  1UG0 A;  3L09 A;  4D9J A;  1ETQ A;  1YW8 A;  3I54 A;  4C2U A;  2ZFW A;  1IRF A;  3EQL F;  2IS6 A;  1V5G A;  2E71 A;  1Z6T A;  1QGP A;  2MYS A;  4DGW B;  1BA5 A;  2L9S A;  3S2H J;  1H9G A;  1ETW A;  5H2F C;  4HX8 A;  3FXU A;  3EUA A;  2QQA A;  2VBY A;  2WY8 Q;  5FO5 A;  5E18 F;  5EGO B;  4BXF A;  1NTC A;  3DPU A;  2STT A;  4ENM A;  1F5T A;  4IHW A;  3ZR8 X;  2LY2 A;  1BW5 A;  3KFW X;  3QP6 A;  1DU0 A;  2KIS A;  1MBE A;  4MIM A;  2JUG A;  3DKY A;  4U7D A;  4YIR X;  1V4R A;  1OCZ H;  3K2A A;  2ACJ A;  2QBY A;  3HL2 A;  2YX4 A;  3OYM A;  2NS0 A;  2DA4 A;  1POG A;  2KRF A;  3CMY A;  3ZQH A;  2R92 J;  4PSW A;  2P81 A;  1MGT A;  4KN4 X;  5C4X J;  2BZT A;  5J47 A;  2PG4 A;  1JTX A;  3UNG C;  4KNY A;  2DK8 A;  2V79 A;  2CW0 F;  4BXX J;  3A1Y A;  3HIF A;  3LSH A;  3JRE A;  3CD6 I;  4OOI A;  3GZN B;  3BG6 A;  4W97 A;  1MSF C;  3Q5F A;  2HQR A;  4ETS A;  1I6X A;  2VL8 A;  4KIF A;  1RZ4 A;  2KRC A;  4OAZ A;  1SAN A;  1X3U A;  4JYK A;  4CZZ A;  3DV8 A;  2OD5 A;  3JTG A;  2PMU A;  3LFK A;  2NVY J;  4II2 A;  1VQK I;  2ZJ2 A;  5GAG J;  1J7K A;  4A0Y A;  4MQV A;  2LTP A;  3K70 D;  4AWX B;  4PJJ A;  3OYK A;  3V7S A;  2HS5 A;  1ZR4 A;  1K4S A;  1JT0 A;  3MWM A;  2MA3 A;  2EFN A;  1UEL B;  1OYY A;  2K4B A;  4XLP F;  4KJZ A;  3WTX C;  4G6D A;  2ME0 A;  3GFM A;  5F6F A;  3M1E A;  5TRD A;  2CMP A;  2V9P A;  1IW7 F;  2IVM A;  3SQN A;  1UAA A;  4OMY A;  5KVR A;  2HYJ A;  3EPZ A;  3MZ8 A;  2DAO A;  3DKW A;  4RAF A;  3CME I;  3E5X A;  2OC6 A;  5FKN A;  4O6J A;  2VAS A;  2P6T A;  3HSE A;  4XOP A;  1S7A A;  3SZG A;  4WCG A;  5BOX A;  3ZPL A;  2M4G A;  4B48 A;  3BTL A;  3OOP A;  3REO A;  5GTI C;  5M3M J;  1YJN I;  1U78 A;  4UY8 I;  3TDU C;  2VE9 A;  2E1O A;  5KAF C;  1F4K A;  2VPL A;  3MN2 A;  3LSG A;  3PIP F;  1VQO I;  4ZYG A;  3S1N J;  2X1E A;  1B59 A;  4BEH A;  4ZH4 F;  3U1K A;  5ERI A;  4AIH A;  1IC8 A;  3FXL A;  2Y0S N;  1E3P A;  2ZSH B;  5E79 C;  2VKD A;  1BOB A;  2TDX A;  3GTM J;  4IPA A;  2R7F A;  1JUS A;  1NK2 P;  3ZQI A;  5C4J J;  4BGD A;  1B8I B;  3A01 B;  5HLI A;  3ULQ B;  4EV0 A;  4LB5 A;  4UB8 C;  1KON A;  3CMA I;  4XID A;  1QZY A;  5GAE J;  1ZR2 A;  4AIJ A;  1BI0 A;  1E2X A;  4RM2 A;  1R00 A;  5DS9 A;  2ESN A;  1W36 C;  1PYV A;  3KLN A;  2E2H J;  4IQJ A;  3HOU J;  3BTI A;  4QPO A;  4G7H F;  3GFL A;  3W2V A;  2Y31 A;  2VJI A;  3M8F A;  2YPR A;  1OPC A;  3TOB A;  3TL4 X;  5ICG A;  3DCF A;  1P7I A;  2VJJ A;  2F2E A;  1LDK B;  4MGR A;  2QQ9 A;  1IXC A;  4I0B A;  4IRH A;  5IY5 H;  4HQE A;  2OBP A;  1AKH B;  4M72 A;  3I5U A;  1O3R A;  3K0L A;  1YIT I;  4AYB N;  4CUG A;  4L18 B;  1HC8 A;  3DU5 A;  4RB3 C;  3WU0 A;  1L0O C;  1WJB A;  1Z21 A;  2X1C A;  2KIM A;  4ANJ A;  4M3G A;  3KCC A;  4WXH A;  3QWL A;  1TWH J;  1BJA A;  2W4S A;  2GXA A;  3DWL E;  4S05 A;  4GDF A;  3EUH C;  4JK1 X;  3H0D A;  5D4S A;  2BW3 B;  1SD6 A;  2A5Y B;  4BL0 B;  2ZC2 A;  3TBI A;  1IF1 A;  3KP7 A;  1ZH5 A;  1A04 A;  2O9L A;  1LVK A;  1SFU A;  3S1M J;  2VXZ A;  2NVT J;  5LLQ A;  1RC9 A;  4HST A;  2XRL A;  2HDC A;  1FC3 A;  2ICW G;  2EV6 A;  1Y1W J;  4M3B A;  4PGH A;  1NG7 A;  2NXN B;  4HDV A;  1T56 A;  3EYY A;  2ECB A;  4G6T B;  1UFM A;  3CCY A;  2M7A A;  3RYP A;  2XKP A;  1CF7 B;  3HGG A;  3V8J A;  2A6H F;  2CWE A;  5HOO A;  3ASN H;  1JXS A;  4CYC B;  2FBH A;  3ZMU A;  4XRM A;  5ICE A;  1X1A A;  1ZG1 A;  2NVX J;  5J3L A;  4RM3 A;  2KDO A;  4Q47 A;  1FBQ A;  4EJW A;  4HEA 2;  3HKZ N;  3NRV A;  1TNT A;  4G8X A;  3ML6 A;  1U3E M;  4DYC A;  4ENK A;  1EA3 A;  2M34 A;  1VQM I;  4U7B A;  4R8H A;  1FP2 A;  3OSG A;  4UB6 C;  2IPQ X;  5CQG A;  3G3Z A;  4FIS A;  2ZME C;  3IKT A;  5CVU A;  5BPD A;  4LLG F;  3WGI A;  3FWE A;  5AON A;  3BR1 A;  4GGG A;  1MH4 A;  2H09 A;  5BNG A;  1GXQ A;  4UUS A;  5H6Q A;  4A3B J;  1ZAR A;  3H36 A;  1EKE A;  1VQ6 I;  2L3D A;  1BI2 A;  1FSE A;  3RPU A;  2K9N A;  4ZYH A;  