2P65A

Crystal structure of the first nucleotide binding domain of chaperone clpb1, putative, (pv089580) from plasmodium vivax
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
185
structure length
185
Chain Sequence
b'QALEKYSRDLTALARAGKLDPVIGRDTEIRRAIQILSRRTKNNPILLGDPGVGKTAIVEGLAIKIVQGDVPDSLKGRKLVSLDLSSLIAGAKYRGDFEERLKSILKEVQDAEGQVVMFIDEIHTVVGAGAVAEGALDAGNILKPMLARGELRCIGATTVSEYRQFIEKDKALERRFQQILVEQPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PF08_0063
molecule tags Structural genomics, unknown function
source organism Plasmodium falciparum
publication title Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
rcsb
total genus 67
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p65A00
2GBLA 3O8DA 5IT5A 1A2BA 1DE0A 1Q1EA 1ZU5A 4PPNA 4TYNA 3CPEA 2DR3A 1ZW6A 1DAGA 3AF1A 3QE0A 1PJRA 4HYYA 4V03A 4LJ7A 3E2IA 3AUXA 4JVLA 3MRSA 1GFIA 4TQ9A 1P6XA 2WJJA 3KJGA 3IIKA 2GF0A 3B1VA 3RSLA 2YV5A 2QAGA 4E5UA 1CR2A 5C18A 4ARZA 2YC4C 1IY1A 1II9A 1LF0A 4MYCA 5EZ6B 1XP8A 2EFCB 2EVWX 3LX8A 3U7HB 3FHTA 4FWIB 3TSOA 2XXAA 4AKIA 1WQ1R 3AVYA 4AKHA 2QQEA 3K09A 4NYJR 3THYA 2ZI6A 2IXFA 1R7RA 1UKVY 3ZYCA 1KSJA 2P65A 1S3GA 1ZNXA 3NVAA 1M7GA 4DEYA 5JCZA 1U2RA 5C4MA 1JJVA 1JR3E 4BFTA 3A8TA 1D2MA 1FX0A 2FPKA 4JIMA 4I99A 4HLDA 1L7VC 4OI4A 2K5UA 4LHWA 4C0JA 1XCGB 3EARA 2NPIA 3ADBA 4YDSA 3QKRA 1GWNA 4C0AC 3CRW1 1C4OA 4KITB 2Z4RA 3G5UA 4AKGA 4Q9LA 2W0SA 3THWA 4RZXA 5LD2B 4MQBA 1VIYA 4EQ6A 1ZU4A 2CLCX 1Z07A 1QZXA 2GJ9A 3QI2A 4PX9A 2XSZD 3VR1A 3K0SA 2J3EA 1US8B 1VIAA 3FTQA 2ZVPX 4P4UA 4W5JA 2XB2A 3AGQA 3MCAA 2CHVA 1XU4A 3E70C 2OBMA 4B48A 4NP6A 4YMVA 2BJVA 1HY3A 4KVAA 3PQCA 2IF0A 4M1WA 4TMWA 1FNMA 3U60B 1E2FA 1KKMA 3LBHA 4WZBE 4B2PA 2DB3A 3N70A 4RD3A 3PVSA 1GOTA 2QROA 2FH5B 3NC1C 4QNMA 3WBJA 4MRNA 4DRZA 3D8BA 4B3DA 2J0QA 3VU9A 5AUOB 2ERYA 2QTFA 3GLFE 4IXMA 3EXAA 2PCLA 3CNOA 3BGWA 4JBWA 1W4RA 1MT0A 2ZI9A 1KZGB 4D4LA 4GRAA 1YRBA 2WWGA 3T15A 1NLFA 1E1QD 5K8UA 2WKQA 1VCMA 4BFXA 2V4ZA 1XCMA 1QHIA 1HQCA 3QKRB 3FGNA 4P4SB 2F9MA 1ZC3A 2PZFA 3B78A 3ICQB 3AVUA 2W83A 3FHOA 1OKKD 3SYLA 1NKTA 2XNDD 2IK8A 3W90A 4C9BA 3BB3A 4PO1A 4LBVA 1VECA 1MOZA 2OSBA 3SFVA 2CVFA 3QKUA 4QBIA 1AA9A 4IFEA 4M9ZA 1CR1A 2KBFA 2ZSBA 2YOFA 2ZU0C 1NP6A 3N5CA 3SJZA 3GLIE 3W5IA 3BB4A 2QAJA 3LBNA 2FOLA 4RZ2A 3GJ6A 4TSFD 2L0XA 3TSZA 2VYFA 5DLQC 2P6NA 4EIWA 4C0QC 2WMNB 5JI3E 1F2TA 5GJBA 3HR8A 3HYRA 3AF0A 3HU2A 1WMSA 2GJ8A 4RVCA 2ZEJA 3BJIC 1O87A 3ZD6A 4YQFA 3RRZA 1UFQA 1N2CE 5FOUA 1LTQA 2J1LA 3KUDA 1UF9A 1NJFA 2ZR7A 4JVNA 3C4JA 1SVOA 4XVRA 2J46A 1L8QA 2VTKA 1YHNA 2V9PA 4M1TA 5FBVB 5L3QB 4BE7B 1KAOA 2HT6A 2W00A 1W0JA 2N46A 2CCGA 2GTPA 3R9WA 4FCTA 4IRUB 3GJ7A 5FBRB 2XZOA 2GEUA 4URZR 2ZRNA 3U3MA 4G5SA 1G7CA 3ZDQA 2E9SA 4QGGA 1J8YF 2JJ1D 2IYRA 3CR7A 3W8NA 2AR7A 2QPAA 2VF8A 4DT1B 4ASUA 4CYMA 3OEEA 2VSFA 1E9EA 5FL7A 3H0KA 2OLJA 1KSHA 2FNAA 2PBRA 4ESHA 1UPTA 3GJ3A 3FMIA 1U0JA 4B44A 3BC1A 3Q3JB 4Q4AA 3GEIA 3CF0A 2A78A 4NYIR 2ZRFA 1G6HA 4QFMA 2I1VB 5GVRA 1P3JA 4NCJA 1BYUA 5KNDA 1N5KA 4C0SA 4FN5A 5CK4A 3U7FB 1EFCA 4M0LA 1CJUC 3BS4A 1DAKA 3WHLA 1TU4A 2ZJYA 4HLUA 3CX6A 3T1QA 4Q21A 3TH5A 4ERNA 4LY6A 2J41A 3REFA 3BH0A 4M1OA 2BBOA 3ZVRA 2HYDA 3U6KA 1N6HA 2FA9A 1YR9A 2ZRHA 2Q9AA 3VKGA 3EZFA 2F6RA 2VIIA 4BFSA 1W36C 4DC9A 4ZCLA 2V55B 2IA5A 2YOGA 1CR0A 3DM5A 1W0KD 4G3XA 4A8JC 2KI5A 2BHRA 3RS7A 2DFLA 5GVSA 1E9SA 2OM2A 2VO1A 4TTQA 4DDVA 3UIEA 3EA0A 4G1UC 5A4JA 4R71A 3HR7A 3H4MA 3TRFA 2YWFA 1NG9A 2AN9A 4HDQB 1FX0B 1IN5A 5EJEA 5FOTA 2QMHA 1G4UR 2XJ4A 4OJKA 4Z54A 2EYUA 4E03A 3BFKA 5K8TA 1CJTC 3SNHA 1JBKA 3PUXA 3WMEA 1E3MA 4M1MA 5A0FA 3P26A 3L43A 2PLFA 3Q7PA 4DZZA 3KKPA 4LHXA 2OCPA 4RD2A 2JIZA 4L16A 1JEEA 1P61B 1SVMA 1YE8A 3CRRA 3VMFA 1KYIA 2R6DA 1ESMA 1X86B 1O3YA 4EDHA 4TYQA 3TGPA 1YR6A 1MO5A 1TUIA 3LWNA 1P2VA 5J4VA 1F3OA 4XTRA 3QEOA 3QPVA 2AKYA 4DLRA 1TEXA 3FYHA 4B3GA 4QHSA 3VTKA 4Y0AA 1RW4A 1G3QA 3QNUA 3K0AA 1PV4A 4PXAA 5EP4A 1A7JA 2V8OA 4LGMA 4LJ8A 4LX0A 2IX3A 2CJWA 4EFMA 1CS4C 1SVWA 2ZTSA 1A2KC 4M1KA 2PX0A 4M9XA 3ZS9A 4D26A 3DDCA 3B1YA 3B2EA 2DY1A 3EW9A 4M8NE 4B6EA 3BFXA 3LW8A 2R8RA 3PEYA 1SXJE 3WYAA 4DSTA 4HB0A 4TL7A 2VPPA 5JWRA 4DCSA 4N0EA 3TAUA 3FFBA 3DZDA 3IILA 1KI6B 2W2TA 1GSIA 1F2TB 4N0DA 1Z6XA 2ZRBA 2ZSFA 1MR3F 3AH8A 4NDZA 3DEFA 4EPRA 5KU1A 2OG2A 2IUSA 2XZPA 4Q1AA 2CCKA 1NBMA 1NVVR 2CJWB 3WRXC 721PA 1G41A 2ZSDA 2Z6VA 3N2EA 1B0UA 2IYUA 2CHGA 1J70A 3SFZA 3PUVA 4U00A 3PR1A 3KKNA 2NO7A 1WCV1 3J81k 2BKEA 1X8KA 5FUXA 5FOXA 4A0HA 3V4RA 4LRWA 3G0HA 3RWOA 4KCGA 2A7QA 1G20E 4B76A 4CEJB 5DN6A 1OB5A 1OT3A 5IK2A 5KTYA 1RKBA 1T5IA 4WAUA 3AVXA 1ESNA 5KSZA 1E2IA 2P5SA 4QL3A 5K8LA 2JLVA 4C3ZA 2ZRPA 1P4SA 4KFTA 1E4VA 4QBGB 4US1R 1Z28A 2BJWA 5G40A 1G3UA 2CCJA 5CDFA 1COWA 3TBKA 3ZIAA 4DCVA 2VP4A 1ZUHA 3LRPA 3KL4A 2ZR9A 3X2SA 4DHEA 3QEJA 3VKWA 3GJ0A 2OAQ1 4B43A 1OXXK 3SJCA 5HZHA 1IBRA 5J47A 1ZMXA 3GJ4A 4PC2A 2Q6TA 2QENA 4B75A 5BN3A 2W2VA 3NC0C 1Z5ZA 2ZPTX 3B9QA 1EWRA 4U7DA 4NCKA 3OE7A 1ZNWA 2NO0A 3N2IA 2ANCA 1GKYA 1IJFA 2GAOA 1PVOA 1CU1A 2ZI4A 4Q9KA 2O8BB 1TQ2A 3U7GA 4V0NA 4UNSA 3CF2A 5TY0A 2XXAB 3B1WA 3NBYC 2A5FA 2OFWA 4CVNA 1E32A 2VHJA 3HPRA 3ZVLA 1JECA 