2P65A

Crystal structure of the first nucleotide binding domain of chaperone clpb1, putative, (pv089580) from plasmodium vivax
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
185
structure length
185
Chain Sequence
QALEKYSRDLTALARAGKLDPVIGRDTEIRRAIQILSRRTKNNPILLGDPGVGKTAIVEGLAIKIVQGDVPDSLKGRKLVSLDLSSLIAGAKYRGDFEERLKSILKEVQDAEGQVVMFIDEIHTVVGAGAVAEGALDAGNILKPMLARGELRCIGATTVSEYRQFIEKDKALERRFQQILVEQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PF08_0063
total genus 67
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p65A00
3PV0A 3RNLA 2YOGA 4PPNA 4YMWA 2BJWA 2BV3A 4WAUA 5GVRA 3NH9A 1COWD 3B78A 5EUMA 1XTIA 3A4NA 3H4MA 1JJ7A 4NYJR 2FZ4A 1NN5A 2J7PD 5DNYB 2DB3A 3VR6A 4TMVA 4BZQA 5BXQC 1JI0A 1QZXA 1E6CA 1N5JA 1E9EA 4RSGA 1CJUC 1ZUIA 3HJNA 3I3SR 1XD8A 2Q21A 4OQNA 5LD2B 2ZJ2A 1ZNYA 5CDFE 5JJIA 2RHMA 4DRZA 2QAJA 3QJYA 4Q7MB 5F9HA 2ORWA 3FHCB 2UKDA 2FNAA 3EW9A 3K0FA 3ND9A 3MUFA 4DT1A 3A36A 4MRVA 2P3SA 4N1AA 1JR6A 3TKLA 1EX7A 5EXPA 4AC9A 1G20E 2Z6VA 2A5JA 1YZQA 2VP2A 3PG5A 2QP9X 4F7WA 1XP8A 2HYDA 4XD7A 5L3QA 1P3JA 4AKGA 4IEEA 5DGXA 4LZZA 3P4YA 4WW0A 4MGKR 4RFSB 4EJSA 3CBQA 1E1RA 3OIVA 3QENA 2FEOA 1XWIA 4OYHA 4QJ4A 2FSHA 4H9GA 1KSJA 4JLPA 1MOZA 2W58A 1JAIA 2C9OA 1OXXK 1ZC3A 2IYTA 1YZLA 2PZGA 1BKDR 1XX6A 5E3HA 3IDQA 5EUQB 4GT1A 4X8HA 1MR3F 1GITA 4CEHA 3GD7A 3QBTA 3A1SA 1IJEA 1PVOA 1OH7A 2D2EA 1R2QA 4BLQA 2QMHA 4M9XA 4RVCA 1RKBA 1COWA 2F43B 4B35A 4BZPA 2J7PA 3HU2A 2ZS8A 2SHKA 2XOKD 2BEKA 4OJKA 1U98A 5GJBA 1BIFA 1SHZA 3W6OA 5DI3A 3DEFA 4AKEA 5EJEA 3PVSA 4NL4H 1N6LA 3R8FA 4US1R 3ICEA 1P2TA 2X19A 5D3QA 2JLWA 2GHIA 4RD6A 3EZ6A 4QHSA 5GJCA 4PPQA 1DBSA 1S2MA 3U5ZB 1HE1C 1CXZA 1X6VA 4PZLA 2NG1A 1IY1A 2FGJA 2NTYC 4TL7A 5TVKA 1FQJA 1Q3HA 2ATVA 5DLQC 5J4YA 2CL6X 4B3DA 5EE0A 2QMEA 1T3SA 4PQYA 3G82C 4IVPA 3WP1B 4G1UC 4C0LA 2ZI9A 5GVSA 3OIYA 3NVAA 1P2VA 3MCAA 2KJQA 1G3MA 2G3YA 1TU3A 1G7CA 2QNRA 2OEPA 5JSZB 3ECCA 1K6MA 1N5LA 5FUVA 4CW7A 4OI1A 3O8CA 2QTHA 4B44A 2WZQA 3D3QA 3V4RA 3T35A 1U9IA 2CCGA 2AD1A 1FMJA 2MSDB 1KO7A 3OEEA 1DOAA 2GVDC 4A1FA 1J7KA 3LV8A 2XZLA 2TMKA 2BBTA 4P32A 3NWJA 3MWJA 3DHWC 2AL7A 4HLUA 1L8QA 1VCMA 2EWVA 2QPAA 3BH0A 2EFCB 3LXXA 4GP7A 1GRQA 3AKYA 2A5DA 1NNEA 1ZD8A 4QXAA 2WWYA 3FTQA 2AX4A 1CRQA 1OV4A 1LS1A 4D4LA 3ZVNA 1JNYA 2ZI6A 2RGDA 3NBFA 5KNBA 2AD5A 3NEYA 3LAWA 1U0HC 4IRUB 2JGNA 3IEVA 1W48A 3TAHA 4F93B 1ZRHA 1SXJB 2Z83A 4XVQA 2WHXA 1N0VC 4WZAE 1Z0JA 2CJWA 1G7TA 4IFEA 5E4FA 1A2BA 3CPEA 3IO5A 4KITB 5DO9A 3CX6A 3ZS9A 2BC9A 2F7SA 3BE4A 5KSZA 1QVRA 1Z8FA 4MDFA 3L43A 1GP2A 4B3GA 1ZYUA 3AV0B 1SHKA 1CEEA 2OCAA 2F1RA 3CNLA 2QI9C 4DDTA 1F5NA 2ZYTX 4C0AC 1T0JB 2ZUDA 3IO3A 3VMFA 4PXAA 2K5UA 3EZ2A 2HUPA 4BGDA 1SKQA 1BO6A 3CH5A 3EAQA 2ZQ5A 5KUTA 4Y0AA 4GZLA 3BK7A 1UJ2A 5F9FA 4TMXA 1MABB 3S1AA 3NXSA 1GTVA 2G1KA 2J0VA 3P4XA 1KIMA 1YZUA 2QG6A 3TW8B 1GILA 2OCBA 2WIBA 4IOMA 3MGCA 2DFKB 3O47A 2FEMA 1KJWA 2FOLA 3I92A 3AH8A 1EXMA 3BFVA 4ESHA 1OW3B 4HAYA 4MH0R 4Q5IA 4PO8A 1GDDA 2QEQA 4LBZA 1LB1B 3BBPA 4UNSA 4JVNA 1OXVA 1ZU4A 3UXMA 3AF0A 1E9AA 4V0LA 4URXR 