2P5QA

Crystal structure of the poplar glutathione peroxidase 5 in the reduced form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
ESVHDFTVKDAKENDVDLSIFKGKVLLIVNVASKCGMTNSNYAEMNQLYEKYKDQGLEILAFPCNQFGEEEPGTNDQITDFVCTRFKSEFPIFDKIDVNGENASPLYRFLKLGKWGIFGDDIQWNFAKFLVNKDGQVVDRYYPTTSPLSLERDIKQLLEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione peroxidase 5
publication title Crystal Structures of a Poplar Thioredoxin Peroxidase that Exhibits the Structure of Glutathione Peroxidases: Insights into Redox-driven Conformational Changes.
pubmed doi rcsb
source organism Populus trichocarpa x populus deltoides
molecule tags Oxidoreductase
total genus 53
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.-:
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p5qA00
2V2GA 1FVKA 3TKSE 5EL8A 1X0RA 4IELA 4GWRA 3GH6A 4DEJA 5B8AA 3LG6A 5JCGA 3GIXA 3MWHA 2QSIA 3HY2A 5DALA 1R5AA 4ZILA 4XIHA 1N8JA 1MDKA 2Z9SA 4AJ6A 4IS0A 3IR4A 3ERGA 1XOAA 1EWXA 3P90A 2AAWA 1ZGNA 3TKSA 3DIEA 3UEMA 5HR0A 1N2AA 2LS5A 4IW9A 2CV4A 5D9XA 3M9KA 5ECSA 3KM6A 2WFCA 3D4MA 3VI7A 2VL3A 4TVEA 2RLIA 1SD8A 4LLRA 3M0FA 1QK8A 2CVBA 4TN8A 2ZNMA 3GSTA 4POBA 4FYCA 4F82A 3DVXA 3VK9A 2WZ9A 1XFLA 2V1MA 3IC4A 2I81A 2B1LA 2XBIA 2EIQA 3L9SA 1IYHA 4ULXA 1HD2A 1TXXA 1XWBA 3IDVA 3A2VA 4YQUA 2DJ1A 4MJEA 5ECQB 5D8IA 2QKEA 5B7CA 2VLUA 2PGTA 3IE3A 1OC9B 1K0OA 1KTEA 4L0WA 2H70A 4F0CA 1K0MA 3VFIA 2C0GA 2K8SA 2MBSA 3IBHA 4IJ3A 1TJDA 4K8MA 5J41A 3GTUA 3P7XA 3QFAC 2REMA 1QMVA 1ERWA 2LJAA 4K0GA 4EC0A 3FKFA 2FUG2 3TOTA 2L57A 3EU3A 2PN8A 3NOFA 1ERVA 4KDYA 1TK0B 1Y6EA 4NAXA 2FCHA 1QFNA 5D96A 2O8VB 1J0FA 3JCML 3L0HA 5CYYA 2HRNA 4WR5A 4PX1A 1Z5YE 2HZEB 2JZTA 5GSTA 1GSUA 1WIKA 4QL7A 1AUCA 4KDXA 2JL4A 1ST9A 4BL7A 1TU7A 5DVBA 5G5FA 4LL1B 4LMVA 4EXJA 3FR3A 3UAPA 2GGTA 2L59A 3CSHA 2A2SA 5JWRB 1XZOA 2PUKC 1XIYA 1YJ6A 3GMFA 1PGTA 1SD9A 4J56E 3E3EA 2YWOA 2CX4A 1EGRA 4ZXGA 6GSVA 6GSXA 3VWWA 3ZTLA 2EIOA 1S3DA 4EO3A 2VAFA 1ACVA 4JZQA 1CQHA 1B4QA 3E0UA 8GSSA 3O76A 1GULA 3H8QA 5H5QA 4ZL9A 1JZWA 1ZZYA 6GSTA 1SKSB 1GWCA 1VF2A 5FT3A 3DRNA 2FWEA 3VURA 3VI5A 2AUVA 1ZYEA 3HXSA 3WT1A 2E0QA 3EMPA 2VD1A 4ISDA 3D0ZA 4V1Ap 3RAZA 1Z6NA 4DSSA 2YWNA 1NM3A 2B7JA 3IV4A 2FA8A 4FYUA 3A2WA 1K0CA 3GL3A 5D9VA 3FEUA 5H5RA 5AIXA 4ECJA 1XVWA 1EZKA 1R5PA 1LU4A 1K0NA 3W8JA 1Z6MA 1FG4A 4ZBDA 5HQPA 1SL1B 1GUKA 2TRXA 1X9MB 5ECKB 2H74A 5KN3A 4ML6A 3M1GA 5DJMA 2NPBA 2P5QA 1WRYA 2GT5A 1WMJA 4MDCA 1XWAA 2DIYA 1PMTA 5DBQA 1XBSA 2GSSA 2LJRA 1BAYA 4DSRA 1BYEA 2OA7A 1DUGA 5D73A 2LRCA 3O3TA 3FYGA 1OC3A 1A24A 2K6VA 2N5BA 1U3AA 3UMAA 3H79A 5ENUA 2ON5A 4Z7XA 4L0UA 4AF2A 4KB3A 3TJGA 5DCGA 3GN3A 3A2XA 4QL9A 3APSA 2TRCP 5ECIB 1MEKA 1KBNA 2L6CA 5J5NA 2DJ2A 3OR5A 4LA1A 2ZUPA 3KD0A 2C80A 5AIVA 1BEDA 5AN1A 3CTFA 4ZL8A 2IPAA 2JADA 3EC3A 2RM5A 1JZDA 5G5EA 5HR2A 5J3RA 4KW6A 3A5WA 3N9JA 2DSAA 2JU5A 1XXUA 4K9ZA 1B9YC 3TJJA 4WXTA 5LCZA 1AW9A 4I2TA 2BTOT 5ELAA 4IJIA 3UARA 1MDJA 2VL9A 1F37A 1K0AA 4POLA 3GFKA 2RUEA 2M46A 1T8EB 2PMTA 3I69A 5G30A 1K0BA 3TUEA 4K1FA 4ECBA 4TXVA 3A3TA 2VL2A 1XWGA 1TW9A 5HFKA 4KUNA 3ME7A 3IRAA 5CP1A 2OKAA 1QUWA 3ZFBA 3AY8A 3TGZA 2G2QA 2WGRA 1EP7A 3LXTA 1FW1A 1PA3A 1SJZA 5HFIA 2G0FA 3CRUA 1YF0A 5IOXA 4IVFA 2DJ3A 1X9SB 3C1SA 1OYJA 1QQ2A 3DXBA 4JEDA 5EPFA 5J4UA 4GSSA 1PD21 4EUYA 2H73A 1K3LA 2GLRA 2FWFA 3ERWA 1HQOA 1OKDA 2VM1A 4V2MA 5IMDA 3LQ7A 5G2ZA 2MMNA 4RI7A 2CAQA 4L5LA 2PVOC 3J7Yb 3ED3A 3FK8A 5JCWA 5IIZA 1SKRB 4IP1A 4J2FA 3ZIJA 5IMVA 2BJXA 1M2AA 3CTGA 3QAWA 5G1LA 3Q18A 1U3IA 1YEPA 5KEJA 2DBCA 4GLTA 1EOHA 5DQYA 2R4VA 3H1NA 3EE2A 1GSEA 3BCKA 5F8BA 1R26A 1XVQA 3I43A 2DJJA 4BWQA 1F9MA 4ZBBA 4KCEA 1VF3A 2VLTA 3DWVA 2XPDA 3TKPA 1O8XA 3KTBA 2HI7A 2O89A 2B7KA 4NMUA 3ZMLA 2ZCTA 3TRPA 3D5JA 1J9BA 5IQYA 2VUPA 4E8HA 1G7OA 2L5LA 4O5RA 1GTIA 4N0ZA 1H4OA 3HZ8A 4CDOA 2L6DA 4PNFA 1HNCA 2FWHA 1M2DA 2H1DA 4N30A 2NBSA 5DAKA 4GQCA 3WGEA 4WKWA 1V58A 1USBA 3CBUA 4WETA 4MPGA 3HZ4A 2VIMA 2OACA 3ZZXA 2F3MA 3FZ5A 2GTUA 2CVDA 2KP2A 2VL2C 4MPFA 4PQ1A 3DKSA 2DLXA 3GKXA 3SBCA 1QXHA 2F9SA 2R2JA 2H6ZA 4POKA 2XPEA 2WRTA 5E4WA 4HEA2 3LXZA 2X8CA 3GYKA 3C1RA 3PR8A 3L4NA 4AJ8A 3TDGA 5DALB 4EVMA 2LTKA 2P5RA 2GZYA 4WF4A 1A8YA 1WJKA 3FW2A 4MZCA 2GZPA 2IFQA 4K7IA 2O87A 1JHBA 1THOA 1FO5A 5F07A 1B4PA 4WEYA 3LGCA 1ZYQB 1SKWB 2IMFA 2V32A 4KNDA 4K2DA 4KSMA 1A23A 5IPHA 1AQWA 1XWKA 2C4JA 4MF5A 4HUAA 1B9XC 1GSQA 2DJ0A 2I4AA 4XRAA 2H6XA 3HKRA 1NW2A 2YN1A 2VM2A 3F3QA 5CREA 3L9VA 1V9WA 3DGQA 1XW9A 2XHFA 1EEMA 3FRCA 4ECIA 5CRDA 1OAZA 2KLXA 2M80A 3D21A 3CSIA 7GSSA 2XC2A 1TDIA 1F2EA 5ECLB 3VPTA 1T3BA 1ML6A 5EVOA 2B6MA 1EV9A 3EYTA 1MD4A 2IL3A 1VF1A 1Z7RA 2RUFA 2NVLA 3NIVA 5IMFA 1A0RP 4EDZA 3KJYA 3ME8A 3EINA 2CT6A 2YWMA 3KP8A 3GTUB 4OMVA 4DSQA 3N5OA 2P0GA 3QR6A 1F3BA 2C3QA 4OCFA 3KGKA 2X8GA 4L8EA 1GLPA 3DYRA 1SU9A 5J9CA 2C8UA 4I2UA 5ECRB 3EMXA 2GZZA 4PUAA 5KN1A 2VD0A 4JE1A 3QMXA 5IM9A 1S3AA 2HRFA 3HDCA 3LORA 4ZB9A 5IMCA 2K9FA 5ID2A 2CVKA 1HNAA 4FO5A 1OVNA 3ZLPA 5ECHB 3VWVA 2ALBA 2E2GA 3APOA 4ZBAA 3M8NA 4WF5A 5B6NA 1FOVA 2VLVA 1ZCPA 1WWJA 1I9DA 1TI3A 3K8NA 1E6BA 2LRTA 3KH9A 5L71A 4MABA 1S3CA 1XPVA 4GTUA 4HJMA 2C1YA 2TIRA 2JSYA 1GSFA 2C3TA 4X0XA 1GRXA 4HJ2A 2LV3A 4ML1A 3C8EA 2JZRA 2OE1A 3TKQA 1SJIA 2YWIA 4GCIA 2K8VA 4PXOA 2GSQA 3F9UA 4G2EA 4OO5A 1PL2A 3L9UA 1GNWA 3KEBA 5FWGA 2VCVA 1G6YA 5IO2A 4MA9A 2N5FA 1UN2A 5DJLA 1X5EA 1AC1A 2LUSA 1EGOA 5AISA 3P2AA 4ZIJA 2R5GA 4BPYA 1IYIA 3KH7A 4GF0A 4MZWA 3P8WA 3PH9A 2X64A 3KTLA 5ECNB 4IBPA 1PKWA 1BX9A 4OFMA 4DSSB 1GSYA 1UVZA 3GKKA 3KZQA 4RUVA 3HVSA 2MMOA 1NSWA 3RDWA 3TB2A 3ZMKA 4MJAA 4RQRA 2LKUA 2DMMA 5C00A 3GX0A 3BJ5A 5A4WA 1AQVA 5CRWA 3VWUA 1AIUA 1SYXA 3GX8A 3GURA 4PQHA 4I97A 2H6YA 2J9HA 4Q5QA 3EU4A 2JSZA 2KP1A 5FHIA 4YH2A 3G7IA 2ON7A 3QD9A 4XRDA 2VO4A 6GSWA 4NHZA 4L5OA 4NHWA 3HCZA 4HZ4A 2VCXA 1PX7A 1FB0A 2CQ9A 2OBKA 2RM6A 1B48A 3RPNA 1XWCA 4HS1A 3F4TA 4LL4B 5D9TA 2LNSA 1JFUA 1WE0A 3TOUA 4X1UA 3SWLA 4MF6A 4TXOA 3ZREA 4HQZA 4BWSA 3MDKA 2YV9A 3GUSA 3F63A 4HU7A 1Z7PA 1M0UA 3UVHA 3DMLA 1EV4A 3L78A 4TXOB 3U5RE 3ZVJA 2B5XA 2I3YA 2N5AA 5EY6A 3RPPA 1FB6A 1EOGA 1AXDA 5GZZB 3CMIA 4OFNA 10GSA 1SL0B 1R4WA 3DD3A 4E8EA 1W4VA 1G6WA 4MMMA 3HA9A 2HE3A 4V1Ag 4P3YB 5DQSA 4BA7A 4D73A 3MNGA 3FZ4A 5ECOB 2GS3A 5DCHA 4QQ7A 1GUMA 1X5DA 3HVVA 3QFBC 2B5EA 2XBQA 4JR4A 1GTAA 1YZXA 4N0VA 2RIIA 3S9FA 2FD3A 4V2NA 5INYA 4MLYA 1A2JA 4AGSA 4POMA 2GT6A 1GP1A 4J57E 4NXIA 5CNWA 4IQAA 5IO0A 2PERA 4FIWA 2HZFA 2YNXA 3D6IA 3EWLA 2YCDA 4JBBA 3KMOA 2HFDA 2IMKA 2AV4A 4Q5RA 2IJYA 2MMAA 4GSTA 2LQQA 1A8LA 2QGVA 1LBKA 3KIJA 2KHPA 2F8AA 4ECCA 2L4CA 2EIRA 5JCUA 2FHEA 1DE2A 2MBTA 1SENA 2GVPA 1FVJA 4KE3A 2WULA 5C04A 1ZL9A 1LJRA 1X9WB 3WD6A 3GV1A 3HJOA 1EEJA 4NPBA 2CAIA 1O7UA 1TK8B 16GSA 13GSA 2V6OA 2CZ3A 6GSUA 1GTUA 1CQGA 2H01A 2MYGA 2VOCA 1OE8A 2QC7A 4G10A 1FHEA 1NHOA 5J9BA 2JACA 5LD0A 2PU9C 5GSSA 1C72A 3GA4A 5F06A 4PNGA 1GSSA 1YDKA 1W89A 3GNJA 3LSZA 3QDNA 1T4YA 1A2MA 2H8LA 4MH3A 3F3RA 4XS4A 3H93A 1T7PB 4YQVA 3R2QA 4EE0A 3HD5A 4IN0A 3FZ9A 1RW1A 3HJMA 4I5QA 2HNLA 2HSHA 2OADA 3HVXA 1SJ6A 4HU9A 5G31A 4OD7A 1M2BA 5CRHA 5DAKB 1VRSD 1VGLA 2I9HA 1AQXA 1MD3A 2O85A 3HJPA 4TR1A 4K0NA 4O7HA 1NHYA 4OCEA 4YAPA 4DVCA 2KOKA 3BBYA 4OFTA 3LYKA 4TR0A 1ILOA 2F51A 1TU8A 2H76A 1TKDB 3TJFA 3APQA 1TK5B 14GSA 1HYUA 4ILFA 1SL2B 5IMAA 4IKHA 1TOFA 3F4SA 1V2AA 1GL8A 3IOSA 2R37A 1DBYA 5GAPD 2AJQB 3W6GA 2R3XA 4ID0A 3G9BA 2MMZA 1OC8A 1JLWA 1TRWA 4RQXA 1WP0A 1VF4A 1WPIA 1OKTA 1PN9A 3G7YA 1ERTA 5E59A 4O32A 1G0TA 2OE0A 2KUCA 2LJKA 3CSJA 1OE7A 4HQSA 2H72A 2IFQB 3FY7A 3WGDA 1F6MC 22GSA 4KGIA 1YY7A 5COHA 2JZSA 2D2ZA 3IAM2 2YJHA 1H75A 2O7KA 3LEFA 3M9JA 3WYWA 5HR3A 3ZL5A 3QCPA 2YV7A 3F4RA 4I8BA 5LNKe 5GAND 3C71A 3F8UA 1GSDA 3EVIA 5KN0A 2IMEA 3G7JA 2LNTA 2V41A 2H0HA 5CO3A 3IHQA 4JU5A 2OJLA 2IIYA 1XW5A 4MJBA 5D9WA 1F3AA 1GNEA 1V98A 1OC9A 2DC5A 4EL1A 4JR6A 4I6XA 4F9ZA 1URMA 3IK9A 2PBJA 1BQ7A 3J7Yk 1U87A 2FWGA 1GH2A 4EKZA 5A4VA 1FAAA 2OBIA 4IQ1A 4PQIA 2MZCA 4K6XA 2VCQA 1JZRA 20GSA 1PKZA 2YZUA 2LQOA 4GRFA 4RI6A 2HLSA 2GDRA 4YAVA 4MZBA 5JWQB 4TOPA 3IK7A 3DVWA 1JLVA 4AJ7A 3Q6OA 4XS1A 3FR6A 1HNBA 2H1BA 1K3OA 1SYRA 1O6JA 2HT9A 1XW6A 2VCZA 3QOUA 4KAEA 4NV2A 2CZ2A 2C0EA 3FZAA 2K18A 3KMNA 4HDEA 4FYBA 3CXGA 2HZEA 1TRVA 1PL1A 1WOUA 4KCAA 2B5YA 2WDUA 4G19A 5A5KA 1XCCA 2WB9A 2IMIA 1AAZA 4IHUA 4KSOA 5ID2B 3GKNA 3IXRA 5KN2A 2YP6A 2PVQA 2L4QA 2I1UA 3RBTA 4BVYA 5G1KA 2WCIA 5ELGA 2P31A 2E2MA 1K3YA 3IAS2 17GSA 1GTBA 3TJBA 4KDUA 3TKSC 1SK2A 4F0BA 2YOIA 3KP9A 1M9BA 3CRTA 2YZHA 4F03A 3ISOA 2CA8A 3F6FA 6GSSA 2VCWA 1R7HA 4X43A 5IOWA 2PPTA 1M7TA 1MDIA 5ECMB 2F8FA 3IA1A 1T00A 3Q19A 2H30A 3UVTA 11GSA 1BG5A 2PWJA 4ACSA 4NV5A 2H71A 1V40A 1KNGA 4TW5A 4WR4A 4O92A 4EDYA 3ZVJD 3LYPA 2X99A 2FLSA 2GSTA 3GL5A 3GSSA 4OWYA 3BD2A 5F0GA 1O85A 1UA5A 3VWXA 2H1AA 3KCMA 5HR1A 3GKMA 2HYXA 2DJKA 1PQNA 1Q98A 1BJXA 2HXKA 3QAVA 1Z9HA 3US3A 4XCSA 4IP6A 1T1VA 1G7EA 3MSZA 1SK1A 5H5SA 2J23A 4TRXA 3QAGA 4EF0A 4N10A 2CX3A 3H4KA 1RK4A 2YPMA 4OO4A 2H0GA 1TP9A 3TCOA 4Q5FA 4F2IA 1M9AA 4IGJA 1YKCA 3FHKA 19GSA 3C7MA 3WT2A 4Q5NA 2M72A 6GSYA 4N11A 1K0DA 4MF7A 2HSYA 4WBRD 1SK0A 3LFLA 2B1KA 3HHVA 3LJRA 1A0FA 2H75A 4K7OA 3Q74A 1GLQA 4JRRA 2FNOA 2NDOA 1O8WA 18GSA 1TRSA 3TRQA 3NZNA 2EC4A 4MCUA 3LWAA 1ABAA 1DSBA 2X8HA 4KH7A 1U6TA 3GRXA 1THXA 1ERUA 2FGXA 3F6DA 1JZOA 3U6VA 2BMXA 5ECPB 4H86A 3IPZA 4KX4A 9GSSA 5B8BA 2ES7A 4FH8A 4ZL7A 4BVXA 1T4ZA 4GSNA 3RHCA 1M99A 3CYNA 2LEGA 1E2YA 1PSQA 1QGVA 4CHSA 12GSA 4V2LA 1X5CA 3HYPA 2C0DA 5IPGA 3MAKA 1TRUA 2A2RA 4D73B 1ZOFA 3UOMA 3UBKA 4HZ2A 1B8XA 2IWTA 4MH2A 2GQMA 2GQKA 5B6MA 4CW9A 4NWYA 1TTZA 3W8SA 4PUFC 3EURA 3QPMA 2YJ7A 2H0IA 1Y25A 3DEXA 1DE1A 2IMDA 2E7PA 2H66A 1Z3EA 4PGTA 1PX6A 5CAXA 1V57A 3UIWA 3BOAA 4ZB8A 2FY6A 4TKYA 4WBJA 2H1GA 2YANA 3D4TA 2AYTA 3PGTA 5D93A 1Q4JA 1J08A 2LRNA 2FA4A 4HI7A 1ZMAA 3F0IA 4GXZA 2DIZA 3ZFLA 4YQMA 4GQFA 3FR9A 1RQMA 4TR3A 2AHEA 2LSTA 2A4VA 1UC7A 3I6AA 1KEBA 5ABRA 3E9JB 1GUHA 2WJUA 2OE3A 3GH9A 3TJKA 3UL3A 1XOBA 1A2LA 5CRGA 3M3MA 1YKAA 3RHBA 4KA0A 4XS6A 2GSRA 1EP8A 4MK3A 5AGYA 1O81A 2VCTA 2C0FA 1PRXA 2WS2A 5A4UA 3I9V2 3BCIA 1U88A 2NTOA 1I5GA 3ZIVA 3PINA 1TI1A 3V1WA 2B3SA 4LMWA 3GHAA 2GQLA 5F05A 2L5OA 3D22A 2DMLA 3UJ1A 3C73A 2R6KA 3ZRDA 2C3NA 4HOJA 4ZB6A 3ZYWA 4XHMA 5IMZA 1YQ1A 4XS4B 3ERFA 1ON4A 3TRXA 4MP4A 3UBLA 5JWOB 3ZITA 1O73A 1YEXA 1MTCA 4K7NA 2H19A 3TKRA 5HFGA 4XTSA 2IN3A 5DDLA 3VLNA 4MJCA 3WGXA 2AB6A 3KXOA 4G9HA 1YF1A 4PURA 3VPQA 2V6KA 4TR1B 4TR4A 3O6TA