2F43A 4LWZA 3EAQA 1WB9A 1E2GA 3CW2A 4R98A 4A1FA 3AF4A 2YWGA 5H70A 4GZMA 3GLFB 2ODBA 5GJVC 2WSSA 3DOFA 4N3NA 1G5PA 3IGFA 4I1OA 1Z6TA 3QY0A 1IM2A 1G8GA 4JS0A 4JKIA 1XCPA 3QXJA 4W5WA 4DBLC 3B5JA 4D25A 3CLVA 5EP1A 1K5GA 2XTZA 2RAPA 1I4DD 1P2UA 3AQ4A 2ZAOA 3K70D 3U2QA 2QSYA 2VH5R 3KXLA 3NXSA 4JZKA 3AUYA 4YMUA 3FMOB 3TVTA 4B3XA 4S35A 2V7QD 2WAXA 2BIFA 5E7MA 1W0JD 4A15A 2JLXA 1VCNA 3KDSE 1JQLB 1HA3A 5B64A 4D0NA 2GNOA 521PA 3QJYA 1E9RA 3UMSA 1JXOA 5KPDA 2GCNA 1E2QA 1P60A 3K9HA 3IIJA 4QGFA 1WBDA 1YR8A 2RGNA 4DDWA 3U44B 3TQCA 1XPUA 4FMDB 1YZNA 4D2IA 1R10A 3IHLA 5TDHA 4NZYA 4M21A 4OQFA 4LYAA 1E79A 2OE2A 4PHGA 4B2IA 4XSHA 3DZ8A 5E7IA 1GM5A 3EASA 3L8YA 4GBMA 1II8A 1W36D 3EPKA 3B13B 4ITRC 2C03A 4QHTA 3TE6A 1NMYA 4D4JA 4TLAA 4XOIA 2RGNC 2Z4SA 4GL2A 1GITA 1CP2A 1HE8B 1SHKA 2B8WA 3IBGA 3RC8A 4CEHA 1FTSA 3DVLA 1DBSA 3ZD7A 1VPLA 1K6MA 2GXAA 1SHZA 5EE3A 4UXJA 1BKDR 1HTWA 2WWXA 3U6BA 2BM1A 3RS4A 1HV8A 1COWD 2KE5A 4PR0A 3KX2A 1JALA 5FFMA 3ZVMA 1SXJD 2P5TB 4Q7LA 4DWJA 1RPZA 1Q3HA 1J99A 1OW3B 4JYCA 4MRPA 3ZZUA 2RHDA 1S0UA 5P21A 5JEEA 1Z6YA 2V1UA 1KDRA 2IS4A 1RRPA 4M1SA 2WBLC 5FR2A 3SYNA 2ZRAA 2B7BA 5AUQA 4D0LB 2WWWA 3KJEA 1Z0JA 4JLNA 3BORA 4TL6A 2PLRA 2KBEA 2QU8A 1NLYA 1PLKA 3AP1A 4RKFA 4Z51A 2J9RA 3V00A 4BLSA 3QG1A 4D81A 3NH9A 4B47A 4TQUS 3VX3A 1G17A 1U8ZA 3EG5A 4WIAA 1RVDA 3WP0A 1H65A 2PZGA 3FFAA 2QE7A 2WJGA 3KKMA 4DCTA 1US8A 2OCYC 4RJLA 4HZUA 1DAIA 2ZSEA 4DLTA 1SXJB 2QG6A 4DLVA 1T5LA 2VSXA 3MMPA 2R9VA 5BYJA 1G7RA 3FHCB 4HB2A 3MLEA 2GKSA 4C30A 4Q7JB 1LFDB 2QT0A 5DISB 4US0R 2IWRA 5FTLA 4KLZA 1TNDA 4OQXA 1KO8A 2NOAA 2BWJA 3FOZA 5KDOA 5TV2A 3REGA 2AXNA 4HUQA 1OYWA 2GHIA 1I4TD 4F4IA 1PLJA 2QZ4A 4MYHA 1E4YA 4AC9A 1XEXB 5CB6A 3K53A 4RD6A 1XTJA 4HAXA 4A0GA 1G3IA 2A5DA 1JXMA 3KB1A 1E2NA 4US2R 1RIFA 2BV3A 2QUZA 1TX4B 4JLJA 3OEHD 2REXB 4DIEA 1TPZA 1EESA 2AFHE 2I1QA 3BH6A 4Q00A 1DELA 1CF4A 2FSFA 1XEWY 5EP3A 3ZJYA 2YOHA 4XD7A 1IXRC 3DO6A 4BEBA 4LJYA 4NCNA 4URUR 2ZS8A 1KNQA 1II8B 4XJXA 1AIPA 5GJWC 1KOFA 1M7BA 3EX7C 4HAWA 1D9XA 3CWQA 3W5JA 4IW3B 1KSFX 5AJYA 5CB8A 3WP1B 1KNXA 5FR1A 2RCNA 4E07A 2QY9A 2F9LA 2C99A 4HZIA 1N25A 2CNWA 4UNQA 2IXEA 4ABYA 1Q3TA 1H8ED 4GDFA 1NBME 1U98A 1Z0AA 1G3RA 1ZD1A 2HF9A 1N6LA 2IS6A 1CBUA 1ZUIA 1R0XA 4YMWA 1YZQA 1FUUA 3Q9LA 4Q9JA 5KDDA 2DPXA 4EPWA 3VFDA 1W0KA 1U90A 2F3TA 4BZXA 4WZAE 3QUSA 3ASYA 3CPJB 4QRHA 3BBPA 4RFSB 2VHTA 4AKEA 3IEUA 2IYZA 4E22A 3O8CA 3QBTA 2JDID 3ECCA 2ZE7A 4NPHA 2C8VA 2FSGA 3KTAA 2IYWA 2WJVA 5FOVA 2WKRA 1G16A 2OEPA 3F0TA 4LBZA 1RRFA 4EPXA 4PPQA 2ZANA 3S1AA 2ZVQX 1ZM2A 2O8CA 3MWKA 3DKVA 3OAAD 5ANRB 3B1XA 4A8JB 4TT3A 2NO9A 4LV8B 1QHGA 4NYIQ 2Q9BA 1AGPA 3IQXA 3BB1A 1MABA 2QEQA 5IRCD 4LV6A 3KXKA 1OV4A 3KJIA 4LJ6A 4PC7A 4EFNA 3BERA 3UMFA 2XX3A 3PEVA 3QXHA 4HAZA 1A82A 4P32A 1OYYA 1Z2CA 4C0BA 1NIJA 1B23P 2O0JA 3X1ZA 1F2UA 1CTQA 1XJ0A 4X8HA 2C04A 3QF7A 1IY2A 4ACBA 4B74A 1Z22A 1K8RA 4URVR 2PEYA 3K1JA 1IXZA 1Z6GA 3EZ9A 4HAVA 4HZUB 4RD0A 2GZDA 4ZCMA 2EWWA 2FEOA 2ODWA 5JZVA 2OILA 4AG5A 1XMIA 1UEIA 1QRAA 3R20A 4YLGA 4F4JA 2FFAA 4JLMA 4LHYA 2OZEA 2Q3MA 1OH7A 3U4QA 2AX4A 1UAAA 2QAGC 1E69A 1QF9A 1X6VA 2AD5A 1AK2A 2ZRDA 4DLUA 5TB5A 4EAQA 3ETLA 2ZS9A 1E2KA 4BFUA 8OHMA 3I62A 2GILA 4TYPA 4C0HA 4V0ME 1RRCA 4OK6A 1G9XA 1NRJB 2AXPA 2O8CB 2CEAA 2EW1A 1TAGA 4BLRA 5LD2C 4POAA 3NHBA 2W0MA 3SI7A 1E2EA 2CL6X 4P4TA 5JWOA 4NE2A 2ZXUA 1E2HA 5FPTA 4EQ6B 3CZPA 1XZQA 5DGXA 3LNCA 2VL7A 4PQYA 3RC3A 3L0OA 4XWOA 2AWNA 3JZMA 1Q20A 3T1TA 5KPJA 2ZYUX 1Z29A 2B92A 1S4QA 4BFZA 3GJXC 4F92B 4MDEA 2GVZC 2KWIA 3QXXA 4P31A 4C4PA 1W2GA 2O8DA 2GK7A 2DWOA 1C1YA 4BLQA 3TUJC 4O25A 3A1SA 2HCJB 2J0UB 4DDTA 2IYXA 4WXRA 1MABB 2OBNA 1G291 1GILA 1SVLA 3H84A 4BECA 4QKQA 1YR7A 2HJGA 2BMDA 4L4UA 2FGKA 5G41A 3EPHA 1A4RA 3KFVA 4LYFA 2AK2A 1GRRA 3K0CA 3NHAA 2BEJA 2QBYA 1E2LA 1W5SA 5EXPA 4O0MA 5HR5A 1G8HA 1KI4A 2VP0A 4V02A 4DB2A 2IBMA 4O2LA 4ZV4A 2QL6A 5JCPA 1RJ9A 4BQSA 3CUEF 1W49A 1UJ2A 4Q9HA 5JJKA 1QHYA 4JMPA 4DSOA 4DVGA 1GRNA 5JFGA 1J90A 1RC8A 4Q4HA 1LY1A 1XD9A 3KQKA 3KQNA 5KNCA 2WJHA 2ZRJA 4O2RA 2B21A 5G3YA 3U44A 1RFLA 1F48A 2CLSA 3PCRB 1QHHA 2R6AA 2EFEB 3TJZA 2J5XA 5JJIA 4PC3A 1YZTA 1VYVA 1IN4A 4IDOA 4MGIR 2ZQ5A 5E3HA 2QP3A 1G7TA 2J87A 3SBDA 1F5NA 1M74A 3Q5EA 3IPYA 1S9HA 1W5TA 4EKDA 2AK3A 1AS0A 2ZJ8A 3BK7A 2F1RA 2MMCA 3P4XA 4TL9A 3R7WA 3UPUA 5EQTA 1OKKA 2D3WA 4YONB 1CKEA 1VTKA 2QORA 3FDIA 4OKSA 3P4YA 3TUZC 1N5JA 1ZJ6A 3RS3A 2CE7A 4Q1DA 2RGAA 3HP1A 4A82A 2XNDA 1XF9A 2NO6A 3OFND 2D4HA 4BLTA 3MSXA 4XVUA 2QPOA 2FX3A 3AF3A 5CK5A 3CKLA 4BLOA 2JLZA 4KO8A 4IDPA 1I2MA 4KFUA 3I32A 2IS2A 3RS0A 2ZI3A 1OLOA 4G0NA 1U8YA 2WPDD 3FMFA 3G82C 1NMXA 3DMNA 4RFSA 4U5XA 1FUKA 3KKQA 2VP2A 4G5OA 5UKDA 3AKCA 4L9WA 2C9CA 1DG3A 3L8ZA 5AJVB 3VNVA 1E1RD 3I5YA 1ODFA 4MITA 2G83A 4IHQA 2ORVA 2VHCA 2JLUA 3K0CC 2ZR0A 1SQ5A 1N6OA 1IY0A 2NQ2C 5JWHA 2ZRCA 2G1JA 1R0WA 4DDUA 1KO7A 3C15C 1S9DA 4JSYA 2OCAA 1GG2A 1EG7A 3ASZA 1Z08A 2IYQA 3X1WA 3I92A 1EK0A 4UJ3A 3GQBA 5CDFE 4AI6A 2JCSA 1R8QA 1IN8A 1RE0A 3A4MA 3JZAA 3AF2A 2C98A 3OE7D 4M22A 1ZD8A 3C5HA 3R8FA 4B35A 2BCGY 3R8CA 3D3QA 3TQFA 4PZLA 2F55A 5J5CA 3QPUA 3AKEA 3D7MA 3QKSA 4CGZA 2ODEA 2BMEA 