4C0QC 2ZE6A 4LDJA 1NIJA 1CLUA 1OIXA 1XCMA 1GVNB 4Q4AB 4UNPA 2IS4A 4BWYA 4LJ9A 2YINC 4WVFA 5KPJA 4LV5B 3RANA 1ZW6A 3SHFA 4KCGA 1GKYA 3GLGE 3X1DA 3U7GA 2KBEA 3I5YA 4ZDJA 3B1WA 4JL5A 4Q66C 2FSFA 5ANRB 4MGZR 3RS7A 1TF7A 1XRJA 3ZZ0A 2OFWA 121PA 5J40A 4PC2A 4EUNA 3ZD7A 2ZEJA 4XTRA 2P6UA 5AJVB 4RKEA 4AIIA 1GRNA 3PEVA 1A7JA 4HB4A 1KOFA 2X8AA 3EZFA 4M1OA 5AJWA 4YXWD 5ELXA 3RS3A 4M1WA 4Q4JA 4JLAA 4UXIA 4DLRA 4WXRA 4II7A 2IYZA 4XVRA 3AGPA 2C78A 5EP1A 3R9XA 2BKEA 1NSFA 1ZNWA 3X1YA 4BECA 2PJRA 2V9PA 3QQ5A 1EFHA 4PSVA 3CLVA 4WZ6A 3MD0A 3IIMA 1SGWA 2D2FA 5FL7A 4DEXA 2XEXA 5JHGB 5JLJA 1R10A 2UZIR 3MMPA 1E2LA 1WB9A 2FX3A 4XD7D 4OHXA 1N6KA 2FH5B 1VIAA 2GXSA 3BC1A 2OFOA 4NU0A 1M7BA 1Z63A 1NMZA 4KVGA 3LW7A 4RD0A 3WBKA 4M21A 4Q7LA 2VP0A 3LDAA 2REXB 4JVLA 3T12A 3ZYCA 1BYIA 3BJIC 5HKKD 1F2UB 4OK5A 4XIGS 4JKYA 4ZCIA 5BN4A 5C18A 4QRHA 4D25A 1UKVY 2PT7A 4GZMA 1N6NA 5AWFC 3VHXA 3CPHA 3UPUA 2GAOA 2ZITA 3TRFA 2IT1A 2AFIE 2ZJ5A 4XWKA 1RJ9A 2CLCX 3TSOA 4ZI3A 2F1IA 4Q1DA 5KTYA 4ACBA 2IYYA 3OFND 4URYR 4M4SA 3I62A 3GJ3A 3FMOB 1PUIA 4Q18A 2Q3HA 5K8LA 4JL8A 4C0BA 4OK6A 1IN4A 2FPLA 4PC6A 4GOJA 2CVHA 1Q12A 4S35A 4A82A 4QGHA 2ZAMA 4O2LA 1CJVC 3QY0A 4JVSB 4ZCMA 1Y63A 2ZU0C 3N2EA 3HU1A 4OI4A 4DCNA 2QN6A 5L3SB 2O8BA 3FVQA 1E2KA 3CRQA 4US0R 5FTNA 1X8KA 2JLRA 2YZ2A 1IXSB 4HATA 4RZXA 1D6JA 2CHQA 2JLSA 3E70C 5AJZA 1IN5A 3SJCA 4Q7KA 5EP2A 2IX3A 4MYCA 4DCSA 2ZSBA 2IUTA 4TTRA 3MJHA 4MUBA 1ZU5A 2IYSA 3VX3A 1QHYA 3REFA 4DLWA 3LBHA 2NO0A 2WM9B 1LV7A 2YWFA 4JKIA 4QBFA 1QG4A 4LBYA 2FFHA 1FNNA 1L4YA 2ZR9A 4QKQA 3CNOA 2QSZA 2FN4A 3AGQA 5TY0A 1OYYA 2C9CA 2E9SA 2GZAA 2PCJA 2YWGA 3BRWD 4O25A 1OFUX 4ZIRB 1ZCBA 4NCKA 2A3RA 2V3CC 2XNDA 4L8GA 1W5TA 4R9UC 2A5GA 2OLJA 2WOJA 1EFRD 5UKDA 2JLQA 2JJ8A 4D0LB 5LB2A 3OIWA 1GSIA 4PTLA 3WP0A 1AIPA 2J1LA 3CWQA 1S4QA 1SVOA 2PZEA 3UWKA 4B71A 5CJPA 2J0UA 3THWB 1GKIA 1KDOA 1AZTA 1OF1A 2EYUA 3PCRB 1KO8A 3L0PA 1ZCAA 4KLZA 1KI4A 3LD9A 4LHXA 2JLZA 2P5SA 1MRNA 3AVYA 3NHAA 4HAZA 4IDHA 5DH9A 2F1JA 3LRPA 5DN6A 5C4MA 3JZMA 3MWKA 4KO8A 1NSTA 2GJKA 4EPWA 1EFUA 3THXB 2FPMA 2O8DA 1CIPA 3CX8A 4AKHA 3D8BA 1Q44A 3DOEA 4QM6A 1W2GA 3K0EA 3U6KA 1KAOA 4B3CA 4KFRA 1G3UA 4PC3A 4TLAA 1EFTA 3QNUA 2AK2A 4R2IA 3ICQB 4F4CA 2VLIA 2DFNA 4HUQA 2VF7A 2G83A 3K0FB 2FPKA 2H92A 2JJ1D 3IKJA 4URWR 2WJGA 1KO5A 4YLGA 3GLIA 4PC1A 3B9PA 4DZZA 2C77A 3ZZTA 5FOWA 3SZRA 1SVIA 3W8NA 2AFHE 1KJYA 2DHRA 3GFTA 4LY6A 2OSBA 1O87A 5CYPA 3EPKA 2ZYVX 3GLFB 3DDCA 2JAQA 1FPMA 2RGNA 3QXXA 2NPFA 4IOLA 3BORA 2IS1A 2H57A 5JWHA 1FFHA 1VYTA 3BAFA 4YDSA 2HDNB 5B64A 4EPYA 2DFTA 3W5IA 1US8B 2FG5A 1AA9A 2PBRA 3RWMB 1U99A 2IK8A 1GL9B 4NYIQ 4OI2A 1ZINA 2WBLC 3WYAA 2V4ZA 1WMSA 4IHQA 5DYIA 2RCNA 4U5XA 1FOEB 2A78A 2G0NA 2ZRFA 1I4LD 4Q9IA 1G291 1I2DA 2KSQA 3DVLA 1S8FA 2O5VA 1PV4A 4WXPA 2BCGY 4NYJQ 4BQSA 4HLCA 3RDPA 2QQEA 4WA7A 5SZKB 1K8RA 3R20A 4B48A 1Z47A 1I4TD 4TSFD 2IXFA 2WIAA 4Z1MA 3SN6A 1ZM2A 4D81A 3L8ZA 1XJ0A 1OKKD 3SHWA 1VG8A 1Z07A 1VTKA 4TL8A 3GLFA 4ZPXA 4LBVA 3OF5A 4NYMR 3ZVLA 4A2WA 4F91B 3U44B 2YKGA 2RGAA 1G5RA 2NO9A 3GJ8A 3NTUA 3V4FA 