chains in the Genus database with same CATH superfamily
2V2GA 1FVKA 3TKSE 5EL8A 1X0RA 4IELA 4GWRA 3GH6A 4DEJA 5B8AA 3LG6A 5JCGA 3GIXA 3MWHA 2QSIA 3HY2A 5DALA 1R5AA 4ZILA 4XIHA 1N8JA 1MDKA 2Z9SA 4AJ6A 4IS0A 1PN0A 3IR4A 3ERGA 1XOAA 1EWXA 3P90A 2AAWA 1ZGNA 3TKSA 3DIEA 3UEMA 5HR0A 1N2AA 2LS5A 4IW9A 2CV4A 5D9XA 3M9KA 5ECSA 3KM6A 2WFCA 3D4MA 3VI7A 2VL3A 4TVEA 2RLIA 2A2PA 1SD8A 4LLRA 3M0FA 1QK8A 2CVBA 4TN8A 2ZNMA 3GSTA 1M3IA 4POBA 4FYCA 4F82A 3DVXA 3VK9A 2WZ9A 1XFLA 2V1MA 3IC4A 2I81A 2B1LA 2XBIA 2EIQA 3L9SA 1IYHA 4ULXA 1HD2A 1TXXA 1XWBA 3IDVA 3A2VA 4YQUA 2DJ1A 4MJEA 5ECQB 5D8IA 2QKEA 5B7CA 2VLUA 2PGTA 3IE3A 5KOXA 1OC9B 1K0OA 1KTEA 4L0WA 2H70A 4F0CA 1K0MA 3VFIA 2C0GA 2K8SA 2MBSA 3IBHA 4IJ3A 1TJDA 4K8MA 5J41A 3GTUA 3P7XA 3QFAC 2REMA 1QMVA 1ERWA 2LJAA 4K0GA 4EC0A 3FKFA 2FUG2 3TOTA 2L57A 3EU3A 2PN8A 3NOFA 1ERVA 4KDYA 1TK0B 1Y6EA 4NAXA 2FCHA 1QFNA 5D96A 2O8VB 1J0FA 3JCML 3L0HA 5CYYA 2HRNA 4WR5A 4PX1A 1Z5YE 2HZEB 2JZTA 5GSTA 1GSUA 1WIKA 4QL7A 1AUCA 4KDXA 2JL4A 1ST9A 4BL7A 1TU7A 5DVBA 5G5FA 4LL1B 4LMVA 4EXJA 3FR3A 3UAPA 2GGTA 2L59A 3CSHA 2A2SA 5JWRB 1XZOA 2PUKC 1XIYA 1YJ6A 3GMFA 1PGTA 1SD9A 4J56E 3E3EA 2YWOA 2CX4A 4G0LA 1EGRA 4ZXGA 6GSVA 6GSXA 3VWWA 3ZTLA 2EIOA 1S3DA 4EO3A 2VAFA 1ACVA 4JZQA 1CQHA 1B4QA 3E0UA 8GSSA 3O76A 1GULA 3H8QA 5H5QA 4ZL9A 1JZWA 1ZZYA 6GSTA 1SKSB 1GWCA 1VF2A 5FT3A 2R0PA 3DRNA 2FWEA 3VURA 3VI5A 2AUVA 1ZYEA 3HXSA 3WT1A 2E0QA 3EMPA 2VD1A 4ISDA 3D0ZA 4V1Ap 3RAZA 1Z6NA 4DSSA 2YWNA 1NM3A 2B7JA 3IV4A 2FA8A 4FYUA 3A2WA 1K0CA 3GL3A 5D9VA 3FEUA 5H5RA 5AIXA 4ECJA 1XVWA 1EZKA 1R5PA 1LU4A 1K0NA 3W8JA 1Z6MA 1FG4A 4ZBDA 5HQPA 1SL1B 1GUKA 2TRXA 1X9MB 5ECKB 2H74A 5KN3A 4ML6A 3M1GA 2P5QA 2NPBA 5DJMA 1WRYA 2GT5A 1WMJA 4MDCA 1XWAA 2DIYA 1PMTA 5DBQA 1XBSA 2GSSA 2LJRA 1BAYA 4DSRA 1BYEA 2OA7A 1DUGA 5D73A 2LRCA 3O3TA 3FYGA 1OC3A 1A24A 2K6VA 2N5BA 3MYDA 4YKGA 5BRTA 1U3AA 3UMAA 3H79A 5ENUA 2ON5A 4Z7XA 4L0UA 4AF2A 4KB3A 3TJGA 5DCGA 3GN3A 3A2XA 4QL9A 3APSA 2TRCP 5ECIB 1MEKA 1KBNA 2L6CA 5J5NA 2DJ2A 3OR5A 4LA1A 2ZUPA 3KD0A 4BVXB 2C80A 5AIVA 1BEDA 5AN1A 3CTFA 4ZL8A 2IPAA 2JADA 3EC3A 2RM5A 1JZDA 3HVNA 5G5EA 4K5RA 5HR2A 5J3RA 4KW6A 3A5WA 3N9JA 2DSAA 2JU5A 1XXUA 4K9ZA 1B9YC 3TJJA 4WXTA 5LCZA 1AW9A 4I2TA 2BTOT 5ELAA 4IJIA 3UARA 1MDJA 2VL9A 1F37A 1K0AA 4POLA 3GFKA 2RUEA 2M46A 1T8EB 2PMTA 3I69A 5G30A 1K0BA 3TUEA 4K1FA 4ECBA 4TXVA 3A3TA 2VL2A 1XWGA 1TW9A 5HFKA 4KUNA 3ME7A 3IRAA 5CP1A 2OKAA 1QUWA 3ZFBA 3AY8A 4USSA 3TGZA 2G2QA 2WGRA 1EP7A 3LXTA 4G0KA 1FW1A 1PA3A 1SJZA 5HFIA 2G0FA 3CRUA 1YF0A 5IOXA 4IVFA 2DJ3A 1X9SB 3C1SA 1OYJA 1QQ2A 3DXBA 4JEDA 5EPFA 5J4UA 4GSSA 1PD21 4EUYA 2H73A 1K3LA 2GLRA 2FWFA 3ERWA 1HQOA 1OKDA 2VM1A 4V2MA 5IMDA 3LQ7A 5G2ZA 2MMNA 4RI7A 2CAQA 4L5LA 4EIPA 2PVOC 3J7Yb 3ED3A 3FK8A 5JCWA 5IIZA 1SKRB 4IP1A 4J2FA 3ZIJA 5IMVA 2BJXA 1M2AA 3CTGA 3QAWA 5G1LA 3Q18A 1U3IA 1YEPA 5KEJA 2DBCA 4GLTA 1EOHA 5DQYA 2R4VA 3H1NA 3EE2A 1GSEA 3BCKA 5F8BA 1R26A 1XVQA 3I43A 2DJJA 4BWQA 1F9MA 4ZBBA 4KCEA 1VF3A 2VLTA 3DWVA 2XPDA 3TKPA 1O8XA 3KTBA 2HI7A 2O89A 2B7KA 4NMUA 3ZMLA 2ZCTA 3TRPA 3D5JA 1J9BA 5IQYA 2VUPA 4E8HA 1G7OA 2L5LA 4O5RA 1GTIA 4N0ZA 1H4OA 3HZ8A 4CDOA 2L6DA 4PNFA 1HNCA 2FWHA 1M2DA 2H1DA 4N30A 2NBSA 3EPTA 5DAKA 4GQCA 3WGEA 4WKWA 1V58A 1USBA 3CBUA 4WETA 4MPGA 3HZ4A 2VIMA 2OACA 3ZZXA 2F3MA 3FZ5A 2GTUA 2CVDA 2KP2A 2VL2C 4MPFA 4PQ1A 3DKSA 2DLXA 3GKXA 3SBCA 1QXHA 2F9SA 2R2JA 2HRAA 2H6ZA 4POKA 4K2XA 2XPEA 2WRTA 5E4WA 4HEA2 3LXZA 2X8CA 3GYKA 3C1RA 3PR8A 3L4NA 4AJ8A 3TDGA 5DALB 4EVMA 4ICYA 2LTKA 2P5RA 2GZYA 4WF4A 1A8YA 1WJKA 3FW2A 4MZCA 2GZPA 2IFQA 4K7IA 2O87A 1JHBA 1THOA 1FO5A 4HSCX 5F07A 1B4PA 4WEYA 3LGCA 1ZYQB 1SKWB 2IMFA 2V32A 4KNDA 4K2DA 4KSMA 1A23A 5IPHA 1AQWA 1XWKA 2C4JA 4MF5A 4HUAA 1B9XC 1GSQA 2DJ0A 2I4AA 4XRAA 2H6XA 3HKRA 1NW2A 2YN1A 2VM2A 3F3QA 5CREA 3L9VA 1V9WA 3DGQA 1XW9A 2XHFA 1EEMA 2UZ8A 3FRCA 4ECIA 5CRDA 1OAZA 2KLXA 2M80A 3D21A 3CSIA 7GSSA 2XC2A 1TDIA 1F2EA 5ECLB 3VPTA 1T3BA 1ML6A 5EVOA 2B6MA 1EV9A 3EYTA 1MD4A 2IL3A 1VF1A 1Z7RA 2RUFA 2NVLA 3NIVA 5IMFA 1A0RP 4EDZA 3KJYA 3ME8A 3EINA 2CT6A 2YWMA 3KP8A 3GTUB 4OMVA 4DSQA 3N5OA 2P0GA 3QR6A 1F3BA 2C3QA 4OCFA 3KGKA 2X8GA 4L8EA 1GLPA 3DYRA 1SU9A 5J9CA 2C8UA 2R0CA 4I2UA 5ECRB 3EMXA 2GZZA 4PUAA 5KN1A 2VD0A 4JE1A 3QMXA 5IM9A 1S3AA 2HRFA 3HDCA 3LORA 4ZB9A 5IMCA 2K9FA 5ID2A 2CVKA 1HNAA 4FO5A 1OVNA 3CQFA 3ZLPA 5ECHB 3VWVA 2ALBA 2E2GA 3APOA 4BL7B 4ZBAA 3M8NA 4WF5A 5B6NA 1FOVA 2VLVA 1ZCPA 2X4AA 1WWJA 1I9DA 1TI3A 3K8NA 1E6BA 2LRTA 3KH9A 5L71A 4MABA 1S3CA 1XPVA 4GTUA 4HJMA 2C1YA 2TIRA 1FOHA 2JSYA 1GSFA 2C3TA 4X0XA 1GRXA 4HJ2A 2LV3A 4ML1A 3C8EA 2JZRA 2OE1A 3TKQA 1SJIA 2YWIA 4GCIA 2K8VA 4PXOA 2GSQA 3F9UA 4G2EA 3R3EA 4OO5A 1PL2A 3L9UA 1GNWA 3KEBA 1XG8A 5FWGA 2VCVA 1G6YA 5IO2A 4MA9A 2N5FA 1UN2A 5DJLA 1X5EA 1AC1A 2LUSA 3MIXA 1EGOA 5AISA 3P2AA 4ZIJA 2R5GA 4BPYA 1IYIA 3KH7A 4GF0A 4MZWA 3P8WA 3PH9A 2X64A 3KTLA 5ECNB 4IBPA 1PKWA 1BX9A 4OFMA 4KF9A 4DSSB 1GSYA 1UVZA 3GKKA 3KZQA 4RUVA 3HVSA 2MMOA 2DKHA 1NSWA 3RDWA 3TB2A 3ZMKA 4MJAA 4RQRA 2LKUA 2DMMA 1ZYNA 5C00A 3GX0A 3BJ5A 5A4WA 1AQVA 5CRWA 3VWUA 1AIUA 1SYXA 3GX8A 3GURA 4PQHA 4I97A 2H6YA 2J9HA 2X49A 4Q5QA 2HRKA 3EU4A 2JSZA 2KP1A 5FHIA 4YH2A 3G7IA 2ON7A 3QD9A 4XRDA 2VO4A 6GSWA 4NHZA 4L5OA 4NHWA 3HCZA 4HZ4A 2VCXA 1PX7A 1FB0A 2CQ9A 2OBKA 2RM6A 1B48A 3A5IA 3RPNA 1XWCA 4HS1A 3F4TA 4LL4B 5D9TA 2LNSA 1JFUA 1WE0A 3TOUA 4X1UA 3SWLA 4MF6A 4TXOA 3ZREA 4HQZA 4BWSA 1S3RA 2YV9A 3MDKA 3GUSA 3F63A 4HU7A 1Z7PA 1M0UA 3UVHA 3DMLA 1EV4A 3L78A 4TXOB 3U5RE 3ZVJA 2B5XA 2I3YA 2N5AA 5EY6A 3RPPA 1FB6A 1EOGA 1AXDA 5GZZB 3CMIA 4OFNA 10GSA 1SL0B 1R4WA 3DD3A 4E8EA 1W4VA 1G6WA 4MMMA 3HA9A 2HE3A 4V1Ag 4P3YB 5DQSA 4BA7A 4D73A 3MNGA 3FZ4A 5ECOB 2GS3A 5DCHA 4QQ7A 1GUMA 1X5DA 3HVVA 3QFBC 2B5EA 2XBQA 4JR4A 1GTAA 1YZXA 4N0VA 2RIIA 3S9FA 2FD3A 4V2NA 5INYA 4MLYA 1A2JA 4Z2TA 4AGSA 4POMA 2GT6A 1GP1A 4J57E 4NXIA 5CNWA 4IQAA 5IO0A 2PERA 4FIWA 2HZFA 2YNXA 3IHGA 3D6IA 3EWLA 2YCDA 4JBBA 3KMOA 2HFDA 2IMKA 2AV4A 4Q5RA 2IJYA 2MMAA 4GSTA 2LQQA 1A8LA 2QGVA 1LBKA 3KIJA 2KHPA 2F8AA 4ECCA 2L4CA 2QA2A 2EIRA 5JCUA 2FHEA 1DE2A 2MBTA 1SENA 2GVPA 1FVJA 4KE3A 2WULA 3PPUA 2R0GA 5C04A 1ZL9A 1LJRA 1X9WB 3WD6A 3GV1A 3HJOA 1EEJA 4NPBA 2CAIA 1O7UA 4BIKA 1TK8B 16GSA 2A4HA 13GSA 2V6OA 2CZ3A 4G0IA 6GSUA 1GTUA 1CQGA 2H01A 2MYGA 2VOCA 1OE8A 2QC7A 4G10A 1FHEA 1NHOA 5J9BA 2JACA 5LD0A 2PU9C 5GSSA 1C72A 3GA4A 1ZYPA 5F06A 4PNGA 1GSSA 1YDKA 1W89A 3GNJA 3LSZA 3QDNA 1T4YA 1A2MA 2H8LA 4MH3A 3F3RA 4XS4A 3H93A 4EIQA 1T7PB 4YQVA 3R2QA 4EE0A 3HD5A 4IN0A 3FZ9A 1RW1A 3HJMA 4I5QA 2HNLA 2HSHA 2OADA 3HVXA 1SJ6A 4HU9A 5G31A 4OD7A 1M2BA 5CRHA 5DAKB 1VRSD 1VGLA 2I9HA 1AQXA 1MD3A 2O85A 3HJPA 4TR1A 4K0NA 4O7HA 1NHYA 4OCEA 4YAPA 4DVCA 2KOKA 3BBYA 4OFTA 3LYKA 4TR0A 1ILOA 2F51A 1TU8A 2H76A 1TKDB 3TJFA 3APQA 1TK5B 14GSA 1HYUA 4ILFA 1SL2B 5IMAA 4IKHA 1TOFA 3F4SA 1V2AA 1GL8A 3IOSA 2R37A 1DBYA 5GAPD 2AJQB 3W6GA 2R3XA 4ID0A 3G9BA 2MMZA 1OC8A 1JLWA 1TRWA 4RQXA 1WP0A 4A5PA 1VF4A 1WPIA 1OKTA 1PN9A 3G7YA 4K5SA 1ERTA 5E59A 4O32A 1G0TA 2OE0A 2KUCA 2LJKA 3CSJA 1OE7A 1PFOA 4HQSA 2H72A 2IFQB 3FY7A 3WGDA 1F6MC 22GSA 4KGIA 1YY7A 5COHA 2JZSA 2D2ZA 3IAM2 2YJHA 1H75A 2O7KA 3LEFA 3M9JA 3WYWA 5HR3A 3ZL5A 3QCPA 4MNNA 2YV7A 3F4RA 4I8BA 5LNKe 5GAND 3C71A 3F8UA 1GSDA 3EVIA 5KN0A 5BMUA 2IMEA 3G7JA 2LNTA 2V41A 2H0HA 5CO3A 3IHQA 4JU5A 2OJLA 2IIYA 1XW5A 4MJBA 5D9WA 1F3AA 1GNEA 1V98A 1OC9A 2DC5A 4EL1A 4JR6A 4I6XA 4F9ZA 1URMA 3IK9A 2PBJA 1BQ7A 3J7Yk 1U87A 2FWGA 1GH2A 4EKZA 5A4VA 1FAAA 2OBIA 4IQ1A 4PQIA 2MZCA 4K6XA 2VCQA 1JZRA 20GSA 1PKZA 2YZUA 2LQOA 4GRFA 4RI6A 2HLSA 2GDRA 4YAVA 4MZBA 5JWQB 4TOPA 3IK7A 4CY8A 3DVWA 1JLVA 4AJ7A 3Q6OA 4XS1A 3FR6A 1HNBA 2H1BA 1K3OA 1SYRA 1O6JA 2HT9A 1XW6A 2VCZA 3QOUA 4KAEA 4NV2A 2CZ2A 2C0EA 3FZAA 2K18A 3KMNA 4HDEA 4FYBA 3CXGA 2HZEA 4X4JA 1TRVA 1PL1A 1WOUA 4KCAA 2HSMA 2B5YA 2WDUA 4G19A 5A5KA 1XCCA 2WB9A 2IMIA 1AAZA 4IHUA 4KSOA 5ID2B 3GKNA 3IXRA 5KN2A 2YP6A 2PVQA 2L4QA 2I1UA 3RBTA 4BVYA 5G1KA 2WCIA 5ELGA 2P31A 4Z2UA 2E2MA 1K3YA 4O5UA 3IAS2 17GSA 1GTBA 4BVYB 3TJBA 4KDUA 3TKSC 1SK2A 4F0BA 2YOIA 3KP9A 1M9BA 3CRTA 5KOWA 2YZHA 4F03A 3ISOA 2CA8A 3F6FA 6GSSA 2VCWA 1R7HA 4X43A 5IOWA 2PPTA 1M7TA 1MDIA 5ECMB 2F8FA 3IA1A 1T00A 3Q19A 2H30A 3UVTA 11GSA 1BG5A 2PWJA 4ACSA 4NV5A 2H71A 1V40A 1KNGA 4TW5A 4WR4A 4O92A 4EDYA 3ZVJD 3LYPA 2X99A 4PTSA 2FLSA 2GSTA 3GL5A 3GSSA 4OWYA 3BD2A 5F0GA 1O85A 1UA5A 3VWXA 2H1AA 3KCMA 5HR1A 