3CF6R 4Q1CA 4IOJA 1UKZA 4YMTA 4B6FA 4MGKR 3A1TA 3H2YA 3MGCA 3IEVA 2UZ3A 3NTUA 5FBWB 3PXGA 1Z83A 5J4HA 4QJ4A 3M6AA 3O8BA 3U3OA 2CVHA 4TZ0A 2X77A 1VYTA 1T6NA 4D80A 1SVSA 1HURA 4I1UA 1EWQA 1S1MA 1WF3A 1Z3IX 2FFHA 2HLDA 4JJZA 4AD8A 1OFHA 3HPQA 3IQWA 4IJMA 1JEDA 2GCOB 1OXUA 1T3SA 3SJAA 1XWIA 1E9CA 4GP6A 2GWHA 1E2MA 1Q1BA 2FF7A 2OBLA 3CB4A 4S2EA 4URYR 4PANA 2GDJA 1UDWA 2RB4A 3ZIAD 2ZJAA 4KBGA 1OIVA 4C0LA 4FCVA 3THOA 1KJYA 4PFSA 4NL4H 4QGAA 3K9NA 1ZAKA 2BBTA 2IF2A 1KI7A 4Z1MA 1KK2A 2QGZA 4JVMA 4H1UA 1R5OA 1D8TA 4JL6A 3THXB 5CM8B 1NKSA 3CZQA 1CR4A 3KJHA 1T91A 2XAUA 1E0JA 5HCNA 4AIIA 1MO6A 1T0HB 2BMFA 3IIMA 4PHHA 3EWSA 3VAAA 4BEJA 2HUPA 2VP6A 3OIVA 4JKYA 3K0AB 4KXFB 5BQ5A 1U9IC 3BFVA 5KSPA 2QTVB 4MRSA 4Q5IA 2WWFA 1QVRA 3LV8A 4JLBA 2WICA 5BN4A 1KTVA 4KLNA 1XJQA 1P9NA 1G4AE 1ANKA 4HLUC 3FVQA 3MWYW 5KHOC 5DHAA 4C7OA 2IUTA 1N6IA 4LOAA 1IQPA 1LVGA 1AGRA 1MH1A 2R62A 3A1VA 4JSTA 4KHZA 1S1CA 4JLDA 1T3LA 5AR1A 3LQQA 5FBLB 2JASA 2ANBA 2G1KA 2MSEB 5JJLA 2OFXA 2GJKA 3LXXA 4KU4A 5JBQA 1H8HD 4NCHA 1BYIA 1T3HA 1DAMA 2HV8A 2NO1A 1E0KA 2MMGA 2O8EB 1G21E 5JS7A 1M6NA 1DPFA 5AJXA 2CE2X 2ZROA 2GESA 1T9HA 2H8KA 2FV8A 2WIAA 2QNRA 4B32A 1PLLA 4DXAA 4ZDIA 3MAAC 5G3ZA 3SS8A 1EFRA 2J0VA 2V3CC 1S96A 3DOEA 1XRJA 3VNUA 5G53C 3LBIA 1NBMD 1CXZA 2X1VA 1UEJA 4ASUD 1IOZA 5CLLA 1QBKC 1D5CA 1AZTA 3ADKA 3RNLA 3X1XA 1IN7A 2YC2C 3HU3A 2XZLA 2CXXA 4AYXA 4JVSB 4DUGD 1D2NA 2C77A 4QG7A 1XDBA 3RAPR 4FD2A 1CIPA 2BBSA 4Q4JA 3K0EA 3KB2A 1ETUA 1D9ZA 4B3FX 1KIMA 3GPLA 4JL5A 1TEVA 1JI0A 1Z0FA 4CT4B 1R0YA 3QVUA 1ZRHA 2YWEA 4FCWA 3ZQJA 1N5LA 2AL7A 5L3RA 1NN0A 2J59A 1EFTA 4RCZA 2GCPA 4ZDKA 5AJZA 1XBTA 2C9OA 5CJPA 2XOKA 4MKIA 3R9XA 1NY5A 2AWOA 3NWJA 4LYJA 5B57C 2O0HA 4LZZA 2J0SA 3CO5A 2ZE6A 4DLWA 5FTKA 1KO4A 5EE1A 2OESA 5JSZB 1VG0B 1LNZA 1P5ZB 2Q3FA 3IO3A 3JVUA 2Q3HA 1ZNYA 1JB1A 1FPMA 3KKOA 5J40A 3A4LA 3TW4A 4L15A 1QHXA 3ND8A 5K8IA 3P20A 2IHYA 1AKYA 3QXCA 4WW0A 5TARA 3ADDA 3L0SA 5D3MA 4PO9A 3NH6A 2J45A 1SKYE 1CJMA 1KJWA 2ZIAA 2WWIA 1D6JA 3DHWC 1KI9A 1KI8A 1XMJA 2VBCA 3AKYA 3F5FA 3K09C 3BD9A 2JLSA 3H86A 4JBYA 4UNRA 3TK1A 4R9UC 2BOVA 3WNDA 4TTPA 2GEDA 2IL1A 2QBYB 2PJRA 4HEJA 2HLDD 3CRMA 2VRWA 4QBHA 1UBGA 2O52A 2OFOA 4HDOB 5H8WA 1WBBA 3VR5A 2JAQA 2FG5A 4HDCA 2AFIE 1NNEA 2IYSA 4LBWA 1DO2A 4OL0A 3GJ5A 4CF7A 1G5RA 1E2DA 4UQOA 5FI1B 3EIEA 1ZINA 2VQSA 5CIQA 2EYQA 1UDXA 4MRRA 5AK0A 3SN6A 1GVNB 5LBIA 5DE3A 621PA 5LPNA 1SZPA 4KYUA 4WA7A 4FMBB 3DM9B 4P33A 4B34A 4ZO4A 1OHHD 4QXAA 4IDNA 1G6OA 3CBQA 2IEYA 1OB2A 4EJSC 2PH1A 4JT2A 2XITA 4GP7A 3RRNA 5IHPA 1AS2A 2RHMA 2QRNA 1TQDA 3PFIA 3L82B 1HT1E 1LS1A 2DCUA 2H57A 4NYMQ 5EUMA 4Z1MD 4BGDA 4URXR 1OH6A 2ZRIA 5FUVA 3B7GA 2WOOA 2QRZA 5KNBA 1G64A 2LCFA 1GL6A 4MA4A 5FUWA 4OQNA 2FMXA 4QM7A 2A9KA 2V54A 5DYIA 4OI1A 1P2TA 1G19A 2ASEA 3P27A 2DFNA 2GETA 2G9NA 4D4KA 4QBFA 2RGBA 2OAP1 2GBLC 4C2UA 1X3SA 2Q21A 4GPTA 1JQJC 3MWJA 2CL0X 2A5YB 4ZKEA 2G77B 1ZM3A 2NGRA 3R7WB 3AP2A 1OFTA 1KJZA 1EFHA 4Q1FA 1C9KA 4DCUA 2WJYA 2ZRGA 3PUZA 4PSVA 3GFOA 3HYTA 5E95A 2G0NA 3GD7A 3LLMA 2YKGA 4A4DA 3I3SR 3TR5A 1TTTA 3QPWA 4DLYA 1JR3D 2B7CA 4LDJA 2UVQA 5AJWA 4AWXA 1WA5A 4EUNA 4AYWA 3HJNA 3WBKA 3UXMA 3UK6A 3VR2A 1LW7A 1G8PA 1W4AA 2H7VA 3AEZA 4Y0VA 2ZRMA 4XTCS 2F7SA 4BFVA 1XTRA 3MD0A 2A2ZA 3EPLA 3SQWA 3X1YA 2IC5A 4LI0A 4DLZA 5JMTA 1G8FA 1NN1A 3CR8A 2GXSA 1TF7A 3CRQA 3U3RA 1PUIA 4FW9A 1VMAA 4DT1A 2DFTA 4IOMA 4KBFA 1KK0A 3H1TA 4B3BA 1Y3AA 2CK3A 1XXHE 4TMVA 4KSCA 5DHFA 1KI2A 2D2FA 2X2FA 2WOJA 4GT1A 4MKHA 5EE0A 2FE4A 1S3SA 1SVKA 4BZQA 5LB2A 5FTNA 2QMOA 4QNRA 1NVWQ 1Q22A 1SXJC 4IDHA 3F3YA 5DN6D 1E99A 3SQXA 2CNWD 4LV5B 4ZI3A 4ZPXA 1HEIA 3NEJA 2OHFA 4PTLA 3GLHE 3KXIA 2WSSD 3MUFA 1XMSA 1J7KA 2KB0A 1KDTA 4GOXA 5DI3A 4LPSA 4QC2A 2V1XA 1KMQA 4BRUA 3ZVNA 1UBFA 4G5GA 2DWPA 2ZUCA 1ZBDA 3CONA 5HPYB 2XTMA 3OESA 4QHYA 1EFRD 3ZQ6A 4EFLA 3T61A 3CX7A 4D6PA 3F8TA 3MFYA 1OHHA 5FPKA 4A2WA 2FWRA 4C7OB 2G6BA 3Q7QA 1Z0DA 3E5HA 3KFXA 1OJLA 5SZIA 4EPVA 2WAYA 3T06B 5J4LA 3NKVA 1CEEA 3SBEA 4N1AA 3E1SA 2ONJA 5JHHB 2ZJ2A 4CEIA 4P4SA 4K81B 2QP4A 1AN0A 1EX7A 5LDDC 3GFTA 4A6PA 2WJIA 4MH0R 4UNPA 4WOPA 3DL0A 1P9WA 4RD1A 1WP9A 1JR6A 3QOFA 4V0OA 1VYUA 3BXZA 1FFHA 2PL3A 4AURA 3FMPB 1F6BA 2PT7A 3OIYA 5CYOA 2DBYA 2IEZA 3TKLA 1KI1A 2PCJA 5IK2D 1VDZA 1E94E 1AM4D 3SOPA 4LJ5A 3LAWA 3W6OA 4QJ3A 4E09A 2WKPA 3FE2A 1UBEA 2D2EA 3B82A 1JAIA 5L8VA 3NBFA 2IXGA 2F1HA 3W6NA 1FP7A 4MUBA 1YZKA 4KVGA 2PMKA 2SHKA 3T5GA 3CH5A 5DI9A 3O47A 2ZE5A 2JLQA 1BOFA 1J2JA 3GEEA 3RRYA 5DO9A 4GOKA 4DB4A 4URWR 1KMHA 4YDHB 3WMGA 3RABA 2XJ9A 2QA5A 1E9BA 3L0IB 2ZJZA 1G5TA 1JJ7A 2ECKA 2EFGA 3QVVA 5HE9A 2XEXA 3LA6A 1NL3A 3QKSB 2FSHA 4LJ9A 5KSOA 2XTNA 3KQLA 5CLQA 1TU3A 2H92A 1KDOA 2NTYC 3K9GA 2HT1A 2ZUDA 2C95A 1WE2A 3EA5A 1DAHA 2ONKA 3Q8XB 1R2QA 2P3SA 2WVJA 4KV9A 1GUAA 2P6RA 3CIOA 2FZLA 4PZZA 4XIGS 4EJSB 4L8GA 2QM8A 1SKYB 3UG6A 2WWHA 3V9PA 4Q4JB 1TQ4A 1K5DA 4WZ6A 1WRBA 3SHWA 3SR0A 3UANA 4NYJQ 1DTSA 4TMKA 4FWTA 4XH9B 1GZSA 2EWVA 4G5RA 5L3VA 1P62B 4K8OA 5EZ5A 2W2XA 5JEDA 4R7ZA 4JL8A 1E79D 4IVRA 4LUCA 3JVVA 5D3MB 3K9LA 4DJTA 2W6JA 5AWFC 2ZI7A 1QHNA 1OFUX 3FKSD 3IKJA 2ZU6A 3B6EA 4HAYA 1MV5A 4U02A 3WYGA 