3VKGA 3LW8A 5D3MB 1E2EA 3V9PA 4KV9A 2IEYA 3TSWA 2WWGA 2EFEB 2R6AA 4V0NA 4XWOA 3G0HA 3B2EA 3CZQA 1VYUA 3BERA 1HE8B 2RKOA 4XVUA 2HCJB 4B33A 4NONA 3CF6R 2W0MA 3VR3A 5IHPA 3AM1A 3ZD6A 4UXJA 5AUNB 1JPNA 2EFHB 3KDSE 4BLTA 3EIQA 3QPVA 1QHHB 4YMUA 3B82A 4GBMA 2QT1A 1QBKC 4ZDIA 1R5OA 2LKCA 3QXSA 4W5WA 3BOSA 3K0SA 1KI8A 3KTAA 4ZV4A 2ERXA 3QKSA 4U00A 1EFCA 2B92A 2CK3D 2W6JD 2BWJA 2JDID 4A2QA 3GLIE 4PZZA 3A6PC 1R4AA 3IQWA 3LLUA 2YC2C 3NDPA 2VO1A 2ZJZA 4EQ6B 2GVZC 1U0JA 1AN0A 5FBLB 3N5CA 1E9RA 3GJ4A 4AKIA 1DE0A 2Z5FA 1GAJA 1G5PA 2IEZA 3KTAB 3LA6A 3KFVA 3CX7A 1U8ZA 5L3QB 5F98A 3JVUA 3U2QA 1R6BX 2WPDD 1MT0A 2FZLA 1YZTA 1XJCA 4G5RA 2QU8A 3W6NA 4QNRA 3AVOA 2GILA 2YOHA 2Z0MA 1NBMD 3HP1A 3K8YA 1ZMXA 4JMPA 4LHWA 4Z8YA 1LW7A 4TLCA 1W36C 2GXUA 3OE7A 2VTKA 1TQ2A 2XITA 3C16C 2P6RA 1Q3TA 8OHMA 4EPVA 3GCGA 2XZPA 1J90A 2BMFA 4DLZA 3VX4A 1HQYE 5F3WB 1GFIA 2DPXA 5IT5A 2WJIA 2V55B 2QORA 1ZC4A 2F9LA 5B58C 1HT2E 5HE8A 5FI0B 2H18A 1R0WA 3OESA 1N6PA 2BVNA 3I73A 3W6PA 2JLXA 2B7CA 3TQCA 2PMDA 5FOUA 2CNWA 2WSMA 2ZRHA 2QM7A 3QSYA 3DM5A 5JECA 4RFSA 3NKVA 4DLSA 4UKDA 1AQYA 2ZRDA 1YVDA 5KNCA 5SZIA 1KNXA 5EP4A 4AYTA 4IDOA 4A0FA 1HEIA 4EAQA 4EJSC 1HY3A 4LC0A 3B1YA 2GXAA 4QM7A 2C8VA 1CP2A 3KL4A 4OQFA 4TN1A 5G53C 3CR7A 2N1BA 4C0KA 4NCHA 3T1OA 2V6IA 2CL0X 1TF5A 2H16A 2IYWA 2QM8A 5FBVB 1NG1A 3SI7A 4NPHA 3PEYA 4GSYA 1F2UA 2P5TB 1G8PA 2L0XA 1VECA 5FH9A 1GNQA 3Q7QA 3VHLB 4BLRA 5J4VA 3GLIB 1II8B 1IHUA 4TQ9A 5DHFA 1KI3A 5FPSA 1HYQA 2VP4A 2XNDD 3FOZA 1D8TA 3QXCA 1M7HA 4MGYR 1T8TA 2OAQ1 3EXAA 4MKFA 4M9QA 2XTMA 3EZ7A 4NTZA 4CYMA 5JFGA 2QAGC 3AVUA 2WPDA 3CPJB 4DC9A 4OBEA 4G5QA 2OG2A 2BM1A 3QPUA 3VR1A 3EPJA 3S1AB 4TYQA 2ZR7A 1G7SA 3OEHA 2VF8A 3M6AA 4UNQA 3DKVA 2IYUA 2FU5C 4TLBA 2ASEA 1LFDB 1Z0FA 4DUGD 1ZNXA 2D62A 4CGZA 3WYFA 4MGIR 3B1XA 4KFUA 5CIQA 4MYTA 1XBTA 4R71A 1QRAA 1Z3IX 3OAAA 1XPUA 3FYHA 1Z6GA 5D3MA 3KJHA 5K8IA 1E2NA 1O3YA 1D2NA 3RC8A 1NF3A 1NI3A 5IK2D 4LV8B 4FMCB 3U7EB 3K9HA 3L0IB 1PLJA 4FW9A 2QE7A 2XAUA 4JZKA 5AJYA 1V43A 3ADCA 4TWZA 4TYPA 4FIDA 2R8RA 5KNDA 1OHHD 1XTKA 4PR0A 3IIKA 4TTQA 5EXXA 1II8A 5LD2C 4QJ5A 1MABA 1F48A 3KZ1E 1HT1E 1KO4A 2GDJA 1CRPA 5FPYA 4CT4B 2CCKA 2OT3B 1L4UA 2OCYC 3VU9B 2R62A 2GJ9A 4HB3A 1BS1A 1GL6A 2R6DA 3NH6A 2ODNA 1P73A 1DTSA 2B21A 4ZDKA 3UMFA 3U4QB 1ODFA 4BASA 4ZDWA 2OLKA 2QBYA 2WJYA 5CJ2A 1VPLA 1UEIA 1OJLA 4WBSA 5KOYA 4UQOA 4B43A 3Q72A 1Q1EA 3R9WA 3VR4A 1E69A 1X1RA 3KQHA 1R8SA 3I72A 1N3BA 3K0AB 4G5SA 2HXSA 3FGNA 1VDZA 3KUDA 2JJ1A 1YZGA 5JRJA 3AVXA 2Z43A 2ZREA 1OFTA 4FI3C 1OFIA 1WA5A 5TV2A 2OZEA 1SXJE 4ASUA 3PUYA 1DG3A 3LX8A 1N6RA 4QBHA 2V7QD 5KPDA 3I61A 1GOTA 1NVXQ 3DO6A 1W4RA 3EPHA 1IOZA 5JJKA 1FTNA 1GNPA 1T3LA 4LUCA 4OHWA 2F3RA 2VHUA 1ZBDA 3W3AA 4BLSA 5K8UA 1G64A 1E0SA 4B3XA 2A5FA 5IK2A 3C14C 4Z1MD 5FBRB 3MLEA 3K9GA 4FMDF 4N0EA 3F5FA 1A82A 3E1SA 2R6FA 4MUAA 1JR3A 2QROA 5CK5A 4KLNA 1NVVR 1N0WA 3HPRA 1A4RA 5K8TA 3EX7C 2FJUA 5CK4A 4KU4A 1R7RA 1RVDA 2ODBA 3NBZC 5FOSA 3BB3A 3NEJA 3AUYA 2E1RA 3QG5A 4TLDA 1FNMA 2J7KA 1ZVQA 1XB2A 1XF9A 1NG9A 4LI0A 2D74A 1FX0B 3D6TB 