2P5TA

Molecular and structural characterization of the pezat chromosomal toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
92
structure length
92
Chain Sequence
LNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fragment of PezA helix-turn-helix motif
publication title Molecular and Structural Characterization of the PezAT Chromosomal Toxin-Antitoxin System of the Human Pathogen Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription regulator
total genus 38
structure length 92
sequence length 92
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2p5tA00
1GVNA 2P5TA 3Q8XA
chains in the Genus database with same CATH superfamily
2DAEA 1ZAEA 3C3EA 3RGSA 5DYIA 2CV2A 1J09A 5H37D 2XF3A 1IY2A 2YQZA 1LTMA 2WSCF 2JXNA 3HX3A 4PD2A 1D0MA 1FJGM 1DGHA 3SBJA 3UK6A 1ZV1A 2DI0A 4WW0A 4XBOA 5ITYA 1QAMA 2LXEA 2EUCA 3GLFE 1TTEA 3GPUA 3SHFA 1L2BA 3C9PA 2NQ8C 4RKUF 5IT9S 1IBLM 2XSZA 1VEGA 3I51A 4IIWA 3GPXA 3GQ4A 1W5TA 4AW4A 5KQ8A 2L09A 3GLIB 4S12A 4LFAM 2XFSA 2I7NA 1HNZM 1JR3D 2JNHA 2M5ZA 2DXIA 4LF7M 2J5YA 2QBYB 4LJAA 4LY6A 2QPAA 2V1UA 1QANA 4OX9M 4NXNM 3SYKA 3FTDA 2OOBA 4ANRA 4BLCA 4AI6A 2JA2A 4MB7A 2XFTA 2KHHA 1HJPA 3A45A 3GRRA 3KS4A 1TGUA 4DV4M 1PJIA 2P5TA 2YFQA 3GLHB 4MGZE 1RU3A 2MH8A 2F5SA 5EXPA 1JQJC 4JI2M 4CGYB 1R7RA 3FE3A 3DA1A 4XGIA 2K0BX 4M9SA 3UZUA 4IBCA 4GKJM 2C98A 2BWBA 2ZTDA 4AZFA 4DR1M 5KPZA 2EA0A 2JZ0A 4WP2A 2CUZA 4LF6M 2APLA 3CGWA 4II7A 2JY8A 4CIZA 3LQQA 1JR3A 2CRUA 2EJSA 3C3DA 3RFWA 1VQ1A 2R4EA 3J7BA 4IJFA 5ITXE 4P16A 3PNYA 2FS1A 4PDIA 2DWMA 4KHPM 2BWEA 4GH9A 8CATA 3U6SA 1R6BX 4FVMA 2HHHM 4QHTA 1G41A 4ITQA 4LJ4A 3GQ5A 2KW0A 1OIPA 2C96A 2KRKA 4IBBA 4F2LA 1N78A 1E9RA 4MM3B 3U5ZB 4DV3M 1NVMA 3DZDA 4UN2B 3VK7A 4I5SA 4MGIE 4MGKE 4KLNA 4LJ8A 4LCBA 3GQ3A 3Q8XA 1IXRC 1C1KA 1IXSA 3U61B 2C99A 2I7PA 3KVWA 4BB9A 4DR5M 1K82A 2CV0A 3GRVA 3PFIA 1XXHA 5KPRA 1OKSA 4B3MM 3U6CA 1N77A 1A5TA 5C18A 2QHOB 4IBGA 3FTFA 3T38A 5FSWA 3E21A 2F5OA 2CFOA 2QSFX 3LCVB 3H4MA 3J80S 4JYAM 2H1RA 3AJIB 3B7ZA 1H6UA 3K9OA 4NSRA 3HHZA 3QAUA 4LF9M 3PNVA 4DV6M 5FTJA 1X37A 2GNOA 2Z4RA 4CHTB 1GJSA 1ZMUA 2FH0A 1KSFX 1EIJA 1Z5BA 4PDGA 2F5PA 2XLJA 4PCZA 2ZM6M 2H5XA 4DR7M 1FNNA 4Z8XA 1QZMA 2KNVA 2Q2EB 3IECA 5DYGA 2R65A 3GP1A 4AKGA 2G8LA 3V76A 3EIHA 1Y8GA 2ZBKB 2R0IA 3LCUA 2FE8A 1NSFA 2F5QA 1HNWM 2X8AA 1GO5A 3B7QA 3GLFB 4ZPXA 4DV2M 3FTEA 3ILKA 1Q39A 3EIEA 4Z6YA 4AG5A 4DV0M 3HKPA 5FTNA 2Z7JA 3FRHA 3KOZE 4IBEA 4LF4M 4RF1A 4JV5M 2DZNB 1WR1B 1N33M 4FCWA 4GIPA 1UFZA 2KZUA 2CHGA 4BBAA 2JWSA 1GL7A 3T15A 3KSXA 2FFJA 2QQ8A 1G71A 1NY6A 1HR0M 1NV8A 3MHVC 4FWHA 3MJ5A 3HJQA 5EJCA 4QOZC 3AL0C 1QUSA 1OAIA 3SAUA 2R18A 3KP1E 1QAQA 1XMQM 2UXBM 1Q3BA 1AUAA 4F1IA 2KA6B 3D8LA 2VDBB 2ZAMA 3GLGA 3T1HM 1NY5A 2EKKA 3CF6E 3MK6A 1J7KA 4JI0M 3M7GA 3SHGB 3LQRA 4YHHM 3I4VA 3HU2A 4OVZA 2VQEM 3L25A 2LHCA 3FKEA 2J7NA 3KOYE 5ITRA 2OOAA 4W5WA 3U6MA 3HZJA 2LVPC 1Z5AA 1OIZA 2HAKA 2L7IA 1YUBA 1VEKA 5JI2E 1PJQA 2CP8A 5ITTA 1F4IA 4AKHA 2L7HA 2DZOB 4LJ7A 1ORYB 2R62A 4GRIA 1K3WA 3HHWA 2C5RA 3QWLA 1HQYE 5E26A 4XK8F 1TR8A 4WURA 2JY5A 3AOEA 3KW6A 3DFZA 2LVQD 2K47A 3K8ZA 3QYEA 2A5YB 4LJ6A 4DV1M 1V92A 3FYCA 1G3IA 1TH2A 3NBIA 4KODA 1JR3E 2X49A 1XNQM 2F4VM 1DO0A 5LMNM 2LVNC 5E6JA 1R2YA 1K3XA 4QNMA 1MU5A 3HJ8A 2BNKA 2D7GA 1S3SA 2OPFA 1DGBA 3K92A 2CEAA 1NJGA 5EXXA 3RGPA 2LBCA 1XWIA 4GHAA 1GABA 1G59A 1VEJA 1T43A 3BXWA 4GC5A 5EXSA 3U60B 1SXJD 1VG5A 4KT0F 5EXTA 3H4JA 3L28A 2V6ZM 2JY7A 3KOXE 1PJSA 2DVWB 2MJ5B 2XGNA 3FUUA 5F3WA 3I04M 4JI5M 1DV0A 5IZ7D 1XXHE 3VK8A 4RNAA 4L6V6 2XZUA 2QENA 2L6OA 1MN3A 1G4AE 3SMPA 3GO8A 1OAOC 3FUWA 