5JR3 A;  3WHC A;  1ORK A;  4M9S A;  1D0X A;  1GLN A;  1YLF A;  2IXS A;  3JRH A;  3OYB A;  1MNE A;  2CW7 A;  4A3G J;  3LSR A;  1P6R A;  2WY7 Q;  1WI9 A;  3C7J A;  4PSX A;  2XKO A;  1X1P A;  3JW4 A;  1XTA A;  3ABL H;  2QGU A;  3ISP A;  3VEP A;  1ONV A;  1MBK A;  1IV8 A;  3DPT A;  3FX3 A;  5DUK A;  5F27 A;  2HEO A;  1JKP C;  3WGG A;  2ID3 A;  2GIV A;  4V2F A;  3LOC A;  2OU2 A;  2WTE A;  3CJR B;  2ZFU A;  2QKM B;  4LG0 A;  3IL2 A;  3G1O A;  2BEO A;  2HTS A;  1SD7 A;  4GYG A;  2VOO A;  2DQL A;  3I59 A;  4BQA A;  2LY1 A;  2HPI A;  1MNM C;  5GPA A;  2NVQ J;  1WZ2 A;  2PI0 A;  1YS6 A;  1LNW A;  4U0Y A;  4KMF A;  5LHG A;  1U6G A;  1BN5 A;  3TO7 A;  2BHZ A;  2HQN A;  2Q1Z B;  3DBR B;  3HC7 A;  3O3K A;  1EH6 A;  1FY7 A;  5H6R A;  2H8W A;  4CZC A;  3CCU I;  4DOZ A;  2D1H A;  5HS9 A;  1YW9 A;  5F1R A;  1Y39 A;  5E1Z B;  2GM4 A;  2B63 J;  2EZL A;  3AG2 H;  5CJ9 A;  2FXA A;  3BTJ A;  4ZYE A;  2HXI A;  2VON A;  3CCL I;  4XKC A;  3OWT A;  3ZP5 A;  1TWF J;  1O7L A;  4BDZ A;  3RKQ A;  1T33 A;  4LK1 F;  2IJL A;  5HLG A;  5DCM A;  1B72 B;  1FMV A;  1VQ4 I;  2HWV A;  1I1G A;  3GCM A;  2KDZ A;  1HKQ A;  3EDP A;  3UR3 C;  4EQQ A;  3H9G A;  3ELK A;  4AIK A;  1ETV A;  1MMS A;  4V19 K;  3FXK A;  3QAH A;  1E3O C;  2XAF A;  5E1X A;  2P5V A;  4BS9 A;  5D5U B;  3ZN1 A;  4KIB A;  4RGR A;  1U8R A;  4UUT A;  2AXT C;  3S32 A;  1ZK8 A;  2DPU A;  2BE5 F;  2ISZ A;  2RQP A;  4L5J A;  3SZP A;  2LLK A;  3KP4 A;  3QU3 A;  4HLX A;  1DGW Y;  1XDS A;  2BY3 A;  2JMW A;  2JVG A;  3AL0 C;  4JBA A;  5F0H A;  5LGN A;  1LE8 A;  1I5Z A;  3GTL J;  2E1M B;  1WKM A;  4WXD A;  2QQ8 A;  4RMN A;  2R7O A;  1TWA J;  2CQX A;  3E0J B;  2HNH A;  4DBR A;  5AIP A;  1Y0N A;  4FAS D;  2L7M P;  2DBB A;  3CUO A;  3HOV J;  5DEQ A;  4F91 B;  2DOE A;  4BKX A;  4G9Y A;  2CQQ A;  2G7U A;  3HRU A;  4LLL A;  1QO0 D;  3K4K A;  1S3J A;  4M9X A;  1T6S A;  2ZNZ A;  2OQG A;  3SZT A;  5L3C A;  3F23 A;  3MMY B;  4L9N A;  4DIQ A;  2VQC A;  1B9N A;  3F9K A;  1D0Y A;  4DZP A;  3BTC A;  4ZYA A;  1FT9 A;  4HLY A;  2HQA A;  2XSJ C;  1N78 A;  5L3F A;  1T38 A;  3IHU A;  3JTH A;  1ZLK A;  3BG9 A;  3ROU A;  4AU7 A;  5FLM J;  3AAF A;  2OTL I;  4HV5 A;  4ENJ A;  3FKI J;  1LQ1 A;  2I8D A;  1HST A;  3A03 A;  3LST A;  5E17 F;  1QVU A;  1ON2 A;  4XMY A;  3TKY A;  4LIV A;  4AC0 A;  2DJN A;  3GTK J;  2PN6 A;  1FPQ A;  3R60 A;  2KKO A;  2DOD A;  2A6E F;  1ZGW A;  5L3E A;  2WAF A;  3DTI A;  3S1Q J;  2MLG A;  3KEQ A;  2WB1 N;  5EGO A;  2OAZ A;  1PDN C;  3S2W A;  2DA2 A;  2RNG A;  1LEA A;  2DN0 A;  4A5N A;  5HDN A;  4XR6 A;  2K02 A;  1WH7 A;  1R1T A;  2CW8 A;  2FD5 A;  5FRO A;  4CCK A;  4RAG A;  3LA7 A;  2DO7 A;  4OIR F;  3CCJ I;  1VND A;  3D1N I;  1Z7U A;  1IGN A;  1JHH A;  2DMQ A;  1T2K A;  2D45 A;  3OIQ A;  2YS9 A;  1MH3 A;  4RGX A;  3RKY A;  4UVB A;  5L3D A;  3W2A A;  4PJL A;  2CYY A;  4P5O A;  2Z3Y A;  4MO7 A;  3HDD A;  2J5O A;  5GAD J;  3RZD J;  2O6G E;  3KP3 A;  1BM9 A;  5J1R A;  1PUF B;  2X4H A;  2DMP A;  2IA2 A;  3FZV A;  4XRF A;  3S2D J;  5FFX A;  2Y75 A;  3I58 A;  1Z1D A;  3QYB A;  4RAY A;  2VPR A;  2TCT A;  3CCS I;  3KX2 A;  5IYD J;  4KIT B;  4E7K A;  2E7X A;  1J2X A;  2MH2 A;  3ZRG A;  3MD2 A;  4I2O A;  3P9I A;  1ZRF A;  3QRF F;  4ZTJ A;  3S15 J;  4IHS A;  1FWZ A;  3HG9 A;  5E8G A;  4IRI A;  2MD5 A;  3A2K A;  3IUO A;  1FIA A;  2M8G X;  3NEU A;  1YX5 A;  4MQ9 F;  3PUF A;  3QPL A;  4PJ0 C;  3WGH A;  1K79 A;  3FHZ A;  2JN6 A;  4IL6 C;  3GO5 A;  1QZE A;  4IEJ A;  4XSZ F;  4A3L J;  2CS3 A;  3GTJ J;  1AOY A;  2X85 A;  3OYJ A;  5A2Q K;  4MTD A;  1UHW A;  2VLA A;  1X3W B;  1HXD A;  2G9W A;  2XHK A;  2FQ4 A;  3GEZ A;  1I3Q J;  3RTR A;  4B47 A;  1GV2 A;  2QA4 I;  3U2R A;  3WG7 H;  3GF2 A;  1OCP A;  2BVL A;  1ZRC A;  3H35 A;  4A5M A;  3RPQ A;  1U5T B;  3OR2 C;  1KQ0 A;  4OWR B;  3BCB A;  4ESF A;  3FBI B;  2QSF X;  4XIC A;  2J5P A;  2ZME A;  1U2W