2JJ2D 1ZM4A 4QBGB 3SS8A 3U3KA 3SQWA 2ZI4A 5L3RA 1VG9B 4EPRA 3K53A 3FFBA 2Q3MA 4BFSA 1ETUA 1X1SA 3UG6A 1RZ3A 1OKKA 2CDNA 3N70A 2W00A 4G01B 3OE7D 1Z6YA 2ZAOA 1E4YA 4C4PA 3QEJA 4AYWA 3SJBA 4RZ3A 2GWHA 4ACAA 1OE0A 4IVQA 3T5GA 4GI7A 5J4LA 1W2HA 1W46A 3QG1A 2OESA 2CLSA 2J87A 5E7MA 3RRNA 4QGGA 3VKHA 1QHNA 4TZ6A 1S9DA 3P32A 5KDLA 2N42A 1Z28A 3A4LA 2BHRA 1TL7C 4TTPA 4DDUA 4TMWA 1YJ5A 3T34A 4ITRC 3U6BA 2QMUA 4KAXA 4LOAA 3UATA 1X8LA 1EFRA 1G9XA 4YQFA 1E96A 1ZD1A 3PENA 1Q1ZA 1T3HA 1JAHA 4CEHB 1MH1A 4FN5A 1GL7A 4MKHA 2IXGA 4DIEA 2D3WA 4M1SA 4JT2A 4HLDA 1VG1A 4Q1AA 3ZS8A 2BBOA 2FV8A 3K0CC 3NG1A 4YMVA 1G1MA 2Z4SA 3QKSB 2W83A 4UNNA 1KMQA 3PR1A 4F38A 3ZVRA 3ZVMA 1E2FA 1IXRC 3F0TA 2EVWX 2D7DA 2PX0A 3M0EA 2VBCA 2BMEA 4RY2A 3RSOA 6Q21A 3VKWA 4FWIB 4KYIB 4NYMQ 1J8YF 1UPTA 3GEHA 1W5SA 1FUUA 4IOKA 2PJZA 4EJSB 1RIFA 4JLMA 2O8EB 4LSGA 5KSPA 2HV8A 1F2TA 5FPHA 5E95A 1DELA 3KKMA 1VCNA 3NHBA 1UKYA 1V5WA 4X8LA 4M1TA 1W47A 2ZRMA 4PAOA 5EXTA 1T91A 2J41A 4F92B 1KI2A 2ONKA 4NH0A 4DT1B 621PA 3MSXA 5KYKA 2IA5A 5DN6D 3ZIAA 1KK1A 4LBWA 1M2OB 1I4DD 1ZD9A 4QNMA 1M6NA 2QPTA 3PITA 2BMDA 4FCWA 2WTUA 3NDBB 2JLYA 2XJ9A 1KYIA 4RD2A 3DM9B 4BRUA 2BIFA 4BFUA 5BQ5A 1VYVA 5AJXA 2FA9A 1G41A 4E09A 2W6IA 2C99A 1TADA 5JHHB 4M0LA 4ZCLA 3DZDA 5BN5A 721PA 1E2DA 1ZIOA 1TQ6A 4W5HA 2IYVA 3SYLA 2C95A 2QQ0A 2AXNA 2GJ8A 4IKEA 5FBWB 1FZQA 1G3RA 2ZVPX 5HR5A 1S3GA 1Z6AA 3QKTA 3TBKA 2XTZA 4Q47A 2QL6A 4M53A 3GFPA 4LV6A 2R44A 5EZ6B 5TXGA 3AEZA 3BXZA 4OL0A 4NZYA 1R0XA 1DAFA 1KDRA 2IUSA 3GLGB 3ZQJA 3CRW1 1PLLA 1UFQA 3QKRB 2C9YA 4OKSA 2ZRCA 1G3QA 1ONBA 2FE4A 4BLOA 4ERNA 1W0KA 2QGNA 2VYFA 2GF0A 4P4UA 3W3ZB 4A9AA 1XXHA 1R0ZA 2D06A 1US8A 3L82B 4DLVA 5KDOA 1G6HA 5FPTA 3VQTA 1NKSA 1SXJA 4Q21A 3R8CA 5DE3A 4DKXA 4B3FX 4PC7A 3I32A 1E1QA 1NIPA 3LH5A 5TARA 4BEJA 2O0JA 4NYIR 2UVQA 2ZRPA 1IQPA 4PO1A 2ZI7A 3AVVA 2CMKA 2V54A 1NP6A 3CRMA 4EDHA 3EWSA 3IILA 5DSZA 2RGCA 2NO7A 4W9MC 1IJFA 4P4SB 5FUXA 1G8YA 1NKTA 1OT3A 2XB2A 4W5JA 5CIWA 521PA 2ZSEA 4EFLA 3QF7A 3A8TA 5KDDA 1GWNA 2GEUA 2F1HA 3OFNA 2O8FB 2KB0A 2W2TA 3O8BA 4LPSA 4QC2A 5G3YA 4QOSA 4A36A 2YC4C 2JEOA 2PT5A 4ZKEA 2JASA 2P6NA 3LVQE 3RABA 4P31A 1K5DA 2GBLC 3K09A 3EA5A 3PUVA 4V03A 1KTVA 2Q6TA 4ZI2A 3CIOA 3GMTA 3K9NA 1OH8A 3TSZA 4Q9KA 1GZSA 3SFVA 4UNRA 2AN9A 3KQKA 4DB2A 1SZPA 5FTKA 4FCTA 4HUTA 4A8JB 1NN3A 5J5CA 5KSOA 4LYFA 1X8JA 1J99A 1ZM3A 1G3IA 4JYBA 1YKSA 3DMNA 3TAUA 1W4CA 1XEWY 4JLOA 5HCIA 3PEUA 1OHHA 2C2HA 1UF9A 1KI9A 2VRWA 4Q1EA 2FFBA 4TLEA 1UADA 2Q9BA 2VPPA 1Z6TA 4HZIA 4JBYA 5H8WA 2O8BB 2ONJA 3THYA 2IF2A 3PUWA 5JBQA 1NY6A 4ZKDA 5AUOB 3H1TA 4ASUD 1GKUB 1MO3A 3RWOA 4B2IA 2WOOA 1ZM7A 3U7FB 5LB4A 2CXXA 1N5KA 1RRGA 4PHGA 5FOVA 2HF9A 3AP3A 3TVTA 3UK6A 2OXRA 3MJRA 3CH4B 4PHHA 2NGRA 4IJMA 3TUJC 3HDTA 5KHOC 1Q1BA 1GUAA 1S1MA 3U3RA 1AS3A 3AB3A 3B1VA 2NQ2C 3CNNA 1KNQA 1SVKA 5FTJA 1ZM9A 2WWWA 2ZJOA 5JCZA 2QTFA 1DAKA 5AUQA 1TQDA 3GQBA 4WIAA 1RFLA 2ZSFA 1L7VC 2CCJA 3LWNA 4MRRA 1KK0A 3RS4A 2ZROA 2CLDX 3H0KA 4URUR 5JI2E 4C3ZA 2GCOB 3LXRA 3DL0A 4MRNA 3FMIA 5TDHA 2OUKA 5P21A 5G40A 1Z6XA 3AKEA 