3GKMA 2HYXA 2DJKA 1PQNA 1Q98A 1BJXA 2HXKA 3QAVA 1Z9HA 3US3A 4XCSA 4IP6A 1T1VA 1G7EA 3MSZA 1SK1A 5H5SA 2J23A 4TRXA 3QAGA 4EF0A 4N10A 2CX3A 3H4KA 1RK4A 2YPMA 4OO4A 2H0GA 1TP9A 3TCOA 4Q5FA 4F2IA 1M9AA 4IGJA 1YKCA 3FHKA 19GSA 3C7MA 3WT2A 4Q5NA 2M72A 6GSYA 4N11A 1K0DA 4MF7A 2HSYA 4WBRD 1SK0A 3LFLA 2B1KA 3HHVA 3LJRA 1A0FA 2H75A 4K7OA 3Q74A 1GLQA 4JRRA 2FNOA 2NDOA 1O8WA 18GSA 1TRSA 3TRQA 3NZNA 2EC4A 4MCUA 3LWAA 1ABAA 1DSBA 2X8HA 4KH7A 1U6TA 3GRXA 1THXA 1ERUA 2FGXA 3F6DA 1JZOA 3U6VA 2BMXA 5ECPB 4H86A 3IPZA 4KX4A 9GSSA 5B8BA 2ES7A 4FH8A 4ZL7A 4BVXA 3FMWA 1T4ZA 3IC8A 4GSNA 3RHCA 1M99A 3CYNA 2LEGA 1E2YA 1PSQA 1QGVA 4CHSA 12GSA 4Z2RA 4V2LA 3LW9A 1X5CA 3HYPA 2C0DA 5IPGA 3MAKA 1TRUA 2A2RA 4D73B 1ZOFA 3UOMA 3UBKA 4HZ2A 1B8XA 2IWTA 4MH2A 2GQMA 2GQKA 5B6MA 4CW9A 4NWYA 1TTZA 3W8SA 4PUFC 3EURA 3QPMA 2YJ7A 2H0IA 1Y25A 3DEXA 1DE1A 2IMDA 2E7PA 2H66A 1Z3EA 4PGTA 1PX6A 5CAXA 1V57A 3UIWA 3BOAA 4ZB8A 2FY6A 4TKYA 4WBJA 2H1GA 4YKFA 2YANA 3D4TA 4CY6A 2AYTA 3PGTA 5D93A 1Q4JA 1J08A 2LRNA 2FA4A 4HI7A 1ZMAA 3F0IA 4GXZA 2DIZA 3ZFLA 4YQMA 4GQFA 3FR9A 1RQMA 4TR3A 2AHEA 2DKIA 2LSTA 2A4VA 1UC7A 3I6AA 1KEBA 5ABRA 3E9JB 1GUHA 2WJUA 2OE3A 3GH9A 3TJKA 3UL3A 1XOBA 1A2LA 5CRGA 3M3MA 1YKAA 3RHBA 4KA0A 4XS6A 2GSRA 1EP8A 4MK3A 5AGYA 1O81A 2VCTA 2C0FA 1PRXA 2WS2A 5A4UA 3I9V2 3BCIA 1U88A 2NTOA 1I5GA 3ZIVA 3PINA 1TI1A 3V1WA 4O5QA 1M3JA 2B3SA 4LMWA 3GHAA 2GQLA 5F05A 2L5OA 3D22A 2DMLA 3UJ1A 3C73A 2R6KA 3ZRDA 2C3NA 4HOJA 4ZB6A 3ZYWA 4FQUA 4XHMA 5IMZA 1YQ1A 4XS4B 3ERFA 1ON4A 3TRXA 4MP4A 3UBLA 5JWOB 3ZITA 1O73A 1YEXA 1MTCA 4K7NA 2H19A 3TKRA 5HFGA 4XTSA 2IN3A 5DDLA 3VLNA 4MJCA 3WGXA 2QA1A 2AB6A 3KXOA 4G9HA 1YF1A 4PURA 3VPQA 4TR4A 2V6KA 4TR1B 3O6TA
chains in the Genus database with same CATH topology
2V2GA 1FVKA 3TKSE 5EL8A 1X0RA 4IELA 4GWRA 3GH6A 4DEJA 5B8AA 3LG6A 5JCGA 3GIXA 3MWHA 2QSIA 3HY2A 5DALA 1R5AA 4ZILA 4XIHA 1N8JA 1MDKA 2Z9SA 4AJ6A 4IS0A 1PN0A 3IR4A 3ERGA 1XOAA 1EWXA 3P90A 2AAWA 1ZGNA 3TKSA 3DIEA 3UEMA 5HR0A 1N2AA 2LS5A 4IW9A 2CV4A 5D9XA 3M9KA 5ECSA 3KM6A 2WFCA 3D4MA 3VI7A 2VL3A 4TVEA 2RLIA 2A2PA 1SD8A 4LLRA 3M0FA 1QK8A 2CVBA 4TN8A 2ZNMA 3GSTA 4POBA 4FYCA 4F82A 3DVXA 3VK9A 2WZ9A 1XFLA 2V1MA 3IC4A 2I81A 2B1LA 2XBIA 2EIQA 3L9SA 1IYHA 4ULXA 1HD2A 1TXXA 1XWBA 3IDVA 3A2VA 4YQUA 2DJ1A 4MJEA 5ECQB 5D8IA 2QKEA 5B7CA 2VLUA 2PGTA 3IE3A 5KOXA 1OC9B 1K0OA 1KTEA 4L0WA 2H70A 4F0CA 1K0MA 3VFIA 2C0GA 2K8SA 2MBSA 3IBHA 4IJ3A 1TJDA 4K8MA 5J41A 3GTUA 3P7XA 3QFAC 2REMA 1QMVA 1ERWA 2LJAA 4K0GA 4EC0A 3FKFA 2FUG2 3TOTA 2L57A 3EU3A 2PN8A 3NOFA 1ERVA 4KDYA 1TK0B 1Y6EA 4NAXA 2FCHA 1QFNA 5D96A 2O8VB 1J0FA 3JCML 3L0HA 5CYYA 2HRNA 4WR5A 4PX1A 1Z5YE 2HZEB 2JZTA 5GSTA 1GSUA 1WIKA 4QL7A 1AUCA 4KDXA 2JL4A 1ST9A 4BL7A 1TU7A 5DVBA 5G5FA 4LL1B 4LMVA 4EXJA 3FR3A 3UAPA 2GGTA 2L59A 3CSHA 2A2SA 5JWRB 1XZOA 2PUKC 1XIYA 1YJ6A 3GMFA 1PGTA 1SD9A 4J56E 3E3EA 2YWOA 2CX4A 4G0LA 1EGRA 4ZXGA 6GSVA 6GSXA 3VWWA 3ZTLA 2EIOA 1S3DA 4EO3A 2VAFA 1ACVA 4JZQA 1CQHA 1B4QA 3E0UA 8GSSA 3O76A 1GULA 3H8QA 5H5QA 4ZL9A 1JZWA 1ZZYA 6GSTA 1SKSB 1GWCA 1VF2A 5FT3A 2R0PA 3DRNA 2FWEA 3VURA 3VI5A 2AUVA 1ZYEA 3HXSA 3WT1A 2E0QA 3EMPA 2VD1A 4ISDA 3D0ZA 4V1Ap 3RAZA 1Z6NA 4DSSA 2YWNA 1NM3A 2B7JA 3IV4A 2FA8A 4FYUA 3A2WA 1K0CA 3GL3A 5D9VA 3FEUA 5H5RA 5AIXA 4ECJA 1XVWA 1EZKA 1R5PA 1LU4A 1K0NA 3W8JA 1Z6MA 1FG4A 4ZBDA 5HQPA 1SL1B 1GUKA 2TRXA 1X9MB 5ECKB 2H74A 5KN3A 4ML6A 3M1GA 2P5QA 2NPBA 5DJMA 1WRYA 2GT5A 1WMJA 4MDCA 1XWAA 2DIYA 1PMTA 5DBQA 1XBSA 2GSSA 2LJRA 1BAYA 4DSRA 1BYEA 2OA7A 1DUGA 5D73A 2LRCA 3O3TA 3FYGA 1OC3A 1A24A 2K6VA 2N5BA 3MYDA 4YKGA 5BRTA 1U3AA 3UMAA 3H79A 5ENUA 2ON5A 4Z7XA 4L0UA 4AF2A 4KB3A 3TJGA 5DCGA 3GN3A 3A2XA 4QL9A 3APSA 2TRCP 5ECIB 1MEKA 1KBNA 2L6CA 5J5NA 2DJ2A 3OR5A 4LA1A 2ZUPA 3KD0A 4BVXB 2C80A 5AIVA 1BEDA 5AN1A 3CTFA 4ZL8A 2IPAA 2JADA 3EC3A 2RM5A 1JZDA 5G5EA 4K5RA 5HR2A 5J3RA 4KW6A 3A5WA 3N9JA 2DSAA 2JU5A 1XXUA 4K9ZA 1B9YC 3TJJA 4WXTA 5LCZA 1AW9A 4I2TA 2BTOT 5ELAA 4IJIA 3UARA 1MDJA 2VL9A 1F37A 1K0AA 4POLA 3GFKA 2RUEA 2M46A 1T8EB 2PMTA 3I69A 5G30A 1K0BA 3TUEA 4K1FA 4ECBA 4TXVA 3A3TA 2VL2A 1XWGA 1TW9A 5HFKA 4KUNA 3ME7A 3IRAA 5CP1A 2OKAA 1QUWA 3ZFBA 3AY8A 4USSA 3TGZA 2G2QA 2WGRA 1EP7A 3LXTA 4G0KA 1FW1A 1PA3A 1SJZA 5HFIA 2G0FA 3CRUA 1YF0A 5IOXA 4IVFA 2DJ3A 1X9SB 3C1SA 1OYJA 1QQ2A 3DXBA 4JEDA 5EPFA 5J4UA 4GSSA 1PD21 4EUYA 2H73A 1K3LA 2GLRA 2FWFA 3ERWA 1HQOA 1OKDA 2VM1A 4V2MA 5IMDA 3LQ7A 5G2ZA 2MMNA 4RI7A 2CAQA 4L5LA 4EIPA 2PVOC 3J7Yb 3ED3A 3FK8A 5JCWA 5IIZA 1SKRB 4IP1A 4J2FA 3ZIJA 5IMVA 2BJXA 1M2AA 3CTGA 3QAWA 5G1LA 3Q18A 1U3IA 1YEPA 5KEJA 2DBCA 4GLTA 1EOHA 5DQYA 2R4VA 3H1NA 3EE2A 1GSEA 3BCKA 5F8BA 1R26A 1XVQA 3I43A 2DJJA 4BWQA 1F9MA 4ZBBA 4KCEA 1VF3A 2VLTA 3DWVA 2XPDA 3TKPA 1O8XA 3KTBA 2HI7A 2O89A 2B7KA 4NMUA 3ZMLA 2ZCTA 3TRPA 3D5JA 1J9BA 5IQYA 2VUPA 4E8HA 1G7OA 2L5LA 4O5RA 1GTIA 4N0ZA 1H4OA 3HZ8A 4CDOA 2L6DA 4PNFA 1HNCA 2FWHA 1M2DA 2H1DA 4N30A 2NBSA 3EPTA 5DAKA 4GQCA 3WGEA 4WKWA 1V58A 1USBA 3CBUA 4WETA 4MPGA 3HZ4A 2VIMA 2OACA 3ZZXA 2F3MA 3FZ5A 2GTUA 2CVDA 2KP2A 2VL2C 4MPFA 4PQ1A 3DKSA 2DLXA 3GKXA 3SBCA 1QXHA 2F9SA 2R2JA 2HRAA 2H6ZA 4POKA 4K2XA 2XPEA 2WRTA 5E4WA 4HEA2 3LXZA 2X8CA 3GYKA 3C1RA 3PR8A 3L4NA 4AJ8A 3TDGA 5DALB 4EVMA 4ICYA 2LTKA 2P5RA 2GZYA 4WF4A 1A8YA 1WJKA 3FW2A 4MZCA 2GZPA 2IFQA 4K7IA 2O87A 1JHBA 1THOA 1FO5A 5F07A 1B4PA 4WEYA 3LGCA 1ZYQB 1SKWB 2IMFA 2V32A 4KNDA 4K2DA 4KSMA 1A23A 5IPHA 1AQWA 1XWKA 2C4JA 4MF5A 4HUAA 1B9XC 1GSQA 2DJ0A 2I4AA 4XRAA 2H6XA 3HKRA 1NW2A 2YN1A 2VM2A 3F3QA 5CREA 3L9VA 1V9WA 3DGQA 1XW9A 2XHFA 1EEMA 2UZ8A 3FRCA 4ECIA 5CRDA 1OAZA 2KLXA 2M80A 3D21A 3CSIA 7GSSA 2XC2A 1TDIA 1F2EA 5ECLB 3VPTA 1T3BA 1ML6A 5EVOA 2B6MA 1EV9A 3EYTA 1MD4A 2IL3A 1VF1A 1Z7RA 2RUFA 2NVLA 3NIVA 5IMFA 1A0RP 4EDZA 3KJYA 3ME8A 3EINA 2CT6A 2YWMA 3KP8A 3GTUB 4OMVA 4DSQA 3N5OA 2P0GA 3QR6A 1F3BA 2C3QA 4OCFA 3KGKA 2X8GA 4L8EA 1GLPA 3DYRA 1SU9A 5J9CA 2C8UA 2R0CA 4I2UA 5ECRB 3EMXA 2GZZA 4PUAA 5KN1A 2VD0A 4JE1A 3QMXA 5IM9A 1S3AA 2HRFA 3HDCA 3LORA 4ZB9A 5IMCA 2K9FA 5ID2A 2CVKA 1HNAA 4FO5A 1OVNA 3ZLPA 5ECHB 3VWVA 2ALBA 2E2GA 3APOA 4BL7B 4ZBAA 3M8NA 4WF5A 5B6NA 1FOVA 2VLVA 1ZCPA 2X4AA 1WWJA 1I9DA 1TI3A 3K8NA 1E6BA 2LRTA 3KH9A 5L71A 4MABA 1S3CA 1XPVA 4GTUA 4HJMA 2C1YA 2TIRA 1FOHA 2JSYA 1GSFA 2C3TA 4X0XA 1GRXA 4HJ2A 2LV3A 4ML1A 3C8EA 2JZRA 2OE1A 3TKQA 1SJIA 2YWIA 4GCIA 2K8VA 4PXOA 2GSQA 3F9UA 4G2EA 3R3EA 4OO5A 1PL2A 3L9UA 1GNWA 3KEBA 5FWGA 2VCVA 1G6YA 5IO2A 4MA9A 2N5FA 1UN2A 5DJLA 1X5EA 1AC1A 2LUSA 3MIXA 1EGOA 5AISA 3P2AA 4ZIJA 2R5GA 4BPYA 1IYIA 3KH7A 4GF0A 4MZWA 3P8WA 3PH9A 2X64A 3KTLA 5ECNB 4IBPA 1PKWA 1BX9A 4OFMA 4KF9A 4DSSB 1GSYA 1UVZA 3GKKA 3KZQA 4RUVA 3HVSA 2MMOA 2DKHA 1NSWA 3RDWA 3TB2A 3ZMKA 4MJAA 4RQRA 2LKUA 2DMMA 1ZYNA 5C00A 3GX0A 3BJ5A 5A4WA 1AQVA 5CRWA 3VWUA 1AIUA 1SYXA 3GX8A 3GURA 4PQHA 4I97A 2H6YA 2J9HA 2X49A 4Q5QA 2HRKA 3EU4A 2JSZA 2KP1A 5FHIA 4YH2A 3G7IA 2ON7A 3QD9A 4XRDA 2VO4A 6GSWA 4NHZA 4L5OA 4NHWA 3HCZA 4HZ4A 2VCXA 1PX7A 1FB0A 2CQ9A 2OBKA 2RM6A 1B48A 3A5IA 3RPNA 1XWCA 4HS1A 3F4TA 4LL4B 5D9TA 2LNSA 1JFUA 1WE0A 3TOUA 4X1UA 3SWLA 4MF6A 4TXOA 3ZREA 4HQZA 4BWSA 3MDKA 2YV9A 3GUSA 3F63A 4HU7A 1Z7PA 1M0UA 3UVHA 3DMLA 1EV4A 3L78A 4TXOB 3U5RE 3ZVJA 2B5XA 2I3YA 2N5AA 5EY6A 3RPPA 1FB6A 1EOGA 1AXDA 5GZZB 3CMIA 4OFNA 10GSA 1SL0B 1R4WA 3DD3A 4E8EA 1W4VA 1G6WA 4MMMA 3HA9A 2HE3A 4V1Ag 4P3YB 5DQSA 4BA7A 4D73A 3MNGA 3FZ4A 5ECOB 2GS3A 5DCHA 4QQ7A 1GUMA 1X5DA 3HVVA 3QFBC 2B5EA 2XBQA 4JR4A 1GTAA 1YZXA 4N0VA 2RIIA 3S9FA 2FD3A 4V2NA 5INYA 4MLYA 1A2JA 4Z2TA 4AGSA 4POMA 2GT6A 1GP1A 4J57E 4NXIA 5CNWA 4IQAA 5IO0A 2PERA 4FIWA 2HZFA 2YNXA 3IHGA 3D6IA 3EWLA 2YCDA 4JBBA 3KMOA 2HFDA 2IMKA 2AV4A 4Q5RA 2IJYA 2MMAA 4GSTA 2LQQA 1A8LA 2QGVA 1LBKA 3KIJA 2KHPA 2F8AA 4ECCA 2L4CA 2QA2A 2EIRA 5JCUA 2FHEA 1DE2A 2MBTA 1SENA 2GVPA 1FVJA 4KE3A 2WULA 3PPUA 2R0GA 5C04A 1ZL9A 1LJRA 1X9WB 3WD6A 3GV1A 3HJOA 1EEJA 4NPBA 2CAIA 1O7UA 1TK8B 16GSA 2A4HA 13GSA 2V6OA 2CZ3A 4G0IA 6GSUA 1GTUA 1CQGA 2H01A 2MYGA 2VOCA 1OE8A 2QC7A 4G10A 1FHEA 1NHOA 5J9BA 2JACA 5LD0A 2PU9C 5GSSA 1C72A 3GA4A 1ZYPA 5F06A 4PNGA 1GSSA 1YDKA 1W89A 3GNJA 3LSZA 3QDNA 1T4YA 1A2MA 2H8LA 4MH3A 3F3RA 4XS4A 3H93A 4EIQA 1T7PB 4YQVA 3R2QA 4EE0A 3HD5A 4IN0A 3FZ9A 1RW1A 3HJMA 4I5QA 2HNLA 2HSHA 2OADA 3HVXA 1SJ6A 4HU9A 5G31A 4OD7A 1M2BA 5CRHA 5DAKB 1VRSD 1VGLA 2I9HA 1AQXA 1MD3A 2O85A 3HJPA 4TR1A 4K0NA 4O7HA 1NHYA 4OCEA 4YAPA 4DVCA 2KOKA 3BBYA 4OFTA 3LYKA 4TR0A 1ILOA 2F51A 1TU8A 2H76A 1TKDB 3TJFA 3APQA 1TK5B 14GSA 1HYUA 4ILFA 1SL2B 5IMAA 4IKHA 1TOFA 3F4SA 1V2AA 1GL8A 3IOSA 2R37A 1DBYA 5GAPD 2AJQB 3W6GA 2R3XA 4ID0A 3G9BA 2MMZA 1OC8A 1JLWA 1TRWA 4RQXA 1WP0A 4A5PA 1VF4A 1WPIA 1OKTA 1PN9A 3G7YA 4K5SA 1ERTA 5E59A 4O32A 1G0TA 2OE0A 2KUCA 2LJKA 3CSJA 1OE7A 4HQSA 2H72A 2IFQB 3FY7A 3WGDA 1F6MC 22GSA 4KGIA 1YY7A 5COHA 2JZSA 2D2ZA 3IAM2 2YJHA 1H75A 2O7KA 3LEFA 3M9JA 3WYWA 5HR3A 3ZL5A 3QCPA 4MNNA 2YV7A 3F4RA 4I8BA 5LNKe 5GAND 3C71A 3F8UA 1GSDA 3EVIA 5KN0A 5BMUA 2IMEA 3G7JA 2LNTA 2V41A 2H0HA 5CO3A 3IHQA 4JU5A 2OJLA 2IIYA 1XW5A 4MJBA 5D9WA 1F3AA 1GNEA 1V98A 1OC9A 2DC5A 4EL1A 4JR6A 4I6XA 4F9ZA 1URMA 3IK9A 2PBJA 1BQ7A 3J7Yk 1U87A 2FWGA 1GH2A 4EKZA 5A4VA 1FAAA 2OBIA 4IQ1A 4PQIA 2MZCA 4K6XA 2VCQA 1JZRA 20GSA 1PKZA 2YZUA 2LQOA 4GRFA 4RI6A 2HLSA 2GDRA 4YAVA 4MZBA 5JWQB 4TOPA 3IK7A 4CY8A 3DVWA 1JLVA 4AJ7A 3Q6OA 4XS1A 3FR6A 1HNBA 2H1BA 1K3OA 1SYRA 1O6JA 2HT9A 1XW6A 2VCZA 3QOUA 4KAEA 4NV2A 2CZ2A 2C0EA 3FZAA 2K18A 3KMNA 