4M9XA 2UXCM 2L4FA 3W67A 4EIWA 4YY3M 2C9OA 2MROB 2RRUA 2UU9M 1NJFA 1N32M 1KYIA 2Y0TA 3PVSA 3HWSA 1Z6TA 3TQSA 3TWLA 2O01F 1SXJA 2MR9A 4GEWA 4LJ5A 1YSYA 3SYLA 5KQDA 4AQYM 3FUTA 5BPVA 3HHXA 2DENA 2RGHA 4LZZA 1L1ZA 1WGNA 5DNYA 4LF8M 3LVVA 1N34M 1XHBA 3CTWB 1HQCA 1WXQA 3A42A 3KXEC 2VF7A 1T6OA 3B9PA 4JN6A 4FCVA 3R9XB 4IBIA 1DGHB 1TF0B 3L29A 3B7NA 3SATA 2OO9A 4B3RM 2BJWA 4AKIA 4IBFA 2ZTCA 3CF0A 3TE6A 4LJ9A 1IN6A 4I4LA 5ITXA 2GQFA 4LGYA 3MMPA 2R46A 2R45A 4D81A 1TDHA 2DAGA 4JI1M 3LW5F 7CATA 1GKIA 3WHKA 1DGFA 3GLIA 2LH0A 2VIIA 2E5LM 4DR6M 4REZA 1IBMM 2V1CA 1QQWA 4I8OA 1NNJA 2LHGA 2Y21A 5LMUM 2QBYA 3KOWE 3L2AA 1TH3A 1IY0A 5ITUA 3L26A 3M0EA 4LZJA 3UGJA 3GLHA 5GKNA 4G4OA 3SAWA 2DWNA 3AV0A 1OTRA 1IQPA 4GMQA 4M0DA 4JI4M 1DGGA 3GLGE 1E32A 4G4QA 1PJTA 3AFHA 3FD9A 3U6PA 5EP1A 3K2LA 4GC9A 1E9SA 4LFBM 1ZMWA 5BR8M 2RGOA 3J81S 3JR5A 1L2CA 5ITQA 2MGWA 3HJSA 3LVWA 4R3DA 4IBKA 2R6FA 5EQTA 1WHCA 3U6QA 5L8RF 2DWLA 4JI7M 2CHQA 1N75A 1YLAA 1EE8A 4DV5M 2LTUA 1R5LA 3JAMS 2VQFM 5IWAM 1OFHA 2BJVA 2HCBA 4CJ6A 4L16A 3W0LB 4G4RA 1I94M 1SXJC 5EP2A 1OJLA 3U5ZA 4G3OA 4B7FA 1V34A 4JI8M 3T6PA 2DHYA 2KDLA 1XB2B 2EKFA 2R4JA 3FTCA 3IHPA 3KS8A 1QDRA 1IXSB 2CV1A 3U61A 2ERCA 3K9PA 4G4NA 3U6EA 1XXHB 2XH9A 1IN8A 4Y28F 2C9CA 3E46A 2LVAA 1PRBA 4FD2A 4HL4A 4IBJA 5FLXS 3J7AS 2AHMA 2Z4SA 2HKJA 3BBZA 2ZANA 1GLNA 1VDDA 4IBDA 4NC6A 4LF5M 1IFYA 4PT5A 1D2NA 3L27A 4NRWA 2G3QA 2DZLA 2W82A 3D8BA 2CE7A 3DOAA 4B08A 4TUWA 1HNXM 3VKHA 2DKLA 4M0WA 1MX0A 1Q02A 3TWKA 4X66M 1V33A 1Z5CA 1LV7A 4NSOB 1T3TA 3GRYA 3RE8A 2J7OA 4R7GA 2KXEA 5KPTA 4GHLA 1E94E 2KEBA 1L8QA 4I81A 4DBGB 4Q7JA 3J27B 3CF2A 2RKOA 4MGHA 1Q3CA 4IJEA 2Y20A 3IG8A 3QYBA 2Z3XA 2QNJA 2VF8A 4FCTA 1CUKA 3KDSE 1I4WA 3HY5A 1TDZA 3GPYA 3NWLA 5FTLA 3AKZA 4DUYM 2FNAA 1ZQ9A 1DO2A 3VLFB 1BVSA 1VDLA 4FWGA 4D80A 4NL4H 3SFZA 2Y0QA 4LG2A 3UMMA 4FWDA 3K1JA 4LGMA 1IM2A 3GLFA 3TWMA 1Z59A 1IN4A 1UM8A 4FW9A 4NRVA 1GL6A 1SXJE 2OQ4A 5IREB 1J5EM 1OFIA 2JZ1A 1IY1A 4A3VB 3Q8GA 3ZCBB 2UXDM 4DR4M 3E9SA 1JB0F 1D0KA 3PXGA 4AG6A 1MJGM 2KNZA 3WHLA 2UUCM 2F5NA 3GPPA 3KP0E 1XNRM 2DAKA 3E4RA 4X62M 4NOOB 4DV7M 3TL4X 3SASA 3J2PB 2M60A 1YE9A 2K9DA 3A98B 1QVRA 3KSJA 3T1YM 2L2DA 4P17A 4QHSA 4QNRA 2XEPA 3B89A 4LRSA 5FTMA 3VKGA 2LNHC 2DNAA 4L15A 4L4UA 5EP3A 3GRUA 4M9ZA 3UJNA 1D0LA 3GLGB 1NO1A 3IG5A 3A46A 2QZ4A 3I01M 3HHYA 4R71A 4QOSA 2LWXA 3GLIE 1PM5A 1G8PA 4OVZB 3HGIA 3LMMA 5FTKA 1IBKM 2YNMD 4DUZM 1QAOA 1L1TA 2FOIC 4X64M 2KRUA 2QP9X 3THGA 3JR4A 2KZSA 4HLQA 3SARA 3VDUA 4X65M 5C1BA 3AOEC 5EP4A 2X4AA 3NBXX 2N35A 3FUXA 3I4YA 1EFUB 3GLHE 4DR2M 3BOSA 3HU3A 1OQYA 3M6AA 3VFDA 1NHGC 1QDTA 1QUTA 4JXJA 2O5RA 3U6LA 1NHWC 4G6ZA 2D7HA 1IXZA 4HEOA 1C7YA 2HL7A 4B7HA 2JUJA 1ZMVA 4JI6M 4MGYE 2YR0A 3KFUG 4L78A 5A2QS 4LFCM 3W68A 1HT1E 1XMOM 3FRIA 2XZFA 1HT2E 1AIPC 1TH4A 4D82A 2JP7A 1XC8A 4OU7A 1R2ZA 2WSEF 2Z8YM 1R4GA 1KFVA 3B74A 3ZC7B 4MH0E 1NNUC 1PJJA 2R44A 5KO3A 2ZAOA 4B3SM 4KO8A 1IN5A 3U60A 2HWJA 3TPZA 1WGLA 2K6BA 4GKKM 3HU1A 2D7EA 3W0FA 2DWZB 3SMSA 5JI3E 1PGYA 3FUVA 4B3TM 1NV9A 1QZEA 2L4EA 3F92A 3VDPA 2CWBA 2QCUA 4K0KM 4OW0A 3AOGA 4CISA 4LRTA 1GJTA 1N36M 3U6OA 3FYDA 1SG9A 1QYRA 2O25A 2B3TA 3C58A 3ZQJA 2DAIA 2EO2A 1IN7A 2CHVA 2WZJA 4DR3M 1GVNA 3SC3A 1WJ7A 1WIVA 4RF0A 3ZH9B 1L2DA 2G5GX 2UUBM 1W5SA 1P3QQ 5DFLA 3SAVA 2LVOC 2XSZD 2DHRA 4B7GA 2UUAM 1SXJB 2KNAA 3R8FA 3OTOM 4L8RC 2WSFF 2JY6B 4JI3M 3U6DA 4GITA 4NXMM 2DAMA
chains in the Genus database with same CATH topology