2ANCA 3W34A 3R7WB 2OCPA 3A1WA 1Y3AA 4TL9A 3KJGA 2AHOA 3ADKA 4QG7A 3L0OA 4QJ3A 2VL7A 3ASYA 5G3ZA 4TYWA 3L0SA 2O8FA 3ND8A 4IDNA 3U60B 1MV5A 2OFXA 4D80A 4M9ZA 4CT5A 4JBWA 4ARZB 2KI5A 2LWIA 1M74A 2A2ZA 2CL7X 1W0JD 1NVWQ 2YV5A 2ZSAA 1SKYB 4L9SA 1EX6A 5BN3A 4H1VA 3GJXC 2WAXA 5FL3A 5HZKA 4RD1A 1P2UA 4C2TA 4X8OA 1NL3A 1YHNA 5CLLA 4A6XA 5EQTA 3SE0A 4K8OA 2R2AA 1KY3A 3BH6A 4PO9A 4F4JA 1TTTA 4I99A 3FHOA 2V1XA 2GBLA 3K09C 4YXWA 1RRPA 4FMDB 2I4IA 1ZNZA 3SOPA 3SJZA 4DSOA 4MKGA 4Q1CA 4OHYA 4BFWA 3K9LA 4DUGA 5CITA 2GZHA 1ZUHA 1YU9A 2AXPA 2H8KA 3UMSA 3TMKA 2NOAA 2KE5A 1LNZA 3FHTA 2JLVA 1P60A 4A0GA 5J47A 4H1UA 3QEOA 5IRCD 3K70C 3TR5A 1XEXA 2VP6A 4PHTA 4OHZA 1JEEA 1TQ4A 5EZ5A 4Q9JA 5GJWC 2B6HA 1UBGA 3AVQA 3E5HA 2GJSA 1DO2A 1XD2A 2W0SA 2W2XA 3UWOA 4D4JA 2RAPA 3B5JA 3ZQ6A 2CK3A 2W6JA 3TQFA 2XGJA 4MDEA 2FFQA 3CZPA 4GMXA 1E9FA 1VKJA 2OILA 2AWNA 1SXJC 2QE7D 2QPOA 3GP8A 1T4GA 1TMKA 1TAGA 3GLFE 2IHBA 3CRVA 1ZIPA 2P65A 3CRRA 3GLHE 1Z0IA 4IDPA 1SVLA 3SU8A 1A2KC 4HLQB 5AK0A 4AG5A 4Q48A 4MA4A 4PSKA 4NCNA 1CTQA 1AS0A 5FUWA 1DO0A 1XPOA 2GJAA 2QBYB 3E2IA 2CEAA 4CDGA 2G88A 1NLYA 3CKLA 3KKQA 1XEFA 3AP2A 1Q22A 4DSNA 3JZAA 3SBEA 3VFDA 4YC7A 1IN7A 1R5NA 3IBYA 4M1MA 4GOKA 1Q1QA 2GEDA 4Q9LA 3T5DA 2WWFA 4Q02A 3ZZUA 2QSYA 1HURA 1UBCA 2ZU6A 4LJAA 2VSXA 2G77B 4I1SA 1UEJA 2ZYWX 2NPIA 1DAGA 3RHFA 4DSTA 2JDIA 5B30A 3J81k 3KQLA 1KO1A 1G8GA 1X86B 4E07A 3SFZA 1TPZA 3JVVA 5FUYA 2CHVA 4AY2A 2X77A 2OHFA 2FMXA 3EASA 2V7QA 2ZYUX 3X1XA 4LJ7A 2CHGA 3QVUA 3Q85A 2ZE7A 1II9A 3GJ0A 4DLTA 1S9HA 3KQUA 2IYQA 1W44A 1XTQA 2AK3A 4LHYA 5FOXA 1QHXA 2A7QA 2EYQA 4A2PA 3A58B 1PZNA 2XNSA 2F3TA 4KI0A 4RD4A 1RW4A 4LJ6A 1EGAA 2VIIA 1JR3D 2VQSA 3SJAA 3WRYC 4P4SA 5FTLA 1FW6A 1NJGA 3HYTA 3KJEA 1U0LA 1E0KA 3G5UA 2XSZA 4QGAA 4I4LA 1J8MF 3R7WA 4D82A 4LHZA 4V0ME 4XTCS 4UJ3A 4B76A 3ONWA 2B8WA 1E2MA 5JZVA 4M8NE 2GCOA 4BPBA 4D4KA 4B34A 5BYKA 5GADl 1JB1A 3D31A 1G8FA 2QZ4A 1RPZA 4EIWA 1E98A 3C8UA 3GFOA 1VMAA 1KDPA 3EC1A 1JR3E 3ASZA 2WJHA 1Z5ZA 2J46A 3U44A 4X8MA 3RRMA 2R6CA 2A5YB 2YWHA 1KJZA 4HDCA 3ADDA 5HKKA 3THWA 3AF2A 4DVGA 2ZRAA 3MWYW 2IWRA 2Q0HA 2IS2A 1YR7A 4NBSA 2ZR0A 2NZJA 1DAMA 1EG7A 5CB6A 3P20A 3X2SA 4JLKA 4RCYA 1UM8A 2OAP1 3MFYA 3I8SA 1N6IA 2IYRA 2NZ8A 1E9SA 4N0DA 4O2RA 3AVWA 1KMHA 4BRWA 1UKZA 2WKRA 5FL7D 4DLXA 3HPQA 4R2HA 1AKEA 4GDFA 1DG1G 5CLQA 1E79A 2Z4RA 3UMRA 2DWOA 5J4KA 3ZLJA 4DIDA 4KFSA 3B60A 2BBSA 5DI3B 1BOFA 2ZRGA 4MYHA 5FR1A 2RGEA 4L5BA 4KSBA 3AF4A 3KXKA 3VR2A 4CEJA 2NO6A 2JA1A 4JLNA 4EQ6A 3I5XA 2B7BA 4QBIA 1PUJA 1R8QA 3F8TA 4LJYA 4A8JA 1VHTA 4PFSA 1JBKA 5DI9A 3A1UA 1R0YA 4Q01A 3WRXC 2I1QA 4B3BA 1YR8A 1T5IA 3ZJYA 4HB0A 1N5IA 4KHZA 2C5LA 2WJJA 5EE5B 4D26A 4AI6A 4TMZA 2CVFA 1YR9A 1KY2A 4TT3D 4XOIA 1OIWA 2JCSA 4DLYA 4TSFA 4RZ2A 3SEAA 4L9WA 4A0HA 4ABYA 1KI6B 3WBJA 3RS5A 3QVVA 4L4UA 2FWRA 2IF0A 2CE2X 4I1UA 1G6OA 1WBBA 2WKQA 4Q03A 4ZIRA 2IHYA 5DISB 2Y8EA 2P67A 4KXFB 1UKEA 2R6GA 3LX5A 2ZJBA 3DOFA 1CR4A 2W6ID 4B6FA 5C4GB 4B32A 1KKLA 4PQFA 2PMKA 3RAPR 2F9MA 2WMNB 5HCNA 3NC0C 3ZIAD 1WCV1 3IIJA 4GFDA 3DKPA 3LQRA 4FWTA 