1NI3A 3TIFA 1MKYA 5JSZA 3QKTA 1XEXA 5F3WB 1OXVA 4OBEA 1E98A 3QXSA 4M2LA 4A9AA 4M9SA 5F9HA 1QHSA 3M0EA 4WXPA 3R9IA 1IXSB 3AP3A 1Q0UA 3IO5A 3LVRE 4GSYA 1V5WA 1NIPA 1HYQA 4A36A 4OQMA 1T8TA 3C41J 3Q72A 5C4GB 1MRNA 2H17A 3ND9A 4LHVA 3OEED 1M2OB 4LK2A 2J7PA 1XTIA 4RY2A 5FI0B 1CJVC 2P6UA 4PPGA 1M8PA 2N1BA 2J7KA 3GEHA 1Z0KA 4CW7A 1OIXA 2IWHA 3AVTA 3BAFA 4IOKA 1KZ7B 2LKDA 5DSZA 5EXSA 5F9FA 1OF1A 2PMDA 2W6ID 2A5JA 2BDTA 1R5NA 4DCNA 2CBZA 2EU8A 2PX3A 2BBWA 1ZIOA 1T8UA 2F3RA 4Q7KA 4ZIRB 4WVFA 3PEWA 1OXSC 5TMPA 3BE4A 2GAAA 2JA1A 4TYWA 4MRVA 4PZYA 421PA 5IDVA 4BLPA 1P2SA 4JJKA 4XWAA 2ZYVX 3K0FA 5B58C 1GKIA 2HCBA 2WWYA 1DAEA 3WNCA 3UWKA 4B3CA 2NZ8A 3THYB 2WV9A 3T1VA 4RSGA 4B71A 2IYYA 3CPHA 3UMRA 5AUPB 4B33A 4GMXA 2JJ8A 2FZ4A 1FL9A 1XD8A 4CIDA 1KI6A 4LJ4A 4OHXA 1DOAA 3B85A 5B2ZA 2JEOA 1ELOA 2QAGB 2VHQA 3TUIC 4W9MC 2ZM5A 1KK3A 1KGDA 4YXWA 2TMKA 2RKOA 4XD7D 1NN3A 2X2EA 1PZNA 2Z43A 3MWLA 1E2JA 2MSDB 3B1ZA 121PA 3QIAA 3PIRA 4D4MA 4NCIA 2GVDC 3B60A 1I2DA 2H18A 4TQAA 3GP8A 3GLHB 3A37A 3PENA 3SC3A 2FN4A 1GTVA 2KSQA 2QM7A 2X19A 5EP2A 5KSYA 3TSWA 4C0KA 1XTSA 5JLJA 1R8SA 4ARZB 1ZM9A 2ZJBA 3ZZ0A 2WIBA 3NBZC 4L5BA 5DI3B 3C7KA 4UKDA 2GJSA 4CEJA 3GLGB 1Z06A 4H9GA 2QPTA 4GFDA 4KAXA 2CK3D 4G5QA 2AHOA 1JPNA 1VCIA 1CULC 2JLRA 1BH2A 4II7A 4PHTA 4RCYA 3TMKA 2R2AA 3KQHA 1GP2A 4OHZA 4O3MA 5FUYA 3LDAA 4TLEA 2Q9CA 2ORIA 4M1YA 4WBSA 5LB4A 1NVVQ 3VU9B 5EUQB 3CM0A 1BS1A 4JLKA 2GF9A 4PHFA 5AUNB 3QENA 4RFVA 1MO4A 2W6JD 1AKEA 2F1IA 4M53A 3GJ8A 1DEKA 3PV0A 1M7HA 4MKGA 4NU0A 3GLGA 1ZYUA 1YRAA 4Q18A 1IAQA 2CHQA 3GLGE 3M1IA 2Y8EA 2D7DA 5FOWA 2DFKB 2ZJ5A 1NN5A 4IOLA 4JLPA 1P72A 2FU5C 4HATA 1SKQA 2O5VA 2NIPA 5EXXA 2QSZA 4NBSA 3NBXX 3I72A 1QVAA 1TQ6A 4LYHA 3AM1A 2ZS7A 2XGJA 1DAFA 2X8AA 1Z47A 4ILEA 1UM8A 3U3KA 2Z0MA 4TYYA 3ONWA 4OK3A 4PAQA 4KFSA 2OLKA 2QGNA 1W4CA 3W8RA 4OI2A 3KQUA 1UKYA 2NZJA 1E1QA 5J4YA 1D2EA 3PUWA 1XB2A 4K46A 3U5ZB 1VG9B 4MYTA 4NYMR 4ZDJA 1DO0A 4YXWD 2WPDA 1N0VC 2GEVA 2RGEA 3I4LA 3EIQA 5JECA 5FPYA 4ZIRA 4LC1A 1Q12A 1LS6A 2YINC 3D31A 1XD2B 3I5XA 1OE0A 3NIBA 1HH4A 1NVUQ 4P0TA 3AVOA 1YU9A 4KJZA 5HE8A 4HI0E 1E0SA 3WHKA 1KAGA 1NF3A 1OPXA 2D06A 4TL8A 3A6PC 4MGZR 2V6IA 1AZSC 3IDQA 1KKLA 2Q0HA 2PJZA 5JI2E 1CJKC 1ZNZA 3WXMA 2NG1A 1T0JB 2B8TA 2ZRKA 2IUUA 5TVKA 3K70C 3W34A 5CIWA 4A2PA 1VG1A 2ZETA 1NLZA 4CRWB 5BW8A 4I1VA 5EXTA 3GMTA 3NDBB 4TN1A 1H8HA 1GNQA 1NJGA 2ATXA 2BEKA 1W36B 4KODA 2FEMA 1ZC4A 4JLAA 2VSOA 4QJ5A 2DHRA 5JRJA 2DYKA 1E0AA 1EGAA 4PPFA 4OI0A 4A2QA 4M9QA 1AJEA 4GMDA 3C14C 2UKDA 1ZUNB 4PQRA 1CRPA 4FXPA 2UZIR 3THWB 5E4FA 5J4KA 5L3SA 1Q1QA 1M1YE 2ZYWX 2R6FA 4DUGA 1G3MA 3CWZA 4KFRA 2WHXA 3EZ6A 3A58B 4LHZA 1SGWA 3NEYA 3Q85A 3ZZTA 4DEXA 2GZAA 3I61A 2A30A 2ATVA 3PEUA 4AYTA 3W3AA 2YNMA 3BIFA 4CEHB 1N5IA 2NPFA 3K70B 1H8EA 2DWQA 4Q4HB 3S1AB 1GL9B 2QI9C 2QQ0A 1LV7A 5M04A 2HXSA 1I4LD 1ONBA 1U8AA 1QG2A 1A5TA 4AG6A 2GRJA 2V6JA 2PEZA 1EFUA 1ZCBA 4JLVA 4Q66C 1W2HA 5GADl 1U94A 3BOSA 1DADA 3VX4A 4X8OA 2O8DB 2RGDA 5EE5B 3K8YA 4TLCA 2RH5A 4PQFA 2JLWA 3OAAA 5BN5A 3BWDD 4QM6A 2GXUA 1R6BX 1CLUA 2OXRA 3LY5A 2HYIC 4DKXA 3D6TB 5BXQC 4GOJA 2IT1A 5KO2A 4DIDA 2GA8A 2XOKD 1P73A 3WRYC 1GIAA 1KK1A 3HWSA 3AVQA 5FTJA 2I4IA 4BASA 2WM9B 5SZJA 4XSGA 3LO5A 4ZCIA 2PZEA 2EFHB 1XX6A 2WSMA 5JRZA 3SHFA 4D0GA 1DVRA 2HF8A 3QF4A 3RHFA 1P75A 1UADA 4HLQB 1DG1G 5JS8A 3QBVA 2W6IA 3LH5A 4CZ2A 1XXHA 1KO1A 2QP9X 3AB3A 4A92A 3P32A 3DKPA 1RRGA 1W1WA 4P3YA 3T12A 1XFAA 1VHLA 2VLIA 4UXIA 3WMFA 2YZ2A 3SZRA 2O0KA 3B9PA 2JIZD 2XNSA 3SYKA 2HDNB 4MGYR 1FTNA 1XJCA 1W4BA 2H1LA 4J0QA 4LSGA 4A0RA 3SDZA 1U0HC 1XD2A 4TLBA 4RZ3A 4TWZA 1YQTA 2J0UA 3DPUA 3LFUA 3OF5A 4LJAA 5FTMA 1F2UB 3VR6A 1G1MA 3WYFA 1GNRA 1Z8FA 1L2TA 3SE0A 1XMVA 4KSBA 3CNNA 1MRSA 1Q21A 3M4YA 3WNBA 2ZE8A 1AQYA 2OUKA 1RYFA 5L3SB 1NY6A 3PUYA 1FZQA 2C96A 3OZXA 4BRWA 5FBQB 1Z6AA 4V0MA 3LQRA 1SXJA 4IVQA 3SJBA 5JHGB 2JGNA 2ERXA 2PT5A 4L9SA 1W44A 4ON9A 2CLDX 4Z8YA 1BMFA 3U61B 4X8MA 4DLSA 4LPKA 5FL7D 1ZD9A 2YVUA 2KJQA 2ZI5A 2JJ2A 1FOEB 2N42A 2LKCA 1RJ9B 4FMCF 3ZGXA 1W48A 4F93B 1YZUA 1X8LA 2JJ1A 4Q7MB 1ZIPA 3T1OA 1IN6A 4EJSA 2GZHA 2EQBA 4QOSA 4A0FA 1L4YA 2WZQA 3FB4A 3TW8B 1NG1A 3OFNA 3C16C 4OHVA 4A6XA 4ESVA 1SVIA 1HQYE 1HE1C 1QHHB 1XPRA 2QT1A 4FMDF 5F98A 3CX8A 1TF2A 1IONA 2WTUA 4Q4AB 1ZCAA 3VR4A 4QGHA 3HU1A 1E96A 3SEAA 2HJVA 4OK5A 4MDFA 3MJRA 5BYKA 4NONA 1E9DA 2RGCA 4LBYA 2AKAB 3LLUA 3A4NA 4JLOA 4KI0A 1QG4A 3T34A 1DARA 3X1DA 1PUJA 3RS2A 3AKDA 1F60A 1Q44A 3P1JA 4FIDA 3EPJA 1ZM7A 1XTQA 2W58A 4LCBA 2V7QA 3AVVA 5SZKB 2REOA 3NG1A 5L3QA 1U0LA 2GK6A 3GLFA 2IHBA 3VQTA 1IJEA 3UKDA 4OJQA 4AY2A 4F38A 5DYGA 5CYPA 2EFDB 2REBA 4V0LA 1KY3A 1R4AA 4B73A 4OHWA 1L4UA 1JAHA 1YZGA 2OV2A 1HT2E 5DH9A 3UG7A 4BUJA 2ZAMA 3W9YA 2JATA 2R6GA 3I8XA 4Q9IA 1XNJA 1W47A 2FJUA 1EXMA 2BCJQ 2GCOA 4PSKA 1S8FA 5E7JA 3Q5DA 4CDGA 3I73A 5C2JB 4TMTA 1YVDA 2CDNA 2G3YA 2YHSA 1LB1B 5KDLA 3T5DA 1XPOA 1G7SA 1GNPA 3FKQA 3LX5A 1M34E 221PA 2FSIA 2R44A 4IFBA 1MO3A 1N6NA 1S2MA 4PAMA 4PO8A 4C2TA 1VCOA 1YZLA 1U99A 1X1RA 4I4LA 2IYTA 4KYIB 1KDPA 1WXQA 1RZ3A 3VR3A 2BMJA 4IKEA 1JR3A 4BPBA 3ICEA 1FP6A 4IEEA 4TMZA 1Z2AA 6Q21A 1X1SA 2HEIA 2VF7A 4RZUA 4NMMA 