1ZAEA 3RGSA 5DYIA 2CV2A 1J09A 5H37D 2XF3A 1IY2A 2YQZA 4PD2A 1FJGM 1DGHA 3SBJA 3UK6A 4WW0A 4XBOA 5ITYA 1QAMA 2EUCA 2LXEA 3GPUA 3SHFA 1L2BA 2NQ8C 5IT9S 1IBLM 2XSZA 3I51A 4IIWA 3GPXA 3GQ4A 1W5TA 4AW4A 5KQ8A 2L09A 3GLIB 4S12A 4LFAM 2XFSA 2I7NA 1HNZM 1JR3D 2DXIA 2M5ZA 4LF7M 2QBYB 4LJAA 4LY6A 2QPAA 2V1UA 1QANA 4OX9M 4NXNM 3SYKA 3FTDA 4BLCA 4AI6A 2JA2A 4MB7A 2XFTA 3GRRA 3A45A 3KS4A 1TGUA 4DV4M 1PJIA 2P5TA 2YFQA 3GLHB 4MGZE 2F5SA 5EXPA 1JQJC 4JI2M 4CGYB 1R7RA 4XGIA 3DA1A 4GKJM 4M9SA 3UZUA 4IBCA 2C98A 4AZFA 4DR1M 5KPZA 2EA0A 2CUZA 4LF6M 4II7A 3LQQA 1JR3A 3RFWA 2R4EA 3J7BA 4IJFA 5ITXE 4P16A 3PNYA 4PDIA 2DWMA 4KHPM 8CATA 4GH9A 3U6SA 1R6BX 4FVMA 2HHHM 4QHTA 1G41A 4ITQA 4LJ4A 3GQ5A 2KW0A 2C96A 2KRKA 4IBBA 1N78A 1E9RA 4MM3B 3U5ZB 4DV3M 1NVMA 3DZDA 3VK7A 4I5SA 4MGIE 4MGKE 4KLNA 4LJ8A 4LCBA 3GQ3A 3Q8XA 1IXRC 1C1KA 3U61B 2C99A 2I7PA 3KVWA 4BB9A 4DR5M 1K82A 2CV0A 3GRVA 3PFIA 1XXHA 5KPRA 4B3MM 3U6CA 1N77A 5C18A 4IBGA 3FTFA 3T38A 5FSWA 2F5OA 2CFOA 3J80S 3H4MA 4JYAM 2H1RA 3AJIB 1H6UA 4NSRA 3HHZA 3QAUA 4LF9M 3PNVA 4DV6M 5FTJA 1X37A 2Z4RA 4CHTB 1KSFX 1Z5BA 4PDGA 2F5PA 2XLJA 4PCZA 2ZM6M 4DR7M 1FNNA 4Z8XA 1QZMA 5DYGA 2Q2EB 2R65A 3GP1A 4AKGA 2G8LA 3EIHA 2ZBKB 2FE8A 1NSFA 2F5QA 1HNWM 2X8AA 3GLFB 4ZPXA 4DV2M 3FTEA 3ILKA 1Q39A 3EIEA 4Z6YA 4AG5A 4DV0M 3HKPA 5FTNA 2Z7JA 3KOZE 4IBEA 4LF4M 4RF1A 4JV5M 2DZNB 1N33M 4FCWA 4GIPA 2KZUA 2CHGA 4BBAA 1GL7A 3T15A 3KSXA 2FFJA 1NY6A 1HR0M 3MHVC 4FWHA 3MJ5A 3HJQA 5EJCA 4QOZC 3AL0C 3SAUA 2R18A 3KP1E 1QAQA 1XMQM 2UXBM 1Q3BA 2KA6B 3D8LA 2ZAMA 3GLGA 3T1HM 1NY5A 3CF6E 3MK6A 1J7KA 4JI0M 3M7GA 3SHGB 3LQRA 4YHHM 3I4VA 3HU2A 4OVZA 2VQEM 3L25A 3FKEA 2J7NA 3KOYE 5ITRA 4W5WA 3U6MA 1Z5AA 2L7IA 1YUBA 5JI2E 4AKHA 5ITTA 2L7HA 2DZOB 4LJ7A 1ORYB 2R62A 4GRIA 1K3WA 3HHWA 2C5RA 3QWLA 1HQYE 5E26A 4WURA 3AOEA 3KW6A 3DFZA 2K47A 3K8ZA 2A5YB 4LJ6A 4DV1M 3FYCA 1G3IA 1TH2A 3NBIA 4KODA 2X49A 1XNQM 2F4VM 1DO0A 5LMNM 5E6JA 1R2YA 1K3XA 4QNMA 1MU5A 3HJ8A 2BNKA 2D7GA 1S3SA 2OPFA 1DGBA 3K92A 2CEAA 1NJGA 5EXXA 3RGPA 1XWIA 4GHAA 1G59A 5EXSA 4GC5A 3U60B 1SXJD 5EXTA 3L28A 2V6ZM 3KOXE 2DVWB 2XGNA 4JI5M 3FUUA 5F3WA 5IZ7D 3VK8A 4RNAA 2XZUA 2QENA 2L6OA 1G4AE 3SMPA 3GO8A 3FUWA 4M9XA 2UXCM 4EIWA 4YY3M 2C9OA 2UU9M 1NJFA 1N32M 1KYIA 2Y0TA 3PVSA 3HWSA 1Z6TA 3TQSA 3TWLA 1SXJA 4LJ5A 5KQDA 4AQYM 1YSYA 3SYLA 3FUTA 5BPVA 3HHXA 2RGHA 4LZZA 1L1ZA 5DNYA 4LF8M 3LVVA 1N34M 1XHBA 3CTWB 1HQCA 1WXQA 3A42A 3KXEC 3B9PA 4JN6A 3R9XB 4FCVA 4IBIA 1DGHB 3L29A 3SATA 4B3RM 2BJWA 4AKIA 4IBFA 3CF0A 3TE6A 4LJ9A 1IN6A 4I4LA 5ITXA 4LGYA 2R46A 2R45A 4D81A 1TDHA 4JI1M 7CATA 1GKIA 3WHKA 1DGFA 3GLIA 2LH0A 2VIIA 2E5LM 4DR6M 4REZA 1IBMM 2V1CA 1QQWA 4I8OA 1NNJA 2Y21A 2QBYA 5LMUM 3KOWE 3L2AA 1TH3A 1IY0A 5ITUA 3L26A 3M0EA 4LZJA 3UGJA 3GLHA 5GKNA 4G4OA 3SAWA 2DWNA 3AV0A 1IQPA 4GMQA 4M0DA 4JI4M 1DGGA 1E32A 4G4QA 3AFHA 3FD9A 3U6PA 5EP1A 3K2LA 4GC9A 1E9SA 4LFBM 5BR8M 2RGOA 3J81S 3JR5A 1L2CA 5ITQA 3HJSA 3LVWA 4R3DA 4IBKA 3U6QA 5EQTA 2DWLA 4JI7M 2CHQA 1N75A 1EE8A 4DV5M 3JAMS 2VQFM 5IWAM 1OFHA 2BJVA 2HCBA 4L16A 3W0LB 4G4RA 1I94M 1SXJC 5EP2A 1OJLA 3U5ZA 4JI8M 4B7FA 2R4JA 3FTCA 3KS8A 1IXSB 2CV1A 3U61A 2ERCA 4G4NA 3U6EA 1XXHB 2XH9A 1IN8A 5FLXS 2C9CA 4FD2A 4HL4A 4IBJA 3J7AS 2AHMA 2Z4SA 2HKJA 2ZANA 1GLNA 1VDDA 4IBDA 4LF5M 4PT5A 1D2NA 3L27A 4NRWA 2W82A 3D8BA 2CE7A 3DOAA 4B08A 4TUWA 1HNXM 3VKHA 4M0WA 1MX0A 3TWKA 4X66M 1Z5CA 4NSOB 1LV7A 1T3TA 3GRYA 3RE8A 2J7OA 4R7GA 2KXEA 5KPTA 4GHLA 1E94E 2KEBA 1L8QA 4I81A 3J27B 3CF2A 2RKOA 4MGHA 1Q3CA 4IJEA 2Y20A 3IG8A 2Z3XA 4FCTA 3KDSE 1I4WA 1TDZA 3GPYA 3NWLA 5FTLA 3AKZA 4DUYM 2FNAA 1ZQ9A 1DO2A 3VLFB 4D80A 4FWGA 4NL4H 3SFZA 2Y0QA 4LG2A 3UMMA 4FWDA 3K1JA 4LGMA 1IM2A 3GLFA 3TWMA 1Z59A 1IN4A 1UM8A 4FW9A 4NRVA 1GL6A 1SXJE 