2P5TA

Molecular and structural characterization of the pezat chromosomal toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
92
structure length
92
Chain Sequence
LNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular and Structural Characterization of the PezAT Chromosomal Toxin-Antitoxin System of the Human Pathogen Streptococcus pneumoniae.
pubmed doi rcsb
molecule keywords fragment of PezA helix-turn-helix motif
molecule tags Transcription regulator
source organism Streptococcus pneumoniae
total genus 38
structure length 92
sequence length 92
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2p5tA00
3Q8XA 2P5TA 1GVNA
chains in the Genus database with same CATH superfamily
3QYBA 1XB2B 1ZV1A 1BVSA 4L4UA 1Z5CA 4QNRA 3A45A 3FKEA 3OTOM 4B7GA 2MROB 1WGNA 3E46A 1XNRM 1OJLA 3IG5A 3I4VA 5EXSA 3ZH9B 4LFAM 1IBMM 2F4VM 1N77A 3H4MA 4IBBA 1N34M 1K3XA 1A5TA 5EP4A 4LZJA 2FNAA 2P5TA 5F3WA 1HNZM 2OQ4A 3HWSA 4WP2A 1MU5A 1VEKA 4JN6A 1N33M 1TH2A 2LHCA 1WR1B 5EXTA 4DV5M 5FTKA 4X64M 3J2PB 1NO1A 1VDLA 3KW6A 4G4NA 4JI5M 4FCTA 4M0DA 5FSWA 2BJVA 3TWMA 3U6QA 1HR0M 4L8RC 4I8OA 2H5XA 2LVOC 2YQZA 1VDDA 4II7A 3J80S 5KQ8A 2CHVA 4LF9M 4B7HA 4AI6A 2KW0A 2DAIA 3J27B 4NC6A 2LBCA 3KP1E 3A98B 4FW9A 1OIZA 1DGHB 1KYIA 1QZEA 2J5YA 2DHRA 1GKIA 4FVMA 5IZ7D 3AKZA 1JR3D 4DV0M 3LVVA 4CISA 3M0EA 3VFDA 4B3TM 1Q39A 1E9SA 3E9SA 3U6OA 3L28A 2VIIA 1Z59A 4LGYA 3SMPA 2G8LA 5FTNA 2JY6B 2B3TA 3K92A 4LJ4A 4NSOB 5DYIA 3LCVB 3RFWA 4JYAM 5IREB 3CGWA 4YHHM 4G4OA 4IBJA 2DENA 4IBKA 3IHPA 4Z6YA 2L7IA 3SAVA 1C1KA 2L4EA 3B89A 3J7BA 4ANRA 2JUJA 4AZFA 4DV2M 2KRUA 1PJJA 3L26A 4DR7M 4LJAA 1QVRA 1YSYA 1NVMA 2M60A 1GJTA 4WW0A 1EIJA 2KHHA 3J81S 4B3RM 2LTUA 4YY3M 3VKGA 2R18A 4RNAA 4JI8M 3VK8A 3GPXA 4GEWA 2F5QA 1UM8A 2DAMA 2EO2A 3PFIA 1NV9A 4KT0F 2Y21A 7CATA 4DR1M 3EIHA 4GH9A 3GLFB 2FFJA 3RE8A 4FCVA 3B7ZA 1VEGA 2K47A 1D0LA 2YNMD 1AUAA 3FRIA 3HHYA 1R7RA 3GRYA 1J5EM 3C9PA 2KEBA 1L1TA 4JI1M 2QSFX 5EJCA 5EXPA 1DGBA 1IN6A 4D80A 3GQ5A 3KSXA 2I7NA 2C9OA 3M6AA 2UU9M 1F4IA 3JAMS 5H37D 2HKJA 4NXMM 3GRRA 3FTDA 2LWXA 2CWBA 3T1HM 3U60A 5DNYA 2DVWB 4MM3B 4QOZC 2FS1A 3SC3A 3FUUA 2KA6B 2D7HA 2DHYA 1QAMA 2DWNA 3GO8A 3PNVA 2ZM6M 4EIWA 4XGIA 4LRSA 5FTMA 1HT2E 4B7FA 2X8AA 2XEPA 3QWLA 4RF1A 4GKKM 2XF3A 1KSFX 2VQEM 2FH0A 3H4JA 3ZC7B 3U6SA 1WHCA 1XMQM 1WGLA 4AG5A 4IJFA 1JR3A 1EFUB 2K0BX 2RGOA 4QHTA 3JR4A 2GNOA 3FTFA 2UXDM 1VQ1A 4AW4A 3VDPA 1UFZA 2ERCA 1JR3E 5ITQA 2G5GX 2HHHM 2UXCM 2WSFF 3FYCA 1T3TA 2Z8YM 1GL6A 4QHSA 2Z4RA 4RF0A 1XHBA 2BJWA 3BBZA 3FUTA 3KP0E 3T6PA 5KO3A 2DNAA 1IM2A 2KNAA 4DR6M 1IBLM 2KNVA 1J09A 4RKUF 3D8LA 5ITUA 1GO5A 1SXJC 2L09A 2LVNC 2KRKA 1W5TA 3HKPA 2MGWA 3GLGA 3U60B 4GHAA 1NJGA 2VF7A 4JV5M 2R6FA 4F2LA 4OVZA 3SAUA 2CFOA 3GLGE 4S12A 1R4GA 4KO8A 3FUVA 5JI2E 4M9SA 2C98A 2Z3XA 1CUKA 1OIPA 2DWMA 2CHQA 2BWBA 3NBIA 4FCWA 1SXJE 2NQ8C 3HJ8A 5ITXA 2LXEA 4AKHA 1IXZA 3MHVC 3VKHA 1IY0A 2VF8A 5IT9S 1D0KA 5EP1A 1Z5BA 4FD2A 2EKFA 5EP2A 5ITXE 1XC8A 2UXBM 2XSZD 1R5LA 4I4LA 4L6V6 4LF7M 2MH8A 3HHXA 3SFZA 4MGHA 2QCUA 1IQPA 1QUSA 3DFZA 5JI3E 3JR5A 1J7KA 3TWLA 3AOGA 1DV0A 4AKGA 2H1RA 5KPZA 1Y8GA 3J7AS 4CIZA 2E5LM 2HL7A 4GC9A 2RGHA 3B9PA 3RGPA 4LGMA 3GLGB 4LJ7A 2JP7A 2XLJA 1OQYA 3B7NA 3CTWB 4X65M 4LF5M 1NJFA 3TQSA 5LMNM 1N36M 4OVZB 2Y0TA 3AL0C 4L16A 2A5YB 3FTCA 2GQFA 2KDLA 3C3DA 3AV0A 4DR3M 2QENA 1OAOC 3NBXX 1DO0A 4LJ8A 3F92A 3DA1A 4M9ZA 2CRUA 3A42A 1IN5A 1NV8A 2OPFA 2O5RA 3KFUG 4LRTA 3U6DA 2R65A 2R0IA 3TPZA 3LQQA 3LVWA 3D8BA 1OTRA 1RU3A 4K0KM 1QANA 3GLHA 4R3DA 5BR8M 1OAIA 4Z8XA 3A46A 2LVAA 3UK6A 2ZANA 3GLHE 4G4QA 4JI2M 2ZTCA 