4W5HA 3OIUA 5HZKA 3TLXA 2E87A 5FL3A 3TNFA 3EC2A 5FPSA 3A1UA 5DIFA 3SU8A 5H68A 1JNYA 3BRWD 2J7PD 3PG5A 5GJCA 3GFPA 1Q1ZA 3LW7A 5C46F 3IUYA 1HUQA 2C78A 4GI7A 4CT5A 4Q1BA 1FMJA 3FWYA 3I8SA 1Y63A 1VG8A 2O8BA 1GL7A 1U9IA 1NVXQ 3KZ1E 3W6PA 2D62A 4XVQA 1E9FA 3IPXA 4GZLA 5TXGA 3RLFA 4BWYA 2MSCB 4Q4LA 3K0FB 4FI3C 5CJ2A 3OHMA 3EZ7A 4MKFA 1LF5A 3CNLA 1CRQA 1OH5A 1GDDA 2G88A 2NMVA 4RKEA 1A1VA 2IYLD 3KTAB 1DS6A 1GAJA 2ZJOA 2RMKA 4RD4A 1KSGA 3THXA 2A5GA 1ZVQA 4HB3A 1YKSA 3ZS8A 1BO6A 2O8EA 3RANA 1XEFA 2P67A 1GKUB 2JLYA 2P0EA 4A8JA 2FFQA 4D82A 4EPYA 1QDEA 2G0TA 2VP9A 4DSUA 4Q03A 2FPMA 5B30A 5KUTA 2H5EA 1VHTA 2VA8A 5FOSA 1FQJA 2ODNA 1ZP6A 3V4FA 3LXRA 2YYZA 3GLIB 1N6PA 1P7CA 5CM9C 2O8FB 4YC7A 1X8JA 2GJAA 1VKJA 2FFBA 1NSTA 4Q02A 2E1RA 3QF4B 2JJ2D 1NMZA 2YJTD 3GCGA 3HDTA 2CMKA 3UWOA 3AV0B 4G01B 2OXCA 4HSEA 3MJHA 1RYHA 1TUEA 2IW3A 4UJ5A 4HAUA 2XB4A 3PJRA 1KHTA 4HB4A 1G18A 2D7CA 4M4SA 2OO7A 1J8MF 5CITA 2FDCA 3L0PA 2AD1A 4FINA 2RGGA 2HXYA 3RWMB 2IS1A 5F2EA 3GLIA 4V0KA 4MYUA 2BVNA 4UXHA 1N6KA 2F1JA 1JPJA 4F4CA 4ACAA 2Z5FA 2R65A 1N0UA 4EPTA 2LWIA 1KO5A 3QSYA 2C2HA 3MG9A 2VHUA 4H1VA 3U3JA 4W7SA 3U7EB 4OYHA 1UBCA 4PSAA 1GRQA 3QG5A 4IVPA 5EE9A 3PITA 4DLXA 2B6HA 4BZPA 3TAHA 2YWHA 3AGPA 5D3QA 3VHXA 2GXQA 2XSZA 3DMDA 4TMXA 1KY2A 4TZ6A 1V43A 4NTZA 4I81A 5HKKA 1ZM4A 1TL7C 1OXTA 4YMSA 2ZREA 2R6CA 3FKSA 3CH4B 4BFWA 1W7AA 3LD9A 2JDIA 4GNKA 2P2LA 2QMUA 4UNNA 5IF9A 3KUCA 3O8RA 1OH8A 3LVQE 1BIFA 1FQKA 2QN6A 4HUQB 4CEIB 4NH0A 1KMHB 3A36A 3EWAA 3RRMA 2C5LA 3EIHA 4Q48A 4Q47A 4IEIA 1U81A 4HUTA 1Q57A 1OFIA 4PC1A 2OT3B 5FH9A 2O8FA 3IHWA 5HCIA 3VHLB 4OHYA 2VEDA 2VP5A 3EZ2A 3RVBA 3RSOA 3OIWA 5H1YA 4MUAA 2FPLA 3GLHA 4JT4A 1UKEA 2IYVA 4TLDA 2ZUBA 4Q19A 4R2IA 5HTKA 1E6CA 1FNNA 2QE7D 1BMFD 2OCBA 1E9AA 1OSNA 4PC6A 1XXHB 3RYTC 4JYBA 3C8UA 3U4QB 2WMOB 2RGXA 1TF5A 3TVDA 1N0WA 4DSNA 5HKKD 3NDPA 4Q01A 4LC0A 4ZDWA 5KOYA 3AVWA 2ORWA 3T35A 4FMCB 4HLCA 3W3ZB 2FGJA 1TMKA 2Z83A 1OIWA 4NHOA 1TADA 3ADCA 5FPHA 3RS5A 1Z0IA 2D74A 1T4GA 2ZYTX 5KYKA 4AK9A 1SULA 5DNYB 2ZSAA 5C1BA 1WDTA 3CRVA 1N3BA 1E1RA 4F91B 2QMEA 4Q1EA 3FPAA 4TT3D 4R2HA 1FW6A 2H16A 1XZPA 5A5GA 2BKUA 1AS3A 3OEHA 4F7WA 4IXNA 3AVPA 2ZRLA 1NSFA 3UATA 4TTRA 2CL7X 1IHUA 1YJ5A 4BFYA 3L2OB 1W46A 4OQLA 1R5BA 2BM0A 1P9RA 2ZITA 5BWMA 5ELXA 1G8YA 3BH7A 2A3RA 2C9YA 1KI3A 1E2PA 4B2LA 3RDPA 821PA 4Z8XA 4ZKDA 2BC9A 4IDQA 1II0A 3C5CA 4I1SA 4PAOA 1R0ZA 4NKRA 3IBYA 4XWKA 3VKHA 4ZI2A 1N6RA 1XTKA 2QTHA 2I3BA 3I1FA 2F43B 1Z63A 4JBXA 3WY9A 1AQUA 3A1WA 5SZHB 3EC1A 1EX6A 3B8HA 3TR0A 4X8LA 4TSFA 3ZLJA 1XEWX 3ZH9B 3QQ5A 1FMLA
chains in the Genus database with same CATH superfamily
4UASA 4N5LA 2GBLA 5EVCA 1N4AA 3MERA 3O8DA 2H2DA 1A2BA 1CS0B 1PN3A 3E18A 3TNYA 3VDMA 1Q1EA 2HSWA 3HE3A 1I5EA 1L4GA 5JIBA 2JFVA 3D0OA 4AN4A 4HYYA 5EN4A 1QFMA 1PJRA 3OZWA 2IW1A 3E2IA 3EIWA 3EEOA 1E77A 1GFIA 1P6XA 1UWVA 2WJJA 2XCUA 2AOWA 1D04A 2P5UA 3IIKA 3B1VA 3KJGA 3P19A 3FTEA 1QH9A 1ZWLA 3RSLA 4HXEB 3GAFA 3O0DA 4LW8A 1EDEA 1CR2A 2XYGA 3L6OO 2ZWVA 1IY1A 1NW6A 5DIZA 2A3NA 3U7HB 1IFXA 2EVWX 4JJFA 5HK9A 4ZI7A 1GUFA 1T34A 1K2VN 3HXOA 1KP9A 1LWNA 5DHUA 5EWLA 2QQEA 4NYJR 5T4EA 2CNOA 4R1UA 4AKHA 5DX0A 4CQMD 3JQGA 2FDRA 4ZMSA 1UKVY 4QDXA 2XMCA 2P65A 3O1LA 1ZNXA 4RXTA 1M7GA 1C3LA 1NOIA 1PWYE 3AC0A 3K4HA 5KAPA 5SV2A 1U2RA 3EXG2 1NLUA 3R6WA 3PDCA 1N8TA 4E5PA 1O9GA 3T9BA 4ZO7A 5F2NA 4RVUA 1E7WA 3P97A 4HNGA 4B6QA 4I99A 4CUKA 1L7VC 3SVTA 1YGPA 2FSPA 4RPHA 2R8ZA 3ZE7A 3T7DA 1Y33E 4GLLA 3CRW1 3VTAA 2PQ0A 3M3DA 3PXCX 5BW6B 2A1TR 2ACKA 3TPFA 3WK9A 1JDSA 4RZXA 4AKTA 4LN1A 2CLCX 1Z07A 2C2WA 2EIXA 3BRQA 3OCJA 3QI2A 5HGJA 4PX2A 3L5KA 2J3EA 2PBFA 4P4UA 2ZVPX 2YMPA 2YYSA 3K32A 2D54A 2GLUA 2OGUA 1O97D 3DEHA 3AGQA 3IP9A 3DGEC 3L6DA 3MCAA 2QZZA 4PSCA 4LDAA 3C24A 1KERA 4YFYA 1DX9A 4AMGA 3B5IA 1FXWA 2BJVA 2GLTA 5JXWA 2MHCA 4L0MA 2H1CA 1QJ4A 4XJVA 1KRWA 2JD2A 4CL0A 2ZJFA 1HMYA 4FN4A 3U60B 1LPOA 1QWOA 1KKMA 3GV0A 3LBHA 4QBTA 1F38A 1I4EB 3AB7A 3N70A 4F8JA 1W75A 1WULS 2YXEA 1NE2A 4X85A 2QROA 4PIMA 3UT0A 3PGJA 4CNBA 3GJYA 2AMVA 3D8BA 3REOA 5CVTA 2IQ5A 2J0QA 3VU9A 5AUOB 4GSLA 4MQUA 2Q41A 4HXFB 4Q7QA 4JODA 1P2BA 2YASA 2A9OA 2PCLA 4JBWA 4JOQA 4AB1A 1W4RA 2QD1A 3TZLA 4GX1A 4MS3A 3T15A 1FDSA 1PKXA 3BXFA 4RV4A 2Q6IA 2RE8A 4IDGA 2H54A 3L7LA 2V4ZA 1O2DA 1XCMA 2W8BB 3M5DA 1HQCA 1I33A 2O0LA 5JDIA 1B0PA 1ZC3A 2BPOA 3ICQB 3F6EX 3K6SA 2FPPA 2XZDA 3E9QA 1SNYA 4H6WA 4DR7B 5IC4A 5EJ2A 1ADJA 2NYAA 1D4AA 1WZEA 2NUBA 4PO1A 4WXYB 3RTAA 3RPEA 1RD4A 3AXTA 3UJ9A 5HGXA 2ODTX 3L7YA 1L5YA 5ALLA 3WLMA 3QJGA 1JNXX 4ZN6A 2KBFA 3HN7A 3VV3A 1U3FA 1MU0A 3HFGA 1FMCA 5JZ9A 1NP6A 3VSCA 4AZ0B 3RUPA 4XYBA 3BB4A 1DUIA 4RZ2A 4CIVA 1QQAA 2G7ZA 1WW8A 2QYSA 2EERA 4TSFD 2OV6A 2OCGA 2X9GA 3TSZA 3WLAA 4AJLA 3D6FA 4C0QC 2Y1DA 3ROZA 4I6JA 1F2TA 3HR8A 3HYRA 4HUJA 3AF0A 1QOQB 3UUEA 4B7UA 4L51A 3WA7A 3PA8A 4RVCA 3BJIC 3IDZA 3RG2A 5JH7A 4YQFA 2W43A 3RYHA 3VSBA 3GDFA 4LCEA 1Y5LA 5FOUA 2J1LA 3KUDA 3SZUA 1NJFA 3CVYA 2ZR7A 4I2NA 5CEEA 1TO6A 1FIUA 2Q1UA 1QV9A 3I2KA 3I9OA 4BE7B 1AV7A 1KAOA 3O4VA 2AC7A 1EUYA 1W0JA 2N46A 2CCGA 1RJWA 4IRUB 3OX2A 3LT5A 2J08A 4X20B 1K8QA 4PRKA 4G5SA 5I7VA 2I55A 1UCFA 