A;  5FB2 A;  3I4M J;  2ZCW A;  2AQE A;  2DK5 A;  4N4N B;  1R1U A;  2DT7 B;  1T39 A;  2EK5 A;  1CQT A;  1PP7 U;  1YJW I;  4M71 A;  4Y7N J;  3KZZ A;  3E6M A;  3I64 A;  4I99 C;  5EZH A;  1PUE E;  1TP4 A;  3CDI A;  4A6E A;  2IA1 A;  3W6J B;  3I56 I;  4A2U A;  3CC7 I;  1H88 C;  1GXP A;  1QA6 A;  4XKB A;  1R5I D;  3BR6 A;  2F6C A;  1NH3 A;  3DFG A;  2MC3 A;  1GVJ A;  2O8X A;  3FXR A;  3PL8 A;  2CG4 A;  1G2H A;  3ZMZ A;  2XF7 A;  3A01 A;  2VC1 A;  1B8I A;  1LPQ A;  2XPU A;  4M9Z A;  4P9F A;  1BR4 A;  5B1B H;  1LDJ A;  4BHC A;  3BWG A;  5FJ8 J;  1S9H A;  1VFC A;  4KUM A;  3OS0 A;  2Y0S A;  3L1P A;  2G7H A;  4KMU X;  3T8T A;  1HBX G;  3RSN A;  5IP6 A;  4RLF A;  1G3W A;  1D1A A;  5CYV A;  1MDM B;  2K9M A;  4MNU A;  2EZI A;  4LG3 A;  1XG1 A;  4XLA A;  4BE2 A;  3A02 A;  1XCB A;  3M8J A;  4FX0 A;  5M5X J;  3WTW C;  4XOR A;  5L3B A;  2M9H A;  2OCE A;  2QLZ A;  3HB9 A;  1ZRD A;  5CVR A;  2FML A;  4Q4Z F;  1ENH A;  3CJT B;  3E5Q A;  1AKH A;  3P5J A;  2P4W A;  1OMI A;  3HRT A;  1JKR C;  3D0S A;  4YG2 F;  2CV0 A;  2UWM A;  1Z05 A;  2CJJ A;  1BR2 A;  9ANT A;  1AWC A;  2XVC A;  2WBM A;  1A6I A;  2F5C A;  2MBF A;  1OCC H;  3L2Q A;  1YG2 A;  5LRS A;  2W57 A;  4A3I J;  2M2E A;  4C2T A;  2ESH A;  2VN2 A;  3PSF A;  5F64 A;  1OCT C;  3OS2 A;  1JUM A;  3A0B C;  5M3F J;  3JAM K;  1SFE A;  3ZQQ A;  3FK7 A;  1SFK A;  5E3L A;  5DM7 F;  5E1W A;  2M0C A;  3SHF A;  5AIQ A;  1XC5 A;  4QTR A;  3NQO A;  1IUY A;  5F1J A;  1X1D A;  4CCJ A;  3JRI A;  1A5J A;  4NHJ A;  4DNC A;  2OF7 A;  2VC0 A;  3MKL A;  3KZI C;  3OYE A;  1EH8 A;  1CF7 A;  2CQ7 A;  3M4O J;  1IDZ A;  2EPF A;  3TP3 A;  1BIA A;  1MND A;  2F5E A;  3HHH A;  3L9F A;  2CRG A;  4CYC A;  4IZZ A;  1K83 J;  2LRD A;  4C2M J;  2LBF B;  1I50 J;  3R61 A;  3LSM A;  5M5W J;  1K6O A;  4JX4 A;  3P9K A;  2LYC A;  4RB1 A;  4EVI A;  1MMA A;  4M73 A;  1Q1V A;  2JK3 A;  2LKP A;  2GXG A;  2R5Z B;  4GYI A;  4E6K G;  1YIJ I;  2HKX A;  3AKZ A;  3B6C A;  3QOP A;  2V9K A;  5ILS A;  3WE2 A;  1FYK A;  2BY2 A;  3S3O A;  2DJI A;  4V2G A;  2P7C B;  4D5F A;  3JSP A;  3D5R C;  4FE7 A;  2EWN A;  2JRT A;  3I4P A;  4BJT A;  1MJB A;  1IN4 A;  4I09 A;  1REP C;  2L4M A;  3BCA A;  4ZC3 A;  4ZJZ A;  3MKY B;  2WWY A;  1HW2 A;  3HKZ A;  4IRG A;  5J4Y A;  2IW5 A;  4IJA A;  4KA4 A;  4HNT A;  5LEJ A;  1LB2 A;  3F6V A;  3I71 A;  4M6X A;  1V5F A;  4UVA A;  2RAE A;  4EM1 A;  2OV7 A;  1IO2 A;  2Y2Z A;  3BR3 A;  2QUF A;  4M74 A;  1HW5 A;  3HSF A;  3QPT A;  1MJ9 A;  2FUG 2;  4WK8 F;  3LWF A;  4NQW A;  2DA1 A;  1RUN A;  2EFO A;  3BP8 A;  4PUS A;  4F7Z A;  4J01 A;  3J7A Y;  3PO2 J;  1SMT A;  2A05 A;  3FK6 A;  3KP6 A;  3SYT A;  4LIT A;  1VQP I;  3CUQ B;  2Z16 A;  2UXN A;  1DPU A;  5FLX K;  1YOV B;  3PIO F;  3MFK A;  4RA2 A;  1Z3X A;  3R0J A;  4S04 A;  2M45 A;  4UUV A;  3DEE A;  1JTY A;  1WGX A;  2EIK H;  5IOY A;  2QM3 A;  3GUD A;  2JWT A;  3G6E I;  3ZQC A;  1LEB A;  2DQR A;  1TL8 A;  4BDY A;  2FNA A;  4B09 A;  1RIO H;  3CF2 A;  3H9J A;  1D1B A;  5KCM A;  1WJA A;  3WU2 C;  3IH2 A;  3BJA A;  2X1D A;  3H9Q A;  2HOT A;  2CQN A;  2EIM H;  3CDH A;  1B1B A;  3S8P A;  3ZMD A;  1J5Y A;  4E7S A;  3DXJ F;  4IF4 A;  3CQZ J;  3BLY A;  5HOD A;  1WJD A;  5J6X A;  5KK1 A;  2JA2 A;  1XSD A;  3TED A;  1MMG A;  5CLS A;  3RDI A;  5JVT A;  5HNH A;  1G3S A;  1T8I A;  1ODD A;  1W0U A;  4FQG A;  2WAE A;  3J80 Z;  1XX5 A;  2L7F P;  3WTZ A;  1FIP A;  2JA7 J;  1HDP A;  1D3Y A;  3ZQ7 A;  1B72 A;  2QSG X;  2F5F A;  3WTS C;  4E70 A;  4A3J J;  1QPI A;  1B9M A;  2ME6 A;  4BAY A;  2GBY A;  4XN3 A;  1FLI A;  3JR9 A;  1PP8 F;  4KN7 X;  5FD6 A;  1XGO A;  3RKX A;  4MFE A;  3DEW A;  4X0G A;  1YHQ I;  2IRF G;  3M8E A;  3CC2 I;  2E19 A;  2CGP A;  1IDY A;  3BG5 A;  2DTZ A;  2IGK A;  2P8T A;  1MSE C;  3GME A;  2DYR H;  2BBY A;  2FE3 A;  1IN7 A;  3PSI A;  1P2F A;  4UHT A;  2JT1 A;  4EJT A;  4NUB A;  3OYG A;  2ZJQ F;  