2OQ4A 5IREB 1J5EM 1OFIA 1IY1A 4A3VB 3ZCBB 2UXDM 4DR4M 3E9SA 3PXGA 4AG6A 2UUCM 3WHLA 2F5NA 3GPPA 3KP0E 1XNRM 3E4RA 4X62M 4NOOB 4DV7M 3TL4X 3SASA 3J2PB 2M60A 1YE9A 3A98B 1QVRA 3KSJA 3T1YM 4QHSA 4QNRA 2XEPA 4LRSA 5FTMA 3VKGA 2LNHC 4L15A 4L4UA 5EP3A 3GRUA 4M9ZA 3UJNA 3GLGB 3IG5A 3A46A 2QZ4A 3HHYA 4QOSA 2LWXA 1PM5A 1G8PA 4OVZB 3HGIA 3LMMA 5FTKA 1IBKM 2YNMD 4DUZM 1QAOA 1L1TA 2FOIC 4X64M 2KRUA 2QP9X 3THGA 3JR4A 2KZSA 4HLQA 3SARA 3VDUA 4X65M 5C1BA 3AOEC 5EP4A 2X4AA 3FUXA 3I4YA 4DR2M 3BOSA 3HU3A 3M6AA 3VFDA 1NHGC 4JXJA 2O5RA 3U6LA 1NHWC 4G6ZA 2D7HA 1IXZA 2HL7A 4B7HA 4JI6M 4MGYE 2YR0A 3KFUG 4L78A 5A2QS 4LFCM 1HT1E 1XMOM 2XZFA 1HT2E 1TH4A 4D82A 1XC8A 4OU7A 1R2ZA 1KFVA 3ZC7B 4MH0E 1NNUC 1PJJA 5KO3A 2ZAOA 4B3SM 4KO8A 1IN5A 3U60A 3TPZA 4GKKM 3HU1A 2D7EA 3W0FA 2DWZB 3SMSA 5JI3E 3FUVA 4B3TM 3VDPA 2QCUA 4K0KM 4OW0A 3AOGA 4CISA 4LRTA 1N36M 3U6OA 3FYDA 1QYRA 3C58A 2EO2A 1IN7A 2CHVA 4DR3M 1GVNA 3SC3A 3ZH9B 4RF0A 1L2DA 2G5GX 2UUBM 1W5SA 3SAVA 2XSZD 2DHRA 4B7GA 2UUAM 1SXJB 3R8FA 3OTOM 4L8RC 3U6DA 4JI3M 4GITA 4NXMM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVN A;  2P5T A;  3Q8X A; 
#chains in the Genus database with same CATH topology
 2DAE A;  1ZAE A;  3C3E A;  3RGS A;  5DYI A;  2CV2 A;  1J09 A;  5H37 D;  2XF3 A;  1IY2 A;  2YQZ A;  1LTM A;  2WSC F;  2JXN A;  3HX3 A;  4PD2 A;  1D0M A;  1FJG M;  1DGH A;  3SBJ A;  3UK6 A;  1ZV1 A;  2DI0 A;  4WW0 A;  4XBO A;  5ITY A;  1QAM A;  2LXE A;  2EUC A;  3GLF E;  1TTE A;  3GPU A;  3SHF A;  1L2B A;  3C9P A;  2NQ8 C;  4RKU F;  5IT9 S;  1IBL M;  2XSZ A;  1VEG A;  3I51 A;  4IIW A;  3GPX A;  3GQ4 A;  1W5T A;  4AW4 A;  5KQ8 A;  2L09 A;  3GLI B;  4S12 A;  4LFA M;  2XFS A;  2I7N A;  1HNZ M;  1JR3 D;  2JNH A;  2M5Z A;  2DXI A;  4LF7 M;  2J5Y A;  2QBY B;  4LJA A;  4LY6 A;  2QPA A;  2V1U A;  1QAN A;  4OX9 M;  4NXN M;  3SYK A;  3FTD A;  2OOB A;  4ANR A;  4BLC A;  4AI6 A;  2JA2 A;  4MB7 A;  2XFT A;  2KHH A;  1HJP A;  3A45 A;  3GRR A;  3KS4 A;  1TGU A;  4DV4 M;  1PJI A;  2P5T A;  2YFQ A;  3GLH B;  4MGZ E;  1RU3 A;  2MH8 A;  2F5S A;  5EXP A;  1JQJ C;  4JI2 M;  4CGY B;  1R7R A;  3FE3 A;  3DA1 A;  4XGI A;  2K0B X;  4M9S A;  3UZU A;  4IBC A;  4GKJ M;  2C98 A;  2BWB A;  2ZTD A;  4AZF A;  4DR1 M;  5KPZ A;  2EA0 A;  2JZ0 A;  4WP2 A;  2CUZ A;  4LF6 M;  2APL A;  3CGW A;  4II7 A;  2JY8 A;  4CIZ A;  3LQQ A;  1JR3 A;  2CRU A;  2EJS A;  3C3D A;  3RFW A;  1VQ1 A;  2R4E A;  3J7B A;  4IJF A;  5ITX E;  4P16 A;  3PNY A;  2FS1 A;  4PDI A;  2DWM A;  4KHP M;  2BWE A;  4GH9 A;  8CAT A;  3U6S A;  1R6B X;  4FVM A;  2HHH M;  4QHT A;  1G41 A;  4ITQ A;  4LJ4 A;  3GQ5 A;  2KW0 A;  1OIP A;  2C96 A;  2KRK A;  4IBB A;  4F2L A;  1N78 A;  1E9R A;  4MM3 B;  3U5Z B;  4DV3 M;  1NVM A;  3DZD A;  4UN2 B;  3VK7 A;  4I5S A;  4MGI E;  4MGK E;  4KLN A;  4LJ8 A;  4LCB A;  3GQ3 A;  3Q8X A;  1IXR C;  1C1K A;  1IXS A;  3U61 B;  2C99 A;  2I7P A;  3KVW A;  4BB9 A;  4DR5 M;  1K82 A;  2CV0 A;  3GRV A;  3PFI A;  1XXH A;  5KPR A;  1OKS A;  4B3M M;  3U6C A;  1N77 A;  1A5T A;  5C18 A;  2QHO B;  4IBG A;  3FTF A;  3T38 A;  5FSW A;  3E21 A;  2F5O A;  2CFO A;  2QSF X;  3LCV B;  3H4M A;  3J80 S;  4JYA M;  2H1R A;  3AJI B;  3B7Z A;  1H6U A;  3K9O A;  4NSR A;  3HHZ A;  3QAU A;  4LF9 M;  3PNV A;  4DV6 M;  5FTJ A;  1X37 A;  2GNO A;  2Z4R A;  4CHT B;  1GJS A;  1ZMU A;  2FH0 A;  1KSF X;  1EIJ A;  1Z5B A;  4PDG A;  2F5P A;  2XLJ A;  4PCZ A;  2ZM6 M;  2H5X A;  4DR7 M;  1FNN A;  4Z8X A;  1QZM A;  2KNV A;  2Q2E B;  3IEC A;  5DYG A;  2R65 A;  3GP1 A;  4AKG A;  2G8L A;  3V76 A;  3EIH A;  1Y8G A;  