4HDEA 4FYBA 3CXGA 2HZEA 4X4JA 1TRVA 1PL1A 1WOUA 4KCAA 2HSMA 2B5YA 2WDUA 4G19A 5A5KA 1XCCA 2WB9A 2IMIA 1AAZA 4IHUA 4KSOA 5ID2B 3GKNA 3IXRA 5KN2A 2YP6A 2PVQA 2L4QA 2I1UA 3RBTA 4BVYA 5G1KA 2WCIA 5ELGA 2P31A 4Z2UA 2E2MA 1K3YA 4O5UA 3IAS2 17GSA 1GTBA 4BVYB 3TJBA 4KDUA 3TKSC 1SK2A 4F0BA 2YOIA 3KP9A 1M9BA 3CRTA 5KOWA 2YZHA 4F03A 3ISOA 2CA8A 3F6FA 6GSSA 2VCWA 1R7HA 4X43A 5IOWA 2PPTA 1M7TA 1MDIA 5ECMB 2F8FA 3IA1A 1T00A 3Q19A 2H30A 3UVTA 11GSA 1BG5A 2PWJA 4ACSA 4NV5A 2H71A 1V40A 1KNGA 4TW5A 4WR4A 4O92A 4EDYA 3ZVJD 3LYPA 2X99A 4PTSA 2FLSA 2GSTA 3GL5A 3GSSA 4OWYA 3BD2A 5F0GA 1O85A 1UA5A 3VWXA 2H1AA 3KCMA 5HR1A 3GKMA 2HYXA 2DJKA 1PQNA 1Q98A 1BJXA 2HXKA 3QAVA 1Z9HA 3US3A 4XCSA 4IP6A 1T1VA 1G7EA 3MSZA 1SK1A 5H5SA 2J23A 4TRXA 3QAGA 4EF0A 4N10A 2CX3A 3H4KA 1RK4A 2YPMA 4OO4A 2H0GA 1TP9A 3TCOA 4Q5FA 4F2IA 1M9AA 4IGJA 1YKCA 3FHKA 19GSA 3C7MA 3WT2A 4Q5NA 2M72A 6GSYA 4N11A 1K0DA 4MF7A 2HSYA 4WBRD 1SK0A 3LFLA 2B1KA 3HHVA 3LJRA 1A0FA 2H75A 4K7OA 3Q74A 1GLQA 4JRRA 2FNOA 2NDOA 1O8WA 18GSA 1TRSA 3TRQA 3NZNA 2EC4A 4MCUA 3LWAA 1ABAA 1DSBA 2X8HA 4KH7A 1U6TA 3GRXA 1THXA 1ERUA 2FGXA 3F6DA 1JZOA 3U6VA 2BMXA 5ECPB 4H86A 3IPZA 4KX4A 9GSSA 5B8BA 2ES7A 4FH8A 4ZL7A 4BVXA 3FMWA 1T4ZA 3IC8A 4GSNA 3RHCA 1M99A 3CYNA 2LEGA 1E2YA 1PSQA 1QGVA 4CHSA 12GSA 4Z2RA 4V2LA 3LW9A 1X5CA 3HYPA 2C0DA 5IPGA 3MAKA 1TRUA 2A2RA 4D73B 1ZOFA 3UOMA 3UBKA 4HZ2A 1B8XA 2IWTA 4MH2A 2GQMA 2GQKA 5B6MA 4CW9A 4NWYA 1TTZA 3W8SA 4PUFC 3EURA 3QPMA 2YJ7A 2H0IA 1Y25A 3DEXA 1DE1A 2IMDA 2E7PA 2H66A 1Z3EA 4PGTA 1PX6A 5CAXA 1V57A 3UIWA 3BOAA 4ZB8A 2FY6A 4TKYA 4WBJA 2H1GA 4YKFA 2YANA 3D4TA 4CY6A 2AYTA 3PGTA 5D93A 1Q4JA 1J08A 2LRNA 2FA4A 4HI7A 1ZMAA 3F0IA 4GXZA 2DIZA 3ZFLA 4YQMA 4GQFA 3FR9A 1RQMA 4TR3A 2AHEA 2DKIA 2LSTA 2A4VA 1UC7A 3I6AA 1KEBA 5ABRA 3E9JB 1GUHA 2WJUA 2OE3A 3GH9A 3TJKA 3UL3A 1XOBA 1A2LA 5CRGA 3M3MA 1YKAA 3RHBA 4KA0A 4XS6A 2GSRA 1EP8A 4MK3A 5AGYA 1O81A 2VCTA 2C0FA 1PRXA 2WS2A 5A4UA 3I9V2 3BCIA 1U88A 2NTOA 1I5GA 3ZIVA 3PINA 1TI1A 3V1WA 4O5QA 2B3SA 4LMWA 3GHAA 2GQLA 5F05A 2L5OA 3D22A 2DMLA 3UJ1A 3C73A 2R6KA 3ZRDA 2C3NA 4HOJA 4ZB6A 3ZYWA 4FQUA 4XHMA 5IMZA 1YQ1A 4XS4B 3ERFA 1ON4A 3TRXA 4MP4A 3UBLA 5JWOB 3ZITA 1O73A 1YEXA 1MTCA 4K7NA 2H19A 3TKRA 5HFGA 4XTSA 2IN3A 5DDLA 3VLNA 4MJCA 3WGXA 2QA1A 2AB6A 3KXOA 4G9HA 1YF1A 4PURA 3VPQA 4TR4A 2V6KA 4TR1B 3O6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2G A;  1FVK A;  3TKS E;  5EL8 A;  1X0R A;  4IEL A;  4GWR A;  3GH6 A;  4DEJ A;  5B8A A;  3LG6 A;  5JCG A;  3GIX A;  3MWH A;  2QSI A;  3HY2 A;  5DAL A;  1R5A A;  4ZIL A;  4XIH A;  1N8J A;  1MDK A;  2Z9S A;  4AJ6 A;  4IS0 A;  3IR4 A;  3ERG A;  1XOA A;  1EWX A;  3P90 A;  2AAW A;  1ZGN A;  3TKS A;  3DIE A;  3UEM A;  5HR0 A;  1N2A A;  2LS5 A;  4IW9 A;  2CV4 A;  5D9X A;  3M9K A;  5ECS A;  3KM6 A;  2WFC A;  3D4M A;  3VI7 A;  2VL3 A;  4TVE A;  2RLI A;  1SD8 A;  4LLR A;  3M0F A;  1QK8 A;  2CVB A;  4TN8 A;  2ZNM A;  3GST A;  4POB A;  4FYC A;  4F82 A;  3DVX A;  3VK9 A;  2WZ9 A;  1XFL A;  2V1M A;  3IC4 A;  2I81 A;  2B1L A;  2XBI A;  2EIQ A;  3L9S A;  1IYH A;  4ULX A;  1HD2 A;  1TXX A;  1XWB A;  3IDV A;  3A2V A;  4YQU A;  2DJ1 A;  4MJE A;  5ECQ B;  5D8I A;  2QKE A;  5B7C A;  2VLU A;  2PGT A;  3IE3 A;  1OC9 B;  1K0O A;  1KTE A;  4L0W A;  2H70 A;  4F0C A;  1K0M A;  3VFI A;  2C0G A;  2K8S A;  2MBS A;  3IBH A;  4IJ3 A;  1TJD A;  4K8M A;  5J41 A;  3GTU A;  3P7X A;  3QFA C;  2REM A;  1QMV A;  1ERW A;  2LJA A;  4K0G A;  4EC0 A;  3FKF A;  2FUG 2;  3TOT A;  2L57 A;  3EU3 A;  2PN8 A;  3NOF A;  1ERV A;  4KDY A;  1TK0 B;  1Y6E A;  4NAX A;  2FCH A;  1QFN A;  5D96 A;  2O8V B;  1J0F A;  3JCM L;  3L0H A;  5CYY A;  2HRN A;  4WR5 A;  4PX1 A;  1Z5Y E;  2HZE B;  2JZT A;  5GST A;  1GSU A;  1WIK A;  4QL7 A;  1AUC A;  4KDX A;  2JL4 A;  1ST9 A;  4BL7 A;  1TU7 A;  5DVB A;  5G5F A;  4LL1 B;  4LMV A;  4EXJ A;  3FR3 A;  3UAP A;  2GGT A;  2L59 A;  3CSH A;  2A2S A;  5JWR B;  1XZO A;  2PUK C;  1XIY A;  1YJ6 A;  3GMF A;  1PGT A;  1SD9 A;  4J56 E;  3E3E A;  2YWO A;  2CX4 A;  1EGR A;  4ZXG A;  6GSV A;  6GSX A;  3VWW A;  3ZTL A;  2EIO A;  1S3D A;  4EO3 A;  2VAF A;  1ACV A;  4JZQ A;  1CQH A;  1B4Q A;  3E0U A;  8GSS A;  3O76 A;  1GUL A;  3H8Q A;  5H5Q A;  4ZL9 A;  1JZW A;  1ZZY A;  6GST A;  1SKS B;  1GWC A;  1VF2 A;  5FT3 A;  3DRN A;  2FWE A;  3VUR A;  3VI5 A;  2AUV A;  1ZYE A;  3HXS A;  3WT1 A;  2E0Q A;  3EMP A;  2VD1 A;  4ISD A;  3D0Z A;  4V1A p;  3RAZ A;  1Z6N A;  4DSS A;  2YWN A;  1NM3 A;  2B7J A;  3IV4 A;  2FA8 A;  4FYU A;  3A2W A;  1K0C A;  3GL3 A;  5D9V A;  3FEU A;  5H5R A;  5AIX A;  4ECJ A;  1XVW A;  1EZK A;  1R5P A;  1LU4 A;  1K0N A;  3W8J A;  1Z6M A;  1FG4 A;  4ZBD A;  5HQP A;  1SL1 B;  1GUK A;  2TRX A;  1X9M B;  5ECK B;  2H74 A;  5KN3 A;  4ML6 A;  3M1G A;  5DJM A;  2NPB A;  2P5Q A;  1WRY A;  2GT5 A;  1WMJ A;  4MDC A;  1XWA A;  2DIY A;  1PMT A;  5DBQ A;  1XBS A;  2GSS A;  2LJR A;  1BAY A;  4DSR A;  1BYE A;  2OA7 A;  1DUG A;  5D73 A;  2LRC A;  3O3T A;  3FYG A;  1OC3 A;  1A24 A;  2K6V A;  2N5B A;  1U3A A;  3UMA A;  3H79 A;  5ENU A;  2ON5 A;  4Z7X A;  4L0U A;  4AF2 A;  4KB3 A;  3TJG A;  5DCG A;  3GN3 A;  3A2X A;  4QL9 A;  3APS A;  2TRC P;  5ECI B;  1MEK A;  1KBN A;  2L6C A;  5J5N A;  2DJ2 A;  3OR5 A;  4LA1 A;  2ZUP A;  3KD0 A;  2C80 A;  5AIV A;  1BED A;  5AN1 A;  3CTF A;  4ZL8 A;  2IPA A;  2JAD A;  3EC3 A;  2RM5 A;  1JZD A;  5G5E A;  5HR2 A;  5J3R A;  4KW6 A;  3A5W A;  3N9J A;  2DSA A;  2JU5 A;  1XXU A;  4K9Z A;  1B9Y C;  3TJJ A;  4WXT A;  5LCZ A;  1AW9 A;  4I2T A;  2BTO T;  5ELA A;  4IJI A;  3UAR A;  1MDJ A;  2VL9 A;  1F37 A;  1K0A A;  4POL A;  3GFK A;  2RUE A;  2M46 A;  1T8E B;  2PMT A;  3I69 A;  5G30 A;  1K0B A;  3TUE A;  4K1F A;  4ECB A;  4TXV A;  3A3T A;  2VL2 A;  1XWG A;  1TW9 A;  5HFK A;  4KUN A;  3ME7 A;  3IRA A;  5CP1 A;  2OKA A;  1QUW A;  3ZFB A;  3AY8 A;  3TGZ A;  2G2Q A;  2WGR A;  1EP7 A;  3LXT A;  1FW1 A;  1PA3 A;  1SJZ A;  5HFI A;  2G0F A;  3CRU A;  1YF0 A;  5IOX A;  4IVF A;  2DJ3 A;  1X9S B;  3C1S A;  1OYJ A;  1QQ2 A;  3DXB A;  4JED A;  5EPF A;  5J4U A;  4GSS A;  1PD2 1;  4EUY A;  2H73 A;  1K3L A;  2GLR A;  2FWF A;  3ERW A;  1HQO A;  1OKD A;  2VM1 A;  4V2M A;  5IMD A;  3LQ7 A;  5G2Z A;  2MMN A;  4RI7 A;  2CAQ A;  4L5L A;  2PVO C;  3J7Y b;  3ED3 A;  3FK8 A;  5JCW A;  5IIZ A;  1SKR B;  4IP1 A;  4J2F A;  3ZIJ A;  5IMV A;  2BJX A;  1M2A A;  3CTG A;  3QAW A;  5G1L A;  3Q18 A;  1U3I A;  1YEP A;  5KEJ A;  2DBC A;  4GLT A;  1EOH A;  5DQY A;  2R4V A;  3H1N A;  3EE2 A;  1GSE A;  3BCK A;  5F8B A;  1R26 A;  1XVQ A;  3I43 A;  2DJJ A;  4BWQ A;  1F9M A;  4ZBB A;  4KCE A;  1VF3 A;  2VLT A;  3DWV A;  2XPD A;  3TKP A;  1O8X A;  3KTB A;  2HI7 A;  2O89 A;  2B7K A;  4NMU A;  3ZML A;  2ZCT A;  3TRP A;  3D5J A;  1J9B A;  5IQY A;  2VUP A;  4E8H A;  1G7O A;  2L5L A;  4O5R A;  1GTI A;  4N0Z A;  1H4O A;  3HZ8 A;  4CDO A;  2L6D A;  4PNF A;  1HNC A;  2FWH A;  1M2D A;  2H1D A;  4N30 A;  2NBS A;  5DAK A;  4GQC A;  3WGE A;  4WKW A;  1V58 A;  1USB A;  3CBU A;  4WET A;  4MPG A;  3HZ4 A;  2VIM A;  2OAC A;  3ZZX A;  2F3M A;  3FZ5 A;  2GTU A;  2CVD A;  2KP2 A;  2VL2 C;  4MPF A;  4PQ1 A;  3DKS A;  2DLX A;  3GKX A;  3SBC A;  1QXH A;  2F9S A;  2R2J A;  2H6Z A;  4POK A;  2XPE A;  2WRT A;  5E4W A;  4HEA 2;  3LXZ A;  2X8C A;  3GYK A;  3C1R A;  3PR8 A;  3L4N A;  4AJ8 A;  3TDG A;  5DAL B;  4EVM A;  2LTK A;  2P5R A;  2GZY A;  4WF4 A;  1A8Y A;  1WJK A;  3FW2 A;  4MZC A;  2GZP A;  2IFQ A;  4K7I A;  2O87 A;  1JHB A;  1THO A;  1FO5 A;  5F07 A;  1B4P A;  4WEY A;  3LGC A;  1ZYQ B;  1SKW B;  2IMF A;  2V32 A;  4KND A;  4K2D A;  4KSM A;  1A23 A;  5IPH A;  1AQW A;  1XWK A;  2C4J A;  4MF5 A;  4HUA A;  1B9X C;  1GSQ A;  2DJ0 A;  2I4A A;  4XRA A;  2H6X A;  3HKR A;  1NW2 A;  2YN1 A;  2VM2 A;  3F3Q A;  5CRE A;  3L9V A;  1V9W A;  3DGQ A;  1XW9 A;  2XHF A;  1EEM A;  3FRC A;  4ECI A;  5CRD A;  1OAZ A;  2KLX A;  2M80 A;  3D21 A;  3CSI A;  7GSS A;  2XC2 A;  1TDI A;  1F2E A;  5ECL B;  3VPT A;  1T3B A;  1ML6 A;  5EVO A;  2B6M A;  1EV9 A;  3EYT A;  1MD4 A;  2IL3 A;  1VF1 A;  1Z7R A;  2RUF A;  2NVL A;  3NIV A;  5IMF A;  1A0R P;  4EDZ A;  3KJY A;  3ME8 A;  3EIN A;  2CT6 A;  2YWM A;  3KP8 A;  3GTU B;  4OMV A;  4DSQ A;  3N5O A;  2P0G A;  3QR6 A;  1F3B A;  2C3Q A;  4OCF A;  3KGK A;  2X8G A;  4L8E A;  1GLP A;  3DYR A;  1SU9 A;  5J9C A;  2C8U A;  4I2U A;  5ECR B;  3EMX A;  2GZZ A;  4PUA A;  5KN1 A;  2VD0 A;  4JE1 A;  3QMX A;  5IM9 A;  1S3A A;  2HRF A;  3HDC A;  3LOR A;  4ZB9 A;  5IMC A;  2K9F A;  5ID2 A;  2CVK A;  1HNA A;  4FO5 A;  1OVN A;  3ZLP A;  5ECH B;  3VWV A;  2ALB A;  2E2G A;  3APO A;  4ZBA A;  3M8N A;  4WF5 A;  5B6N A;  1FOV A;  2VLV A;  1ZCP A;  1WWJ A;  1I9D A;  1TI3 A;  3K8N A;  1E6B A;  2LRT A;  3KH9 A;  5L71 A;  4MAB A;  1S3C A;  1XPV A;  4GTU A;  4HJM A;  2C1Y A;  2TIR A;  2JSY A;  1GSF A;  2C3T A;  4X0X A;  1GRX A;  4HJ2 A;  2LV3 A;  4ML1 A;  3C8E A;  2JZR A;  2OE1 A;  3TKQ A;  1SJI A;  2YWI A;  4GCI A;  2K8V A;  4PXO A;  2GSQ A;  3F9U A;  4G2E A;  4OO5 A;  1PL2 A;  3L9U A;  1GNW A;  3KEB A;  5FWG A;  2VCV A;  1G6Y A;  5IO2 A;  4MA9 A;  2N5F A;  1UN2 A;  5DJL A;  1X5E A;  1AC1 A;  2LUS A;  1EGO A;  5AIS A;  3P2A A;  4ZIJ A;  2R5G A;  4BPY A;  1IYI A;  3KH7 A;  4GF0 A;  4MZW A;  3P8W A;  3PH9 A;  2X64 A;  3KTL A;  5ECN B;  4IBP A;  1PKW A;  1BX9 A;  4OFM