4REZA 2FOIC 3W67A 2L7HA 3PXGA 2RKOA 3FRHA 1GLNA 2O25A 4QOSA 2X49A 2F5SA 1NNJA 3BXWA 2LNHC 2QQ8A 3KOZE 4P16A 3W0FA 2MJ5B 5KPTA 3IECA 2Z4SA 2N35A 1G71A 1TH4A 3FYDA 2DKLA 4NOOB 1SXJD 1LV7A 3UGJA 2HWJA 1HQCA 3UZUA 4LF6M 2KZSA 3WHLA 1TTEA 4UN2B 2BWEA 1N75A 3KXEC 2F5OA 2QBYA 4MGYE 3KOXE 1LTMA 4L78A 2I7PA 3FTEA 4IBGA 1IBKM 4BB9A 4B3SM 1ZMVA 3CF0A 3GRUA 4R71A 2EA0A 4JI3M 1GVNA 2K9DA 1OFIA 2DZLA 2EJSA 2XSZA 4LY6A 4MGZE 2ZBKB 4MH0E 3HJQA 3GLHB 2EKKA 4GIPA 1D2NA 4XBOA 3SAWA 4NSRA 4G6ZA 2DWLA 2DZOB 4I5SA 2C5RA 2XH9A 1NHGC 3MMPA 3U6LA 4HLQA 4XK8F 2R62A 1QUTA 3B74A 1ORYB 4LJ9A 3LCUA 5E6JA 1Z5AA 2CUZA 4DV3M 3CF2A 3L27A 2UUCM 4CHTB 1C7YA 2CHGA 1I4WA 5L8RF 1PRBA 4AKIA 2C96A 4FWHA 2QBYB 1TF0B 1XWIA 4MB7A 2KNZA 3AFHA 3C3EA 3M7GA 4KHPM 1N78A 3I4YA 3U5ZA 2D7GA 2QP9X 2JY8A 3KOYE 4DBGB 2ZTDA 4W5WA 4DV4M 2DXIA 1G4AE 1ZMWA 1IN7A 4KODA 1G59A 4JI7M 3KDSE 4CGYB 1IN4A 3T38A 2CV1A 3HU3A 1YLAA 3L29A 4IIWA 3VK7A 3HY5A 2EUCA 1QAOA 3Q8XA 2VQFM 4PT5A 3LMMA 4FWDA 3HU1A 2RRUA 5LMUM 4IBEA 1ZQ9A 3SBJA 4LF8M 1HJPA 4BLCA 2V6ZM 3E21A 3I51A 4B3MM 1Q02A 3RGSA 4DR4M 2WZJA 5ITTA 1SG9A 2CV0A 2R4JA 4G3OA 1MX0A 1SXJA 4GC5A 4HL4A 4DUYM 2R45A 1JQJC 1QZMA 3HZJA 3LW5F 2L2DA 4A3VB 3QAUA 1PGYA 4GKJM 4MGKE 4CJ6A 5ITRA 1MJGM 2X4AA 3C58A 5C1BA 1L8QA 2ZAOA 3K9PA 2WSEF 1T43A 1Q3BA 2JXNA 3FUXA 1DGGA 4L15A 1TDZA 1Z6TA 3U5ZB 2DZNB 1W5SA 2QHOB 2V1UA 1IFYA 2CE7A 2JZ0A 3NWLA 1PJQA 3B7QA 2HCBA 3KOWE 2UUBM 3CF6E 1T6OA 4MGIE 1PJSA 4DR2M 2DAGA 3W0LB 4Q7JA 2LHGA 4LF4M 1IXSA 1HT1E 2OOBA 1NY6A 2D7EA 1FNNA 4TUWA 2XZUA 3GLIA 1JB0F 1S3SA 4G4RA 4PD2A 2OOAA 2KXEA 4OX9M 1GL7A 4OU7A 1SXJB 1G8PA 4PDIA 4GHLA 2YFQA 4NL4H 3GLIE 1R6BX 4R7GA 4AG6A 1PM5A 5ITYA 1DO2A 2YR0A 2FE8A 4OW0A 2L6OA 1L1ZA 2LH0A 2XGNA 2WSCF 4KLNA 3GP1A 1PJTA 4LCBA 1XNQM 5EP3A 3U61A 3SARA 3KS8A 3I04M 2C99A 3ZQJA 2APLA 2K6BA 1EE8A 5EQTA 2LVPC 4DUZM 1P3QQ 1MN3A 5KPRA 4DR5M 1G41A 4IBDA 4WURA 3SHGB 5FTJA 3U6MA 3BOSA 1FJGM 1HNWM 1QYRA 3GLFA 3Q8GA 1XMOM 3AOEC 2Y0QA 3UJNA 2L4FA 4DV7M 1TH3A 2JZ1A 4LZZA 3GLFE 2W82A 1NHWC 1GABA 1Q3CA 2CP8A 2DAKA 3SHFA 3MJ5A 2J7NA 2DAEA 2DWZB 2J7OA 1WIVA 1IXSB 3HGIA 4B08A 3PNYA 1E94E 2R46A 2BNKA 1QQWA 2OO9A 1TGUA 3K9OA 4GMQA 4GRIA 5C18A 4AQYM 1QDTA 3GLIB 1HQYE 4IJEA 1WJ7A 3AJIB 8CATA 4DV6M 1V34A 3AOEA 3HJSA 3TL4X 4P17A 3GPYA 2Z7JA 5E26A 2JY7A 4M0WA 4JI6M 4PCZA 4IBIA 2V1CA 2CEAA 3FE3A 4IBFA 5EXXA 5GKNA 4GITA 1IY1A 2Y20A 3VLFB 1KFVA 4JI4M 3SASA 1X37A 1VG5A 1WXQA 4M9XA 3U61B 1DGFA 3HU2A 3K1JA 3THGA 1K82A 1XXHA 3LQRA 1N32M 3ILKA 3VDUA 2F5PA 5BPVA 3U6EA 2Q2EB 3QYEA 3T1YM 1XXHE 4NRVA 2JWSA 2CV2A 3SYKA 4NRWA 2XFSA 2LVQD 1NSFA 1L2BA 1V33A 2MR9A 1NNUC 3TWKA 3HHWA 4F1IA 5A2QS 2G3QA 2DI0A 1YUBA 3GRVA 4NXNM 3GQ3A 1R2YA 1V92A 2JY5A 2M5ZA 3GPPA 4X66M 3T15A 1E9RA 4PDGA 1D0MA 2UUAM 3GPUA 1PJIA 3DOAA 4LG2A 4BBAA 4JI0M 1YE9A 1OKSA 2AHMA 1AIPC 2VDBB 3I01M 3MK6A 1GJSA 4D81A 3U6PA 3W68A 1ZMUA 3IG8A 3EIEA 3FD9A 1HNXM 2QZ4A 3KS4A 3SATA 2JNHA 1IXRC 3FUWA 3SYLA 4FWGA 1K3WA 3R9XB 3PVSA 4DV1M 1IY2A 3L2AA 1XXHB 3V76A 5IWAM 1QDRA 1TR8A 2KZUA 4Y28F 5KQDA 3HHZA 5DFLA 4ITQA 4LFCM 4LFBM 4HEOA 1IN8A 2F5NA 4QNMA 2HAKA 1NY5A 5FTLA 4JXJA 3U6CA 1I94M 3WHKA 1G3IA 1E32A 2JA2A 1TDHA 2O01F 2R4EA 4LJ5A 4I81A 2QNJA 2XFTA 3KSJA 4D82A 3E4RA 1QAQA 5DYGA 3TE6A 1ZAEA 4IBCA 4ZPXA 3GQ4A 1OFHA 2C9CA 2QPAA 1R2ZA 3R8FA 1L2DA 3SMSA 1H6UA 2XZFA 2R44A 4X62M 4LJ6A 3L25A 3HX3A 3K2LA 3UMMA 3ZCBB 1VEJA 3KVWA 1L2CA 3DZDA 1DGHA 2ZAMA 5FLXS 3K8ZA
chains in the Genus database with same CATH topology