2ZBK B;  2R0I A;  3LCU A;  2FE8 A;  1NSF A;  2F5Q A;  1HNW M;  2X8A A;  1GO5 A;  3B7Q A;  3GLF B;  4ZPX A;  4DV2 M;  3FTE A;  3ILK A;  1Q39 A;  3EIE A;  4Z6Y A;  4AG5 A;  4DV0 M;  3HKP A;  5FTN A;  2Z7J A;  3FRH A;  3KOZ E;  4IBE A;  4LF4 M;  4RF1 A;  4JV5 M;  2DZN B;  1WR1 B;  1N33 M;  4FCW A;  4GIP A;  1UFZ A;  2KZU A;  2CHG A;  4BBA A;  2JWS A;  1GL7 A;  3T15 A;  3KSX A;  2FFJ A;  2QQ8 A;  1G71 A;  1NY6 A;  1HR0 M;  1NV8 A;  3MHV C;  4FWH A;  3MJ5 A;  3HJQ A;  5EJC A;  4QOZ C;  3AL0 C;  1QUS A;  1OAI A;  3SAU A;  2R18 A;  3KP1 E;  1QAQ A;  1XMQ M;  2UXB M;  1Q3B A;  1AUA A;  4F1I A;  2KA6 B;  3D8L A;  2VDB B;  2ZAM A;  3GLG A;  3T1H M;  1NY5 A;  2EKK A;  3CF6 E;  3MK6 A;  1J7K A;  4JI0 M;  3M7G A;  3SHG B;  3LQR A;  4YHH M;  3I4V A;  3HU2 A;  4OVZ A;  2VQE M;  3L25 A;  2LHC A;  3FKE A;  2J7N A;  3KOY E;  5ITR A;  2OOA A;  4W5W A;  3U6M A;  3HZJ A;  2LVP C;  1Z5A A;  1OIZ A;  2HAK A;  2L7I A;  1YUB A;  1VEK A;  5JI2 E;  1PJQ A;  2CP8 A;  5ITT A;  1F4I A;  4AKH A;  2L7H A;  2DZO B;  4LJ7 A;  1ORY B;  2R62 A;  4GRI A;  1K3W A;  3HHW A;  2C5R A;  3QWL A;  1HQY E;  5E26 A;  4XK8 F;  1TR8 A;  4WUR A;  2JY5 A;  3AOE A;  3KW6 A;  3DFZ A;  2LVQ D;  2K47 A;  3K8Z A;  3QYE A;  2A5Y B;  4LJ6 A;  4DV1 M;  1V92 A;  3FYC A;  1G3I A;  1TH2 A;  3NBI A;  4KOD A;  1JR3 E;  2X49 A;  1XNQ M;  2F4V M;  1DO0 A;  5LMN M;  2LVN C;  5E6J A;  1R2Y A;  1K3X A;  4QNM A;  1MU5 A;  3HJ8 A;  2BNK A;  2D7G A;  1S3S A;  2OPF A;  1DGB A;  3K92 A;  2CEA A;  1NJG A;  5EXX A;  3RGP A;  2LBC A;  1XWI A;  4GHA A;  1GAB A;  1G59 A;  1VEJ A;  1T43 A;  3BXW A;  4GC5 A;  5EXS A;  3U60 B;  1SXJ D;  1VG5 A;  4KT0 F;  5EXT A;  3H4J A;  3L28 A;  2V6Z M;  2JY7 A;  3KOX E;  1PJS A;  2DVW B;  2MJ5 B;  2XGN A;  3FUU A;  5F3W A;  3I04 M;  4JI5 M;  1DV0 A;  5IZ7 D;  1XXH E;  3VK8 A;  4RNA A;  4L6V 6;  2XZU A;  2QEN A;  2L6O A;  1MN3 A;  1G4A E;  3SMP A;  3GO8 A;  1OAO C;  3FUW A;  4M9X A;  2UXC M;  2L4F A;  3W67 A;  4EIW A;  4YY3 M;  2C9O A;  2MRO B;  2RRU A;  2UU9 M;  1NJF A;  1N32 M;  1KYI A;  2Y0T A;  3PVS A;  3HWS A;  1Z6T A;  3TQS A;  3TWL A;  2O01 F;  1SXJ A;  2MR9 A;  4GEW A;  4LJ5 A;  1YSY A;  3SYL A;  5KQD A;  4AQY M;  3FUT A;  5BPV A;  3HHX A;  2DEN A;  2RGH A;  4LZZ A;  1L1Z A;  1WGN A;  5DNY A;  4LF8 M;  3LVV A;  1N34 M;  1XHB A;  3CTW B;  1HQC A;  1WXQ A;  3A42 A;  3KXE C;  2VF7 A;  1T6O A;  3B9P A;  4JN6 A;  4FCV A;  3R9X B;  4IBI A;  1DGH B;  1TF0 B;  3L29 A;  3B7N A;  3SAT A;  2OO9 A;  4B3R M;  2BJW A;  4AKI A;  4IBF A;  2ZTC A;  3CF0 A;  3TE6 A;  4LJ9 A;  1IN6 A;  4I4L A;  5ITX A;  2GQF A;  4LGY A;  3MMP A;  2R46 A;  2R45 A;  4D81 A;  1TDH A;  2DAG A;  4JI1 M;  3LW5 F;  7CAT A;  1GKI A;  3WHK A;  1DGF A;  3GLI A;  2LH0 A;  2VII A;  2E5L M;  4DR6 M;  4REZ A;  1IBM M;  2V1C A;  1QQW A;  4I8O A;  1NNJ A;  2LHG A;  2Y21 A;  5LMU M;  2QBY A;  3KOW E;  3L2A A;  1TH3 A;  1IY0 A;  5ITU A;  3L26 A;  3M0E A;  4LZJ A;  3UGJ A;  3GLH A;  5GKN A;  4G4O A;  3SAW A;  2DWN A;  3AV0 A;  1OTR A;  1IQP A;  4GMQ A;  4M0D A;  4JI4 M;  1DGG A;  3GLG E;  1E32 A;  4G4Q A;  1PJT A;  3AFH A;  3FD9 A;  3U6P A;  5EP1 A;  3K2L A;  4GC9 A;  1E9S A;  4LFB M;  1ZMW A;  5BR8 M;  2RGO A;  3J81 S;  3JR5 A;  1L2C A;  5ITQ A;  2MGW A;  3HJS A;  3LVW A;  4R3D A;  4IBK A;  2R6F A;  5EQT A;  1WHC A;  3U6Q A;  5L8R F;  2DWL A;  4JI7 M;  2CHQ A;  1N75 A;  1YLA A;  1EE8 A;  4DV5 M;  2LTU A;  1R5L A;  3JAM S;  2VQF M;  5IWA M;  1OFH A;  2BJV A;  2HCB A;  4CJ6 A;  4L16 A;  3W0L B;  4G4R A;  1I94 M;  1SXJ C;  5EP2 