3ZDQA 3DEJA 1J8YF 4NNJA 4QGGA 1XMOB 4LCJA 1FVFA 2JBWA 4URFA 4UU0A 1IATA 2IYRA 3DOIA 4YQEA 3URMA 4DT1B 5JDIC 3OEEA 3RIMA 3X2FA 2PD6A 4UPDA 2FZGA 1E9EA 1M75A 2C29D 3OZGA 3H0KA 2BDUA 1KSHA 2OLJA 2MSLA 4RGBA 2FX2A 5T4HA 4BY9E 2XYHA 4Z2AA 2HMTA 4DIUA 5K05A 3MJCA 3LQFA 3FMIA 1QE5A 3R4VA 4GR9A 2CHEA 1A9QA 2YX1A 1U7WA 4GQAA 1DFGA 3HXPA 4IGFA 4MWTA 4Q4AA 6NULA 4BNYA 1K92A 4Q37A 3GEIA 3CF0A 5AW9A 2Q6VA 2A78A 2I9PA 2IITA 4OJTA 4XM2A 1G6HA 1T2DA 2I1VB 2A0WA 3EMVA 4Z7QB 5BVGA 1HOTA 1KEVA 1VYHA 4FIZA 2P41A 5AK3A 4DDKA 5KNDA 2VYND 4LK3A 1KJJA 2MJLA 5JR3A 2JK1A 4HEQA 4M0LA 4MXDA 2V6GA 4Y8VA 4Z7OB 2D1SA 3SZ3A 3IL2A 4HLUA 3FTCA 1M10A 1FDWA 3FCYA 4ERNA 2HTEA 3OETA 3ZDBA 3AOEC 5ALRA 2O2SA 3PNQA 3PX7A 4IRXA 3HJTA 3FOAA 2AOXA 1E1MA 4M1OA 1AQNA 3ZVRA 2JPDA 5KNBH 4Y2SA 4TVSA 3S81A 2QUHA 1MJGA 1YR9A 1X7HA 2P4UA 3DCIA 2F6RA 2VIIA 3D4LA 5AJHA 1P1FA 3WIEA 4TMFA 1KDVA 5ARCA 4MX8A 1NLMA 2Y1KA 3GU3A 2HX1A 3T5TA 3TXAA 1ECFA 1HLGA 4UUPA 1BEUB 2YFHA 3MTJA 4ZJUA 4G3XA 4A8JC 4I4TA 1A7AA 5FB3A 5GVSA 3TSCA 1E9SA 4BVLA 2H1SA 3PHHA 4PAGA 4CLDA 2DLDA 3MINB 3UIEA 1OA0A 1I3NA 3WB2A 1E3SA 1WD7A 3EA0A 4AJ1A 3QLUC 5DX1A 2W4MA 2BZ1A 2QTLA 3ENKA 4JENA 2YWFA 3NPAA 1NG9A 2AN9A 4OHFA 1SCIA 1IN5A 2WY2D 3WLSA 1F8YA 4JKOA 1KEEA 1Z39A 3UBTA 4OX9Y 2XJ4A 4V39A 3UC5A 5BNIA 4Z54A 2BP7B 2JCGA 3BFKA 2D8MA 1CZRA 1CJTC 2I76A 3LC7O 4XGRA 3FN4A 3SNHA 5K8TA 5JJBA 3H1PA 3PUXA 1HYEA 3D6NB 4FFNA 1E3MA 3MB8A 3AOGA 3L77A 3RU3A 4I66A 5A0FA 2IZ1A 3L43A 1M2OA 2PLFA 4V1CI 5KWJA 4KOAA 1YA6A 1BCSA 3UICA 2PXAA 1ZPDA 1CUFA 5BMVA 4J76A 2OCPA 3MRXA 4YGYA 3PFKA 1YE8A 2LIPA 3K9BA 1NQVA 2HTFA 3SX0A 1KYIA 2OGTA 4D7AA 3PR2B 1O3YA 4G23A 1VJTA 4EDHA 5A9RA 3LSYA 3WQBA 2B3TA 3ORYA 5C3MA 2I6GA 2JJYA 1JLLB 3LWNA 3N2ZB 1F3OA 1CZOA 5F5LA 2OY0A 3GCDA 2PRSA 1YE3A 1ZONA 2I65A 3QPVA 1RJFA 1TEXA 4G9BA 4LTNA 4DLRA 4EF4A 5JNTA 5SYNA 3F6SA 4QHSA 1N7HA 4Y0AA 4LHSA 1G3QA 1EQAA 3L1IA 1FVOA 1PV4A 1B73A 2BRUA 2CD9A 5CT9A 1A7JA 1I9CA 3SDSA 4LJ8A 5LQCA 1T3ZA 2R79A 3LFTA 3M1YA 4MROA 2ZTSA 3BQNB 3KAJA 3I52A 4RELA 1I36A 2QL5A 3B1YA 4M8NE 1DC5A 3LW8A 5CTJA 2E4UA 4K2AA 4LNAA 2EEPA 4LAFA 4N0EA 5A4FS 5JAIA 1DWQA 2RKBA 1WPGA 2GS9A 3DMTA 1YS1X 3DZDA 3KBBA 3M9LA 3OBBA 4LVOA 1KI6B 4BNJA 4FUQA 4FGJA 4C43A 4N0DA 3V97A 1BD3A 3CX4A 3AH8A 3GPIA 3O7MA 4NDZA 1NOKA 1N7JA 1SPBS 1CX9B 3S4YA 1XA4A 4Q3DA 1KAMA 2ZB8A 5ADHA 3J81A 2CCKA 3ZOZA 1C9MA 3H1AA 1G41A 2FW1A 3ESZA 3OCVA 5FPQA 3CGGA 2IYUA 3CF4G 3ZHOA 2M6LA 5JO0A 4QUAA 4U00A 1GXSA 2LE0A 5HCUA 3MMZA 2VNKA 4WH0A 2PIDA 3QWFA 3WGQA 1M6VA 1V9SA 1PF7E 1D3AA 2P2ZA 3HNRA 1ZH0A 4HDNA 4ZALA 3DHYA 4LRWA 5FUXA 4F97A 1W5FA 1A9ZA 1D4OA 3RWOA 2A7QA 4FFBA 4B76A 1A9SA 2GEBA 3JWPA 1OB5A 2C2YA 1EZ4A 2OV1A 4TKUA 1JG6A 4X6XA 5KSZA 1YQGA 2P5SA 2CXUA 4JSRA 4QL3A 1HM5A 2QV7A 5I9BA 1PFGA 4F4FA 5K8LA 5EEGA 3FUXA 4C3ZA 2X9NA 4GBJA 4CBVA 4EDFA 3LYAA 3PNLA 1G3UA 1N3YA 5SY6A 3ZIAA 1CE8B 1KF0A 3WLHA 3V8VA 5AW7A 4KE6A 1KTIA 5KC9A 4IIJF 3LRPA 1G8SA 3FUUA 4PW0A 2XNJA 3G5AA 4EG8A 1CNEA 3PGVA 4WBNA 4TZTA 5CBKA 2OZVA 1U3VA 1XDSA 4HH0A 1WSDA 4JR1A 4LZOA 4H6XA 5HZHA 1IBRA 3B89A 1ZMXA 3ILSA 3GJ4A 1EXDA 4YJ2F 2FZCA 2HV9A 2QENA 3NB0A 2DBVO 2W2VA 3D7LA 3NC0C 4IAOA 1TJ5A 1A96A 1LSSA 3KZNA 4O2AB 3T1NA 4FYWA 1Y1SA 2QHXA 3M9WA 2X0EA 5L7TA 1ZNWA 2QI9F 4TVOA 5B12A 4FFWA 3N2IA 3RHSA 2C0PA 1TIPA 1GV0A 1TIKA 2E85A 1CU1A 4D9CA 3N07A 1SC1A 1FMTA 4GPAA 4NBVA 1M6YA 1HETA 2D7JA 3U7GA 3F6RA 3ANXA 1ABEA 3JZFA 2VDPB 4K6MA 2VJQA 1C8BA 3NBYC 1ZY2A 2A5FA 3E22B 4S1OA 3E03A 1J1IA 1JVBA 1UDRA 2M1ZA 3FF4A 3M2TA 4GI2A 3ZKAA 4NR0A 4RJJA 3A3KA 5CHEA 2YJGA 4ARSA 3BWYA 2H1RA 2X58A 3FPLA 1CZKA 3RYIA 1LRJA 1WDMA 3PHGA 1BXZA 3AF4A 3DE0X 3SE7A 1QU3A 3A6HA 5H70A 1VCHA 1E4EB 2QX4A 2R6JA 4W8OA 3VR5D 3DOFA 2C4UA 1G5PA 1NHGA 1WUIS 4QNNA 3TPCA 1Z6TA 4ENQA 4OFBA 1V7CA 4KPGA 4U9HS 5EERA 2H63A 1PGJA 2IZOA 2W4IA 3QXJA 4JS0A 4W5WA 4YVFA 2AEJA 1YQ9A 2FXVA 4S12A 3F4LA 1C7ZA 2XDAA 3O1HB 1WY7A 2B8JA 2YH2A 3IT1A 3U2QA 2QSYA 1FE8A 4JZKA 3AUYA 3ZE0B 3AM3A 3GRKA 4XJSA 1L3IA 3ETEA 5E7MA 1M8FA 3RVJA 2JLXA 1VCNA 2GTHA 4J7XA 5B4VA 1I4WA 4WOBA 2H1FA 5FWAA 4QPJC 4Y98A 2HJWA 1PQYA 2J3QA 3I1YA 1IJKA 1YA8A 4A6DA 4D0NA 4ZHSA 1MV8A 1PJ3A 1E9RA 3S2ZA 3PGKA 1E2QA 1KVTA 2BR4A 1GFWA 1JEQA 1DL5A 1DTEA 4M9CA 4QRDA 5DEOA 5E4JA 1K5PA 1SBCA 2CXNA 1P1IA 2DQKA 1XQVA 3GUUA 4W9RA 3TQCA 3WADA 4A27A 4HYTA 3GN1A 4LS3A 4ZYWA 2D59A 1KFBB 2WI8A 2WUEA 3DBHA 2G67A 1KYQA 2UYOA 4RA6B 4P6VF 5JXIA 3DC7A 1TKBA 4WXMA 5AJUA 1E79A 3BJEA 3D6AA 3F9IA 4OB8A 3UJNA 2IXBA 1MUUA 2WJWA 3T7EA 1W6RA 3PC6A 4JJIA 4C01A 3DZ8A 5E7IA 5HA5A 1FDTA 1LLCA 1II8A 3B3FA 1W36D 3B13B 1KKUA 4ITRC 3EPRA 2PMFA 1E1YA 1NMYA 4J07A 1AOXA 3K4PA 1DIRA 2Z4SA 4LZWA 1XRMA 1GITA 1TOAA 5EXDA 1M8GA 1KEUA 2YVQA 5JT1A 1SQGA 4ZEMA 3HH8A 2Y1WA 3DVLA 3TO5A 3GUVA 3PJFA 6REQB 4W7IA 1T1GA 5DNDA 3TF5A 3OQIA 1VIMA 1EE9A 5CDTA 3UENA 1QIFA 1MD9A 1BKDR 3KZMA 2WWXA 3U6BA 1JN0A 3L0DA 1P81A 3AESA 4C78A 5FEMA 1COWD 1J7JA 4PR0A 2HQSA 1JALA 2J31A 3NOVA 3CG0A 1SXJD 2P5TB 4Z0PA 3V4ZA 4DARA 1XFDA 4MRPA 1E2UA 3EVCA 1Z6YA 1LSJA 3YASA 2IS4A 4IG4A 2AG0A 1W88B 4M1SA 2ONZA 3DLHA 2QRKA 4C6SA 1NW7A 2ZRAA 3C3PA 2CFTA 2B7BA 1DBRA 