A;  4DSS B;  1GSY A;  1UVZ A;  3GKK A;  3KZQ A;  4RUV A;  3HVS A;  2MMO A;  1NSW A;  3RDW A;  3TB2 A;  3ZMK A;  4MJA A;  4RQR A;  2LKU A;  2DMM A;  5C00 A;  3GX0 A;  3BJ5 A;  5A4W A;  1AQV A;  5CRW A;  3VWU A;  1AIU A;  1SYX A;  3GX8 A;  3GUR A;  4PQH A;  4I97 A;  2H6Y A;  2J9H A;  4Q5Q A;  3EU4 A;  2JSZ A;  2KP1 A;  5FHI A;  4YH2 A;  3G7I A;  2ON7 A;  3QD9 A;  4XRD A;  2VO4 A;  6GSW A;  4NHZ A;  4L5O A;  4NHW A;  3HCZ A;  4HZ4 A;  2VCX A;  1PX7 A;  1FB0 A;  2CQ9 A;  2OBK A;  2RM6 A;  1B48 A;  3RPN A;  1XWC A;  4HS1 A;  3F4T A;  4LL4 B;  5D9T A;  2LNS A;  1JFU A;  1WE0 A;  3TOU A;  4X1U A;  3SWL A;  4MF6 A;  4TXO A;  3ZRE A;  4HQZ A;  4BWS A;  3MDK A;  2YV9 A;  3GUS A;  3F63 A;  4HU7 A;  1Z7P A;  1M0U A;  3UVH A;  3DML A;  1EV4 A;  3L78 A;  4TXO B;  3U5R E;  3ZVJ A;  2B5X A;  2I3Y A;  2N5A A;  5EY6 A;  3RPP A;  1FB6 A;  1EOG A;  1AXD A;  5GZZ B;  3CMI A;  4OFN A;  10GS A;  1SL0 B;  1R4W A;  3DD3 A;  4E8E A;  1W4V A;  1G6W A;  4MMM A;  3HA9 A;  2HE3 A;  4V1A g;  4P3Y B;  5DQS A;  4BA7 A;  4D73 A;  3MNG A;  3FZ4 A;  5ECO B;  2GS3 A;  5DCH A;  4QQ7 A;  1GUM A;  1X5D A;  3HVV A;  3QFB C;  2B5E A;  2XBQ A;  4JR4 A;  1GTA A;  1YZX A;  4N0V A;  2RII A;  3S9F A;  2FD3 A;  4V2N A;  5INY A;  4MLY A;  1A2J A;  4AGS A;  4POM A;  2GT6 A;  1GP1 A;  4J57 E;  4NXI A;  5CNW A;  4IQA A;  5IO0 A;  2PER A;  4FIW A;  2HZF A;  2YNX A;  3D6I A;  3EWL A;  2YCD A;  4JBB A;  3KMO A;  2HFD A;  2IMK A;  2AV4 A;  4Q5R A;  2IJY A;  2MMA A;  4GST A;  2LQQ A;  1A8L A;  2QGV A;  1LBK A;  3KIJ A;  2KHP A;  2F8A A;  4ECC A;  2L4C A;  2EIR A;  5JCU A;  2FHE A;  1DE2 A;  2MBT A;  1SEN A;  2GVP A;  1FVJ A;  4KE3 A;  2WUL A;  5C04 A;  1ZL9 A;  1LJR A;  1X9W B;  3WD6 A;  3GV1 A;  3HJO A;  1EEJ A;  4NPB A;  2CAI A;  1O7U A;  1TK8 B;  16GS A;  13GS A;  2V6O A;  2CZ3 A;  6GSU A;  1GTU A;  1CQG A;  2H01 A;  2MYG A;  2VOC A;  1OE8 A;  2QC7 A;  4G10 A;  1FHE A;  1NHO A;  5J9B A;  2JAC A;  5LD0 A;  2PU9 C;  5GSS A;  1C72 A;  3GA4 A;  5F06 A;  4PNG A;  1GSS A;  1YDK A;  1W89 A;  3GNJ A;  3LSZ A;  3QDN A;  1T4Y A;  1A2M A;  2H8L A;  4MH3 A;  3F3R A;  4XS4 A;  3H93 A;  1T7P B;  4YQV A;  3R2Q A;  4EE0 A;  3HD5 A;  4IN0 A;  3FZ9 A;  1RW1 A;  3HJM A;  4I5Q A;  2HNL A;  2HSH A;  2OAD A;  3HVX A;  1SJ6 A;  4HU9 A;  5G31 A;  4OD7 A;  1M2B A;  5CRH A;  5DAK B;  1VRS D;  1VGL A;  2I9H A;  1AQX A;  1MD3 A;  2O85 A;  3HJP A;  4TR1 A;  4K0N A;  4O7H A;  1NHY A;  4OCE A;  4YAP A;  4DVC A;  2KOK A;  3BBY A;  4OFT A;  3LYK A;  4TR0 A;  1ILO A;  2F51 A;  1TU8 A;  2H76 A;  1TKD B;  3TJF A;  3APQ A;  1TK5 B;  14GS A;  1HYU A;  4ILF A;  1SL2 B;  5IMA A;  4IKH A;  1TOF A;  3F4S A;  1V2A A;  1GL8 A;  3IOS A;  2R37 A;  1DBY A;  5GAP D;  2AJQ B;  3W6G A;  2R3X A;  4ID0 A;  3G9B A;  2MMZ A;  1OC8 A;  1JLW A;  1TRW A;  4RQX A;  1WP0 A;  1VF4 A;  1WPI A;  1OKT A;  1PN9 A;  3G7Y A;  1ERT A;  5E59 A;  4O32 A;  1G0T A;  2OE0 A;  2KUC A;  2LJK A;  3CSJ A;  1OE7 A;  4HQS A;  2H72 A;  2IFQ B;  3FY7 A;  3WGD A;  1F6M C;  22GS A;  4KGI A;  1YY7 A;  5COH A;  2JZS A;  2D2Z A;  3IAM 2;  2YJH A;  1H75 A;  2O7K A;  3LEF A;  3M9J A;  3WYW A;  5HR3 A;  3ZL5 A;  3QCP A;  2YV7 A;  3F4R A;  4I8B A;  5LNK e;  5GAN D;  3C71 A;  3F8U A;  1GSD A;  3EVI A;  5KN0 A;  2IME A;  3G7J A;  2LNT A;  2V41 A;  2H0H A;  5CO3 A;  3IHQ A;  4JU5 A;  2OJL A;  2IIY A;  1XW5 A;  4MJB A;  5D9W A;  1F3A A;  1GNE A;  1V98 A;  1OC9 A;  2DC5 A;  4EL1 A;  4JR6 A;  4I6X A;  4F9Z A;  1URM A;  3IK9 A;  2PBJ A;  1BQ7 A;  3J7Y k;  1U87 A;  2FWG A;  1GH2 A;  4EKZ A;  5A4V A;  1FAA A;  2OBI A;  4IQ1 A;  4PQI A;  2MZC A;  4K6X A;  2VCQ A;  1JZR A;  20GS A;  1PKZ A;  2YZU A;  2LQO A;  4GRF A;  4RI6 A;  2HLS A;  2GDR A;  4YAV A;  4MZB A;  5JWQ B;  4TOP A;  3IK7 A;  3DVW A;  1JLV A;  4AJ7 A;  3Q6O A;  4XS1 A;  3FR6 A;  1HNB A;  2H1B A;  1K3O A;  1SYR A;  1O6J A;  2HT9 A;  1XW6 A;  2VCZ A;  3QOU A;  4KAE A;  4NV2 A;  2CZ2 A;  2C0E A;  3FZA A;  2K18 A;  3KMN A;  4HDE A;  4FYB A;  3CXG A;  2HZE A;  1TRV A;  1PL1 A;  1WOU A;  4KCA A;  2B5Y A;  2WDU A;  4G19 A;  5A5K A;  1XCC A;  2WB9 A;  2IMI A;  1AAZ A;  4IHU A;  4KSO A;  5ID2 B;  3GKN A;  3IXR A;  5KN2 A;  2YP6 A;  2PVQ A;  2L4Q A;  2I1U A;  3RBT A;  4BVY A;  5G1K A;  2WCI A;  5ELG A;  2P31 A;  2E2M A;  1K3Y A;  3IAS 2;  17GS A;  1GTB A;  3TJB A;  4KDU A;  3TKS C;  1SK2 A;  4F0B A;  2YOI A;  3KP9 A;  1M9B A;  3CRT A;  2YZH A;  4F03 A;  3ISO A;  2CA8 A;  3F6F A;  6GSS A;  2VCW A;  1R7H A;  4X43 A;  5IOW A;  2PPT A;  1M7T A;  1MDI A;  5ECM B;  2F8F A;  3IA1 A;  1T00 A;  3Q19 A;  2H30 A;  3UVT A;  11GS A;  1BG5 A;  2PWJ A;  4ACS A;  4NV5 A;  2H71 A;  1V40 A;  1KNG A;  4TW5 A;  4WR4 A;  4O92 A;  4EDY A;  3ZVJ D;  3LYP A;  2X99 A;  2FLS A;  2GST A;  3GL5 A;  3GSS A;  4OWY A;  3BD2 A;  5F0G A;  1O85 A;  1UA5 A;  3VWX A;  2H1A A;  3KCM A;  5HR1 A;  3GKM A;  2HYX A;  2DJK A;  1PQN A;  1Q98 A;  1BJX A;  2HXK A;  3QAV A;  1Z9H A;  3US3 A;  4XCS A;  4IP6 A;  1T1V A;  1G7E A;  3MSZ A;  1SK1 A;  5H5S A;  2J23 A;  4TRX A;  3QAG A;  4EF0 A;  4N10 A;  2CX3 A;  3H4K A;  1RK4 A;  2YPM A;  4OO4 A;  2H0G A;  1TP9 A;  3TCO A;  4Q5F A;  4F2I A;  1M9A A;  4IGJ A;  1YKC A;  3FHK A;  19GS A;  3C7M A;  3WT2 A;  4Q5N A;  2M72 A;  6GSY A;  4N11 A;  1K0D A;  4MF7 A;  2HSY A;  4WBR D;  1SK0 A;  3LFL A;  2B1K A;  3HHV A;  3LJR A;  1A0F A;  2H75 A;  4K7O A;  3Q74 A;  1GLQ A;  4JRR A;  2FNO A;  2NDO A;  1O8W A;  18GS A;  1TRS A;  3TRQ A;  3NZN A;  2EC4 A;  4MCU A;  3LWA A;  1ABA A;  1DSB A;  2X8H A;  4KH7 A;  1U6T A;  3GRX A;  1THX A;  1ERU A;  2FGX A;  3F6D A;  1JZO A;  3U6V A;  2BMX A;  5ECP B;  4H86 A;  3IPZ A;  4KX4 A;  9GSS A;  5B8B A;  2ES7 A;  4FH8 A;  4ZL7 A;  4BVX A;  1T4Z A;  4GSN A;  3RHC A;  1M99 A;  3CYN A;  2LEG A;  1E2Y A;  1PSQ A;  1QGV A;  4CHS A;  12GS A;  4V2L A;  1X5C A;  3HYP A;  2C0D A;  5IPG A;  3MAK A;  1TRU A;  2A2R A;  4D73 B;  1ZOF A;  3UOM A;  3UBK A;  4HZ2 A;  1B8X A;  2IWT A;  4MH2 A;  2GQM A;  2GQK A;  5B6M A;  4CW9 A;  4NWY A;  1TTZ A;  3W8S A;  4PUF C;  3EUR A;  3QPM A;  2YJ7 A;  2H0I A;  1Y25 A;  3DEX A;  1DE1 A;  2IMD A;  2E7P A;  2H66 A;  1Z3E A;  4PGT A;  1PX6 A;  5CAX A;  1V57 A;  3UIW A;  3BOA A;  4ZB8 A;  2FY6 A;  4TKY A;  4WBJ A;  2H1G A;  2YAN A;  3D4T A;  2AYT A;  3PGT A;  5D93 A;  1Q4J A;  1J08 A;  2LRN A;  2FA4 A;  4HI7 A;  1ZMA A;  3F0I A;  4GXZ A;  2DIZ A;  3ZFL A;  4YQM A;  4GQF A;  3FR9 A;  1RQM A;  4TR3 A;  2AHE A;  2LST A;  2A4V A;  1UC7 A;  3I6A A;  1KEB A;  5ABR A;  3E9J B;  1GUH A;  2WJU A;  2OE3 A;  3GH9 A;  3TJK A;  3UL3 A;  1XOB A;  1A2L A;  5CRG A;  3M3M A;  1YKA A;  3RHB A;  4KA0 A;  4XS6 A;  2GSR A;  1EP8 A;  4MK3 A;  5AGY A;  1O81 A;  2VCT A;  2C0F A;  1PRX A;  2WS2 A;  5A4U A;  3I9V 2;  3BCI A;  1U88 A;  2NTO A;  1I5G A;  3ZIV A;  3PIN A;  1TI1 A;  3V1W A;  2B3S A;  4LMW A;  3GHA A;  2GQL A;  5F05 A;  2L5O A;  3D22 A;  2DML A;  3UJ1 A;  3C73 A;  2R6K A;  3ZRD A;  2C3N A;  4HOJ A;  4ZB6 A;  3ZYW A;  4XHM A;  5IMZ A;  1YQ1 A;  4XS4 B;  3ERF A;  1ON4 A;  3TRX A;  4MP4 A;  3UBL A;  5JWO B;  3ZIT A;  1O73 A;  1YEX A;  1MTC A;  4K7N A;  2H19 A;  3TKR A;  5HFG A;  4XTS A;  2IN3 A;  5DDL A;  3VLN A;  4MJC A;  3WGX A;  2AB6 A;  3KXO A;  4G9H A;  1YF1 A;  4PUR A;  3VPQ A;  2V6K A;  4TR1 B;  4TR4 A;  3O6T A; 
#chains in the Genus database with same CATH topology
 2V2G A;  1FVK A;  3TKS E;  5EL8 A;  1X0R A;  4IEL A;  4GWR A;  3GH6 A;  4DEJ A;  5B8A A;  3LG6 A;  5JCG A;  3GIX A;  3MWH A;  2QSI A;  3HY2 A;  5DAL A;  1R5A A;  4ZIL A;  4XIH A;  1N8J A;  1MDK A;  2Z9S A;  4AJ6 A;  4IS0 A;  1PN0 A;  3IR4 A;  3ERG A;  1XOA A;  1EWX A;  3P90 A;  2AAW A;  1ZGN A;  3TKS A;  3DIE A;  3UEM A;  5HR0 A;  1N2A A;  2LS5 A;  4IW9 A;  2CV4 A;  5D9X A;  3M9K A;  5ECS A;  3KM6 A;  2WFC A;  3D4M A;  3VI7 A;  2VL3 A;  4TVE A;  2RLI A;  2A2P A;  1SD8 A;  4LLR A;  3M0F A;  1QK8 A;  2CVB A;  4TN8 A;  2ZNM A;  3GST A;  1M3I A;  4POB A;  4FYC A;  4F82 A;  3DVX A;  3VK9 A;  2WZ9 A;  1XFL A;  2V1M A;  3IC4 A;  2I81 A;  2B1L A;  2XBI A;  2EIQ A;  3L9S A;  1IYH A;  4ULX A;  1HD2 A;  1TXX A;  1XWB A;  3IDV A;  3A2V A;  4YQU A;  2DJ1 A;  4MJE A;  5ECQ B;  5D8I A;  2QKE A;  5B7C A;  2VLU A;  2PGT A;  3IE3 A;  5KOX A;  1OC9 B;  1K0O A;  1KTE A;  4L0W A;  2H70 A;  4F0C A;  1K0M A;  3VFI A;  2C0G A;  2K8S A;  2MBS A;  3IBH A;  4IJ3 A;  1TJD A;  4K8M A;  5J41 A;  3GTU A;  3P7X A;  3QFA C;  2REM A;  1QMV A;  1ERW A;  2LJA A;  4K0G A;  4EC0 A;  3FKF A;  2FUG 2;  3TOT A;  2L57 A;  3EU3 A;  2PN8 A;  3NOF A;  1ERV A;  4KDY A;  1TK0 B;  1Y6E A;  4NAX A;  2FCH A;  1QFN A;  5D96 A;  2O8V B;  1J0F A;  3JCM L;  3L0H A;  5CYY A;  2HRN A;  4WR5 A;  4PX1 A;  1Z5Y E;  2HZE B;  2JZT A;  5GST A;  1GSU A;  1WIK A;  4QL7 A;  1AUC A;  4KDX A;  2JL4 A;  1ST9 A;  4BL7 A;  1TU7 A;  5DVB A;  5G5F A;  4LL1 B;  4LMV A;  4EXJ A;  3FR3 A;  3UAP A;  2GGT A;  2L59 A;  3CSH A;  2A2S A;  5JWR B;  1XZO A;  2PUK C;  1XIY A;  1YJ6 A;  3GMF A;  1PGT A;  1SD9 A;  4J56 E;  3E3E A;  2YWO A;  2CX4 A;  4G0L A;  1EGR A;  4ZXG A;  6GSV A;  6GSX A;  3VWW A;  3ZTL A;  2EIO A;  1S3D A;  4EO3 A;  2VAF A;  1ACV A;  4JZQ A;  1CQH A;  1B4Q A;  3E0U A;  8GSS A;  3O76 A;  1GUL A;  3H8Q A;  5H5Q A;  4ZL9 A;  1JZW A;  1ZZY A;  6GST A;  1SKS B;  1GWC