3PUB A;  1WCM J;  5HS8 A;  3E7L A;  2B0L A;  4ZDO A;  3QPS A;  1P7J A;  3VWB A;  3IRQ A;  3F8N A;  2JUC A;  3WE3 A;  2H1L A;  2W25 A;  3O8G A;  1ZEL A;  2XRN A;  2FBI A;  3IKV A;  1XSV A;  2CFX A;  3DP7 A;  1RES A;  3OOU A;  3MQ0 A;  1T95 A;  1M1E B;  4Z2Y A;  5B3S H;  2KJC A;  2MD0 A;  3HM5 A;  2CSO A;  2G0E A;  1VQL I;  2GA1 A;  3N05 A;  3GWZ A;  4I02 A;  1BIB A;  2L7Z A;  1OQY A;  5HLH A;  2DA3 A;  1UHS A;  4HAM A;  4BHB A;  2DLL A;  2LD5 A;  4HNU A;  3M07 A;  5EF6 A;  3OL4 A;  3GBG A;  1KQ9 A;  2RC4 A;  1YYV A;  1WJE A;  5HNF A;  4LB6 B;  2NNY A;  3T5X A;  3CZ6 A;  2RV8 A;  3QYE A;  2R3S A;  3ZMT A;  4GCV A;  5DV5 A;  3HPH A;  1SFO J;  3K1M A;  2QEX I;  2W00 A;  1YI2 I;  1D0Z A;  2AS5 F;  4OIQ F;  2IT0 A;  3SDG A;  3HOZ J;  2HPM A;  5J40 A;  3H3U A;  1TZL A;  3OY9 A;  2PLY A;  1YIO A;  1BC7 C;  2D5V A;  1G6N A;  1EF4 A;  5F0F A;  2Z5U A;  4UXN A;  3HOX J;  1STZ A;  1XMX A;  1SMY F;  3ONQ A;  1AU7 A;  1LVA A;  3FF5 A;  2RGV A;  2P5K A;  2E60 A;  1Q1H A;  1G3Y A;  1R4N B;  4XNF A;  3KYD B;  4B43 A;  1PUF A;  3OS1 A;  1D5Y A;  2HOA A;  1IJW C;  3A0H C;  3KE2 A;  3FM5 A;  3H5R A;  4FET A;  2ISY A;  2CU7 A;  2VB6 A;  1FBS A;  3P7N A;  1MMN A;  3K4B A;  1GT0 C;  1X3Z B;  1UB9 A;  2BYV E;  2I5U A;  1ACI A;  3KYC B;  1ZGA A;  2OUM A;  2FQ3 A;  2M7B A;  2NS8 A;  1P92 A;  4OAY A;  4ZDL A;  4A93 J;  2R7V A;  2F5D A;  5FKO A;  4WXC A;  2LKX A;  3F8C A;  1JKO C;  2W48 A;  1R71 A;  2B9S A;  5IP7 J;  2A3S A;  2M1B A;  4KT6 A;  3K1P A;  4HRI A;  1O3T A;  2LVS A;  4H4K C;  1IXR C;  2DYS H;  2M87 A;  3ABK H;  1BI1 A;  2ELH A;  2HKO A;  2L9N A;  2LF7 A;  1FP1 D;  2UV1 A;  3IH3 A;  3KLO A;  5EDN A;  3DLL F;  3CTA A;  2H8R A;  1QHH D;  2VKH A;  2DFH A;  1ON1 A;  1D1C A;  3NWS A;  1LUJ B;  2F4O B;  1WJF A;  2DW4 A;  1OKR A;  4L9V A;  5L3G A;  3KET A;  3I0T A;  1SC7 A;  1TWC J;  5M5Y J;  2UXX A;  1W36 D;  3TOA A;  2HVR A;  2LR8 A;  5C3E J;  3F8F A;  1SEU A;  1U5T A;  3R4K A;  1FMW A;  2YSR A;  3ZN0 A;  2R0Q C;  1OCR H;  4D1Q A;  1VI0 A;  4XLN F;  1LFP A;  4NNJ A;  2COB A;  3BR0 A;  2O03 A;  2CV1 A;  3MCZ A;  2CFO A;  1UCR A;  3CP8 A;  4XON A;  1FSH A;  2OQR A;  1P4W A;  3FDY A;  4AVP A;  5FD5 A;  1TTY A;  2JA8 J;  2DDB A;  1UHM A;  2DT5 A;  5D6F A;  4FTH A;  1B6A A;  4YEL A;  2KZV A;  3E97 A;  4Q5S F;  4AUX A;  4IHT A;  2XAQ A;  2WC2 A;  3IP4 B;  3KP5 A;  3VYS B;  2CO5 A;  2VOD A;  1HDD C;  4RBO A;  3U9G A;  4XLF A;  1SVL A;  1RRJ A;  3K6G A;  4HOB A;  4E7J A;  1GHC A;  1R36 A;  3BZ6 A;  2CV2 A;  2E7W A;  1B4A A;  5LHH A;  5E3O A;  1N77 A;  4IHX A;  2FEZ A;  5LHI A;  2GOX B;  4D7N A;  3BJO A;  3K1N A;  1MDM A;  2Y69 H;  3K10 A;  4CCM A;  3H3V K;  2DMN A;  3RYR A;  1Y0U A;  5HDG A;  2OZ6 A;  5TJJ A;  4G12 A;  4GO1 A;  5KAI C;  1U8B A;  3LSK A;  5D4R A;  4Y3O A;  1I27 A;  2EFW A;  3LNQ A;  2VI6 A;  3SJM A;  1S8N A;  2LSO A;  1ZYR F;  3HHG A;  4R79 A;  4G7Z F;  3S3M A;  2GWR A;  2RVC A;  5FRM A;  4YII A;  1A35 A;  2GOM A;  3ZMV A;  4W1U A;  3E1S A;  2JZY A;  4O5V A;  3L2W A;  2MH9 A;  3VSL A;  2D2W A;  2ECC A;  1EJ9 A;  3D5S C;  2Q2E B;  4BUP A;  2HFH A;  4MTE A;  4C3J J;  4RB2 C;  2LKS A;  3H3Z A;  3V8L A;  1QBJ A;  4A69 C;  3RZO J;  4IOA F;  3WOD F;  3RJP A;  5C44 J;  2PEX A;  3RQI A;  3OYH A;  1AHD P;  3J81 K;  2TRT A;  1O7F A;  2EIN H;  5EZG A;  3WTY C;  5D5X B;  1JJ8 C;  5JHU A;  1R7J A;  3IH4 A;  4Y4R A;  2VJ4 A;  2M8E A;  2GAU A;  2O61 A;  2ZXJ A;  3AFH A;  2DCE A;  3H92 A;  4N9H A;  4U88 A;  2OPT A;  3LQQ A;  4CCN A;  4CYD A;  2W24 A;  4YFN F;  3MKZ A;  3G1L A;  2PBI A;  4A0X A;  1S72 I;  3PQJ A;  1T0F A;  4L0Z B;  1X2M A;  3CLQ A;  4ZYD A;  1WJC A;  1R5G A;  2JPB A;  2PQ8 A;  1IUF A;  3FKJ A;  2JRM A;  2QSH X;  2ZBK A;  4PGG A;  2KMU A;  2A61 A;  2IBD A;  4BYY A;  3QP5 A;  2QYO A;  2RDP A;  1HW1 A;  2O8K A;  3T1B A;  3H0G J;  3G71 I;  4IOC F;  2K85 A;  4L9J