3OTOM 4L4UA 1Z5CA 4QNRA 3A45A 3FKEA 4B7GA 1XNRM 1OJLA 3IG5A 3I4VA 5EXSA 3ZH9B 4LFAM 1IBMM 2F4VM 1N77A 3H4MA 4IBBA 1N34M 1K3XA 5EP4A 4LZJA 2FNAA 2P5TA 5F3WA 1HNZM 2OQ4A 3HWSA 1MU5A 4JN6A 1N33M 1TH2A 5EXTA 4DV5M 5FTKA 4X64M 3J2PB 3KW6A 4G4NA 4JI5M 4FCTA 4M0DA 5FSWA 2BJVA 3TWMA 3U6QA 1HR0M 4L8RC 4I8OA 2YQZA 1VDDA 4II7A 3J80S 5KQ8A 2CHVA 4LF9M 4B7HA 4AI6A 2KW0A 3J27B 3KP1E 3A98B 4FW9A 1DGHB 1KYIA 5IZ7D 2DHRA 1GKIA 4FVMA 3AKZA 4DV0M 1JR3D 3LVVA 4CISA 3M0EA 3VFDA 4B3TM 1Q39A 1E9SA 3E9SA 3U6OA 3L28A 2VIIA 1Z59A 4LGYA 3SMPA 2G8LA 5FTNA 3K92A 4NSOB 4LJ4A 5DYIA 3RFWA 4JYAM 5IREB 4YHHM 4G4OA 4IBJA 4IBKA 4Z6YA 2L7IA 3SAVA 1C1KA 3J7BA 4AZFA 4DV2M 2KRUA 1PJJA 3L26A 4DR7M 4LJAA 1QVRA 1YSYA 1NVMA 2M60A 4WW0A 3J81S 4B3RM 4YY3M 3VKGA 2R18A 4RNAA 4JI8M 3VK8A 3GPXA 2F5QA 1UM8A 2EO2A 3PFIA 2Y21A 7CATA 4DR1M 3EIHA 4GH9A 3GLFB 2FFJA 3RE8A 4FCVA 2K47A 2YNMD 3HHYA 1J5EM 1R7RA 3GRYA 1L1TA 2KEBA 4JI1M 5EJCA 5EXPA 1DGBA 1IN6A 4D80A 3GQ5A 3KSXA 2I7NA 2C9OA 3M6AA 2UU9M 3JAMS 5H37D 2HKJA 4NXMM 3GRRA 3FTDA 2LWXA 3T1HM 3U60A 5DNYA 2DVWB 4MM3B 4QOZC 3SC3A 3FUUA 2KA6B 2D7HA 1QAMA 2DWNA 3GO8A 3PNVA 2ZM6M 4EIWA 4XGIA 4LRSA 5FTMA 1HT2E 4B7FA 2X8AA 2XEPA 3QWLA 4RF1A 4GKKM 2XF3A 1KSFX 2VQEM 3ZC7B 3U6SA 1XMQM 4AG5A 4IJFA 1JR3A 3FTFA 2RGOA 4QHTA 3JR4A 2UXDM 4AW4A 3VDPA 2ERCA 5ITQA 2G5GX 2HHHM 2UXCM 3FYCA 1T3TA 1GL6A 4QHSA 2Z4RA 4RF0A 1XHBA 2BJWA 3FUTA 3KP0E 5KO3A 1IM2A 4DR6M 1IBLM 1J09A 3D8LA 5ITUA 1SXJC 2L09A 2KRKA 1W5TA 3HKPA 3GLGA 3U60B 4GHAA 1NJGA 4JV5M 4OVZA 3SAUA 2CFOA 4S12A 4KO8A 3FUVA 5JI2E 4M9SA 2C98A 2Z3XA 2DWMA 2CHQA 3NBIA 4FCWA 1SXJE 2NQ8C 3HJ8A 5ITXA 2LXEA 4AKHA 1IXZA 3MHVC 3VKHA 1IY0A 5EP1A 1Z5BA 4FD2A 5EP2A 5ITXE 1XC8A 2UXBM 2XSZD 4I4LA 4LF7M 3HHXA 3SFZA 4MGHA 2QCUA 1IQPA 3DFZA 5JI3E 3JR5A 1J7KA 3TWLA 3AOGA 4AKGA 2H1RA 5KPZA 3J7AS 2E5LM 2HL7A 4GC9A 2RGHA 3B9PA 3RGPA 4LGMA 3GLGB 4LJ7A 2XLJA 3CTWB 4X65M 4LF5M 1NJFA 3TQSA 5LMNM 1N36M 4OVZB 2Y0TA 3AL0C 4L16A 2A5YB 3FTCA 3AV0A 4DR3M 2QENA 1DO0A 4LJ8A 3DA1A 4M9ZA 3A42A 1IN5A 2OPFA 2O5RA 3KFUG 4LRTA 3U6DA 2R65A 3TPZA 3LQQA 3LVWA 3D8BA 4K0KM 1QANA 3GLHA 4R3DA 5BR8M 4Z8XA 3A46A 3UK6A 2ZANA 4JI2M 4G4QA 4REZA 2FOIC 2L7HA 3PXGA 2RKOA 4QOSA 1GLNA 2X49A 2F5SA 1NNJA 2LNHC 3KOZE 4P16A 3W0FA 5KPTA 2Z4SA 1TH4A 3FYDA 3UGJA 4NOOB 1SXJD 1LV7A 1HQCA 3UZUA 4LF6M 2KZSA 3WHLA 1N75A 3KXEC 2F5OA 2QBYA 4MGYE 3KOXE 4L78A 2I7PA 3FTEA 4IBGA 1IBKM 4BB9A 4B3SM 3CF0A 3GRUA 2EA0A 4JI3M 1GVNA 1OFIA 2XSZA 4LY6A 4MGZE 2ZBKB 4MH0E 3HJQA 3GLHB 4GIPA 1D2NA 4XBOA 3SAWA 4NSRA 4G6ZA 2DWLA 2DZOB 4I5SA 2C5RA 2XH9A 1NHGC 3U6LA 4HLQA 2R62A 1ORYB 4LJ9A 5E6JA 1Z5AA 2CUZA 4DV3M 3CF2A 3L27A 2UUCM 4CHTB 2CHGA 1I4WA 4AKIA 2C96A 4FWHA 2QBYB 4KHPM 1XWIA 4MB7A 3AFHA 3M7GA 1N78A 3I4YA 3U5ZA 2D7GA 2QP9X 3KOYE 4W5WA 4DV4M 2DXIA 1G4AE 1IN7A 4KODA 1G59A 4JI7M 3KDSE 4CGYB 1IN4A 3T38A 2CV1A 3HU3A 3L29A 4IIWA 3VK7A 2EUCA 1QAOA 3Q8XA 2VQFM 4PT5A 3LMMA 4FWDA 3HU1A 5LMUM 4IBEA 1ZQ9A 3SBJA 4LF8M 4BLCA 2V6ZM 3I51A 4B3MM 3RGSA 4DR4M 5ITTA 2CV0A 2R4JA 4HL4A 1MX0A 1SXJA 4GC5A 4DUYM 2R45A 1JQJC 1QZMA 4A3VB 3QAUA 4GKJM 4MGKE 5ITRA 2X4AA 3C58A 5C1BA 1L8QA 2ZAOA 1Q3BA 3FUXA 1DGGA 4L15A 1TDZA 1Z6TA 3U5ZB 2DZNB 1W5SA 2V1UA 2CE7A 3NWLA 2HCBA 3KOWE 2UUBM 3CF6E 4MGIE 4DR2M 3W0LB 4LF4M 1HT1E 1NY6A 2D7EA 1FNNA 4TUWA 2XZUA 3GLIA 4G4RA 1S3SA 4OX9M 4PD2A 2KXEA 1GL7A 4OU7A 1SXJB 1G8PA 4PDIA 4GHLA 2YFQA 4NL4H 1R6BX 4R7GA 4AG6A 1PM5A 5ITYA 1DO2A 2YR0A 2FE8A 4OW0A 2L6OA 1L1ZA 2LH0A 2XGNA 4KLNA 3GP1A 4LCBA 1XNQM 5EP3A 3U61A 3SARA 3KS8A 2C99A 1EE8A 5EQTA 4DUZM 5KPRA 4DR5M 1G41A 4IBDA 4WURA 3SHGB 5FTJA 3U6MA 3BOSA 1FJGM 1HNWM 1QYRA 3GLFA 1XMOM 3AOEC 2Y0QA 3UJNA 4DV7M 1TH3A 4LZZA 2W82A 1NHWC 1Q3CA 3SHFA 