A;  1OJL A;  3U5Z A;  4G3O A;  4B7F A;  1V34 A;  4JI8 M;  3T6P A;  2DHY A;  2KDL A;  1XB2 B;  2EKF A;  2R4J A;  3FTC A;  3IHP A;  3KS8 A;  1QDR A;  1IXS B;  2CV1 A;  3U61 A;  2ERC A;  3K9P A;  4G4N A;  3U6E A;  1XXH B;  2XH9 A;  1IN8 A;  4Y28 F;  2C9C A;  3E46 A;  2LVA A;  1PRB A;  4FD2 A;  4HL4 A;  4IBJ A;  5FLX S;  3J7A S;  2AHM A;  2Z4S A;  2HKJ A;  3BBZ A;  2ZAN A;  1GLN A;  1VDD A;  4IBD A;  4NC6 A;  4LF5 M;  1IFY A;  4PT5 A;  1D2N A;  3L27 A;  4NRW A;  2G3Q A;  2DZL A;  2W82 A;  3D8B A;  2CE7 A;  3DOA A;  4B08 A;  4TUW A;  1HNX M;  3VKH A;  2DKL A;  4M0W A;  1MX0 A;  1Q02 A;  3TWK A;  4X66 M;  1V33 A;  1Z5C A;  1LV7 A;  4NSO B;  1T3T A;  3GRY A;  3RE8 A;  2J7O A;  4R7G A;  2KXE A;  5KPT A;  4GHL A;  1E94 E;  2KEB A;  1L8Q A;  4I81 A;  4DBG B;  4Q7J A;  3J27 B;  3CF2 A;  2RKO A;  4MGH A;  1Q3C A;  4IJE A;  2Y20 A;  3IG8 A;  3QYB A;  2Z3X A;  2QNJ A;  2VF8 A;  4FCT A;  1CUK A;  3KDS E;  1I4W A;  3HY5 A;  1TDZ A;  3GPY A;  3NWL A;  5FTL A;  3AKZ A;  4DUY M;  2FNA A;  1ZQ9 A;  1DO2 A;  3VLF B;  1BVS A;  1VDL A;  4FWG A;  4D80 A;  4NL4 H;  3SFZ A;  2Y0Q A;  4LG2 A;  3UMM A;  4FWD A;  3K1J A;  4LGM A;  1IM2 A;  3GLF A;  3TWM A;  1Z59 A;  1IN4 A;  1UM8 A;  4FW9 A;  4NRV A;  1GL6 A;  1SXJ E;  2OQ4 A;  5IRE B;  1J5E M;  1OFI A;  2JZ1 A;  1IY1 A;  4A3V B;  3Q8G A;  3ZCB B;  2UXD M;  4DR4 M;  3E9S A;  1JB0 F;  1D0K A;  3PXG A;  4AG6 A;  1MJG M;  2KNZ A;  3WHL A;  2UUC M;  2F5N A;  3GPP A;  3KP0 E;  1XNR M;  2DAK A;  3E4R A;  4X62 M;  4NOO B;  4DV7 M;  3TL4 X;  3SAS A;  3J2P B;  2M60 A;  1YE9 A;  2K9D A;  3A98 B;  1QVR A;  3KSJ A;  3T1Y M;  2L2D A;  4P17 A;  4QHS A;  4QNR A;  2XEP A;  3B89 A;  4LRS A;  5FTM A;  3VKG A;  2LNH C;  2DNA A;  4L15 A;  4L4U A;  5EP3 A;  3GRU A;  4M9Z A;  3UJN A;  1D0L A;  3GLG B;  1NO1 A;  3IG5 A;  3A46 A;  2QZ4 A;  3I01 M;  3HHY A;  4R71 A;  4QOS A;  2LWX A;  3GLI E;  1PM5 A;  1G8P A;  4OVZ B;  3HGI A;  3LMM A;  5FTK A;  1IBK M;  2YNM D;  4DUZ M;  1QAO A;  1L1T A;  2FOI C;  4X64 M;  2KRU A;  2QP9 X;  3THG A;  3JR4 A;  2KZS A;  4HLQ A;  3SAR A;  3VDU A;  4X65 M;  5C1B A;  3AOE C;  5EP4 A;  2X4A A;  3NBX X;  2N35 A;  3FUX A;  3I4Y A;  1EFU B;  3GLH E;  4DR2 M;  3BOS A;  3HU3 A;  1OQY A;  3M6A A;  3VFD A;  1NHG C;  1QDT A;  1QUT A;  4JXJ A;  2O5R A;  3U6L A;  1NHW C;  4G6Z A;  2D7H A;  1IXZ A;  4HEO A;  1C7Y A;  2HL7 A;  4B7H A;  2JUJ A;  1ZMV A;  4JI6 M;  4MGY E;  2YR0 A;  3KFU G;  4L78 A;  5A2Q S;  4LFC M;  3W68 A;  1HT1 E;  1XMO M;  3FRI A;  2XZF A;  1HT2 E;  1AIP C;  1TH4 A;  4D82 A;  2JP7 A;  1XC8 A;  4OU7 A;  1R2Z A;  2WSE F;  2Z8Y M;  1R4G A;  1KFV A;  3B74 A;  3ZC7 B;  4MH0 E;  1NNU C;  1PJJ A;  2R44 A;  5KO3 A;  2ZAO A;  4B3S M;  4KO8 A;  1IN5 A;  3U60 A;  2HWJ A;  3TPZ A;  1WGL A;  2K6B A;  4GKK M;  3HU1 A;  2D7E A;  3W0F A;  2DWZ B;  3SMS A;  5JI3 E;  1PGY A;  3FUV A;  4B3T M;  1NV9 A;  1QZE A;  2L4E A;  3F92 A;  3VDP A;  2CWB A;  2QCU A;  4K0K M;  4OW0 A;  3AOG A;  4CIS A;  4LRT A;  1GJT A;  1N36 M;  3U6O A;  3FYD A;  1SG9 A;  1QYR A;  2O25 A;  2B3T A;  3C58 A;  3ZQJ A;  2DAI A;  2EO2 A;  1IN7 A;  2CHV A;  2WZJ A;  4DR3 M;  1GVN A;  3SC3 A;  1WJ7 A;  1WIV A;  4RF0 A;  3ZH9 B;  1L2D A;  2G5G X;  2UUB M;  1W5S A;  1P3Q Q;  5DFL A;  3SAV A;  2LVO C;  2XSZ D;  2DHR A;  4B7G A;  2UUA M;  1SXJ B;  2KNA A;  3R8F A;  3OTO M;  4L8R C;  2WSF F;  2JY6 B;  4JI3 M;  3U6D A;  4GIT A;  4NXM M;  2DAM A; 
#chains in the Genus database with same CATH homology