A;  1VF2 A;  5FT3 A;  2R0P A;  3DRN A;  2FWE A;  3VUR A;  3VI5 A;  2AUV A;  1ZYE A;  3HXS A;  3WT1 A;  2E0Q A;  3EMP A;  2VD1 A;  4ISD A;  3D0Z A;  4V1A p;  3RAZ A;  1Z6N A;  4DSS A;  2YWN A;  1NM3 A;  2B7J A;  3IV4 A;  2FA8 A;  4FYU A;  3A2W A;  1K0C A;  3GL3 A;  5D9V A;  3FEU A;  5H5R A;  5AIX A;  4ECJ A;  1XVW A;  1EZK A;  1R5P A;  1LU4 A;  1K0N A;  3W8J A;  1Z6M A;  1FG4 A;  4ZBD A;  5HQP A;  1SL1 B;  1GUK A;  2TRX A;  1X9M B;  5ECK B;  2H74 A;  5KN3 A;  4ML6 A;  3M1G A;  2P5Q A;  2NPB A;  5DJM A;  1WRY A;  2GT5 A;  1WMJ A;  4MDC A;  1XWA A;  2DIY A;  1PMT A;  5DBQ A;  1XBS A;  2GSS A;  2LJR A;  1BAY A;  4DSR A;  1BYE A;  2OA7 A;  1DUG A;  5D73 A;  2LRC A;  3O3T A;  3FYG A;  1OC3 A;  1A24 A;  2K6V A;  2N5B A;  3MYD A;  4YKG A;  5BRT A;  1U3A A;  3UMA A;  3H79 A;  5ENU A;  2ON5 A;  4Z7X A;  4L0U A;  4AF2 A;  4KB3 A;  3TJG A;  5DCG A;  3GN3 A;  3A2X A;  4QL9 A;  3APS A;  2TRC P;  5ECI B;  1MEK A;  1KBN A;  2L6C A;  5J5N A;  2DJ2 A;  3OR5 A;  4LA1 A;  2ZUP A;  3KD0 A;  4BVX B;  2C80 A;  5AIV A;  1BED A;  5AN1 A;  3CTF A;  4ZL8 A;  2IPA A;  2JAD A;  3EC3 A;  2RM5 A;  1JZD A;  3HVN A;  5G5E A;  4K5R A;  5HR2 A;  5J3R A;  4KW6 A;  3A5W A;  3N9J A;  2DSA A;  2JU5 A;  1XXU A;  4K9Z A;  1B9Y C;  3TJJ A;  4WXT A;  5LCZ A;  1AW9 A;  4I2T A;  2BTO T;  5ELA A;  4IJI A;  3UAR A;  1MDJ A;  2VL9 A;  1F37 A;  1K0A A;  4POL A;  3GFK A;  2RUE A;  2M46 A;  1T8E B;  2PMT A;  3I69 A;  5G30 A;  1K0B A;  3TUE A;  4K1F A;  4ECB A;  4TXV A;  3A3T A;  2VL2 A;  1XWG A;  1TW9 A;  5HFK A;  4KUN A;  3ME7 A;  3IRA A;  5CP1 A;  2OKA A;  1QUW A;  3ZFB A;  3AY8 A;  4USS A;  3TGZ A;  2G2Q A;  2WGR A;  1EP7 A;  3LXT A;  4G0K A;  1FW1 A;  1PA3 A;  1SJZ A;  5HFI A;  2G0F A;  3CRU A;  1YF0 A;  5IOX A;  4IVF A;  2DJ3 A;  1X9S B;  3C1S A;  1OYJ A;  1QQ2 A;  3DXB A;  4JED A;  5EPF A;  5J4U A;  4GSS A;  1PD2 1;  4EUY A;  2H73 A;  1K3L A;  2GLR A;  2FWF A;  3ERW A;  1HQO A;  1OKD A;  2VM1 A;  4V2M A;  5IMD A;  3LQ7 A;  5G2Z A;  2MMN A;  4RI7 A;  2CAQ A;  4L5L A;  4EIP A;  2PVO C;  3J7Y b;  3ED3 A;  3FK8 A;  5JCW A;  5IIZ A;  1SKR B;  4IP1 A;  4J2F A;  3ZIJ A;  5IMV A;  2BJX A;  1M2A A;  3CTG A;  3QAW A;  5G1L A;  3Q18 A;  1U3I A;  1YEP A;  5KEJ A;  2DBC A;  4GLT A;  1EOH A;  5DQY A;  2R4V A;  3H1N A;  3EE2 A;  1GSE A;  3BCK A;  5F8B A;  1R26 A;  1XVQ A;  3I43 A;  2DJJ A;  4BWQ A;  1F9M A;  4ZBB A;  4KCE A;  1VF3 A;  2VLT A;  3DWV A;  2XPD A;  3TKP A;  1O8X A;  3KTB A;  2HI7 A;  2O89 A;  2B7K A;  4NMU A;  3ZML A;  2ZCT A;  3TRP A;  3D5J A;  1J9B A;  5IQY A;  2VUP A;  4E8H A;  1G7O A;  2L5L A;  4O5R A;  1GTI A;  4N0Z A;  1H4O A;  3HZ8 A;  4CDO A;  2L6D A;  4PNF A;  1HNC A;  2FWH A;  1M2D A;  2H1D A;  4N30 A;  2NBS A;  3EPT A;  5DAK A;  4GQC A;  3WGE A;  4WKW A;  1V58 A;  1USB A;  3CBU A;  4WET A;  4MPG A;  3HZ4 A;  2VIM A;  2OAC A;  3ZZX A;  2F3M A;  3FZ5 A;  2GTU A;  2CVD A;  2KP2 A;  2VL2 C;  4MPF A;  4PQ1 A;  3DKS A;  2DLX A;  3GKX A;  3SBC A;  1QXH A;  2F9S A;  2R2J A;  2HRA A;  2H6Z A;  4POK A;  4K2X A;  2XPE A;  2WRT A;  5E4W A;  4HEA 2;  3LXZ A;  2X8C A;  3GYK A;  3C1R A;  3PR8 A;  3L4N A;  4AJ8 A;  3TDG A;  5DAL B;  4EVM A;  4ICY A;  2LTK A;  2P5R A;  2GZY A;  4WF4 A;  1A8Y A;  1WJK A;  3FW2 A;  4MZC A;  2GZP A;  2IFQ A;  4K7I A;  2O87 A;  1JHB A;  1THO A;  1FO5 A;  4HSC X;  5F07 A;  1B4P A;  4WEY A;  3LGC A;  1ZYQ B;  1SKW B;  2IMF A;  2V32 A;  4KND A;  4K2D A;  4KSM A;  1A23 A;  5IPH A;  1AQW A;  1XWK A;  2C4J A;  4MF5 A;  4HUA A;  1B9X C;  1GSQ A;  2DJ0 A;  2I4A A;  4XRA A;  2H6X A;  3HKR A;  1NW2 A;  2YN1 A;  2VM2 A;  3F3Q A;  5CRE A;  3L9V A;  1V9W A;  3DGQ A;  1XW9 A;  2XHF A;  1EEM A;  2UZ8 A;  3FRC A;  4ECI A;  5CRD A;  1OAZ A;  2KLX A;  2M80 A;  3D21 A;  3CSI A;  7GSS A;  2XC2 A;  1TDI A;  1F2E A;  5ECL B;  3VPT A;  1T3B A;  1ML6 A;  5EVO A;  2B6M A;  1EV9 A;  3EYT A;  1MD4 A;  2IL3 A;  1VF1 A;  1Z7R A;  2RUF A;  2NVL A;  3NIV A;  5IMF A;  1A0R P;  4EDZ A;  3KJY A;  3ME8 A;  3EIN A;  2CT6 A;  2YWM A;  3KP8 A;  3GTU B;  4OMV A;  4DSQ A;  3N5O A;  2P0G A;  3QR6 A;  1F3B A;  2C3Q A;  4OCF A;  3KGK A;  2X8G A;  4L8E A;  1GLP A;  3DYR A;  1SU9 A;  5J9C A;  2C8U A;  2R0C A;  4I2U A;  5ECR B;  3EMX A;  2GZZ A;  4PUA A;  5KN1 A;  2VD0 A;  4JE1 A;  3QMX A;  5IM9 A;  1S3A A;  2HRF A;  3HDC A;  3LOR A;  4ZB9 A;  5IMC A;  2K9F A;  5ID2 A;  2CVK A;  1HNA A;  4FO5 A;  1OVN A;  3CQF A;  3ZLP A;  5ECH B;  3VWV A;  2ALB A;  2E2G A;  3APO A;  4BL7 B;  4ZBA A;  3M8N A;  4WF5 A;  5B6N A;  1FOV A;  2VLV A;  1ZCP A;  2X4A A;  1WWJ A;  1I9D A;  1TI3 A;  3K8N A;  1E6B A;  2LRT A;  3KH9 A;  5L71 A;  4MAB A;  1S3C A;  1XPV A;  4GTU A;  4HJM A;  2C1Y A;  2TIR A;  1FOH A;  2JSY A;  1GSF A;  2C3T A;  4X0X A;  1GRX A;  4HJ2 A;  2LV3 A;  4ML1 A;  3C8E A;  2JZR A;  2OE1 A;  3TKQ A;  1SJI A;  2YWI A;  4GCI A;  2K8V A;  4PXO A;  2GSQ A;  3F9U A;  4G2E A;  3R3E A;  4OO5 A;  1PL2 A;  3L9U A;  1GNW A;  3KEB A;  1XG8 A;  5FWG A;  2VCV A;  1G6Y A;  5IO2 A;  4MA9 A;  2N5F A;  1UN2 A;  5DJL A;  1X5E A;  1AC1 A;  2LUS A;  3MIX A;  1EGO A;  5AIS A;  3P2A A;  4ZIJ A;  2R5G A;  4BPY A;  1IYI A;  3KH7 A;  4GF0 A;  4MZW A;  3P8W A;  3PH9 A;  2X64 A;  3KTL A;  5ECN B;  4IBP A;  1PKW A;  1BX9 A;  4OFM A;  4KF9 A;  4DSS B;  1GSY A;  1UVZ A;  3GKK A;  3KZQ A;  4RUV A;  3HVS A;  2MMO A;  2DKH A;  1NSW A;  3RDW A;  3TB2 A;  3ZMK A;  4MJA A;  4RQR A;  2LKU A;  2DMM A;  1ZYN A;  5C00 A;  3GX0 A;  3BJ5 A;  5A4W A;  1AQV A;  5CRW A;  3VWU A;  1AIU A;  1SYX A;  3GX8 A;  3GUR A;  4PQH A;  4I97 A;  2H6Y A;  2J9H A;  2X49 A;  4Q5Q A;  2HRK A;  3EU4 A;  2JSZ A;  2KP1 A;  5FHI A;  4YH2 A;  3G7I A;  2ON7 A;  3QD9 A;  4XRD A;  2VO4 A;  6GSW A;  4NHZ A;  4L5O A;  4NHW A;  3HCZ A;  4HZ4 A;  2VCX A;  1PX7 A;  1FB0 A;  2CQ9 A;  2OBK A;  2RM6 A;  1B48 A;  3A5I A;  3RPN A;  1XWC A;  4HS1 A;  3F4T A;  4LL4 B;  5D9T A;  2LNS A;  1JFU A;  1WE0 A;  3TOU A;  4X1U A;  3SWL A;  4MF6 A;  4TXO A;  3ZRE A;  4HQZ A;  4BWS A;  1S3R A;  2YV9 A;  3MDK A;  3GUS A;  3F63 A;  4HU7 A;  1Z7P A;  1M0U A;  3UVH A;  3DML A;  1EV4 A;  3L78 A;  4TXO B;  3U5R E;  3ZVJ A;  2B5X A;  2I3Y A;  2N5A A;  5EY6 A;  3RPP A;  1FB6 A;  1EOG A;  1AXD A;  5GZZ B;  3CMI A;  4OFN A;  10GS A;  1SL0 B;  1R4W A;  3DD3 A;  4E8E A;  1W4V A;  1G6W A;  4MMM A;  3HA9 A;  2HE3 A;  4V1A g;  4P3Y B;  5DQS A;  4BA7 A;  4D73 A;  3MNG A;  3FZ4 A;  5ECO B;  2GS3 A;  5DCH A;  4QQ7 A;  1GUM A;  1X5D A;  3HVV A;  3QFB C;  2B5E A;  2XBQ A;  4JR4 A;  1GTA A;  1YZX A;  4N0V A;  2RII A;  3S9F A;  2FD3 A;  4V2N A;  5INY A;  4MLY A;  1A2J A;  4Z2T A;  4AGS A;  4POM A;  2GT6 A;  1GP1 A;  4J57 E;  4NXI A;  5CNW A;  4IQA A;  5IO0 A;  2PER A;  4FIW A;  2HZF A;  2YNX A;  3IHG A;  3D6I A;  3EWL A;  2YCD A;  4JBB A;  3KMO A;  2HFD A;  2IMK A;  2AV4 A;  4Q5R A;  2IJY A;  2MMA A;  4GST A;  2LQQ A;  1A8L A;  2QGV A;  1LBK A;  3KIJ A;  2KHP A;  2F8A A;  4ECC A;  2L4C A;  2QA2 A;  2EIR A;  5JCU A;  2FHE A;  1DE2 A;  2MBT A;  1SEN A;  2GVP A;  1FVJ A;  4KE3 A;  2WUL A;  3PPU A;  2R0G A;  5C04 A;  1ZL9 A;  1LJR A;  1X9W B;  3WD6 A;  3GV1 A;  3HJO A;  1EEJ A;  4NPB A;  2CAI A;  1O7U A;  4BIK A;  1TK8 B;  16GS A;  2A4H A;  13GS A;  2V6O A;  2CZ3 A;  4G0I A;  6GSU A;  1GTU A;  1CQG A;  2H01 A;  2MYG A;  2VOC A;  1OE8 A;  2QC7 A;  4G10 A;  1FHE A;  1NHO A;  5J9B A;  2JAC A;  5LD0 A;  2PU9 C;  5GSS A;  1C72 A;  3GA4 A;  1ZYP A;  5F06 A;  4PNG A;  1GSS A;  1YDK A;  1W89 A;  3GNJ A;  3LSZ A;  3QDN A;  1T4Y A;  1A2M A;  2H8L A;  4MH3 A;  3F3R A;  4XS4 A;  3H93 A;  4EIQ A;  1T7P B;  4YQV A;  3R2Q A;  4EE0 A;  3HD5 A;  4IN0 A;  3FZ9 A;  1RW1 A;  3HJM A;  4I5Q A;  2HNL A;  2HSH A;  2OAD A;  3HVX A;  1SJ6 A;  4HU9 A;  5G31 A;  4OD7 A;  1M2B A;  5CRH A;  5DAK B;  1VRS D;  1VGL A;  2I9H A;  1AQX A;  1MD3 A;  2O85 A;  3HJP A;  4TR1 A;  4K0N A;  4O7H A;  1NHY A;  4OCE A;  4YAP A;  4DVC A;  2KOK A;  3BBY A;  4OFT A;  3LYK A;  4TR0 A;  1ILO A;  2F51 A;  1TU8 A;  2H76 A;  1TKD B;  3TJF A;  3APQ A;  1TK5 B;  14GS A;  1HYU A;  4ILF A;  1SL2 B;  5IMA A;  4IKH A;  1TOF A;  3F4S A;  1V2A A;  1GL8 A;  3IOS A;  2R37 A;  1DBY A;  5GAP D;  2AJQ B;  3W6G A;  2R3X A;  4ID0 A;  3G9B A;  2MMZ A;  1OC8 A;  1JLW A;  1TRW A;  4RQX A;  1WP0 A;  4A5P A;  1VF4 A;  1WPI A;  1OKT A;  1PN9 A;  3G7Y A;  4K5S A;  1ERT A;  5E59 A;  4O32 A;  1G0T A;  2OE0 A;  2KUC A;  2LJK A;  3CSJ A;  1OE7 A;  1PFO A;  4HQS A;  2H72 A;  2IFQ B;  3FY7 A;  3WGD A;  1F6M C;  22GS A;  4KGI A;  1YY7 A;  5COH A;  2JZS A;  2D2Z A;  3IAM 2;  2YJH A;  1H75 A;  2O7K A;  3LEF A;  3M9J A;  3WYW A;  5HR3 A;  3ZL5 A;  3QCP A;  4MNN A;  2YV7 A;  3F4R A;  4I8B A;  5LNK e;  5GAN D;  3C71 A;  3F8U A;  1GSD A;  3EVI A;  5KN0 A;  5BMU A;  2IME A;  3G7J A;  2LNT A;  2V41 A;  2H0H A;  5CO3 A;  3IHQ A;  4JU5 A;  2OJL A;  2IIY A;  1XW5 A;  4MJB A;  5D9W A;  1F3A A;  1GNE A;  1V98 A;  1OC9 A;  2DC5 A;  4EL1 A;  4JR6 A;  4I6X A;  4F9Z A;  1URM A;  3IK9 A;  2PBJ A;  1BQ7 A;  3J7Y k;  1U87 A;  2FWG A;  1GH2 A;  4EKZ A;  5A4V A;  1FAA A;  2OBI A;  4IQ1 A;  4PQI A;  2MZC A;  4K6X A;  2VCQ A;  1JZR A;  20GS A;  1PKZ A;  2YZU A;  2LQO A;  4GRF A;  4RI6 A;  2HLS A;  2GDR A;  4YAV A;  4MZB A;  5JWQ B;  4TOP A;  3IK7 A;  4CY8 A;  3DVW A;  1JLV A;  4AJ7 A;  3Q6O