3MJ5A 2J7NA 2DWZB 2J7OA 3HGIA 1IXSB 4B08A 3PNYA 1E94E 2R46A 2BNKA 1QQWA 4GMQA 1TGUA 4GRIA 5C18A 4AQYM 3GLIB 1HQYE 4IJEA 3AJIB 8CATA 4DV6M 3AOEA 3HJSA 3TL4X 3GPYA 2Z7JA 5E26A 4M0WA 4JI6M 4PCZA 4IBIA 2V1CA 2CEAA 4IBFA 5EXXA 5GKNA 4GITA 1IY1A 2Y20A 3VLFB 1KFVA 4JI4M 3SASA 1X37A 1WXQA 4M9XA 3U61B 1DGFA 3HU2A 3K1JA 3THGA 1K82A 1XXHA 3LQRA 1N32M 3ILKA 3VDUA 2F5PA 5BPVA 3U6EA 2Q2EB 3T1YM 4NRVA 2CV2A 3SYKA 4NRWA 2XFSA 1NSFA 1L2BA 1NNUC 3TWKA 3HHWA 5A2QS 1YUBA 3GRVA 4NXNM 3GQ3A 1R2YA 2M5ZA 3GPPA 4X66M 3T15A 1E9RA 4PDGA 2UUAM 3GPUA 1PJIA 3DOAA 4BBAA 4JI0M 1YE9A 2AHMA 3MK6A 4D81A 3U6PA 3IG8A 3EIEA 3FD9A 1HNXM 2QZ4A 3KS4A 3SATA 1IXRC 3FUWA 3SYLA 4FWGA 1K3WA 3R9XB 3PVSA 4DV1M 1IY2A 3L2AA 1XXHB 5IWAM 4LG2A 5IT9S 2KZUA 5KQDA 3HHZA 4LFBM 4LFCM 4ITQA 1IN8A 2F5NA 4QNMA 1NY5A 5FTLA 4JXJA 3U6CA 1I94M 3WHKA 1G3IA 1E32A 2JA2A 1TDHA 2R4EA 4LJ5A 4I81A 3KSJA 2XFTA 4D82A 3E4RA 1QAQA 5DYGA 3TE6A 1ZAEA 4IBCA 4ZPXA 3GQ4A 1OFHA 2C9CA 2QPAA 1R2ZA 3R8FA 1L2DA 3SMSA 1H6UA 2XZFA 4X62M 4LJ6A 3L25A 3K2LA 3UMMA 3ZCBB 3KVWA 1L2CA 3DZDA 1DGHA 2ZAMA 5FLXS 3K8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  2P5T A;  1GVN A; 
#chains in the Genus database with same CATH topology
 3QYB A;  1XB2 B;  1ZV1 A;  1BVS A;  4L4U A;  1Z5C A;  4QNR A;  3A45 A;  3FKE A;  3OTO M;  4B7G A;  2MRO B;  1WGN A;  3E46 A;  1XNR M;  1OJL A;  3IG5 A;  3I4V A;  5EXS A;  3ZH9 B;  4LFA M;  1IBM M;  2F4V M;  1N77 A;  3H4M A;  4IBB A;  1N34 M;  1K3X A;  1A5T A;  5EP4 A;  4LZJ A;  2FNA A;  2P5T A;  5F3W A;  1HNZ M;  2OQ4 A;  3HWS A;  4WP2 A;  1MU5 A;  1VEK A;  4JN6 A;  1N33 M;  1TH2 A;  2LHC A;  1WR1 B;  5EXT A;  4DV5 M;  5FTK A;  4X64 M;  3J2P B;  1NO1 A;  1VDL A;  3KW6 A;  4G4N A;  4JI5 M;  4FCT A;  4M0D A;  5FSW A;  2BJV A;  3TWM A;  3U6Q A;  1HR0 M;  4L8R C;  4I8O A;  2H5X A;  2LVO C;  2YQZ A;  1VDD A;  4II7 A;  3J80 S;  5KQ8 A;  2CHV A;  4LF9 M;  4B7H A;  4AI6 A;  2KW0 A;  2DAI A;  3J27 B;  4NC6 A;  2LBC A;  3KP1 E;  3A98 B;  4FW9 A;  1OIZ A;  1DGH B;  1KYI A;  1QZE A;  2J5Y A;  2DHR A;  1GKI A;  4FVM A;  5IZ7 D;  3AKZ A;  1JR3 D;  4DV0 M;  3LVV A;  4CIS A;  3M0E A;  3VFD A;  4B3T M;  1Q39 A;  1E9S A;  3E9S A;  3U6O A;  3L28 A;  2VII A;  1Z59 A;  4LGY A;  3SMP A;  2G8L A;  5FTN A;  2JY6 B;  2B3T A;  3K92 A;  4LJ4 A;  4NSO B;  5DYI A;  3LCV B;  3RFW A;  4JYA M;  5IRE B;  3CGW A;  4YHH M;  4G4O A;  4IBJ A;  2DEN A;  4IBK A;  3IHP A;  4Z6Y A;  2L7I A;  3SAV A;  1C1K A;  2L4E A;  3B89 A;  3J7B A;  4ANR A;  2JUJ A;  4AZF A;  4DV2 M;  2KRU A;  1PJJ A;  3L26 A;  4DR7 M;  4LJA A;  1QVR A;  1YSY A;  1NVM A;  2M60 A;  1GJT A;  4WW0 A;  1EIJ A;  2KHH A;  3J81 S;  4B3R M;  2LTU A;  4YY3 M;  3VKG A;  2R18 A;  4RNA A;  4JI8 M;  3VK8 A;  3GPX A;  4GEW A;  2F5Q A;  1UM8 A;  2DAM A;  2EO2 A;  3PFI A;  1NV9 A;  4KT0 F;  2Y21 A;  7CAT A;  4DR1 M;  3EIH A;  4GH9 A;  3GLF B;  2FFJ A;  3RE8 A;  4FCV A;  3B7Z A;  1VEG A;  2K47 A;  1D0L A;  2YNM D;  1AUA A;  3FRI A;  3HHY A;  1R7R A;  3GRY A;  1J5E M;  3C9P A;  2KEB A;  1L1T A;  4JI1 M;  2QSF X;  5EJC A;  5EXP A;  1DGB A;  1IN6 A;  4D80 A;  3GQ5 A;  3KSX A;  2I7N A;  2C9O A;  3M6A A;  2UU9 M;  1F4I A;  3JAM S;  5H37 D;  2HKJ A;  4NXM M;  3GRR A;  3FTD A;  2LWX A;  2CWB A;  3T1H M;  3U60 A;  5DNY A;  2DVW B;  4MM3 B;  4QOZ C;  2FS1 A;  3SC3 A;  3FUU A;  2KA6 B;  2D7H A;  2DHY A;  1QAM A;  2DWN A;  3GO8 A;  3PNV A;  2ZM6 M;  4EIW A;  4XGI A;  4LRS A;  5FTM A;  1HT2 E;  4B7F A;  2X8A A;  2XEP A;  3QWL A;  4RF1 A;  4GKK M;  2XF3 A;  1KSF X;  2VQE M;  2FH0 A;  3H4J A;  3ZC7 