4KSCA 4A92A 2X1VA 2DBYA 5EP3A 2OBLA 3BB4A 3RRYA 5FR2A 3TK1A 4I1OA 4CEJB 1XMJA 2ZE8A 2XXAB 1BMFA 3HU3A 1Z0KA 1C1YA 2NMVA 1HUQA 2WVJA 3DZ8A 4UJ5A 1WBDA 4RJLA 5FOTA 1H8EA 2AWOA 1F60A 3LNCA 3M4YA 4QHTA 3QI2A 4ON9A 1H65A 1CULC 1KMHB 4MQBA 3X1WA 2JATA 4LGMA 1SVMA 1U2RA 2REBA 1CJKC 4RD3A 4DEYA 3B6EA 3UG7A 2GEVA 1XEXB 2GTPA 4PSAA 4ARZA 5HZHA 2R65A 5LDDC 2HYIC 4HB2A 2MSCB 1X3SA 3L8YA 1XDBA 3HYRA 2PLFA 5JWOA 1ZAKA 2QGZA 3Q9LA 4N3NA 1CBUA 2OXCA 4K46A 2FDCA 1DAHA 1E99A 4A15A 4XSHA 4Q4HB 4BE7B 2GA8A 4POAA 1AKYA 2VP9A 4D2IA 2FFAA 4AURA 2DCUA 4Z51A 3LBIA 2JJ2A 4XJXA 3IQXA 4YMTA 2G1JA 2FF7A 1L2TA 1CJMA 1FUKA 1H8HD 1VCIA 1D2MA 4JLVA 5LBIA 3CWZA 1OH6A 1MO6A 2A30A 2X2EA 1Z08A 4HZUA 3RYTC 4DB4A 2WWIA 1XMIA 3IBGA 2C04A 1TNDA 4HEJA 4A8JC 2YWEA 2MMGA 3QKRA 4HAUA 3RVBA 5DIFA 3H84A 4OQXA 3GLGA 3W9YA 2FGKA 4Q4JB 3T61A 3EARA 3O8RA 2ORVA 1YZNA 2CBZA 2J9RA 2O8CA 2DFLA 5E7IA 1TUEA 4DCVA 2QAGA 4E22A 4E5UA 1UDXA 2BM0A 4EPTA 2HT6A 4Q7JB 1AK2A 4DJTA 3W8RA 2H5EA 1KZGB 2IC5A 4P4TA 1S3SA 5AUPB 3WMEA 1JQLB 3P1JA 2ZRJA 2PL3A 4DCTA 3BIFA 2BMJA 3KKOA 4CEIA 5G41A 2O8DB 3Q5DA 1VCOA 1D9XA 4G5OA 2XXAA 4OK3A 1AQUA 3FWYA 1T8UA 4DSUA 1NBME 4ILEA 2QTVB 2MSEB 1JQJC 1KI1A 4LC1A 1XCPA 3ZGXA 5DHAA 2RGBA 4RZUA 821PA 4HAXA 3UIEA 5HPYB 2LKDA 2QENA 1G5TA 4QFMA 3SNHA 1P2SA 2ODEA 3SQXA 2J0UB 2OO7A 1SQ5A 1IN8A 4JT4A 4CEIB 2LCFA 1TEXA 1U8AA 2J5XA 3VU9A 5JCPA 2O8EA 3QXJA 1CU1A 1XMVA 3THXA 4URZR 4DDWA 2WSSD 4AYXA 1RE0A 4HAVA 4U02A 2ZM5A 1KI6A 4US2R 5TMPA 2BEJA 2AR7A 1EWQA 2QRNA 2YVUA 1FQKA 1JALA 1N6OA 3K70B 1NRJB 1FP7A 1D2EA 2D4HA 3L2OB 2REOA 3BD9A 2RGXA 3U3JA 1T5LA 2HLDA 1VIYA 3WMFA 1E9DA 5JRZA 4OQMA 5JEDA 1KHTA 4PHFA 1AM4D 4URVR 3C7KA 2ZXUA 2PCLA 2WKPA 4TQAA 3THOA 1N6HA 1G8HA 4V0KA 2XZOA 2BBWA 3ETLA 5FI1B 4B47A 1QHGA 2IWHA 1RYFA 4DBLC 2AKAB 1E4VA 1G17A 4C0HA 1P4SA 3CF2A 3EG5A 3I1FA 2GCNA 1W1WA 1AGPA 4BFZA 2VSOA 3W5JA 4JS0A 2ORIA 1FTSA 1I2MA 3FKQA 1P5ZB 4CF7A 1J70A 1KSGA 2P0EA 2YNMA 1KSFX 4WZBE 3SBDA 2XSZD 1M8PA 3BGWA 5FTMA 3PEWA 3AQ4A 5F2EA 1IN6A 1RJ9B 3N2IA 1BH2A 2BDTA 2H7VA 1R5BA 2ZE5A 1Z83A 3DMDA 4I81A 2B8TA 2BOVA 4TYNA 4YONB 5FFMA 1J2JA 1U81A 3RS2A 4TMKA 4KFTA 3IEUA 3KQNA 4TZ0A 1H8HA 2AKYA 3CM0A 5E7JA 1CKEA 1DARA 4GP6A 3T06B 1OXSC 2OE2A 2YHSA 4JBXA 5IF9A 3KUCA 2GXQA 4OI0A 1NMYA 2ZI5A 1Q20A 3LLMA 1YR6A 3WNDA 3VAAA 3B7GA 4LJ4A 4LRWA 1P9RA 5A0FA 1KKMA 2PH1A 3BH7A 3DPUA 1B23P 3B9QA 4DDVA 2GCPA 1MRSA 3UANA 3C5CA 4V0OA 1NVUQ 3F3YA 1MO5A 3K70D 1CJTC 2IXEA 2XX3A 4Q9HA 3T15A 5L3VA 3D7MA 2DWQA 2RB4A 4B6EA 3CUEF 2IL1A 3BFKA 2UZ3A 2ANBA 5HTKA 2ZRNA 1F2TB 3BFXA 2QT0A 1IONA 3B13B 3MWLA 5BW8A 2O0HA 3NC1C 4CZ2A 1QHHA 2YJTD 2G0TA 4P33A 2GK7A 3FE2A 1E79D 1WXQA 1W36D 2J0QA 2DY1A 3MRSA 5CM9C 4EKDA 2GNOA 4M2LA 1OB5A 3IUYA 3RLFA 1JECA 3WHKA 2ZRKA 3EWAA 4PX9A 2ZSDA 4C7OB 1E9BA 1QHIA 1DS6A 4KODA 3PXGA 4B75A 2G9NA 5JI3E 4D4MA 2OV2A 1B0UA 4Z8XA 3UKDA 4O0MA 1HA3A 4GL2A 1AS2A 2ZS7A 1CF4A 1G4UR 1AZSC 1XD2B 4UXHA 4HUQB 4F4IA 2KWIA 4PAQA 4JVMA 3NIBA 4WOPA 1XTJA 4NCJA 3TJZA 1TF2A 5B2ZA 4C2UA 3Q5EA 4HYYA 5SZHB 3VTKA 4DLUA 4KJZA 4C0JA 