 1ZAE A;  3RGS A;  5DYI A;  2CV2 A;  1J09 A;  5H37 D;  2XF3 A;  1IY2 A;  2YQZ A;  4PD2 A;  1FJG M;  1DGH A;  3SBJ A;  3UK6 A;  4WW0 A;  4XBO A;  5ITY A;  1QAM A;  2EUC A;  2LXE A;  3GPU A;  3SHF A;  1L2B A;  2NQ8 C;  5IT9 S;  1IBL M;  2XSZ A;  3I51 A;  4IIW A;  3GPX A;  3GQ4 A;  1W5T A;  4AW4 A;  5KQ8 A;  2L09 A;  3GLI B;  4S12 A;  4LFA M;  2XFS A;  2I7N A;  1HNZ M;  1JR3 D;  2DXI A;  2M5Z A;  4LF7 M;  2QBY B;  4LJA A;  4LY6 A;  2QPA A;  2V1U A;  1QAN A;  4OX9 M;  4NXN M;  3SYK A;  3FTD A;  4BLC A;  4AI6 A;  2JA2 A;  4MB7 A;  2XFT A;  3GRR A;  3A45 A;  3KS4 A;  1TGU A;  4DV4 M;  1PJI A;  2P5T A;  2YFQ A;  3GLH B;  4MGZ E;  2F5S A;  5EXP A;  1JQJ C;  4JI2 M;  4CGY B;  1R7R A;  4XGI A;  3DA1 A;  4GKJ M;  4M9S A;  3UZU A;  4IBC A;  2C98 A;  4AZF A;  4DR1 M;  5KPZ A;  2EA0 A;  2CUZ A;  4LF6 M;  4II7 A;  3LQQ A;  1JR3 A;  3RFW A;  2R4E A;  3J7B A;  4IJF A;  5ITX E;  4P16 A;  3PNY A;  4PDI A;  2DWM A;  4KHP M;  8CAT A;  4GH9 A;  3U6S A;  1R6B X;  4FVM A;  2HHH M;  4QHT A;  1G41 A;  4ITQ A;  4LJ4 A;  3GQ5 A;  2KW0 A;  2C96 A;  2KRK A;  4IBB A;  1N78 A;  1E9R A;  4MM3 B;  3U5Z B;  4DV3 M;  1NVM A;  3DZD A;  3VK7 A;  4I5S A;  4MGI E;  4MGK E;  4KLN A;  4LJ8 A;  4LCB A;  3GQ3 A;  3Q8X A;  1IXR C;  1C1K A;  3U61 B;  2C99 A;  2I7P A;  3KVW A;  4BB9 A;  4DR5 M;  1K82 A;  2CV0 A;  3GRV A;  3PFI A;  1XXH A;  5KPR A;  4B3M M;  3U6C A;  1N77 A;  5C18 A;  4IBG A;  3FTF A;  3T38 A;  5FSW A;  2F5O A;  2CFO A;  3J80 S;  3H4M A;  4JYA M;  2H1R A;  3AJI B;  1H6U A;  4NSR A;  3HHZ A;  3QAU A;  4LF9 M;  3PNV A;  4DV6 M;  5FTJ A;  1X37 A;  2Z4R A;  4CHT B;  1KSF X;  1Z5B A;  4PDG A;  2F5P A;  2XLJ A;  4PCZ A;  2ZM6 M;  4DR7 M;  1FNN A;  4Z8X A;  1QZM A;  5DYG A;  2Q2E B;  2R65 A;  3GP1 A;  4AKG A;  2G8L A;  3EIH A;  2ZBK B;  2FE8 A;  1NSF A;  2F5Q A;  1HNW M;  2X8A A;  3GLF B;  4ZPX A;  4DV2 M;  3FTE A;  3ILK A;  1Q39 A;  3EIE A;  4Z6Y A;  4AG5 A;  4DV0 M;  3HKP A;  5FTN A;  2Z7J A;  3KOZ E;  4IBE A;  4LF4 M;  4RF1 A;  4JV5 M;  2DZN B;  1N33 M;  4FCW A;  4GIP A;  2KZU A;  2CHG A;  4BBA A;  1GL7 A;  3T15 A;  3KSX A;  2FFJ A;  1NY6 A;  1HR0 M;  3MHV C;  4FWH A;  3MJ5 A;  3HJQ A;  5EJC A;  4QOZ C;  3AL0 C;  3SAU A;  2R18 A;  3KP1 E;  1QAQ A;  1XMQ M;  2UXB M;  1Q3B A;  2KA6 B;  3D8L A;  2ZAM A;  3GLG A;  3T1H M;  1NY5 A;  3CF6 E;  3MK6 A;  1J7K A;  4JI0 M;  3M7G A;  3SHG B;  3LQR A;  4YHH M;  3I4V A;  3HU2 A;  4OVZ A;  2VQE M;  3L25 A;  3FKE A;  2J7N A;  3KOY E;  5ITR A;  4W5W A;  3U6M A;  1Z5A A;  2L7I A;  1YUB A;  5JI2 E;  4AKH A;  5ITT A;  2L7H A;  2DZO B;  4LJ7 A;  1ORY B;  2R62 A;  4GRI A;  1K3W A;  3HHW A;  2C5R A;  3QWL A;  1HQY E;  5E26 A;  4WUR A;  3AOE A;  3KW6 A;  3DFZ A;  2K47 A;  3K8Z A;  2A5Y B;  4LJ6 A;  4DV1 M;  3FYC A;  1G3I A;  1TH2 A;  3NBI A;  4KOD A;  2X49 A;  1XNQ M;  2F4V M;  1DO0 A;  5LMN M;  5E6J A;  1R2Y A;  1K3X A;  4QNM A;  1MU5 A;  3HJ8 A;  2BNK A;  2D7G A;  1S3S A;  2OPF A;  1DGB A;  3K92 A;  2CEA A;  1NJG A;  5EXX A;  3RGP A;  1XWI A;  4GHA A;  1G59 A;  5EXS A;  4GC5 A;  3U60 B;  1SXJ D;  5EXT A;  3L28 A;  2V6Z M;  3KOX E;  2DVW B;  2XGN A;  4JI5 M;  3FUU A;  5F3W A;  5IZ7 D;  3VK8 A;  4RNA A;  2XZU A;  2QEN A;  2L6O A;  1G4A E;  3SMP A;  3GO8 A;  3FUW A;  4M9X A;  2UXC M;  4EIW A;  4YY3 M;  2C9O A;  2UU9 M;  1NJF A;  1N32 M;  1KYI A;  2Y0T A;  3PVS A;  3HWS A;  1Z6T A;  3TQS A;  3TWL A;  1SXJ A;  4LJ5 A;  5KQD A;  4AQY M;  1YSY A;  3SYL A;  3FUT A;  5BPV A;  3HHX A;  2RGH A;  4LZZ A;  1L1Z A;  5DNY A;  4LF8 M;  3LVV A;  1N34 M;  1XHB A;  3CTW B;  1HQC A;  1WXQ A;  3A42 A;  3KXE C;  3B9P A;  4JN6 