A;  1Z3Y A;  5LGT A;  2F4M B;  1H9T A;  1RR7 A;  2VUM J;  2LBF A;  4U87 A;  3FMQ A;  2HR3 A;  3KZY A;  4HX7 A;  1VQN I;  1KA8 A;  2YX7 A;  4GRI A;  2JQ7 A;  2BV6 A;  1UZC A;  2R5Z A;  1J09 A;  5H20 A;  4A0Z A;  1MBJ A;  2M30 A;  2VE8 A;  3OIP A;  5EG0 B;  1D5V A;  3BR5 A;  1S7O A;  2KHM A;  4B3X A;  3N97 A;  2AO9 A;  3IAM 2;  1O4X A;  1IXS B;  1W5S A;  2W85 A;  2HVQ A;  4U0V A;  4LGW A;  2FOW A;  2KIQ A;  3MEX A;  4XLC A;  1X1C A;  3CCE I;  2XV4 S;  3PFY A;  1OLT A;  2LDU A;  3ABU A;  1OFC X;  2XC7 A;  4KIS A;  1WVR A;  2WV1 A;  3S14 J;  3CC4 I;  1V55 H;  2NS7 A;  1Y6I A;  5LRR A;  1W7P D;  4XRS G;  3ZXS A;  4ZTF A;  2CUZ A;  3CF5 F;  3E6B A;  1BL0 A;  3F0C A;  3VPR A;  5IT3 A;  1SD5 A;  3BR2 A;  4AID A;  1JKQ C;  3VFZ A;  4ASN A;  2DMU A;  3CUQ A;  3FMR A;  2IGM A;  1Z0X A;  4HBL A;  2QCO A;  1TQM A;  2R5Y B;  3JRF A;  2DFF A;  4II3 A;  1J0R A;  4BHP A;  1IN6 A;  3VYU B;  3D5L A;  3Q9S A;  2P6S A;  4IO9 F;  2VQG A;  4I6Z A;  1FTT A;  2LNB A;  1XS9 A;  1P4X A;  3OR1 C;  1QNT A;  1NG6 A;  4ON0 A;  2V26 A;  1YW7 A;  4LJZ F;  3AG4 H;  5J4V A;  3PO3 J;  2L01 A;  1ITY A;  2K3P A;  1ZQ3 P;  2VT3 A;  1X1B A;  1JHF A;  5F0C A;  2Z9O A;  2E1M C;  1R58 A;  1BBY A;  1ZGJ A;  1MJA A;  2HQ5 A;  2HDW A;  3BOQ A;  2DOA A;  3SXY A;  3C2G A;  3PNV A;  2R7Q A;  4B44 A;  2DU9 A;  4RDU A;  4EJV A;  2HOS A;  3JRG A;  2KT0 A;  1R9T J;  4EGZ A;  1YQA A;  3CMM A;  4UNO A;  5E20 A;  2HZT A;  1DP7 P;  3HOY J;  1SFX A;  3FHN A;  3CDL A;  3ZQL A;  1WH5 A;  2FJ1 A;  4NBQ A;  2NRA C;  3ABM H;  2QWW A;  3CCQ I;  3GYH X;  2CUE A;  2L7K A;  2MC4 A;  1E17 A;  3LA2 A;  2EQR A;  2FX0 A;  1I3A A;  3DQV C;  1PJR A;  1P4A A;  2ZB9 A;  3W3C A;  1X19 A;  4NDL A;  2FRH A;  3FIW A;  3DU6 A;  3BG7 A;  3WG9 A;  2IS2 A;  1ZAO A;  3J7Y J;  4GXO A;  2K9L A;  3H5A A;  2E1N A;  4XOT A;  4CCO A;  3HXL A;  1K6Y A;  4EGY A;  3GTP J;  3GLX A;  4IHY A;  2IS4 A;  5BMZ A;  4X1E A;  2VBW A;  2VXD A;  4E7I A;  1EH7 A;  1DUX C;  2JSP A;  1MBG A;  4K2E A;  5DCM B;  3K70 C;  5E3N A;  4ZZD A;  1MBH A;  3C2B A;  1YRN B;  4MHG A;  1S5L C;  2BGC A;  1S6L A;  5IP9 J;  4CSW A;  2DDA A;  1FYM A;  3IV5 A;  2EFQ A;  4H0E A;  1VQ8 I;  1FYL A;  3MZH A;  2PJP A;  3P9C A;  1WJ5 A;  2XSD C; 
#chains in the Genus database with same CATH homology
 4RGS A;  3M9A A;  4HW0 A;  2QVO A;  2Q0O A;  2NYX A;  5CVV A;  3R6S A;  4P96 A;  3WTU C;  2X0L A;  1J59 A;  5IT9 K;  2HOE A;  1FNN A;  2ETH A;  1QPM A;  1Z6R A;  2FF4 A;  3F72 A;  2ZNY A;  1F1Z A;  4HF0 A;  1MZB A;  2UZK A;  4BH9 A;  4O3M A;  4P55 A;  2Z99 A;  4YFK F;  5BPI A;  3ERE D;  5J8C A;  1R1V A;  3BY6 A;  3LAP A;  5ILU A;  3F21 A;  4UV9 A;  1IN8 A;  1W4M A;  5DDG A;  2H27 A;  3HSR A;  1UST A;  2GA2 A;  4LK0 F;  3BDD A;  1XGM A;  6PAX A;  4EMS A;  4OIP F;  2WV0 A;  2V9V A;  3I53 A;  3O2P E;  4HYE A;  3G73 A;  1IZ1 A;  1U5T C;  4PZJ A;  1OYI A;  3FXQ A;  4CDG A;  1DDN A;  4KIC A;  1FZP B;  4TV7 A;  1FOK A;  4HA8 A;  1OR7 A;  1BOA A;  4G6Q A;  4D0P A;  2FNP A;  1ZLJ A;  5K5R A;  5A2Q Z;  3BJ6 A;  1WSU A;  5D5V B;  4I7H A;  1KU9 A;  5EEH A;  4OU0 A;  1H0M A;  4P9U A;  1TNS A;  2CQK A;  4NB5 A;  4DQ2 A;  2HGC A;  3L2C A;  2VT2 A;  3T8R A;  3MZY A;  4I0A A;  3HYI A;  5K5Q A;  3V4G A;  1XD7 A;  1ZG5 A;  4MEY F;  4FHT A;  3JSO A;  2L54 A;  3COA C;  3K69 A;  4U0W A;  1Z9C A;  3V7C A;  3T0Y A;  5LEK A;  2GZW A;  2C6Y A;  3C1D A;  4RGU A;  4L0Y B;  4KYW A;  3GVA A;  3GXO A;  1TW3 A;  2MLK A;  5K1Y A;  2XRO A;  2ADU A;  2ZME B;  2RNJ A;  3B73 A;  1SAX A;  3CO7 C;  1MKM A;  4KIG A;  4Y17 A;  3N4M A;  1NHA A;  4CGZ A;  1TW2 A;  1YS7 A;  1O3Q A;  5ICF A;  3EET A;  2FA5 A;  1USS A;  1J75 A;  2R7D A;  2QZ8 A;  1ZRE A;  2KIF A;  3IWF A;  5ILV A;  1C0W A;  3EYI A;  3Q9V A;  3HOT A;  2V1U A;  1YFH A;  5EEG A;  5IT9 Z;  2EJR A;  3IRR A;  1TBX A;  1K78 B;  4I01 A;  3F8B A;  1YTY A;  4HQM A;  