B;  3U6S A;  1WHC A;  1XMQ M;  1WGL A;  4AG5 A;  4IJF A;  1JR3 A;  1EFU B;  2K0B X;  2RGO A;  4QHT A;  3JR4 A;  2GNO A;  3FTF A;  2UXD M;  1VQ1 A;  4AW4 A;  3VDP A;  1UFZ A;  2ERC A;  1JR3 E;  5ITQ A;  2G5G X;  2HHH M;  2UXC M;  2WSF F;  3FYC A;  1T3T A;  2Z8Y M;  1GL6 A;  4QHS A;  2Z4R A;  4RF0 A;  1XHB A;  2BJW A;  3BBZ A;  3FUT A;  3KP0 E;  3T6P A;  5KO3 A;  2DNA A;  1IM2 A;  2KNA A;  4DR6 M;  1IBL M;  2KNV A;  1J09 A;  4RKU F;  3D8L A;  5ITU A;  1GO5 A;  1SXJ C;  2L09 A;  2LVN C;  2KRK A;  1W5T A;  3HKP A;  2MGW A;  3GLG A;  3U60 B;  4GHA A;  1NJG A;  2VF7 A;  4JV5 M;  2R6F A;  4F2L A;  4OVZ A;  3SAU A;  2CFO A;  3GLG E;  4S12 A;  1R4G A;  4KO8 A;  3FUV A;  5JI2 E;  4M9S A;  2C98 A;  2Z3X A;  1CUK A;  1OIP A;  2DWM A;  2CHQ A;  2BWB A;  3NBI A;  4FCW A;  1SXJ E;  2NQ8 C;  3HJ8 A;  5ITX A;  2LXE A;  4AKH A;  1IXZ A;  3MHV C;  3VKH A;  1IY0 A;  2VF8 A;  5IT9 S;  1D0K A;  5EP1 A;  1Z5B A;  4FD2 A;  2EKF A;  5EP2 A;  5ITX E;  1XC8 A;  2UXB M;  2XSZ D;  1R5L A;  4I4L A;  4L6V 6;  4LF7 M;  2MH8 A;  3HHX A;  3SFZ A;  4MGH A;  2QCU A;  1IQP A;  1QUS A;  3DFZ A;  5JI3 E;  3JR5 A;  1J7K A;  3TWL A;  3AOG A;  1DV0 A;  4AKG A;  2H1R A;  5KPZ A;  1Y8G A;  3J7A S;  4CIZ A;  2E5L M;  2HL7 A;  4GC9 A;  2RGH A;  3B9P A;  3RGP A;  4LGM A;  3GLG B;  4LJ7 A;  2JP7 A;  2XLJ A;  1OQY A;  3B7N A;  3CTW B;  4X65 M;  4LF5 M;  1NJF A;  3TQS A;  5LMN M;  1N36 M;  4OVZ B;  2Y0T A;  3AL0 C;  4L16 A;  2A5Y B;  3FTC A;  2GQF A;  2KDL A;  3C3D A;  3AV0 A;  4DR3 M;  2QEN A;  1OAO C;  3NBX X;  1DO0 A;  4LJ8 A;  3F92 A;  3DA1 A;  4M9Z A;  2CRU A;  3A42 A;  1IN5 A;  1NV8 A;  2OPF A;  2O5R A;  3KFU G;  4LRT A;  3U6D A;  2R65 A;  2R0I A;  3TPZ A;  3LQQ A;  3LVW A;  3D8B A;  1OTR A;  1RU3 A;  4K0K M;  1QAN A;  3GLH A;  4R3D A;  5BR8 M;  1OAI A;  4Z8X A;  3A46 A;  2LVA A;  3UK6 A;  2ZAN A;  3GLH E;  4G4Q A;  4JI2 M;  2ZTC A;  4REZ A;  2FOI C;  3W67 A;  2L7H A;  3PXG A;  2RKO A;  3FRH A;  1GLN A;  2O25 A;  4QOS A;  2X49 A;  2F5S A;  1NNJ A;  3BXW A;  2LNH C;  2QQ8 A;  3KOZ E;  4P16 A;  3W0F A;  2MJ5 B;  5KPT A;  3IEC A;  2Z4S A;  2N35 A;  1G71 A;  1TH4 A;  3FYD A;  2DKL A;  4NOO B;  1SXJ D;  1LV7 A;  3UGJ A;  2HWJ A;  1HQC A;  3UZU A;  4LF6 M;  2KZS A;  3WHL A;  1TTE A;  4UN2 B;  2BWE A;  1N75 A;  3KXE C;  2F5O A;  2QBY A;  4MGY E;  3KOX E;  1LTM A;  4L78 A;  2I7P A;  3FTE A;  4IBG A;  1IBK M;  4BB9 A;  4B3S M;  1ZMV A;  3CF0 A;  3GRU A;  4R71 A;  2EA0 A;  4JI3 M;  1GVN A;  2K9D A;  1OFI A;  2DZL A;  2EJS A;  2XSZ A;  4LY6 A;  4MGZ E;  2ZBK B;  4MH0 E;  3HJQ A;  3GLH B;  2EKK A;  4GIP A;  1D2N A;  4XBO A;  3SAW A;  4NSR A;  4G6Z A;  2DWL A;  2DZO B;  4I5S A;  2C5R A;  2XH9 A;  1NHG C;  3MMP A;  3U6L A;  4HLQ A;  4XK8 F;  2R62 A;  1QUT A;  3B74 A;  1ORY B;  4LJ9 A;  3LCU A;  5E6J A;  1Z5A A;  2CUZ A;  4DV3 M;  3CF2 A;  3L27 A;  2UUC M;  4CHT B;  1C7Y A;  2CHG A;  1I4W A;  5L8R F;  1PRB A;  4AKI A;  2C96 A;  4FWH A;  2QBY B;  1TF0 B;  1XWI A;  4MB7 A;  2KNZ A;  3AFH A;  3C3E A;  3M7G A;  4KHP M;  1N78 A;  3I4Y A;  3U5Z A;  2D7G A;  2QP9 X;  2JY8 A;  3KOY E;  4DBG B;  2ZTD A;  4W5W A;  4DV4 M;  2DXI A;  1G4A E;  1ZMW A;  1IN7 A;  4KOD A;  1G59 A;  4JI7 M;  3KDS E;  4CGY B;  1IN4 A;  3T38 A;  2CV1 A;  3HU3 A;  1YLA A;  3L29 A;  4IIW A;  3VK7 A;  3HY5 A;  2EUC A;  1QAO A;  3Q8X A;  2VQF M;  4PT5 A;  3LMM A;  4FWD A;  3HU1 A;  2RRU A;  5LMU M;  4IBE A;  1ZQ9 A;  3SBJ A;  4LF8 M;  1HJP A;  4BLC A;  2V6Z M;  3E21 A;  3I51 A;  4B3M M;  1Q02 A;  3RGS A;  4DR4 M;  2WZJ A;  5ITT A;  1SG9 