A;  4XS1 A;  3FR6 A;  1HNB A;  2H1B A;  1K3O A;  1SYR A;  1O6J A;  2HT9 A;  1XW6 A;  2VCZ A;  3QOU A;  4KAE A;  4NV2 A;  2CZ2 A;  2C0E A;  3FZA A;  2K18 A;  3KMN A;  4HDE A;  4FYB A;  3CXG A;  2HZE A;  4X4J A;  1TRV A;  1PL1 A;  1WOU A;  4KCA A;  2HSM A;  2B5Y A;  2WDU A;  4G19 A;  5A5K A;  1XCC A;  2WB9 A;  2IMI A;  1AAZ A;  4IHU A;  4KSO A;  5ID2 B;  3GKN A;  3IXR A;  5KN2 A;  2YP6 A;  2PVQ A;  2L4Q A;  2I1U A;  3RBT A;  4BVY A;  5G1K A;  2WCI A;  5ELG A;  2P31 A;  4Z2U A;  2E2M A;  1K3Y A;  4O5U A;  3IAS 2;  17GS A;  1GTB A;  4BVY B;  3TJB A;  4KDU A;  3TKS C;  1SK2 A;  4F0B A;  2YOI A;  3KP9 A;  1M9B A;  3CRT A;  5KOW A;  2YZH A;  4F03 A;  3ISO A;  2CA8 A;  3F6F A;  6GSS A;  2VCW A;  1R7H A;  4X43 A;  5IOW A;  2PPT A;  1M7T A;  1MDI A;  5ECM B;  2F8F A;  3IA1 A;  1T00 A;  3Q19 A;  2H30 A;  3UVT A;  11GS A;  1BG5 A;  2PWJ A;  4ACS A;  4NV5 A;  2H71 A;  1V40 A;  1KNG A;  4TW5 A;  4WR4 A;  4O92 A;  4EDY A;  3ZVJ D;  3LYP A;  2X99 A;  4PTS A;  2FLS A;  2GST A;  3GL5 A;  3GSS A;  4OWY A;  3BD2 A;  5F0G A;  1O85 A;  1UA5 A;  3VWX A;  2H1A A;  3KCM A;  5HR1 A;  3GKM A;  2HYX A;  2DJK A;  1PQN A;  1Q98 A;  1BJX A;  2HXK A;  3QAV A;  1Z9H A;  3US3 A;  4XCS A;  4IP6 A;  1T1V A;  1G7E A;  3MSZ A;  1SK1 A;  5H5S A;  2J23 A;  4TRX A;  3QAG A;  4EF0 A;  4N10 A;  2CX3 A;  3H4K A;  1RK4 A;  2YPM A;  4OO4 A;  2H0G A;  1TP9 A;  3TCO A;  4Q5F A;  4F2I A;  1M9A A;  4IGJ A;  1YKC A;  3FHK A;  19GS A;  3C7M A;  3WT2 A;  4Q5N A;  2M72 A;  6GSY A;  4N11 A;  1K0D A;  4MF7 A;  2HSY A;  4WBR D;  1SK0 A;  3LFL A;  2B1K A;  3HHV A;  3LJR A;  1A0F A;  2H75 A;  4K7O A;  3Q74 A;  1GLQ A;  4JRR A;  2FNO A;  2NDO A;  1O8W A;  18GS A;  1TRS A;  3TRQ A;  3NZN A;  2EC4 A;  4MCU A;  3LWA A;  1ABA A;  1DSB A;  2X8H A;  4KH7 A;  1U6T A;  3GRX A;  1THX A;  1ERU A;  2FGX A;  3F6D A;  1JZO A;  3U6V A;  2BMX A;  5ECP B;  4H86 A;  3IPZ A;  4KX4 A;  9GSS A;  5B8B A;  2ES7 A;  4FH8 A;  4ZL7 A;  4BVX A;  3FMW A;  1T4Z A;  3IC8 A;  4GSN A;  3RHC A;  1M99 A;  3CYN A;  2LEG A;  1E2Y A;  1PSQ A;  1QGV A;  4CHS A;  12GS A;  4Z2R A;  4V2L A;  3LW9 A;  1X5C A;  3HYP A;  2C0D A;  5IPG A;  3MAK A;  1TRU A;  2A2R A;  4D73 B;  1ZOF A;  3UOM A;  3UBK A;  4HZ2 A;  1B8X A;  2IWT A;  4MH2 A;  2GQM A;  2GQK A;  5B6M A;  4CW9 A;  4NWY A;  1TTZ A;  3W8S A;  4PUF C;  3EUR A;  3QPM A;  2YJ7 A;  2H0I A;  1Y25 A;  3DEX A;  1DE1 A;  2IMD A;  2E7P A;  2H66 A;  1Z3E A;  4PGT A;  1PX6 A;  5CAX A;  1V57 A;  3UIW A;  3BOA A;  4ZB8 A;  2FY6 A;  4TKY A;  4WBJ A;  2H1G A;  4YKF A;  2YAN A;  3D4T A;  4CY6 A;  2AYT A;  3PGT A;  5D93 A;  1Q4J A;  1J08 A;  2LRN A;  2FA4 A;  4HI7 A;  1ZMA A;  3F0I A;  4GXZ A;  2DIZ A;  3ZFL A;  4YQM A;  4GQF A;  3FR9 A;  1RQM A;  4TR3 A;  2AHE A;  2DKI A;  2LST A;  2A4V A;  1UC7 A;  3I6A A;  1KEB A;  5ABR A;  3E9J B;  1GUH A;  2WJU A;  2OE3 A;  3GH9 A;  3TJK A;  3UL3 A;  1XOB A;  1A2L A;  5CRG A;  3M3M A;  1YKA A;  3RHB A;  4KA0 A;  4XS6 A;  2GSR A;  1EP8 A;  4MK3 A;  5AGY A;  1O81 A;  2VCT A;  2C0F A;  1PRX A;  2WS2 A;  5A4U A;  3I9V 2;  3BCI A;  1U88 A;  2NTO A;  1I5G A;  3ZIV A;  3PIN A;  1TI1 A;  3V1W A;  4O5Q A;  1M3J A;  2B3S A;  4LMW A;  3GHA A;  2GQL A;  5F05 A;  2L5O A;  3D22 A;  2DML A;  3UJ1 A;  3C73 A;  2R6K A;  3ZRD A;  2C3N A;  4HOJ A;  4ZB6 A;  3ZYW A;  4FQU A;  4XHM A;  5IMZ A;  1YQ1 A;  4XS4 B;  3ERF A;  1ON4 A;  3TRX A;  4MP4 A;  3UBL A;  5JWO B;  3ZIT A;  1O73 A;  1YEX A;  1MTC A;  4K7N A;  2H19 A;  3TKR A;  5HFG A;  4XTS A;  2IN3 A;  5DDL A;  3VLN A;  4MJC A;  3WGX A;  2QA1 A;  2AB6 A;  3KXO A;  4G9H A;  1YF1 A;  4PUR A;  3VPQ A;  4TR4 A;  2V6K A;  4TR1 B;  3O6T A; 
#chains in the Genus database with same CATH homology
 2V2G A;  1FVK A;  3TKS E;  5EL8 A;  1X0R A;  4IEL A;  4GWR A;  3GH6 A;  4DEJ A;  5B8A A;  3LG6 A;  5JCG A;  3GIX A;  3MWH A;  2QSI A;  3HY2 A;  5DAL A;  1R5A A;  4ZIL A;  4XIH A;  1N8J A;  1MDK A;  2Z9S A;  4AJ6 A;  4IS0 A;  1PN0 A;  3IR4 A;  3ERG A;  1XOA A;  1EWX A;  3P90 A;  2AAW A;  1ZGN A;  3TKS A;  3DIE A;  3UEM A;  5HR0 A;  1N2A A;  2LS5 A;  4IW9 A;  2CV4 A;  5D9X A;  3M9K A;  5ECS A;  3KM6 A;  2WFC A;  3D4M A;  3VI7 A;  2VL3 A;  4TVE A;  2RLI A;  2A2P A;  1SD8 A;  4LLR A;  3M0F A;  1QK8 A;  2CVB A;  4TN8 A;  2ZNM A;  3GST A;  4POB A;  4FYC A;  4F82 A;  3DVX A;  3VK9 A;  2WZ9 A;  1XFL A;  2V1M A;  3IC4 A;  2I81 A;  2B1L A;  2XBI A;  2EIQ A;  3L9S A;  1IYH A;  4ULX A;  1HD2 A;  1TXX A;  1XWB A;  3IDV A;  3A2V A;  4YQU A;  2DJ1 A;  4MJE A;  5ECQ B;  5D8I A;  2QKE A;  5B7C A;  2VLU A;  2PGT A;  3IE3 A;  5KOX A;  1OC9 B;  1K0O A;  1KTE A;  4L0W A;  2H70 A;  4F0C A;  1K0M A;  3VFI A;  2C0G A;  2K8S A;  2MBS A;  3IBH A;  4IJ3 A;  1TJD A;  4K8M A;  5J41 A;  3GTU A;  3P7X A;  3QFA C;  2REM A;  1QMV A;  1ERW A;  2LJA A;  4K0G A;  4EC0 A;  3FKF A;  2FUG 2;  3TOT A;  2L57 A;  3EU3 A;  2PN8 A;  3NOF A;  1ERV A;  4KDY A;  1TK0 B;  1Y6E A;  4NAX A;  2FCH A;  1QFN A;  5D96 A;  2O8V B;  1J0F A;  3JCM L;  3L0H A;  5CYY A;  2HRN A;  4WR5 A;  4PX1 A;  1Z5Y E;  2HZE B;  2JZT A;  5GST A;  1GSU A;  1WIK A;  4QL7 A;  1AUC A;  4KDX A;  2JL4 A;  1ST9 A;  4BL7 A;  1TU7 A;  5DVB A;  5G5F A;  4LL1 B;  4LMV A;  4EXJ A;  3FR3 A;  3UAP A;  2GGT A;  2L59 A;  3CSH A;  2A2S A;  5JWR B;  1XZO A;  2PUK C;  1XIY A;  1YJ6 A;  3GMF A;  1PGT A;  1SD9 A;  4J56 E;  3E3E A;  2YWO A;  2CX4 A;  4G0L A;  1EGR A;  4ZXG A;  6GSV A;  6GSX A;  3VWW A;  3ZTL A;  2EIO A;  1S3D A;  4EO3 A;  2VAF A;  1ACV A;  4JZQ A;  1CQH A;  1B4Q A;  3E0U A;  8GSS A;  3O76 A;  1GUL A;  3H8Q A;  5H5Q A;  4ZL9 A;  1JZW A;  1ZZY A;  6GST A;  1SKS B;  1GWC A;  1VF2 A;  5FT3 A;  2R0P A;  3DRN A;  2FWE A;  3VUR A;  3VI5 A;  2AUV A;  1ZYE A;  3HXS A;  3WT1 A;  2E0Q A;  3EMP A;  2VD1 A;  4ISD A;  3D0Z A;  4V1A p;  3RAZ A;  1Z6N A;  4DSS A;  2YWN A;  1NM3 A;  2B7J A;  3IV4 A;  2FA8 A;  4FYU A;  3A2W A;  1K0C A;  3GL3 A;  5D9V A;  3FEU A;  5H5R A;  5AIX A;  4ECJ A;  1XVW A;  1EZK A;  1R5P A;  1LU4 A;  1K0N A;  3W8J A;  1Z6M A;  1FG4 A;  4ZBD A;  5HQP A;  1SL1 B;  1GUK A;  2TRX A;  1X9M B;  5ECK B;  2H74 A;  5KN3 A;  4ML6 A;  3M1G A;  2P5Q A;  2NPB A;  5DJM A;  1WRY A;  2GT5 A;  1WMJ A;  4MDC A;  1XWA A;  2DIY A;  1PMT A;  5DBQ A;  1XBS A;  2GSS A;  2LJR A;  1BAY A;  4DSR A;  1BYE A;  2OA7 A;  1DUG A;  5D73 A;  2LRC A;  3O3T A;  3FYG A;  1OC3 A;  1A24 A;  2K6V A;  2N5B A;  3MYD A;  4YKG A;  5BRT A;  1U3A A;  3UMA A;  3H79 A;  5ENU A;  2ON5 A;  4Z7X A;  4L0U A;  4AF2 A;  4KB3 A;  3TJG A;  5DCG A;  3GN3 A;  3A2X A;  4QL9 A;  3APS A;  2TRC P;  5ECI B;  1MEK A;  1KBN A;  2L6C A;  5J5N A;  2DJ2 A;  3OR5 A;  4LA1 A;  2ZUP A;  3KD0 A;  4BVX B;  2C80 A;  5AIV A;  1BED A;  5AN1 A;  3CTF A;  4ZL8 A;  2IPA A;  2JAD A;  3EC3 A;  2RM5 A;  1JZD A;  5G5E A;  4K5R A;  5HR2 A;  5J3R A;  4KW6 A;  3A5W A;  3N9J A;  2DSA A;  2JU5 A;  1XXU A;  4K9Z A;  1B9Y C;  3TJJ A;  4WXT A;  5LCZ A;  1AW9 A;  4I2T A;  2BTO T;  5ELA A;  4IJI A;  3UAR A;  1MDJ A;  2VL9 A;  1F37 A;  1K0A A;  4POL A;  3GFK A;  2RUE A;  2M46 A;  1T8E B;  2PMT A;  3I69 A;  5G30 A;  1K0B A;  3TUE A;  4K1F A;  4ECB A;  4TXV A;  3A3T A;  2VL2 A;  1XWG A;  1TW9 A;  5HFK A;  4KUN A;  3ME7 A;  3IRA A;  5CP1 A;  2OKA A;  1QUW A;  3ZFB A;  3AY8 A;  4USS A;  3TGZ A;  2G2Q A;  2WGR A;  1EP7 A;  3LXT A;  4G0K A;  1FW1 A;  1PA3 A;  1SJZ A;  5HFI A;  2G0F A;  3CRU A;  1YF0 A;  5IOX A;  4IVF A;  2DJ3 A;  1X9S B;  3C1S A;  1OYJ A;  1QQ2 A;  3DXB A;  4JED A;  5EPF A;  5J4U A;  4GSS A;  1PD2 1;  4EUY A;  2H73 A;  1K3L A;  2GLR A;  2FWF A;  3ERW A;  1HQO A;  1OKD A;  2VM1 A;  4V2M A;  5IMD A;  3LQ7 A;  5G2Z A;  2MMN A;  4RI7 A;  2CAQ A;  4L5L A;  4EIP A;  2PVO C;  3J7Y b;  3ED3 A;  3FK8 A;  5JCW A;  5IIZ A;  1SKR B;  4IP1 A;  4J2F A;  3ZIJ A;  5IMV A;  2BJX A;  1M2A A;  3CTG A;  3QAW A;  5G1L A;  3Q18 A;  1U3I A;  1YEP A;  5KEJ A;  2DBC A;  4GLT A;  1EOH A;  5DQY A;  2R4V A;  3H1N A;  3EE2 A;  1GSE A;  3BCK A;  5F8B A;  1R26 A;  1XVQ A;  3I43 A;  2DJJ A;  4BWQ A;  1F9M A;  4ZBB A;  4KCE A;  1VF3 A;  2VLT A;  3DWV A;  2XPD A;  3TKP A;  1O8X A;  3KTB A;  2HI7 A;  2O89 A;  2B7K A;  4NMU A;  3ZML A;  2ZCT A;  3TRP A;  3D5J A;  1J9B A;  5IQY A;  2VUP A;  4E8H A;  1G7O A;  2L5L A;  4O5R A;  1GTI A;  4N0Z A;  1H4O A;  3HZ8 A;  4CDO A;  2L6D A;  4PNF A;  1HNC A;  2FWH A;  1M2D A;  2H1D A;  4N30 A;  2NBS A;  3EPT A;  5DAK A;  4GQC A;  3WGE A;  4WKW A;  1V58 A;  1USB A;  3CBU A;  4WET A;  4MPG A;  3HZ4 A;  2VIM A;  2OAC A;  3ZZX A;  2F3M A;  3FZ5 A;  2GTU A;  2CVD A;  2KP2 A;  2VL2 C;  4MPF A;  4PQ1 A;  3DKS A;  2DLX A;  3GKX A;  3SBC A;  1QXH A;  2F9S A;  2R2J A;  2HRA A;  2H6Z A;  4POK A;  4K2X A;  2XPE A;  2WRT A;  5E4W A;  4HEA 2;  3LXZ A;  2X8C A;  3GYK A;  3C1R A;  3PR8 A;  3L4N A;  4AJ8 A;  3TDG A;  5DAL B;  4EVM A;  4ICY A;  2LTK A;  2P5R A;  2GZY A;  4WF4 A;  1A8Y A;  1WJK A;  3FW2 A;  4MZC A;  2GZP A;  2IFQ A;  4K7I A;  2O87 A;  1JHB A;  1THO A;  1FO5 A;  5F07 A;  1B4P A;  4WEY A;  3LGC A;  1ZYQ B;  1SKW B;  2IMF A;  2V32 A;  4KND A;  4K2D A;  4KSM A;  1A23 A;  5IPH A;  1AQW A;  1XWK A;  2C4J A;  4MF5 A;  4HUA A;  1B9X C;  1GSQ A;  2DJ0 A;  2I4A A;  4XRA A;  2H6X A;  3HKR A;  1NW2 A;  2YN1 A;  2VM2 A;  3F3Q A;  5CRE A;  3L9V A;  1V9W A;  3DGQ A;  1XW9 