A;  3R9X B;  4FCV A;  4IBI A;  1DGH B;  3L29 A;  3SAT A;  4B3R M;  2BJW A;  4AKI A;  4IBF A;  3CF0 A;  3TE6 A;  4LJ9 A;  1IN6 A;  4I4L A;  5ITX A;  4LGY A;  2R46 A;  2R45 A;  4D81 A;  1TDH A;  4JI1 M;  7CAT A;  1GKI A;  3WHK A;  1DGF A;  3GLI A;  2LH0 A;  2VII A;  2E5L M;  4DR6 M;  4REZ A;  1IBM M;  2V1C A;  1QQW A;  4I8O A;  1NNJ A;  2Y21 A;  2QBY A;  5LMU M;  3KOW E;  3L2A A;  1TH3 A;  1IY0 A;  5ITU A;  3L26 A;  3M0E A;  4LZJ A;  3UGJ A;  3GLH A;  5GKN A;  4G4O A;  3SAW A;  2DWN A;  3AV0 A;  1IQP A;  4GMQ A;  4M0D A;  4JI4 M;  1DGG A;  1E32 A;  4G4Q A;  3AFH A;  3FD9 A;  3U6P A;  5EP1 A;  3K2L A;  4GC9 A;  1E9S A;  4LFB M;  5BR8 M;  2RGO A;  3J81 S;  3JR5 A;  1L2C A;  5ITQ A;  3HJS A;  3LVW A;  4R3D A;  4IBK A;  3U6Q A;  5EQT A;  2DWL A;  4JI7 M;  2CHQ A;  1N75 A;  1EE8 A;  4DV5 M;  3JAM S;  2VQF M;  5IWA M;  1OFH A;  2BJV A;  2HCB A;  4L16 A;  3W0L B;  4G4R A;  1I94 M;  1SXJ C;  5EP2 A;  1OJL A;  3U5Z A;  4JI8 M;  4B7F A;  2R4J A;  3FTC A;  3KS8 A;  1IXS B;  2CV1 A;  3U61 A;  2ERC A;  4G4N A;  3U6E A;  1XXH B;  2XH9 A;  1IN8 A;  5FLX S;  2C9C A;  4FD2 A;  4HL4 A;  4IBJ A;  3J7A S;  2AHM A;  2Z4S A;  2HKJ A;  2ZAN A;  1GLN A;  1VDD A;  4IBD A;  4LF5 M;  4PT5 A;  1D2N A;  3L27 A;  4NRW A;  2W82 A;  3D8B A;  2CE7 A;  3DOA A;  4B08 A;  4TUW A;  1HNX M;  3VKH A;  4M0W A;  1MX0 A;  3TWK A;  4X66 M;  1Z5C A;  4NSO B;  1LV7 A;  1T3T A;  3GRY A;  3RE8 A;  2J7O A;  4R7G A;  2KXE A;  5KPT A;  4GHL A;  1E94 E;  2KEB A;  1L8Q A;  4I81 A;  3J27 B;  3CF2 A;  2RKO A;  4MGH A;  1Q3C A;  4IJE A;  2Y20 A;  3IG8 A;  2Z3X A;  4FCT A;  3KDS E;  1I4W A;  1TDZ A;  3GPY A;  3NWL A;  5FTL A;  3AKZ A;  4DUY M;  2FNA A;  1ZQ9 A;  1DO2 A;  3VLF B;  4D80 A;  4FWG A;  4NL4 H;  3SFZ A;  2Y0Q A;  4LG2 A;  3UMM A;  4FWD A;  3K1J A;  4LGM A;  1IM2 A;  3GLF A;  3TWM A;  1Z59 A;  1IN4 A;  1UM8 A;  4FW9 A;  4NRV A;  1GL6 A;  1SXJ E;  2OQ4 A;  5IRE B;  1J5E M;  1OFI A;  1IY1 A;  4A3V B;  3ZCB B;  2UXD M;  4DR4 M;  3E9S A;  3PXG A;  4AG6 A;  2UUC M;  3WHL A;  2F5N A;  3GPP A;  3KP0 E;  1XNR M;  3E4R A;  4X62 M;  4NOO B;  4DV7 M;  3TL4 X;  3SAS A;  3J2P B;  2M60 A;  1YE9 A;  3A98 B;  1QVR A;  3KSJ A;  3T1Y M;  4QHS A;  4QNR A;  2XEP A;  4LRS A;  5FTM A;  3VKG A;  2LNH C;  4L15 A;  4L4U A;  5EP3 A;  3GRU A;  4M9Z A;  3UJN A;  3GLG B;  3IG5 A;  3A46 A;  2QZ4 A;  3HHY A;  4QOS A;  2LWX A;  1PM5 A;  1G8P A;  4OVZ B;  3HGI A;  3LMM A;  5FTK A;  1IBK M;  2YNM D;  4DUZ M;  1QAO A;  1L1T A;  2FOI C;  4X64 M;  2KRU A;  2QP9 X;  3THG A;  3JR4 A;  2KZS A;  4HLQ A;  3SAR A;  3VDU A;  4X65 M;  5C1B A;  3AOE C;  5EP4 A;  2X4A A;  3FUX A;  3I4Y A;  4DR2 M;  3BOS A;  3HU3 A;  3M6A A;  3VFD A;  1NHG C;  4JXJ A;  2O5R A;  3U6L A;  1NHW C;  4G6Z A;  2D7H A;  1IXZ A;  2HL7 A;  4B7H A;  4JI6 M;  4MGY E;  2YR0 A;  3KFU G;  4L78 A;  5A2Q S;  4LFC M;  1HT1 E;  1XMO M;  2XZF A;  1HT2 E;  1TH4 A;  4D82 A;  1XC8 A;  4OU7 A;  1R2Z A;  1KFV A;  3ZC7 B;  4MH0 E;  1NNU C;  1PJJ A;  5KO3 A;  2ZAO A;  4B3S M;  4KO8 A;  1IN5 A;  3U60 A;  3TPZ A;  4GKK M;  3HU1 A;  2D7E A;  3W0F A;  2DWZ B;  3SMS A;  5JI3 E;  3FUV A;  4B3T M;  3VDP A;  2QCU A;  4K0K M;  4OW0 A;  3AOG A;  4CIS A;  4LRT A;  1N36 M;  3U6O A;  3FYD A;  1QYR A;  3C58 A;  2EO2 A;  1IN7 A;  2CHV A;  4DR3 M;  1GVN A;  3SC3 A;  3ZH9 B;  4RF0 A;  1L2D A;  2G5G X;  2UUB M;  1W5S A;  3SAV A;  2XSZ D;  2DHR A;  4B7G A;  2UUA M;  1SXJ B;  3R8F A;  3OTO M;  4L8R C;  3U6D A;  4JI3 M;  4GIT A;  4NXM M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...