A;  2CV0 A;  2R4J A;  4G3O A;  1MX0 A;  1SXJ A;  4GC5 A;  4HL4 A;  4DUY M;  2R45 A;  1JQJ C;  1QZM A;  3HZJ A;  3LW5 F;  2L2D A;  4A3V B;  3QAU A;  1PGY A;  4GKJ M;  4MGK E;  4CJ6 A;  5ITR A;  1MJG M;  2X4A A;  3C58 A;  5C1B A;  1L8Q A;  2ZAO A;  3K9P A;  2WSE F;  1T43 A;  1Q3B A;  2JXN A;  3FUX A;  1DGG A;  4L15 A;  1TDZ A;  1Z6T A;  3U5Z B;  2DZN B;  1W5S A;  2QHO B;  2V1U A;  1IFY A;  2CE7 A;  2JZ0 A;  3NWL A;  1PJQ A;  3B7Q A;  2HCB A;  3KOW E;  2UUB M;  3CF6 E;  1T6O A;  4MGI E;  1PJS A;  4DR2 M;  2DAG A;  3W0L B;  4Q7J A;  2LHG A;  4LF4 M;  1IXS A;  1HT1 E;  2OOB A;  1NY6 A;  2D7E A;  1FNN A;  4TUW A;  2XZU A;  3GLI A;  1JB0 F;  1S3S A;  4G4R A;  4PD2 A;  2OOA A;  2KXE A;  4OX9 M;  1GL7 A;  4OU7 A;  1SXJ B;  1G8P A;  4PDI A;  4GHL A;  2YFQ A;  4NL4 H;  3GLI E;  1R6B X;  4R7G A;  4AG6 A;  1PM5 A;  5ITY A;  1DO2 A;  2YR0 A;  2FE8 A;  4OW0 A;  2L6O A;  1L1Z A;  2LH0 A;  2XGN A;  2WSC F;  4KLN A;  3GP1 A;  1PJT A;  4LCB A;  1XNQ M;  5EP3 A;  3U61 A;  3SAR A;  3KS8 A;  3I04 M;  2C99 A;  3ZQJ A;  2APL A;  2K6B A;  1EE8 A;  5EQT A;  2LVP C;  4DUZ M;  1P3Q Q;  1MN3 A;  5KPR A;  4DR5 M;  1G41 A;  4IBD A;  4WUR A;  3SHG B;  5FTJ A;  3U6M A;  3BOS A;  1FJG M;  1HNW M;  1QYR A;  3GLF A;  3Q8G A;  1XMO M;  3AOE C;  2Y0Q A;  3UJN A;  2L4F A;  4DV7 M;  1TH3 A;  2JZ1 A;  4LZZ A;  3GLF E;  2W82 A;  1NHW C;  1GAB A;  1Q3C A;  2CP8 A;  2DAK A;  3SHF A;  3MJ5 A;  2J7N A;  2DAE A;  2DWZ B;  2J7O A;  1WIV A;  1IXS B;  3HGI A;  4B08 A;  3PNY A;  1E94 E;  2R46 A;  2BNK A;  1QQW A;  2OO9 A;  1TGU A;  3K9O A;  4GMQ A;  4GRI A;  5C18 A;  4AQY M;  1QDT A;  3GLI B;  1HQY E;  4IJE A;  1WJ7 A;  3AJI B;  8CAT A;  4DV6 M;  1V34 A;  3AOE A;  3HJS A;  3TL4 X;  4P17 A;  3GPY A;  2Z7J A;  5E26 A;  2JY7 A;  4M0W A;  4JI6 M;  4PCZ A;  4IBI A;  2V1C A;  2CEA A;  3FE3 A;  4IBF A;  5EXX A;  5GKN A;  4GIT A;  1IY1 A;  2Y20 A;  3VLF B;  1KFV A;  4JI4 M;  3SAS A;  1X37 A;  1VG5 A;  1WXQ A;  4M9X A;  3U61 B;  1DGF A;  3HU2 A;  3K1J A;  3THG A;  1K82 A;  1XXH A;  3LQR A;  1N32 M;  3ILK A;  3VDU A;  2F5P A;  5BPV A;  3U6E A;  2Q2E B;  3QYE A;  3T1Y M;  1XXH E;  4NRV A;  2JWS A;  2CV2 A;  3SYK A;  4NRW A;  2XFS A;  2LVQ D;  1NSF A;  1L2B A;  1V33 A;  2MR9 A;  1NNU C;  3TWK A;  3HHW A;  4F1I A;  5A2Q S;  2G3Q A;  2DI0 A;  1YUB A;  3GRV A;  4NXN M;  3GQ3 A;  1R2Y A;  1V92 A;  2JY5 A;  2M5Z A;  3GPP A;  4X66 M;  3T15 A;  1E9R A;  4PDG A;  1D0M A;  2UUA M;  3GPU A;  1PJI A;  3DOA A;  4LG2 A;  4BBA A;  4JI0 M;  1YE9 A;  1OKS A;  2AHM A;  1AIP C;  2VDB B;  3I01 M;  3MK6 A;  1GJS A;  4D81 A;  3U6P A;  3W68 A;  1ZMU A;  3IG8 A;  3EIE A;  3FD9 A;  1HNX M;  2QZ4 A;  3KS4 A;  3SAT A;  2JNH A;  1IXR C;  3FUW A;  3SYL A;  4FWG A;  1K3W A;  3R9X B;  3PVS A;  4DV1 M;  1IY2 A;  3L2A A;  1XXH B;  3V76 A;  5IWA M;  1QDR A;  1TR8 A;  2KZU A;  4Y28 F;  5KQD A;  3HHZ A;  5DFL A;  4ITQ A;  4LFC M;  4LFB M;  4HEO A;  1IN8 A;  2F5N A;  4QNM A;  2HAK A;  1NY5 A;  5FTL A;  4JXJ A;  3U6C A;  1I94 M;  3WHK A;  1G3I A;  1E32 A;  2JA2 A;  1TDH A;  2O01 F;  2R4E A;  4LJ5 A;  4I81 A;  2QNJ A;  2XFT A;  3KSJ A;  4D82 A;  3E4R A;  1QAQ A;  5DYG A;  3TE6 A;  1ZAE A;  4IBC A;  4ZPX A;  3GQ4 A;  1OFH A;  2C9C A;  2QPA A;  1R2Z A;  3R8F A;  1L2D A;  3SMS A;  1H6U A;  2XZF A;  2R44 A;  4X62 M;  4LJ6 A;  3L25 A;  3HX3 A;  3K2L A;  3UMM A;  3ZCB B;  1VEJ A;  3KVW A;  1L2C A;  3DZD A;  1DGH A;  2ZAM A;  5FLX S;  3K8Z A; 
#chains in the Genus database with same CATH homology