3PJGA 3LO8A 3Q9SA 3KLPX 1VIVA 2XMSA 1I3OA 5EQDA 5AUQA 1YB4A 3T9AA 3LHIA 4JLNA 2XUZA 3U4DA 3U3XA 4H3VA 1LGYA 5IANA 4MEBA 5EHIA 4RKFA 5L4LA 3ZK9A 3ANTA 2J9RA 1UQTA 2A9QA 1OUMA 6LDHA 1JG4A 3EXIA 1JBQA 3L7JA 4TQUS 2QY6A 4CR7A 5FFFA 2NSYA 4CIAA 3HCFA 2ZBPA 4QDZA 3ZDAA 4EENA 1INLA 2XUGA 2CXQA 4HGYA 1IWBB 2PZGA 4ID3A 4YRBA 1R0KA 2W4QA 1RM5A 5BXYA 3ASVA 1UBJS 2W5UA 2WJGA 1ZRNA 1PNVA 1EDZA 2ZUVA 4LRYA 1US8A 2OCYC 2P79A 5KI6A 5LP1A 4HZUA 2EZUA 5LOVF 4XQ0A 2ZSEA 1VM6A 1SXJB 3UJDA 4YUWA 3ECAA 5HQ3A 5EIBC 3LDFA 1G7RA 3FHCB 2UYQA 3NHWA 5KSWB 4Z2YA 5T41A 4AECA 2C54A 4F21A 4TKZA 4YT2A 4ZJPA 2Y66A 4DM4A 4JY7A 4KLZA 1OX5A 1TNDA 1UDCA 2Q2OA 4GE3A 4TRJA 2BWJA 2VT6A 4KYVA 5TV2A 2G63A 2AXNA 6GPBA 4BTEA 5KDOA 4MW1A 3T6KA 5AKGA 1GARA 2X5KO 1T4CA 1E4YA 2VQDA 2ZT6A 1JKJB 2P2NA 3N9IA 3K53A 3QP9A 4U7TB 1XTJA 3C1AA 5AHXA 1G3IA 3RIXA 1JXMA 1QPZA 1C2TA 1CUBA 1P1JA 1PX0A 1T2FA 3G2MA 1QP0A 1FVXA 3HK2A 2OA0A 4BNNA 1EESA 2I1QA 3C8MA 1P7VA 2L2QA 4G24A 4FGUA 2NUTA 2OXFA 1DELA 4OSEA 2AR9A 3A9VA 5KEIA 4YRFA 1R9JA 1OMOA 4J9UE 3DO6A 1C30B 4BEBA 4JI1B 2VDWA 4NCNA 2ZS8A 1UXOA 4UZFA 4PX3A 3SIXA 1PL8A 2P68A 3KQPA 1Q0QA 1Z0UA 3M83A 4I9NA 4UBKA 4AO8A 2BI4A 3EX7C 2B1RA 3B48A 1G0OA 4JJEA 2GFHA 5AJYA 5F5NA 2Y9PB 5A3VA 5KYWB 4V0RA 4QXRA 4ENWA 4QPPA 2QY9A 3MIIA 1I24A 2C2MA 4HZIA 4KO4S 2CNWA 3N8KA 4UNQA 3TQTA 4YTEA 1L6RA 4DKJA 4XFKA 1WZIA 1T5HX 4CG2A 4GDFA 1U98A 4IIHA 3KELA 1ZXLA 2HF9A 2R1TA 2X0JA 1N6LA 1T6YA 2OD2A 2R60A 3T7AA 1SA0A 3ZGNA 2B94A 2DOKA 3B70A 4AMVA 1U7DA 1LA2A 2D5IA 3C3YA 3C3JA 4FEGA 3LOQA 5TJ9A 3VFDA 4CG0A 4EHJA 1Q19A 1I2BA 1W0KA 1FBTA 1ZN7A 3NHLA 3JQBC 3OE4A 1NW5A 1IUPA 3CPJB 1PFKA 3E8MA 3QUSA 4JXKA 4QRHA 3G2KA 4RFSB 5CX1A 5K51A 4D3SA 4EW2A 1Y1LA 3IEUA 4OB7A 1VE9A 3QEMA 3GAAA 3QBTA 2IHVA 4RDIA 1NUTA 1URPA 5EQFA 7GPBA 2ZJ1A 2CWDA 3PNBA 1EZZA 2C8VA 5KYVA 2IYWA 1ACLA 4BQFA 3T5PA 4I08A 1HLDA 3ZJ5A 1QAQA 4YQZA 1RRFA 1B76A 3PPWA 4PPQA 2ZANA 4C76A 4S1VA 1ZM2A 2O8CA 3MWKA 5EHNA 2JA2A 1KRHA 2NO9A 3GZ4A 3DQZA 2DY0A 2Q9BA 3IQXA 3HU5A 5T7BA 1MABA 3P71T 3KXKA 1G9SA 1DT5A 4PZ0A 4PC7A 2NSJA 3KSDO 4P32A 3FPBA 1JAXA 5LQSA 4C6RA 3B3QA 1YTUA 1NIJA 4KK4A 3IHKA 2BONA 4JEHA 2E37A 1V6SA 4Y7DA 4X8HA 2C04A 4UDXX 3WLJA 3PHIA 4Z9AA 3RJZA 2X2PA 4LXIA 4KZPA 3SS7X 5F52A 2XH8A 3U19A 4URVR 2PEYA 2C88A 2XKKA 1QLWA 2FPIA 5EGSA 3T7SA 3R40A 2GZDA 5IVPA 5G1OA 2XQJA 2ZBDA 5C8YF 2OILA 3LPMA 1QO9A 4G1BA 2XBLA 3GLKA 2PT6A 1QRAA 3LX6A 3R20A 4I55F 4Y2RA 3ROXA 4AG5A 4C22A 1RBMA 3GG2A 2OHXA 3ZY2A 2Q3MA 3U4QA 2AX4A 4FCCA 2CFCA 1ILWA 3NDIA 1X6VA 2AD5A 5KJFA 1GQFA 3AIMA 5TB5A 1I0LA 3DXXA 1DRUA 1E2KA 1BKYA 3I62A 1CYEA 3D43A 1AG9A 1DIBA 2FJ0A 1RRCA 1YQXA 1G9XA 4OGKA 3TZHA 5K8CA 1LBQA 3G9XA 4YA6A 1A5SB 2XKBA 4BLRA 1QFZA 4UUAA 1ZH2A 1FYXA 2QD3A 2W0MA 4J03A 4LOJA 2CL6X 4P4TA 4NE2A 1X7ZB 3BK1A 1EQ2A 4JR2A 1L7QA 3CZPA 5EKDA 3WWEA 2FQQA 5DTEA 1YONA 3FVRA 3AF6A 2AWNA 3I2JA 1AUQA 4KUGA 4MQ6A 2VWHA 3DNPA 1N77A 1Z29A 2B92A 5KVSA 1K63A 1K89A 4P31A 2OXIA 1VL5A 3PSHA 2C1EA 1E66A 2GK7A 2FKAA 1NJ5A 4U2GA 4UD6A 5AKLA 4L4YA 4ZYVA 1Q74A 2WIKA 3A1SA 2HCJB 3D4NA 2Y1CA 4M8KA 3WA6A 2X1HA 3F6PA 1G291 1GILA 3D2CA 3L93A 3WDMA 4MVWA 5AKHA 2EJWA 2HJGA 1LDBA 2BMDA 3MYYA 4XQGA 3MTBA 5G41A 1YSCA 1W581 2SICE 3NT2A 1V6AA 4TMYA 1GZHB 3RB8A 1GRRA 3K0CA 3ZEAA 2BEJA 2QBYA 5LP6A 3TINA 3T3IA 3G59A 3OT1B 3DCNA 1G8HA 3P5SA 4V02A 1T9KA 2IBMA 3DAHA 3DHVA 4O2LA 4PYLA 2B8EA 4MS4A 2CV1A 3OPVA 4MR7A 4ISCA 4G8DA 3RKRA 2Q0SA 1ST3A 4H4CA 4Q9HA 5JJKA 1P0MA 4ZO9A 1ONSA 4G1VA 4DSOA 4GF5A 2DQYA 3RBZA 4B7ZA 5C1OA 2PKQO 1GRNA 1OYOA 3NYQA 3CNHA 5EVJA 1XD9A 5EMHA 5TC4A 2B21A 1VSTA 1PJCA 3C7AA 1EB8A 1E7YA 1PDWA 5B1EA 4JI5B 3SJ7A 2CLSA 4ALNA 5CEJA 3TJZA 1UJ6A 2R6AA 5C8YB 2WT4A 1A8HA 4MWGA 3HFSA 3FH0A 2Y0PA 4OFWA 3IP8A 3GZNB 4IDOA 4MGIR 3OF3A 4CCAA 1C8KA 3H16A 4BKQA 3ICVA 3DD5A 3IR6A 1M74A 2IPAB 2RIPA 1Q0PA 4YJ3B 3IPYA 5KQSA 2QTGA 4TRNA 1AS0A 2MMCA 3R6TA 2BFFA 3UPUA 1QCZA 2X8JB 2P0AA 3OMXA 4PN7A 4YONB 3X0DA 1XYYA 4KXQA 2XMGA 4OKSA 3V3KA 5KYYA 1ZG3A 4QDKA 5DNUA 3TUZC 1KYZA 4QD3A 1UBSB 4BX8A 3RS3A 3QEBZ 4Q1DA 4BMSA 3E8XA 2NO6A 2R84A 2ETXA 1RAIA 3MSXA 4BVJA 2B69A 4BLOA 3AR5A 2JLZA 4WESB 3GLVA 2IS2A 4JA2A 2IODA 2Y92A 3OURA 4G0NA 4MVJG 5DM0A 4Y2VA 1IBLB 1U8YA 2WPDD 3JVDA 1H1TA 3GEGA 4EY6A 4U8GA 1PZEA 4G89A 1A76A 2JNWA 4C89A 1BDHA 3KKQA 1NAHA 4AP6A 2EKPA 4G5OA 1QRRA 5FQOA 2JVIA 4L9WA 1IEWA 3PRKE 1QB8A 3BBLA 1D1TA 1O89A 2QRGA 1DG3A 1QQ7A 3L8ZA 3EW7A 3PZBA 4MJ3A 4X1OA 4AWBA 3URKA 3K92A 1FA9A 3PHBE 4UAJA 3T3HA 4MZDA 5KWVA 1FS5A 4YIKA 1IULA 3KKEA 3CMMA 1FU7A 1YDHA 1HBJA 4D6YA 1E3WA 1RBQA 9ABPA 1N6OA 2AI2A 4H31A 1EUDA 1R0WA 2G1JA 2VJDA 3OHSX 3Q3IA 1KO7A 3A4VA 1S9DA 3C15C 4MR8B 2FPRA 2OCAA 1NHWA 1EG7A 1X0XA 2OCLA 4HNAB 4JIGA 3ZWKA 4DEVA 2QUAA 3OSZA 3KEMA 4L95C 2AYXA 3BSYA 2IYNA 4KH1A 1PBNA 3HGTA 4L0QA 3S68A 2ZBEA 4KQIA 3S7TA 3TR6A 4K9NA 3LPLA 1F6WA 3R0VA 3O95A 4AMZA 2CEKA 4BJ5A 1VJ5A 3OIFA 5ICGA 3MVEA 3HUTA 1LCIA 5EMLA 1EFVA 3WWZA 4PZLA 1QIHA 1HE5A 3ILVA 4MA0A 1ZSVA 4MWBA 3AKEA 4CGZA 4INJA 1SCAA 5FP0A 1YQUA 2BMEA 1EA7A 2R8OA 3HC7A 2NACA 5IZCC 2F8SA 2AOVA 4MVXA 1HFJA 2YZGA 3NTUA 2X3YA 2C3OA 3KTDA 3UEOA 2ZSHA 