2K7L A;  1G3T A;  1EV7 A;  2XGX A;  4KFC A;  2Q8K A;  5BS6 A;  3JAM Z;  4CO8 A;  1ZHF A;  3QPH A;  2Q2E A;  3VOE A;  3V8K A;  3RI4 A;  1R22 A;  1WWX A;  4N0B A;  2L02 A;  1HQC A;  3GFJ A;  3WTT C;  3RIR A;  3HRM A;  1XMA A;  2GXB A;  2ZKZ A;  4FX4 A;  2P5L C;  4G94 A;  2XAH A;  1FBU A;  1W7P B;  2V6C A;  3F3X A;  5DD4 A;  4QLC U;  1XDU A;  4BNC A;  4YIF A;  4MEX F;  2EFP A;  4EJO A;  3DPL C;  1ZN2 A;  3E5U A;  3W6K B;  3CUQ C;  4L9T A;  1JGS A;  1XGS A;  2H94 A;  4HZF A;  1O3S A;  1W5T A;  1L3L A;  2VBX A;  3CJN A;  1D8K A;  1RI7 A;  3IWZ A;  3DF8 A;  2DPD A;  2W84 A;  2IP2 A;  4OIN F;  2DI3 A;  2FU4 A;  5J8F A;  2GQQ A;  1J9I A;  2D1V A;  2XAJ A;  2FMY A;  5JI6 A;  3FM3 A;  2HYF A;  4HDU A;  2XIG A;  4ESB A;  2QBY B;  3L7W A;  5FLX Z;  1R5H A;  4A12 A;  3SFZ A;  4L5I A;  2H6B A;  2NAZ A;  1I1S A;  3WU1 B;  4JQF A;  2JSC A;  2PFB A;  5K5O A;  4IVN A;  3HTS B;  1SD4 A;  4XBF A;  1XB4 A;  4YFX F;  1XSX A;  4LLN A;  3LAJ A;  5D6E A;  2RN7 A;  2A07 F;  5DYM A;  3V7R A;  5E8I A;  5JFR A;  2FSW A;  1T98 A;  2EB7 A;  1XN7 A;  2M5W A;  2FBK A;  3VB2 A;  4EM0 B;  4UVC A;  3F8M A;  4PCQ A;  3TO6 A;  1G4D A;  1HKT A;  4HV6 A;  1OYW A;  1KU7 A;  1KYZ A;  3WTV C;  4LFU A;  5CVJ A;  1R23 A;  5FGM A;  3CO6 C;  4HF1 A;  2VBZ A;  1S29 A;  2PMH A;  2KJB A;  2Y0M A;  1LDD A;  4B8X A;  4UV8 A;  1IAW A;  3TQN A;  2HTJ A;  5LGU A;  4RB0 A;  1HKS A;  1V3F A;  3E6D A;  5HDK A;  2AXL A;  1RNL A;  4BXU A;  2O0Y A;  2V1X A;  2H6C A;  5DD8 A;  1RUO A;  4EM2 A;  3C3W A;  1XMK A;  2DFI A;  4CXF A;  1KQ8 A;  2A68 F;  4N9I A;  2EV5 A;  1KU3 A;  4R1H A;  1MD0 A;  5LBQ A;  3PFI A;  1WRJ A;  4LD5 A;  4M6Y A;  3GZ5 A;  4I98 B;  4PDK A;  3BPX A;  2HYG D;  4WF2 A;  5DUI A;  1HSJ A;  1LJ9 A;  2ZO4 A;  4IXA A;  2EA2 A;  2E1C A;  3IC7 A;  3PQK A;  3VOD A;  3K9T A;  3F6O A;  4WX9 A;  2COM A;  2XAG A;  3ZMS A;  1K7A A;  2YU3 A;  1CGP A;  2STW A;  1YO5 C;  4Q48 A;  3F22 A;  2K86 A;  3ECO A;  3TGN A;  4Y15 A;  2EV0 A;  4A6D A;  2P7V B;  3K2Z A;  2Y48 A;  3HRS A;  2VOP A;  1XGN A;  3DEU A;  3FMS A;  1JE8 A;  4ESJ A;  3C18 A;  3MAJ A;  2FOK A;  4G7O F;  1DPR A;  1F9N A;  3E3V A;  3L00 A;  3TDZ C;  3EUH A;  4EJU A;  1Z91 A;  5HVQ C;  4FT8 A;  3M7G A;  1ULY A;  3GW2 A;  3GZ6 A;  2YR2 A;  3R0A A;  2JPC A;  5BQT A;  3LA3 A;  3HUG A;  3KP2 A;  2KIU A;  1KGS A;  2O3F A;  4ENN A;  3BPV A;  4CIC A;  2K27 A;  4KDP A;  3GX4 X;  4LG0 B;  3I59 B;  5D8L B;  3BRO A;  4KT5 C;  5DCF A;  2QEN A;  2OA4 A;  2LF8 A;  2RKH A;  1TLH B;  3U1D A;  3CLO A;  2DTR A;  4QWQ A;  1TQI A;  4XSX F;  4CHU A;  4ZZL A;  1TQP A;  2EA4 A;  1KU2 A;  4AD9 A;  3GFI A;  4HF2 A;  2IA0 A;  3LQR A;  2XUB A;  1BI3 A;  5D8K B;  3QU6 A;  3HOS A;  3RKW A;  1ZG3 A;  1WQ2 A;  4LMY A;  4OIO F;  2XAS A;  3E6C C;  2OZU A;  2JTV A;  5D5W B;  4RS8 A;  1FX7 A;  1K78 A;  5ED4 A;  4HX4 A;  1QZZ A;  4RAZ A;  3J81 Z;  3HTU A;  1XCV A;  1IN5 A;  3J80 K;  4Y13 A;  1O57 A;  1QQI A;  1D8J A;  2L4A A;  2Z33 A;  2V1D A;  1KYW A;  3J7A O;  3ECH A;  2K4J A;  2QQB A;  5FFZ A;  5HS7 A;  4WWC A;  3O6B B;  3OV8 A;  2NNN A;  3B02 A;  4OMZ A;  1BC8 C;  2A69 F;  3KEO A;  1W7P A;  1VTN C;  5ICC A;  3TO9 A;  5CVI A;  3ABT A;  3L09 A;  3I54 A;  1YW8 A;  2ZFW A;  1IRF A;  3EQL F;  1Z6T A;  1QGP A;  1H9G A;  4HX8 A;  3FXU A;  2QQA A;  2VBY A;  5FO5 A;  5E18 F;  2STT A;  4ENM A;  1F5T A;  3KFW X;  3QP6 A;  4U7D A;  1V4R A;  2ACJ A;  2QBY A;  2YX4 A;  2NS0 A;  2KRF A;  1MGT A;  4KN4 X;  2PG4 A;  4KNY A;  2DK8 A;  2V79 A;  2CW0 F;  3HIF A;  4OOI A;  3Q5F A;  2HQR A;  4ETS A;  1I6X A;  4KIF A;  1RZ4 A;  1X3U A;  4CZZ A;  3DV8 A;  2OD5 A;  3JTG A;  2PMU A;  3LFK A;  2ZJ2 A;  1J7K A;  4A0Y A;  4MQV A;  4AWX B;  3V7S A;  2HS5 A;  3MWM A;  2MA3 A;  2EFN A;  1OYY A;  2K4B A;  4XLP F;  3WTX C;  4G6D A;  3GFM A;  5F6F A;  3M1E A;  5TRD A;  1IW7 F;  2IVM A;  3SQN A;  4OMY A;  5KVR