 3OTO M;  4L4U A;  1Z5C A;  4QNR A;  3A45 A;  3FKE A;  4B7G A;  1XNR M;  1OJL A;  3IG5 A;  3I4V A;  5EXS A;  3ZH9 B;  4LFA M;  1IBM M;  2F4V M;  1N77 A;  3H4M A;  4IBB A;  1N34 M;  1K3X A;  5EP4 A;  4LZJ A;  2FNA A;  2P5T A;  5F3W A;  1HNZ M;  2OQ4 A;  3HWS A;  1MU5 A;  4JN6 A;  1N33 M;  1TH2 A;  5EXT A;  4DV5 M;  5FTK A;  4X64 M;  3J2P B;  3KW6 A;  4G4N A;  4JI5 M;  4FCT A;  4M0D A;  5FSW A;  2BJV A;  3TWM A;  3U6Q A;  1HR0 M;  4L8R C;  4I8O A;  2YQZ A;  1VDD A;  4II7 A;  3J80 S;  5KQ8 A;  2CHV A;  4LF9 M;  4B7H A;  4AI6 A;  2KW0 A;  3J27 B;  3KP1 E;  3A98 B;  4FW9 A;  1DGH B;  1KYI A;  5IZ7 D;  2DHR A;  1GKI A;  4FVM A;  3AKZ A;  4DV0 M;  1JR3 D;  3LVV A;  4CIS A;  3M0E A;  3VFD A;  4B3T M;  1Q39 A;  1E9S A;  3E9S A;  3U6O A;  3L28 A;  2VII A;  1Z59 A;  4LGY A;  3SMP A;  2G8L A;  5FTN A;  3K92 A;  4NSO B;  4LJ4 A;  5DYI A;  3RFW A;  4JYA M;  5IRE B;  4YHH M;  4G4O A;  4IBJ A;  4IBK A;  4Z6Y A;  2L7I A;  3SAV A;  1C1K A;  3J7B A;  4AZF A;  4DV2 M;  2KRU A;  1PJJ A;  3L26 A;  4DR7 M;  4LJA A;  1QVR A;  1YSY A;  1NVM A;  2M60 A;  4WW0 A;  3J81 S;  4B3R M;  4YY3 M;  3VKG A;  2R18 A;  4RNA A;  4JI8 M;  3VK8 A;  3GPX A;  2F5Q A;  1UM8 A;  2EO2 A;  3PFI A;  2Y21 A;  7CAT A;  4DR1 M;  3EIH A;  4GH9 A;  3GLF B;  2FFJ A;  3RE8 A;  4FCV A;  2K47 A;  2YNM D;  3HHY A;  1J5E M;  1R7R A;  3GRY A;  1L1T A;  2KEB A;  4JI1 M;  5EJC A;  5EXP A;  1DGB A;  1IN6 A;  4D80 A;  3GQ5 A;  3KSX A;  2I7N A;  2C9O A;  3M6A A;  2UU9 M;  3JAM S;  5H37 D;  2HKJ A;  4NXM M;  3GRR A;  3FTD A;  2LWX A;  3T1H M;  3U60 A;  5DNY A;  2DVW B;  4MM3 B;  4QOZ C;  3SC3 A;  3FUU A;  2KA6 B;  2D7H A;  1QAM A;  2DWN A;  3GO8 A;  3PNV A;  2ZM6 M;  4EIW A;  4XGI A;  4LRS A;  5FTM A;  1HT2 E;  4B7F A;  2X8A A;  2XEP A;  3QWL A;  4RF1 A;  4GKK M;  2XF3 A;  1KSF X;  2VQE M;  3ZC7 B;  3U6S A;  1XMQ M;  4AG5 A;  4IJF A;  1JR3 A;  3FTF A;  2RGO A;  4QHT A;  3JR4 A;  2UXD M;  4AW4 A;  3VDP A;  2ERC A;  5ITQ A;  2G5G X;  2HHH M;  2UXC M;  3FYC A;  1T3T A;  1GL6 A;  4QHS A;  2Z4R A;  4RF0 A;  1XHB A;  2BJW A;  3FUT A;  3KP0 E;  5KO3 A;  1IM2 A;  4DR6 M;  1IBL M;  1J09 A;  3D8L A;  5ITU A;  1SXJ C;  2L09 A;  2KRK A;  1W5T A;  3HKP A;  3GLG A;  3U60 B;  4GHA A;  1NJG A;  4JV5 M;  4OVZ A;  3SAU A;  2CFO A;  4S12 A;  4KO8 A;  3FUV A;  5JI2 E;  4M9S A;  2C98 A;  2Z3X A;  2DWM A;  2CHQ A;  3NBI A;  4FCW A;  1SXJ E;  2NQ8 C;  3HJ8 A;  5ITX A;  2LXE A;  4AKH A;  1IXZ A;  3MHV C;  3VKH A;  1IY0 A;  5EP1 A;  1Z5B A;  4FD2 A;  5EP2 A;  5ITX E;  1XC8 A;  2UXB M;  2XSZ D;  4I4L A;  4LF7 M;  3HHX A;  3SFZ A;  4MGH A;  2QCU A;  1IQP A;  3DFZ A;  5JI3 E;  3JR5 A;  1J7K A;  3TWL A;  3AOG A;  4AKG A;  2H1R A;  5KPZ A;  3J7A S;  2E5L M;  2HL7 A;  4GC9 A;  2RGH A;  3B9P A;  3RGP A;  4LGM A;  3GLG B;  4LJ7 A;  2XLJ A;  3CTW B;  4X65 M;  4LF5 M;  1NJF A;  3TQS A;  5LMN M;  1N36 M;  4OVZ B;  2Y0T A;  3AL0 C;  4L16 A;  2A5Y B;  3FTC A;  3AV0 A;  4DR3 M;  2QEN A;  1DO0 A;  4LJ8 A;  3DA1 A;  4M9Z A;  3A42 A;  1IN5 A;  2OPF A;  2O5R A;  3KFU G;  4LRT A;  3U6D A;  2R65 A;  3TPZ A;  3LQQ A;  3LVW A;  3D8B A;  4K0K M;  1QAN A;  3GLH A;  4R3D A;  5BR8 M;  4Z8X A;  3A46 A;  3UK6 A;  2ZAN A;  4JI2 M;  4G4Q A;  4REZ A;  2FOI C;  2L7H A;  3PXG A;  2RKO A;  4QOS A;  1GLN A;  2X49 A;  2F5S A;  1NNJ A;  2LNH C;  3KOZ E;  4P16 A;  3W0F A;  5KPT A;  2Z4S A;  1TH4 A;  3FYD A;  3UGJ A;  4NOO B;  1SXJ D;  1LV7 A;  1HQC A;  3UZU A;  4LF6 M;  2KZS A;  3WHL A;  1N75 A;  3KXE C;  2F5O A;  2QBY A;  4MGY E;  3KOX E;  4L78 A;  2I7P A;  3FTE A;  4IBG A;  1IBK M;  4BB9 A;  4B3S M;  3CF0 A;  3GRU