1SXJD 4LYHA 1C4OA 1XZPA 3MAAC 4YDHB 2VSFA 3X1ZA 4BFYA 3QBVA 2GESA 1E2IA 1NLZA 1LVGA 4JLBA 4JJKA 4Q1BA 3EC2A 2VEDA 1H8ED 4MRPA 3A1VA 1GG2A 1P62B 4C9BA 1OB2A 4M1YA 2RGNC 5H70A 4LCBA 1E1RD 2XJ4A 2HXYA 4AD8A 2I3BA 2BCJQ 4D0NA 1IY0A 1M1YE 1YZKA 1Z29A 2VHTA 1DVRA 1QG2A 221PA 1A5TA 2CJWB 2VA8A 2JLUA 1UDWA 2O52A 1LF0A 4JSYA 1CS4C 1F3OA 4GMDA 1P9WA 2DWPA 1TEVA 4JIMA 1OXUA 3KKNA 4KYUA 4W7SA 1T6NA 4P3YA 1G16A 3OEHD 3NBYC 2ZIAA 1LTQA 4RKFA 1WQ1R 1XU4A 3B8HA 3C4JA 4BUJA 4AK9A 1VHLA 2C98A 2J0SA 3KKPA 3PUXA 4K81B 4RFVA 5EE9A 1JXOA 2VHCA 3EA0A 4LYJA 3TUZC 2KBFA 3TH5A 1DAIA 2HT1A 5CYOA 1SVSA 2RHDA 3NBXX 3BWDD 3PJRA 3IGFA 4CRWB 1IY2A 3A1TA 1E9CA 5KO2A 2IYXA 4AG6A 2IS6A 4PZYA 1NN0A 4GPTA 5AR1A 1E2QA 3A4MA 2IYLD 4C0SA 3ZDQA 4CVNA 3REGA 1CR1A 2IBMA 1IBRA 2J3EA 3QF4B 2XOKA 5C2JB 1XD9A 2YYZA 3KX2A 3QE0A 1XZQA 4BFVA 4NMMA 3IPYA 1FMLA 1P6XA 3FFAA 1G19A 3GPLA 3SC3A 4Z54A 4FD2A 3KXIA 2ZUCA 5EE1A 1E3MA 2OBMA 2FSGA 1KZ7B 3PQCA 1XTRA 2CE7A 1Z2AA 4IEIA 4C30A 3FPAA 2DR3A 1KI7A 1WE2A 2ZUBA 5L3SA 3FKSA 4Q4HA 3CONA 3QPWA 1ZJ6A 4BZXA 3CR8A 2ZRBA 2C03A 2HJVA 1W4BA 2W2VA 1XTSA 3K1JA 3OEED 2RH5A 1XEWX 1DPFA 3I4LA 3WXMA 1DADA 4XSGA 3TR0A 4LJ5A 1Q57A 3W90A 4B74A 4GRAA 5A5GA 5JJLA 3AKDA 3RS0A 4Y0VA 1OFHA 2WAYA 2H17A 4IXNA 2ZJ8A 1AJEA 4FCVA 2ZETA 3BB1A 4NKRA 5CM8B 4R7ZA 4Q00A 1E0AA 3FDIA 4EFNA 1W4AA 3AUXA 2ERYA 3TGPA 5JSZA 1KK3A 5CB8A 2V1UA 3FMPB 4Q4AA 2P2LA 1RRCA 1MKYA 5A4JA 5EXSA 4MKIA 3LBNA 4A0RA 1HV8A 4HDOB 2WSSA 3KJIA 5M04A 4A6PA 1YRBA 3PIRA 5CDFA 1YRAA 1HTWA 1JPJA 1U8YA 1U94A 2WV9A 4TL6A 1N0UA 2Q9CA 4G5GA 2RGGA 4C7OA 1P7CA 3U3MA 1OH5A 5B57C 2HLDD 2NO1A 3OZXA 2RMKA 3U4QA 1E2GA 4NCIA 4D6PA 1CR0A 3WMGA 2F43A 2CNWD 1BYUA 2QUZA 1IM2A 2X2FA 4LYAA 4M9SA 3WNCA 1TX4B 3B85A 2O8CB 4AWXA 4NDZA 1LF5A 1ZP6A 3Q8XB 4JLJA 4PANA 5FPKA 3KXLA 2QMOA 4HAWA 2Q9AA 4YMSA 2IUUA 3U3OA 2DYKA 4LK2A 4M22A 1Q21A 2ZJAA 4BLPA 4DXAA 4U7DA 2D7CA 3IHLA 4S2EA 3Q3JB 3TLXA 4I1VA 1YQTA 4ZO4A 2QP4A 4M1KA 2Q3FA 3AKCA 1K5GA 1RYHA 1IXZA 3GLHA 4FMCF 1HQCA 2EWWA 2GF9A 1D9ZA 3I8XA 2VH5R 4IXMA 4NP6A 1OSNA 3IHWA 3B1ZA 3OIUA 5LPNA 3P26A 3QUSA 3AVTA 4IDQA 2C96A 1P9NA 1CR2A 4IVRA 5JMTA 3PFIA 1FX0A 3EZ9A 3PUZA 3QKUA 5HE9A 2QP3A 2F55A 4TQUS 2A9KA 4ESVA 2MMCA 3VNUA 2GK6A 1W7AA 4J0QA 3TNFA 4TMTA 5H1YA 1ELOA 3WYGA 4FINA 4BEBA 2ZI3A 3AP1A 4KBGA 1G21E 1BMFD 3LFUA 1WRBA 3KB2A 1KGDA 5JS7A 1ESNA 1XCGB 3TE6A 3HR8A 1E2PA 2OBNA 3U7HB 4B2PA 2WWXA 2NIPA 2PLRA 4IOJA 3SYNA 3VNVA 4G0NA 3TIFA 2ZVQX 2HJGA 1Z06A 2ATXA 3OHMA 2V6JA 3AF1A 1OYWA 5C46F 3U61B 2IW3A 1F6BA 1UAAA 1TUIA 2ZANA 4EPXA 3H2YA 1RC8A 4DHEA 3RRZA 3EPLA 1GRRA 2ZTSA 1JJVA 2EW1A 3GLHB 4PPFA 3K0CA 4Q4LA 4QL3A 1N25A 4G3XA 3T1QA 5KSYA 4HSEA 3AVPA 3QOFA 3TVDA 4OJQA 4JL6A 1SKYE 4XH9B 2ZJYA 2ODWA 1T9HA 4JLDA 4XWAA 1EESA 3HR7A 1NJFA 1GM5A 1MO4A 1OIVA 1S0UA 3HWSA 1LS6A 4JSTA 2VHJA 4PPGA 4O3MA 1S96A 5IDVA 1XPRA 2WMOB 2PZFA 3Q7PA 4LPKA 3ADBA 4GOXA 3OAAD 4NE2A 2VP5A 4L15A 1QVAA 2JIZA 1SULA 5TB5A 2I1VB 3T1VA 1D5CA 1M34E 1QDEA 1Z2CA 1WP9A 1E32A 1E1QD 1SVWA 1XJQA 3ZH9B 3TW4A 2BKUA 5KU1A 5BYJA 3SDZA 