A;  2DAO A;  3DKW A;  3E5X A;  4O6J A;  2P6T A;  3HSE A;  1S7A A;  4WCG A;  5BOX A;  3ZPL A;  3OOP A;  3REO A;  1U78 A;  3TDU C;  2VE9 A;  1F4K A;  4ZYG A;  1B59 A;  4ZH4 F;  5ERI A;  4AIH A;  2TDX A;  4IPA A;  2R7F A;  5HLI A;  3ULQ B;  4EV0 A;  4LB5 A;  1QZY A;  4AIJ A;  1BI0 A;  1E2X A;  1R00 A;  2ESN A;  3KLN A;  4G7H F;  3GFL A;  3M8F A;  2YPR A;  1OPC A;  3TOB A;  5ICG A;  2F2E A;  1LDK B;  4MGR A;  2QQ9 A;  1IXC A;  4I0B A;  4IRH A;  4HQE A;  2OBP A;  4M72 A;  3I5U A;  1O3R A;  3K0L A;  4L18 B;  4RB3 C;  3WU0 A;  1L0O C;  2KIM A;  4WXH A;  3KCC A;  1BJA A;  4S05 A;  4JK1 X;  5D4S A;  1SD6 A;  2A5Y B;  1IF1 A;  3KP7 A;  1ZH5 A;  1A04 A;  1SFU A;  2VXZ A;  5LLQ A;  2HDC A;  1FC3 A;  2EV6 A;  4PGH A;  4HDV A;  3EYY A;  1UFM A;  3RYP A;  2XKP A;  1CF7 B;  3V8J A;  2A6H F;  2CWE A;  5HOO A;  1JXS A;  2FBH A;  3ZMU A;  5ICE A;  1ZG1 A;  4Q47 A;  1FBQ A;  4EJW A;  3NRV A;  1TNT A;  4G8X A;  3ML6 A;  1U3E M;  4ENK A;  4U7B A;  4R8H A;  1FP2 A;  2IPQ X;  3G3Z A;  3IKT A;  5CVU A;  5BPD A;  4LLG F;  3WGI A;  3FWE A;  5AON A;  4GGG A;  2H09 A;  1GXQ A;  5H6Q A;  1ZAR A;  2L3D A;  1BI2 A;  1FSE A;  3RPU A;  5JR3 A;  4ZYH A;  4M9S A;  1YLF A;  1P6R A;  1WI9 A;  3C7J A;  2XKO A;  3JW4 A;  3ISP A;  3VEP A;  1ONV A;  3DPT A;  3FX3 A;  5DUK A;  2HEO A;  3WGG A;  2GIV A;  2OU2 A;  2WTE A;  4LG0 A;  3IL2 A;  2BEO A;  2HTS A;  1SD7 A;  4GYG A;  2VOO A;  2DQL A;  3I59 A;  4BQA A;  2PI0 A;  1YS6 A;  1LNW A;  4U0Y A;  4KMF A;  5LHG A;  1U6G A;  1BN5 A;  3TO7 A;  2HQN A;  3O3K A;  1EH6 A;  1FY7 A;  5H6R A;  2D1H A;  5HS9 A;  1YW9 A;  5F1R A;  5E1Z B;  5CJ9 A;  2FXA A;  4ZYE A;  2VON A;  3ZP5 A;  1O7L A;  4LK1 F;  2IJL A;  5HLG A;  5DCM A;  2HWV A;  1I1G A;  1HKQ A;  3EDP A;  4EQQ A;  3ELK A;  4AIK A;  3QAH A;  2XAF A;  5E1X A;  2P5V A;  5D5U B;  3ZN1 A;  4KIB A;  4RGR A;  1U8R A;  2DPU A;  2BE5 F;  2ISZ A;  2RQP A;  4L5J A;  3SZP A;  3KP4 A;  3QU3 A;  4HLX A;  1XDS A;  4JBA A;  5LGN A;  1I5Z A;  1WKM A;  4WXD A;  5AIP A;  2DBB A;  3CUO A;  5DEQ A;  4G9Y A;  2G7U A;  3HRU A;  4LLL A;  1QO0 D;  1S3J A;  4M9X A;  1T6S A;  2ZNZ A;  2OQG A;  3SZT A;  5L3C A;  3F23 A;  4L9N A;  1B9N A;  1FT9 A;  4HLY A;  5L3F A;  1T38 A;  3IHU A;  3JTH A;  1ZLK A;  3ROU A;  3AAF A;  4HV5 A;  4ENJ A;  1LQ1 A;  1HST A;  3LST A;  5E17 F;  1ON2 A;  3TKY A;  2PN6 A;  1FPQ A;  3R60 A;  2KKO A;  2A6E F;  5L3E A;  2MLG A;  3KEQ A;  2OAZ A;  1PDN C;  3S2W A;  1LEA A;  4A5N A;  5HDN A;  2K02 A;  1R1T A;  3LA7 A;  2DO7 A;  4OIR F;  1Z7U A;  1JHH A;  1T2K A;  2D45 A;  4RGX A;  3RKY A;  4UVB A;  5L3D A;  2CYY A;  4P5O A;  2Z3Y A;  2J5O A;  2O6G E;  3KP3 A;  1BM9 A;  2X4H A;  2IA2 A;  3FZV A;  4XRF A;  5FFX A;  2Y75 A;  3I58 A;  1Z1D A;  4RAY A;  2E7X A;  1J2X A;  2MH2 A;  4I2O A;  3P9I A;  1ZRF A;  3QRF F;  4IHS A;  1FWZ A;  5E8G A;  4IRI A;  2MD5 A;  3NEU A;  4MQ9 F;  3WGH A;  1K79 A;  3FHZ A;  3GO5 A;  4XSZ F;  1AOY A;  5A2Q K;  4MTD A;  1UHW A;  1HXD A;  2G9W A;  2XHK A;  3GEZ A;  3RTR A;  3U2R A;  3GF2 A;  1ZRC A;  4A5M A;  3RPQ A;  1U5T B;  1KQ0 A;  4ESF A;  2J5P A;  2ZME A;  1U2W A;  5FB2 A;  2ZCW A;  2DK5 A;  1R1U A;  1T39 A;  2EK5 A;  1PP7 U;  4M71 A;  3KZZ A;  3E6M A;  3I64 A;  1PUE E;  4A6E A;  2IA1 A;  3W6J B;  4A2U A;  1GXP A;  3DFG A;  2MC3 A;  1GVJ A;  2O8X A;  3FXR A;  2CG4 A;  3ZMZ A;  2VC1 A;  4M9Z A;  4P9F A;  1LDJ A;  4BHC A;  3BWG A;  4KUM A;  2G7H A;  4KMU X;  3T8T A;  1HBX G;  1G3W A;  5CYV A;  1MDM B;  4MNU A;  1XCB A;  4FX0 A;  3WTW C;  5L3B A;  2QLZ A;  1ZRD A;  5CVR A;  2FML A;  4Q4Z F;  3E5Q A;  2P4W A;  1OMI A;  3HRT A;  3D0S A;  4YG2 F;  2UWM A;  1Z05 A;  1AWC A;  2XVC A;  2F5C A;  2MBF A;  1YG2 A;  5LRS A;  2W57 A;  2ESH A;  2VN2 A;  5F64 A;  3JAM K;  1SFE A;  5E1W A;  3SHF A;  5AIQ A;  3NQO A;  1IUY A;  4NHJ A;  4DNC A;  2VC0 A;  1EH8 A;  1CF7 A;  1BIA A;  2F5E A;  