A;  2EA0 A;  4JI3 M;  1GVN A;  1OFI A;  2XSZ A;  4LY6 A;  4MGZ E;  2ZBK B;  4MH0 E;  3HJQ A;  3GLH B;  4GIP A;  1D2N A;  4XBO A;  3SAW A;  4NSR A;  4G6Z A;  2DWL A;  2DZO B;  4I5S A;  2C5R A;  2XH9 A;  1NHG C;  3U6L A;  4HLQ A;  2R62 A;  1ORY B;  4LJ9 A;  5E6J A;  1Z5A A;  2CUZ A;  4DV3 M;  3CF2 A;  3L27 A;  2UUC M;  4CHT B;  2CHG A;  1I4W A;  4AKI A;  2C96 A;  4FWH A;  2QBY B;  4KHP M;  1XWI A;  4MB7 A;  3AFH A;  3M7G A;  1N78 A;  3I4Y A;  3U5Z A;  2D7G A;  2QP9 X;  3KOY E;  4W5W A;  4DV4 M;  2DXI A;  1G4A E;  1IN7 A;  4KOD A;  1G59 A;  4JI7 M;  3KDS E;  4CGY B;  1IN4 A;  3T38 A;  2CV1 A;  3HU3 A;  3L29 A;  4IIW A;  3VK7 A;  2EUC A;  1QAO A;  3Q8X A;  2VQF M;  4PT5 A;  3LMM A;  4FWD A;  3HU1 A;  5LMU M;  4IBE A;  1ZQ9 A;  3SBJ A;  4LF8 M;  4BLC A;  2V6Z M;  3I51 A;  4B3M M;  3RGS A;  4DR4 M;  5ITT A;  2CV0 A;  2R4J A;  4HL4 A;  1MX0 A;  1SXJ A;  4GC5 A;  4DUY M;  2R45 A;  1JQJ C;  1QZM A;  4A3V B;  3QAU A;  4GKJ M;  4MGK E;  5ITR A;  2X4A A;  3C58 A;  5C1B A;  1L8Q A;  2ZAO A;  1Q3B A;  3FUX A;  1DGG A;  4L15 A;  1TDZ A;  1Z6T A;  3U5Z B;  2DZN B;  1W5S A;  2V1U A;  2CE7 A;  3NWL A;  2HCB A;  3KOW E;  2UUB M;  3CF6 E;  4MGI E;  4DR2 M;  3W0L B;  4LF4 M;  1HT1 E;  1NY6 A;  2D7E A;  1FNN A;  4TUW A;  2XZU A;  3GLI A;  4G4R A;  1S3S A;  4OX9 M;  4PD2 A;  2KXE A;  1GL7 A;  4OU7 A;  1SXJ B;  1G8P A;  4PDI A;  4GHL A;  2YFQ A;  4NL4 H;  1R6B X;  4R7G A;  4AG6 A;  1PM5 A;  5ITY A;  1DO2 A;  2YR0 A;  2FE8 A;  4OW0 A;  2L6O A;  1L1Z A;  2LH0 A;  2XGN A;  4KLN A;  3GP1 A;  4LCB A;  1XNQ M;  5EP3 A;  3U61 A;  3SAR A;  3KS8 A;  2C99 A;  1EE8 A;  5EQT A;  4DUZ M;  5KPR A;  4DR5 M;  1G41 A;  4IBD A;  4WUR A;  3SHG B;  5FTJ A;  3U6M A;  3BOS A;  1FJG M;  1HNW M;  1QYR A;  3GLF A;  1XMO M;  3AOE C;  2Y0Q A;  3UJN A;  4DV7 M;  1TH3 A;  4LZZ A;  2W82 A;  1NHW C;  1Q3C A;  3SHF A;  3MJ5 A;  2J7N A;  2DWZ B;  2J7O A;  3HGI A;  1IXS B;  4B08 A;  3PNY A;  1E94 E;  2R46 A;  2BNK A;  1QQW A;  4GMQ A;  1TGU A;  4GRI A;  5C18 A;  4AQY M;  3GLI B;  1HQY E;  4IJE A;  3AJI B;  8CAT A;  4DV6 M;  3AOE A;  3HJS A;  3TL4 X;  3GPY A;  2Z7J A;  5E26 A;  4M0W A;  4JI6 M;  4PCZ A;  4IBI A;  2V1C A;  2CEA A;  4IBF A;  5EXX A;  5GKN A;  4GIT A;  1IY1 A;  2Y20 A;  3VLF B;  1KFV A;  4JI4 M;  3SAS A;  1X37 A;  1WXQ A;  4M9X A;  3U61 B;  1DGF A;  3HU2 A;  3K1J A;  3THG A;  1K82 A;  1XXH A;  3LQR A;  1N32 M;  3ILK A;  3VDU A;  2F5P A;  5BPV A;  3U6E A;  2Q2E B;  3T1Y M;  4NRV A;  2CV2 A;  3SYK A;  4NRW A;  2XFS A;  1NSF A;  1L2B A;  1NNU C;  3TWK A;  3HHW A;  5A2Q S;  1YUB A;  3GRV A;  4NXN M;  3GQ3 A;  1R2Y A;  2M5Z A;  3GPP A;  4X66 M;  3T15 A;  1E9R A;  4PDG A;  2UUA M;  3GPU A;  1PJI A;  3DOA A;  4BBA A;  4JI0 M;  1YE9 A;  2AHM A;  3MK6 A;  4D81 A;  3U6P A;  3IG8 A;  3EIE A;  3FD9 A;  1HNX M;  2QZ4 A;  3KS4 A;  3SAT A;  1IXR C;  3FUW A;  3SYL A;  4FWG A;  1K3W A;  3R9X B;  3PVS A;  4DV1 M;  1IY2 A;  3L2A A;  1XXH B;  5IWA M;  4LG2 A;  5IT9 S;  2KZU A;  5KQD A;  3HHZ A;  4LFB M;  4LFC M;  4ITQ A;  1IN8 A;  2F5N A;  4QNM A;  1NY5 A;  5FTL A;  4JXJ A;  3U6C A;  1I94 M;  3WHK A;  1G3I A;  1E32 A;  2JA2 A;  1TDH A;  2R4E A;  4LJ5 A;  4I81 A;  3KSJ A;  2XFT A;  4D82 A;  3E4R A;  1QAQ A;  5DYG A;  3TE6 A;  1ZAE A;  4IBC A;  4ZPX A;  3GQ4 A;  1OFH A;  2C9C A;  2QPA A;  1R2Z A;  3R8F A;  1L2D A;  3SMS A;  1H6U A;  2XZF A;  4X62 M;  4LJ6 A;  3L25 A;  3K2L A;  3UMM A;  3ZCB B;  3KVW A;  1L2C A;  3DZD A;  1DGH A;  2ZAM A;  5FLX S;  3K8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...