1Z83A 4YJ3F 3WNQA 4QJ4A 2YQ5A 4B6PA 4MW6A 1ZJ4A 3M6AA 3O8BA 4N7JA 3SDBA 3D0KA 2FUG6 3U3OA 4TZ0A 2V3VA 4RH0A 4MVJD 3W2TA 5F23A 1HURA 1WW3A 3LU1A 4ROTA 2YHBA 2FFHA 1Z3IX 5M5BA 3BZBA 1OFHA 2PQ2A 3HPQA 4ME6A 3EH1A 3KC2A 1BVUA 2E7ZA 3VO1A 3HEBA 4IIFA 1HYHA 1VFPA 2REQB 1TB4A 4IFTA 2AJLI 1XWIA 4PFJA 4Q3KA 3Q8KA 2GWHA 5JDCC 1Q1BA 4EX6A 1NJ1A 3Q6NA 1V16B 2XYRA 3JQDA 4K3VA 4S2EA 4XDZA 2RB4A 1PR2A 4KBGA 2HPVA 1CY2A 2P69A 2QNIA 1R0LA 1OIVA 1GCOA 1EIZA 1F4PA 2JGLA 4HLNA 5L4SA 1LBHA 3GI1A 4CG1A 1KJYA 1REQB 2VOEA 4NL4H 4R0VA 3SR4A 3X1KA 1PR0A 2O4UX 3K71B 1KA9H 1KEEB 3ZHUA 1L5HB 1GA4A 1QKIA 2C31A 2ISSD 5TMBA 2HKIA 2ZJ3A 4TKVB 3THXB 1NKSA 1V6CA 2BR5A 3CZQA 5DTMA 4EB6B 2DLCX 2GLXA 2H08A 3CJRA 3N53A 1T91A 3MCTA 5CFMA 1EBUA 5HCNA 3R09A 3ID6C 1MO6A 4W99A 2Q4OA 3DXFA 3EWSA 5DBHX 2XOXA 1KR5A 3KQQA 3VAAA 1G8JA 3U09A 1BVHA 2HUPA 2XMBA 3OIVA 3K0AB 1N2GA 5DEIA 5KSPA 4NG4A 4FZJA 1DO8A 4MRSA 4FW8A 1BKSB 4D9GA 1HK7A 1PR6A 1RPTA 2DHDA 1MG5A 2RC6A 3HA2A 4H27A 3RS8A 4DN6A 1MW8X 3LV8A 2Q6LA 2WICA 5BN4A 1KTVA 5ILGA 1O9BA 4GAEA 4HVLA 3GWZA 4LOKA 2AG6A 4LRQA 4BBZA 4EMUA 4DV1B 3KKLA 1CPYA 2UUBB 1ATZA 2H4FA 1P9NA 4EMTA 5H82A 4EI8A 1ANKA 4HLUC 5IDQA 5JNWA 4WESA 1WDWB 1JZTA 2BT4A 3GAZA 4Z5XA 2IUTA 2PAFA 4LOAA 1Y7TA 2XCLA 3A1VA 4AWAA 4KHZA 2ETVA 1OFVA 3U4GA 1T3LA 1CHDA 3MUOA 1QIGA 3H0EA 3JQPA 3MRVA 5AOBA 2PZAA 5D6NA 5BWNA 3SZGA 3VPAA 1MJNA 1SO8A 1WKCA 5DZSA 3O9ZA 4BDSA 4UBLA 2H51A 3NW9A 4KU4A 5B3AA 3OZIA 3VU0A 5JXJA 1UOQA 1BYIA 4I8IA 5LP6C 1ODKA 4B7AA 4MPRA 1SU8A 2ZDGA 5BSTA 3MCZA 1G21E 5JS7A 4M9RA 3BXOA 4O4JF 1O95C 2X4IA 2H2GA 3QU7A 2V4MA 2I7XA 1CWUA 1QLHA 2CE2X 4P5DA 4X00A 2XTJA 5TE9A 1O1YA 3T7IA 2JL1A 4DXAA 4FHDA 4TVKA 3IUPA 4N9WA 2HHAA 4D5GA 1YAHA 1WD5A 4UVGA 3BK2A 3H5VA 3LGAA 1QTNA 3LPAA 2BZSA 3OT5A 5I9SA 3MJFA 1LSUA 3LDGA 1ZI8A 4LMRA 5BR7A 3LBIA 2UXDB 1CXZA 5JZOA 1CR6A 4MWEA 5FV7A 1JI3A 2FFJA 4ASUD 2DZDA 3UJ8A 4HDSB 2BI8A 4HGQA 1D5CA 2H65A 4KXVA 1IN7A 2YC2C 1WR8A 2XZLA 3ICWA 5K8JB 1P9OA 3N8NA 2XW6A 2GD1O 3QVKA 3C6MA 3AUUA 4B0OA 2JG3A 3A6GA 1JYFA 2VHYA 1D2NA 2J6HA 1N5OX 1XDBA 2ZDHA 3HL4A 2FN3A 4FD2A 5M3BA 4FQ8A 5JQWA 4JEIA 5LOVA 1GPAA 3ZCSA 1DDOA 3K0EA 1X0VA 5BVHA 3HCEA 4H0FA 5A4DA 2C8KA 1D9ZA 2J32A 3ZLBA 4GO1A 3VNQA 1YBMA 2WWTA 5SYAA 3GLQA 2N9UA 4FFRA 2OPHA 2QNBA 3J7AC 3O8LA 2E4YA 2Y67A 2WFZA 2YWEA 4FCWA 4R68A 3ZQJA 4DC0A 3EY9A 5LWQA 3CY6A 3HR4A 5DTQA 4UMVA 1H4TA 1Y1TA 2QLFA 3IR5A 2GEKA 1EFTA 2P2DA 1ORIA 3X43A 4KO3S 1EX9A 5AJZA 4D9KA 3QV1A 4QYWA 2ILTA 3D8RA 5JAMA 2CFOA 4PGHA 4KBYA 4QGBA 2ZE6A 4FMPA 4CGYA 3L7NA 3DBHB 3V2HA 4Y9SA 3N2LA 4P84A 5TF4A 3W05A 1NMQA 2OESA 3H0CA 5LZ2A 1VG0B 1P5ZB 1PEKE 2Q3FA 2DH5A 1PDOA 1ZXBA 3KKOA 1FRFS 5C52B 3TW4A 5AIBA 3DV0B 4KACA 1AKYA 1I0ZA 3PGA1 4RVOA 4A2CA 1NVDA 5KJEA 3UAVA 2VDMB 3FWHA 3ADDA 2IEDA 3PXUA 3L0SA 1T0UA 2Q3LA 4OGGA 5I3CA 6CHYA 2FHSA 2PJDA 1BTOA 3PQ2A 4EEKA 1CJMA 1KJWA 2C5AA 2WWIA 2GRUA 4Y7CA 1KI9A 2LDXA 2VBCA 4O4JB 3AKYA 3WMWA 3GZJA 3P52A 3ZX4A 2JLSA 4KE8A 3H86A 4UNRA 4KR3A 3IBSA 3D6UA 1W30A 3KR0A 3IUJA 5M34A 2Q7XA 1QFJA 1Y1QA 1PFVA 3CEHA 1HFWA 2W6QA 4DVJA 3E9NA 4MTLA 4ER3A 2R85A 4FKBA 4MV5A 4U3JA 5LA6B 3WRWA 3STVA 2VRWA 4HQ0A 1UBGA 1WVIA 4KMMA 5KHAA 3W4KA 2W6OA 1WBBA 3TD2A 4BO8A 1XKLA 3TQOA 1SVNA 4PAWA 4ARUA 3P9QA 3ERCA 4FYKA 4UM9D 2AFIE 2O7VA 4PLWA 2YZKA 4LYGA 4QUHA 5TEWA 4B45A 1UZAA 1F7VA 1IEQA 5JC8A 4UQOA 3A6EA 4A0SA 3SN6A 2H1IA 2VJMA 1N0IA 621PA 4WFKA 3QWAA 4KYUA 1XGKA 2VNSA 2EHDA 2YDYA 4PVDA 4WA7A 4FMBB 2FR1A 2RJOA 3E3MA 4DXHA 3H5OA 5JROA 4P33A 1ZMRA 4XGNA 4DDHA 3COJA 4JBGA 1G6OA 4M49A 4EB0A 3WQSB 2LR0A 3NGXA 2PH1A 1JZSA 3OOSA 5SICE 3RRNA 3L18A 5KWSA 2AB0A 2RHMA 3UCEA 3M33A 3TFOA 3HBLA 4NYMQ 4X7RA 1AUVA 2DCUA 1LS1A 1W2WB 5AHRA 4BGDA 4YMLA 1OI2A 2Q5JA 3MPOA 4Z1MD 4DE5A 5FUVA 4L5JA 2JKZA 3AM5A 4TXHA 4RE6A 3ZI4A 5KNBA 1G64A 1UMCB 2LCFA 3OOWA 3NEPX 1GL6A 1M2WA 4KPYA 1F0NA 4HQNA 1QANA 3KZVA 2RK4A 1H9BA 2I6SA 4N6NA 1TKAA 4GOND 1L4LA 3DZFA 4D4KA 1A8SA 4QBFA 1L7AA 3GGOA 2RGBA 4M6WA 3SC2B 4P0QB 1JHYA 4BRZA 1N8KA 4AY5A 4CG3A 4X20A 2IFTA 1F8XA 3W5HA 4IDDA 3PSAA 5MF6A 1N33B 3R7WB 3KKKA 3IRUA 5IAGA 5CA0F 1CJBA 1XTUA 3EUFA 2VG8A 4FYVA 1KJZA 1EFHA 4Y2JA 5J5AA 1OC2A 4JC8A 2V8BA 3HRIA 2XWPA 3U4CA 5C37A 2G0NA 3GD7A 5JALA 3NZEA 3I3SR 1P31A 3TR5A 3SFTA 1TTTA 1E59A 1JR3D 2B7CA 4JNCA 2R1ZA 2PSEA 4KXMA 4MV9A 3D81A 2GK3A 1UAYA 2WYHA 3DOJA 4GH5A 4OXQA 5K4GA 1WA5A 5F78A 4FHZA 1CQPA 1P9LA 2P9GA 5TX7A 3UT5B 2NXEA 5L6MB 2D13A 4FPXA 2H7VA 5DB4A 1FVHA 2HWYA 3GY0A 4XTCS 1PQ4A 1FDVA 4CIBA 5FO0A 3MD0A 1Z2NX 2HK7A 2XGGA 3ODGA 1MB3A 4EYOA 5CB4A 2BUAA 3DVQX 2ZB2A 5TJHA 2XUDA 1BGVA 3V5NA 1NN1A 2GEFA 2GXSA 4XZ3A 2QXTA 4WNIA 1PUIA 3B6JA 3BCSA 1PBTA 5EJMA 3WLPA 3LQ1A 2ZCVA 4R3NA 3ROKA 4KBFA 1PW7A 3VBEA 1KK0A 3H1TA 4L72A 1Y3AA 2AYYA 2CKMA 5DKFA 2C61A 4TMVA 2OZPA 1SKMA 2XCQA 2BHLA 2OQRA 2WU1A 3PFCA 1WXHA 1KFKB 4YRPA 4NQRA 1DDGA 2CHFA 4GR4A 4KAAA 5EE0A 4A5OA 4RUKA 1S3SA 4ENSA 2WM3A 3BMCB 2ID8A 5AKXA 3SPXA 5FTNA 5EJ7A 4QNRA 5HUHA 1SXJC 1YBHA 4HDKA 1DV1A 4LV5B 4CQNA 2WD7B 1M5RA 2XGSA 3DMGA 4FR5A 1BQ4A 4NEQA 2I8LA 4RSHA 3DKKA 4IXWA 4PTLA 1VOTA 1VJGA 4R9NA 3ELYA 2VHVA 1JU9A 3MUFA 3NFYA