3HHH A;  3L9F A;  3R61 A;  1K6O A;  3P9K A;  4RB1 A;  4EVI A;  4M73 A;  2LKP A;  2GXG A;  4GYI A;  2HKX A;  3QOP A;  5ILS A;  3WE2 A;  1FYK A;  2P7C B;  3JSP A;  2EWN A;  2JRT A;  3I4P A;  1MJB A;  1IN4 A;  4I09 A;  1REP C;  2L4M A;  2WWY A;  1HW2 A;  4IRG A;  2IW5 A;  4IJA A;  4KA4 A;  5LEJ A;  1LB2 A;  3F6V A;  3I71 A;  4M6X A;  4UVA A;  4EM1 A;  4M74 A;  2QUF A;  1HW5 A;  3HSF A;  3QPT A;  1MJ9 A;  4WK8 F;  3LWF A;  4NQW A;  1RUN A;  2EFO A;  3BP8 A;  4F7Z A;  1SMT A;  3KP6 A;  3CUQ B;  1DPU A;  2UXN A;  5FLX K;  3MFK A;  3R0J A;  4S04 A;  2M45 A;  4UUV A;  2QM3 A;  3GUD A;  1LEB A;  2DQR A;  2FNA A;  4B09 A;  1RIO H;  3BJA A;  3CDH A;  1B1B A;  3ZMD A;  1J5Y A;  3DXJ F;  4IF4 A;  5J6X A;  5KK1 A;  1XSD A;  5CLS A;  3RDI A;  5JVT A;  1G3S A;  1ODD A;  3J80 Z;  3WTZ A;  1D3Y A;  3ZQ7 A;  2F5F A;  3WTS C;  4E70 A;  1B9M A;  4BAY A;  1FLI A;  1PP8 F;  4KN7 X;  5FD6 A;  1XGO A;  3RKX A;  2IRF G;  3M8E A;  2CGP A;  2P8T A;  2BBY A;  2FE3 A;  1IN7 A;  1P2F A;  4UHT A;  2JT1 A;  4EJT A;  5HS8 A;  2B0L A;  3IRQ A;  3F8N A;  3WE3 A;  2W25 A;  2XRN A;  2FBI A;  3IKV A;  1XSV A;  2CFX A;  3DP7 A;  3MQ0 A;  4Z2Y A;  2KJC A;  2CSO A;  2GA1 A;  3GWZ A;  4I02 A;  1BIB A;  5HLH A;  4HAM A;  4BHB A;  2DLL A;  1KQ9 A;  2RC4 A;  1YYV A;  4LB6 B;  2NNY A;  3T5X A;  2RV8 A;  3ZMT A;  2R3S A;  4GCV A;  5DV5 A;  3K1M A;  2AS5 F;  4OIQ F;  2IT0 A;  3H3U A;  2PLY A;  1YIO A;  1BC7 C;  1G6N A;  2Z5U A;  4UXN A;  1STZ A;  1SMY F;  1LVA A;  3FF5 A;  2RGV A;  2P5K A;  1Q1H A;  1G3Y A;  3KE2 A;  3FM5 A;  2ISY A;  1FBS A;  3P7N A;  1UB9 A;  2BYV E;  1ZGA A;  2FQ3 A;  1P92 A;  2F5D A;  4WXC A;  3F8C A;  2A3S A;  2M1B A;  3K1P A;  1O3T A;  1IXR C;  2M87 A;  1BI1 A;  2ELH A;  2HKO A;  1IRG A;  2LF7 A;  1FP1 D;  3KLO A;  3CTA A;  1ON1 A;  2DW4 A;  1OKR A;  3KET A;  4L9V A;  5L3G A;  3I0T A;  2UXX A;  3TOA A;  3F8F A;  1U5T A;  3R4K A;  2YSR A;  3ZN0 A;  4XLN F;  2O03 A;  3MCZ A;  1UCR A;  1FSH A;  2OQR A;  1P4W A;  4AVP A;  5FD5 A;  1TTY A;  1UHM A;  2DT5 A;  5D6F A;  1B6A A;  3E97 A;  4Q5S F;  4IHT A;  2XAQ A;  2WC2 A;  3KP5 A;  2CO5 A;  2VOD A;  3U9G A;  1GHC A;  4HOB A;  1R36 A;  3BZ6 A;  2E7W A;  1B4A A;  5LHH A;  2FEZ A;  5LHI A;  3BJO A;  3K1N A;  1MDM A;  3RYR A;  1Y0U A;  5HDG A;  2OZ6 A;  5TJJ A;  4GO1 A;  5D4R A;  1I27 A;  2EFW A;  1S8N A;  2LSO A;  1ZYR F;  3HHG A;  4R79 A;  4G7Z F;  2GWR A;  2RVC A;  4YII A;  3ZMV A;  2JZY A;  4O5V A;  2MH9 A;  2D2W A;  2HFH A;  4MTE A;  4RB2 C;  3H3Z A;  3V8L A;  1QBJ A;  3WOD F;  3RJP A;  2PEX A;  3J81 K;  1O7F A;  3WTY C;  5D5X B;  5JHU A;  1R7J A;  2M8E A;  2GAU A;  2O61 A;  2ZXJ A;  3H92 A;  4N9H A;  4U88 A;  3LQQ A;  4CYD A;  2W24 A;  4YFN F;  2PBI A;  4A0X A;  3PQJ A;  1T0F A;  4L0Z B;  4ZYD A;  1R5G A;  2JPB A;  2PQ8 A;  2ZBK A;  4PGG A;  2A61 A;  4BYY A;  3QP5 A;  2QYO A;  2RDP A;  1HW1 A;  3T1B A;  4L9J A;  5LGT A;  1H9T A;  3FMQ A;  2HR3 A;  3KZY A;  4HX7 A;  1KA8 A;  2YX7 A;  2BV6 A;  5H20 A;  4A0Z A;  2M30 A;  2VE8 A;  1D5V A;  1S7O A;  3N97 A;  1IXS B;  1W5S A;  2W85 A;  4U0V A;  4LGW A;  3MEX A;  2XV4 S;  2LDU A;  3ABU A;  5LRR A;  1W7P D;  3E6B A;  5IT3 A;  1SD5 A;  3VFZ A;  4ASN A;  3CUQ A;  3FMR A;  4HBL A;  1TQM A;  1J0R A;  4BHP A;  1IN6 A;  3D5L A;  3Q9S A;  2P6S A;  2LNB A;  1P4X A;  1QNT A;  4ON0 A;  1YW7 A;  4LJZ F;  2L01 A;  2VT3 A;  1JHF A;  2Z9O A;  1R58 A;  1BBY A;  1ZGJ A;  1MJA A;  3BOQ A;  3SXY A;  2DU9 A;  4EJV A;  4EGZ A;  1YQA A;  4UNO A;  5E20 A;  2HZT A;  1DP7 P;  1SFX A;  2NRA C;  2QWW A;  3GYH X;  1E17 A;  3LA2 A;  3DQV C;  1P4A A;  2FRH A;  3WG9 A;  1ZAO A;  4GXO A;  2E1N A;  4EGY A;  3GLX A;  5BMZ A;  2VBW A;  1EH7 A;  1DUX C;  4K2E A;  5DCM B;  4ZZD A;  4MHG A;  2BGC A;  1S6L A;  1FYM A;  2EFQ A;  4H0E A;  1FYL A;  3MZH A;  2PJP A;  3P9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...