A;  2XHF A;  1EEM A;  2UZ8 A;  3FRC A;  4ECI A;  5CRD A;  1OAZ A;  2KLX A;  2M80 A;  3D21 A;  3CSI A;  7GSS A;  2XC2 A;  1TDI A;  1F2E A;  5ECL B;  3VPT A;  1T3B A;  1ML6 A;  5EVO A;  2B6M A;  1EV9 A;  3EYT A;  1MD4 A;  2IL3 A;  1VF1 A;  1Z7R A;  2RUF A;  2NVL A;  3NIV A;  5IMF A;  1A0R P;  4EDZ A;  3KJY A;  3ME8 A;  3EIN A;  2CT6 A;  2YWM A;  3KP8 A;  3GTU B;  4OMV A;  4DSQ A;  3N5O A;  2P0G A;  3QR6 A;  1F3B A;  2C3Q A;  4OCF A;  3KGK A;  2X8G A;  4L8E A;  1GLP A;  3DYR A;  1SU9 A;  5J9C A;  2C8U A;  2R0C A;  4I2U A;  5ECR B;  3EMX A;  2GZZ A;  4PUA A;  5KN1 A;  2VD0 A;  4JE1 A;  3QMX A;  5IM9 A;  1S3A A;  2HRF A;  3HDC A;  3LOR A;  4ZB9 A;  5IMC A;  2K9F A;  5ID2 A;  2CVK A;  1HNA A;  4FO5 A;  1OVN A;  3ZLP A;  5ECH B;  3VWV A;  2ALB A;  2E2G A;  3APO A;  4BL7 B;  4ZBA A;  3M8N A;  4WF5 A;  5B6N A;  1FOV A;  2VLV A;  1ZCP A;  2X4A A;  1WWJ A;  1I9D A;  1TI3 A;  3K8N A;  1E6B A;  2LRT A;  3KH9 A;  5L71 A;  4MAB A;  1S3C A;  1XPV A;  4GTU A;  4HJM A;  2C1Y A;  2TIR A;  1FOH A;  2JSY A;  1GSF A;  2C3T A;  4X0X A;  1GRX A;  4HJ2 A;  2LV3 A;  4ML1 A;  3C8E A;  2JZR A;  2OE1 A;  3TKQ A;  1SJI A;  2YWI A;  4GCI A;  2K8V A;  4PXO A;  2GSQ A;  3F9U A;  4G2E A;  3R3E A;  4OO5 A;  1PL2 A;  3L9U A;  1GNW A;  3KEB A;  5FWG A;  2VCV A;  1G6Y A;  5IO2 A;  4MA9 A;  2N5F A;  1UN2 A;  5DJL A;  1X5E A;  1AC1 A;  2LUS A;  3MIX A;  1EGO A;  5AIS A;  3P2A A;  4ZIJ A;  2R5G A;  4BPY A;  1IYI A;  3KH7 A;  4GF0 A;  4MZW A;  3P8W A;  3PH9 A;  2X64 A;  3KTL A;  5ECN B;  4IBP A;  1PKW A;  1BX9 A;  4OFM A;  4KF9 A;  4DSS B;  1GSY A;  1UVZ A;  3GKK A;  3KZQ A;  4RUV A;  3HVS A;  2MMO A;  2DKH A;  1NSW A;  3RDW A;  3TB2 A;  3ZMK A;  4MJA A;  4RQR A;  2LKU A;  2DMM A;  1ZYN A;  5C00 A;  3GX0 A;  3BJ5 A;  5A4W A;  1AQV A;  5CRW A;  3VWU A;  1AIU A;  1SYX A;  3GX8 A;  3GUR A;  4PQH A;  4I97 A;  2H6Y A;  2J9H A;  2X49 A;  4Q5Q A;  2HRK A;  3EU4 A;  2JSZ A;  2KP1 A;  5FHI A;  4YH2 A;  3G7I A;  2ON7 A;  3QD9 A;  4XRD A;  2VO4 A;  6GSW A;  4NHZ A;  4L5O A;  4NHW A;  3HCZ A;  4HZ4 A;  2VCX A;  1PX7 A;  1FB0 A;  2CQ9 A;  2OBK A;  2RM6 A;  1B48 A;  3A5I A;  3RPN A;  1XWC A;  4HS1 A;  3F4T A;  4LL4 B;  5D9T A;  2LNS A;  1JFU A;  1WE0 A;  3TOU A;  4X1U A;  3SWL A;  4MF6 A;  4TXO A;  3ZRE A;  4HQZ A;  4BWS A;  3MDK A;  2YV9 A;  3GUS A;  3F63 A;  4HU7 A;  1Z7P A;  1M0U A;  3UVH A;  3DML A;  1EV4 A;  3L78 A;  4TXO B;  3U5R E;  3ZVJ A;  2B5X A;  2I3Y A;  2N5A A;  5EY6 A;  3RPP A;  1FB6 A;  1EOG A;  1AXD A;  5GZZ B;  3CMI A;  4OFN A;  10GS A;  1SL0 B;  1R4W A;  3DD3 A;  4E8E A;  1W4V A;  1G6W A;  4MMM A;  3HA9 A;  2HE3 A;  4V1A g;  4P3Y B;  5DQS A;  4BA7 A;  4D73 A;  3MNG A;  3FZ4 A;  5ECO B;  2GS3 A;  5DCH A;  4QQ7 A;  1GUM A;  1X5D A;  3HVV A;  3QFB C;  2B5E A;  2XBQ A;  4JR4 A;  1GTA A;  1YZX A;  4N0V A;  2RII A;  3S9F A;  2FD3 A;  4V2N A;  5INY A;  4MLY A;  1A2J A;  4Z2T A;  4AGS A;  4POM A;  2GT6 A;  1GP1 A;  4J57 E;  4NXI A;  5CNW A;  4IQA A;  5IO0 A;  2PER A;  4FIW A;  2HZF A;  2YNX A;  3IHG A;  3D6I A;  3EWL A;  2YCD A;  4JBB A;  3KMO A;  2HFD A;  2IMK A;  2AV4 A;  4Q5R A;  2IJY A;  2MMA A;  4GST A;  2LQQ A;  1A8L A;  2QGV A;  1LBK A;  3KIJ A;  2KHP A;  2F8A A;  4ECC A;  2L4C A;  2QA2 A;  2EIR A;  5JCU A;  2FHE A;  1DE2 A;  2MBT A;  1SEN A;  2GVP A;  1FVJ A;  4KE3 A;  2WUL A;  3PPU A;  2R0G A;  5C04 A;  1ZL9 A;  1LJR A;  1X9W B;  3WD6 A;  3GV1 A;  3HJO A;  1EEJ A;  4NPB A;  2CAI A;  1O7U A;  1TK8 B;  16GS A;  2A4H A;  13GS A;  2V6O A;  2CZ3 A;  4G0I A;  6GSU A;  1GTU A;  1CQG A;  2H01 A;  2MYG A;  2VOC A;  1OE8 A;  2QC7 A;  4G10 A;  1FHE A;  1NHO A;  5J9B A;  2JAC A;  5LD0 A;  2PU9 C;  5GSS A;  1C72 A;  3GA4 A;  1ZYP A;  5F06 A;  4PNG A;  1GSS A;  1YDK A;  1W89 A;  3GNJ A;  3LSZ A;  3QDN A;  1T4Y A;  1A2M A;  2H8L A;  4MH3 A;  3F3R A;  4XS4 A;  3H93 A;  4EIQ A;  1T7P B;  4YQV A;  3R2Q A;  4EE0 A;  3HD5 A;  4IN0 A;  3FZ9 A;  1RW1 A;  3HJM A;  4I5Q A;  2HNL A;  2HSH A;  2OAD A;  3HVX A;  1SJ6 A;  4HU9 A;  5G31 A;  4OD7 A;  1M2B A;  5CRH A;  5DAK B;  1VRS D;  1VGL A;  2I9H A;  1AQX A;  1MD3 A;  2O85 A;  3HJP A;  4TR1 A;  4K0N A;  4O7H A;  1NHY A;  4OCE A;  4YAP A;  4DVC A;  2KOK A;  3BBY A;  4OFT A;  3LYK A;  4TR0 A;  1ILO A;  2F51 A;  1TU8 A;  2H76 A;  1TKD B;  3TJF A;  3APQ A;  1TK5 B;  14GS A;  1HYU A;  4ILF A;  1SL2 B;  5IMA A;  4IKH A;  1TOF A;  3F4S A;  1V2A A;  1GL8 A;  3IOS A;  2R37 A;  1DBY A;  5GAP D;  2AJQ B;  3W6G A;  2R3X A;  4ID0 A;  3G9B A;  2MMZ A;  1OC8 A;  1JLW A;  1TRW A;  4RQX A;  1WP0 A;  4A5P A;  1VF4 A;  1WPI A;  1OKT A;  1PN9 A;  3G7Y A;  4K5S A;  1ERT A;  5E59 A;  4O32 A;  1G0T A;  2OE0 A;  2KUC A;  2LJK A;  3CSJ A;  1OE7 A;  4HQS A;  2H72 A;  2IFQ B;  3FY7 A;  3WGD A;  1F6M C;  22GS A;  4KGI A;  1YY7 A;  5COH A;  2JZS A;  2D2Z A;  3IAM 2;  2YJH A;  1H75 A;  2O7K A;  3LEF A;  3M9J A;  3WYW A;  5HR3 A;  3ZL5 A;  3QCP A;  4MNN A;  2YV7 A;  3F4R A;  4I8B A;  5LNK e;  5GAN D;  3C71 A;  3F8U A;  1GSD A;  3EVI A;  5KN0 A;  5BMU A;  2IME A;  3G7J A;  2LNT A;  2V41 A;  2H0H A;  5CO3 A;  3IHQ A;  4JU5 A;  2OJL A;  2IIY A;  1XW5 A;  4MJB A;  5D9W A;  1F3A A;  1GNE A;  1V98 A;  1OC9 A;  2DC5 A;  4EL1 A;  4JR6 A;  4I6X A;  4F9Z A;  1URM A;  3IK9 A;  2PBJ A;  1BQ7 A;  3J7Y k;  1U87 A;  2FWG A;  1GH2 A;  4EKZ A;  5A4V A;  1FAA A;  2OBI A;  4IQ1 A;  4PQI A;  2MZC A;  4K6X A;  2VCQ A;  1JZR A;  20GS A;  1PKZ A;  2YZU A;  2LQO A;  4GRF A;  4RI6 A;  2HLS A;  2GDR A;  4YAV A;  4MZB A;  5JWQ B;  4TOP A;  3IK7 A;  4CY8 A;  3DVW A;  1JLV A;  4AJ7 A;  3Q6O A;  4XS1 A;  3FR6 A;  1HNB A;  2H1B A;  1K3O A;  1SYR A;  1O6J A;  2HT9 A;  1XW6 A;  2VCZ A;  3QOU A;  4KAE A;  4NV2 A;  2CZ2 A;  2C0E A;  3FZA A;  2K18 A;  3KMN A;  4HDE A;  4FYB A;  3CXG A;  2HZE A;  4X4J A;  1TRV A;  1PL1 A;  1WOU A;  4KCA A;  2HSM A;  2B5Y A;  2WDU A;  4G19 A;  5A5K A;  1XCC A;  2WB9 A;  2IMI A;  1AAZ A;  4IHU A;  4KSO A;  5ID2 B;  3GKN A;  3IXR A;  5KN2 A;  2YP6 A;  2PVQ A;  2L4Q A;  2I1U A;  3RBT A;  4BVY A;  5G1K A;  2WCI A;  5ELG A;  2P31 A;  4Z2U A;  2E2M A;  1K3Y A;  4O5U A;  3IAS 2;  17GS A;  1GTB A;  4BVY B;  3TJB A;  4KDU A;  3TKS C;  1SK2 A;  4F0B A;  2YOI A;  3KP9 A;  1M9B A;  3CRT A;  5KOW A;  2YZH A;  4F03 A;  3ISO A;  2CA8 A;  3F6F A;  6GSS A;  2VCW A;  1R7H A;  4X43 A;  5IOW A;  2PPT A;  1M7T A;  1MDI A;  5ECM B;  2F8F A;  3IA1 A;  1T00 A;  3Q19 A;  2H30 A;  3UVT A;  11GS A;  1BG5 A;  2PWJ A;  4ACS A;  4NV5 A;  2H71 A;  1V40 A;  1KNG A;  4TW5 A;  4WR4 A;  4O92 A;  4EDY A;  3ZVJ D;  3LYP A;  2X99 A;  4PTS A;  2FLS A;  2GST A;  3GL5 A;  3GSS A;  4OWY A;  3BD2 A;  5F0G A;  1O85 A;  1UA5 A;  3VWX A;  2H1A A;  3KCM A;  5HR1 A;  3GKM A;  2HYX A;  2DJK A;  1PQN A;  1Q98 A;  1BJX A;  2HXK A;  3QAV A;  1Z9H A;  3US3 A;  4XCS A;  4IP6 A;  1T1V A;  1G7E A;  3MSZ A;  1SK1 A;  5H5S A;  2J23 A;  4TRX A;  3QAG A;  4EF0 A;  4N10 A;  2CX3 A;  3H4K A;  1RK4 A;  2YPM A;  4OO4 A;  2H0G A;  1TP9 A;  3TCO A;  4Q5F A;  4F2I A;  1M9A A;  4IGJ A;  1YKC A;  3FHK A;  19GS A;  3C7M A;  3WT2 A;  4Q5N A;  2M72 A;  6GSY A;  4N11 A;  1K0D A;  4MF7 A;  2HSY A;  4WBR D;  1SK0 A;  3LFL A;  2B1K A;  3HHV A;  3LJR A;  1A0F A;  2H75 A;  4K7O A;  3Q74 A;  1GLQ A;  4JRR A;  2FNO A;  2NDO A;  1O8W A;  18GS A;  1TRS A;  3TRQ A;  3NZN A;  2EC4 A;  4MCU A;  3LWA A;  1ABA A;  1DSB A;  2X8H A;  4KH7 A;  1U6T A;  3GRX A;  1THX A;  1ERU A;  2FGX A;  3F6D A;  1JZO A;  3U6V A;  2BMX A;  5ECP B;  4H86 A;  3IPZ A;  4KX4 A;  9GSS A;  5B8B A;  2ES7 A;  4FH8 A;  4ZL7 A;  4BVX A;  3FMW A;  1T4Z A;  3IC8 A;  4GSN A;  3RHC A;  1M99 A;  3CYN A;  2LEG A;  1E2Y A;  1PSQ A;  1QGV A;  4CHS A;  12GS A;  4Z2R A;  4V2L A;  3LW9 A;  1X5C A;  3HYP A;  2C0D A;  5IPG A;  3MAK A;  1TRU A;  2A2R A;  4D73 B;  1ZOF A;  3UOM A;  3UBK A;  4HZ2 A;  1B8X A;  2IWT A;  4MH2 A;  2GQM A;  2GQK A;  5B6M A;  4CW9 A;  4NWY A;  1TTZ A;  3W8S A;  4PUF C;  3EUR A;  3QPM A;  2YJ7 A;  2H0I A;  1Y25 A;  3DEX A;  1DE1 A;  2IMD A;  2E7P A;  2H66 A;  1Z3E A;  4PGT A;  1PX6 A;  5CAX A;  1V57 A;  3UIW A;  3BOA A;  4ZB8 A;  2FY6 A;  4TKY A;  4WBJ A;  2H1G A;  4YKF A;  2YAN A;  3D4T A;  4CY6 A;  2AYT A;  3PGT A;  5D93 A;  1Q4J A;  1J08 A;  2LRN A;  2FA4 A;  4HI7 A;  1ZMA A;  3F0I A;  4GXZ A;  2DIZ A;  3ZFL A;  4YQM A;  4GQF A;  3FR9 A;  1RQM A;  4TR3 A;  2AHE A;  2DKI A;  2LST A;  2A4V A;  1UC7 A;  3I6A A;  1KEB A;  5ABR A;  3E9J B;  1GUH A;  2WJU A;  2OE3 A;  3GH9 A;  3TJK A;  3UL3 A;  1XOB A;  1A2L A;  5CRG A;  3M3M A;  1YKA A;  3RHB A;  4KA0 A;  4XS6 A;  2GSR A;  1EP8 A;  4MK3 A;  5AGY A;  1O81 A;  2VCT A;  2C0F A;  1PRX A;  2WS2 A;  5A4U A;  3I9V 2;  3BCI A;  1U88 A;  2NTO A;  1I5G A;  3ZIV A;  3PIN A;  1TI1 A;  3V1W A;  4O5Q A;  2B3S A;  4LMW A;  3GHA A;  2GQL A;  5F05 A;  2L5O A;  3D22 A;  2DML A;  3UJ1 A;  3C73 A;  2R6K A;  3ZRD A;  2C3N A;  4HOJ A;  4ZB6 A;  3ZYW A;  4FQU A;  4XHM A;  5IMZ A;  1YQ1 A;  4XS4 B;  3ERF A;  1ON4 A;  3TRX A;  4MP4 A;  3UBL A;  5JWO B;  3ZIT A;  1O73 A;  1YEX A;  1MTC A;  4K7N A;  2H19 A;  3TKR A;  5HFG A;  4XTS A;  2IN3 A;  5DDL A;  3VLN A;  4MJC A;  3WGX A;  2QA1 A;  2AB6 A;  3KXO A;  4G9H A;  1YF1 A;  4PUR A;  3VPQ A;  4TR4 A;  2V6K A;  4TR1 B;  3O6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...