4QGFA 4JJZA 2GKSA 5GJVC 5JEEA 3O8DA 3R9IA 3BS4A 5J4HA 1AGRA 4LWZA 2WICA 5C1BA 4TT3A 5L8VA 1W0KD 2YOFA 1XXHE 1JEDA 2ZPTX 4DWJA 1Z0AA 3CF0A 3H86A 5JWRA 2BJVA 2PEYA 3WHLA 4PQRA 3THYB 1T0HB 4R98A 4HLUC 1DAEA 1KDTA 1G7RA 1NBMA 1NN1A 1NLFA 1P61B 1PJRA 2EFGA 3LY5A 4A4DA 1DEKA 4CIDA 4LX0A 4D0GA 2FSIA 3GJ7A 3P27A 4HI0E 1II0A 4KBFA 1U9IC 1W49A 1OPXA 1E94E 3SYKA 1M7GA 3FMFA 1VG0B 3IPXA 4HDQB 3V00A 1Z22A 5FBQB 1Z0DA 4Q1FA 1UBEA 3C5HA 1Q0UA 3KB1A 1N2CE 2PEZA 5SZJA 2XB4A 2QRZA 2WWHA 4BFTA 1NVVQ 3CO5A 3SR0A 1G18A 2VHQA 3GEEA 3K0AA 2HF8A 1YE8A 3MG9A 3WY9A 4B2LA 1E2HA 1NY5A 2XTNA 4QHYA 2HCBA 1UBFA 4B73A 4P0TA 2F6RA 4GNKA 4PAMA 4FXPA 1ESMA 2E87A 3TUIC 1ANKA 2EFDB 3C41J 3EIHA 2R9VA 2J59A 1ZUNB 4MRSA 1TU4A 1E0JA 1P75A 3EIEA 4Q19A 3RC3A 2V8OA 1GNRA 3KFXA 1P72A 2O0KA 3FB4A 3LO5A 3VR5A 4DCUA 4TYYA 1C9KA 1OLOA 1QF9A 5JS8A 2HEIA 3LQQA 4L16A 2G6BA 3WNBA 3QIAA 1EWRA 4KVAA 4NHOA 1XFAA 4EFMA 2ZRIA 1KK2A 1FL9A 1RRFA 3M1IA 1HH4A 2GAAA 4JYCA 4RCZA 3GJ6A 1A1VA 4IW3B 1XMSA 2J45A 2JIZD 4E03A 3LVRE 5H68A 1QHSA 2EQBA 3RSLA 2H1LA 1EK0A 2GRJA 1KAGA 4MITA 1XXHB 1GIAA 3T1TA 1S1CA 1NMXA 4MYUA 5BWMA 1G4AE 1KSHA 5DYGA 4HZUB 1WDTA 4LHVA 1JXMA 2N46A 2ZS9A 1U90A 4V0MA 2WJVA 2GETA 4IFBA 1OXTA 3CW2A 3GEIA 3C15C 3FKSD 2EU8A 4OQLA 2OM2A 2QY9A 4BFXA 421PA 2QAGB 1PLKA 2ZRLA 3QF4A 3GJ5A 1IAQA 4OHVA 1FP6A 3CB4A 3AF3A 3QXHA 2QA5A 4FMBB 4V02A 1XNJA 4LJ8A 2ECKA 1WF3A 5EE3A 2PX3A 1W0JA 1LY1A 3A37A 1E2JA 2GZDA 1W36B
chains in the Genus database with same CATH superfamily
2FMKA 3PV0A 3RNLA 2AG5A 2YOGA 4PPNA 3RVDA 1L8XA 2QJWA 4I5DA 2BV3A 3R77A 4AICA 4P86A 1FRZA 1OTXA 4R54A 4MVXA 4TV8B 3OCCA 5JU6A 1JJ7A 4KGDA 3UJ6A 4YGXB 1EBUA 4TMVA 3DDSA 4RW0A 3WGKA 2IZ1A 1QZXA 1SCUB 1HE3A 1EA5A 2RHJA 4NOKA 1CQXA 4RSGA 3AG6A 3HJNA 5G1OA 4P3KA 5ALIA 2OORA 3N2ZB 3L7BA 2E89A 2GEFA 4IZ6A 1XD8A 4UD6A 4H2DA 4F4UA 1FFGA 3RK1A 9LDBA 4E4TA 4AUEA 1OZFA 3B6IA 3V7WA 2B0CA 1CX9B 2EFYA 4XR9A 3GRYA 1B3RA 4LNAA 3V46A 4Q3OA 5CB4F 3QJYA 1OYOA 2ORWA 2UKDA 3ND9A 3A36A 4MRVA 1U3CA 3UH0A 3TKLA 5EJ9A 1M2VA 3NHLA 2JLXA 1A8HA 1YZQA 3KV1A 3DAOA 5BSKA 3K20A 3RSHA 3RU2A 1IM5A 4MVJI 5GOTA 4C1BA 1PSDA 1D7AA 5IT0A 3DDOA 5B1SA 2C57A 1I7PA 4CG1A 3K32A 2C82A 4LZZA 4C43A 1Z7GA 1GKKA 4WW0A 1EZ1A 1FC0A 5DM60 4EJSA 3CBQA 1F14A 1HYHA 3HZOA 4F97A 2FEOA 1XWIA 3JYOA 3PK0A 2OPBA 3CVOA 4MV7A 4ODIA 2QTRA 2HPHA 2FPXA 5K03A 2DJIA 2Y1GA 1HDGO 1F9AA 5C3UA 3VTZA 4C07A 3WZLA 3ZGZA 1Q2XA 4GT1A 3OP4A 1J5XA 3COPA 4TKUA 2VQFB 4CEHA 3QBTA 1P7VA 5BOVA 1IJEA 3F71A 2FRXA 4UCFA 5KBYA 3ON5A 2PYZA 1UKCA 3KSZO 1JQ5A 4XYEA 2D1RA 1LK5A 4PRKA 2C3YA 2E18A 1SBCA 5U9CA 4M9XA 3LUAA 3IL2A 2EJVA 3BE5A 3YASA 2F43B 2XB9A 3D3EA 4QOFA 3F5DA 4R16A 1ZXXA 2IOHA 1XROA 2ZIWB 2CXHA 1EFVA 2G5PA 3KWMA 2XOKD 2BEKA 2B8JA 3C3YA 5EYPB 1E5TA 5GJBA 4I9FA 2GO1A 2FWMX 3BTVA 1ZGGA 5EJEA 3PRKE 4AKEA 4K6OA 4LECA 3X2FA 1BFDA 1N6LA 1Y7HA 5ALPA 1P2TA 2D59A 2X19A 3HKBB 4N47A 5K0TA 3O1LA 4RD6A 2QTLA 4PPQA 1DBSA 2WM8A 1I7SB 4UBMA 5I3ZA 1QOPB 1S2MA 2X8BA 5KREA 1FUEA 3U5ZB 1ZH2A 2NTYC 4TL7A 1V71A 1NXTA 5TVKA 1FQJA 5DLQC 2P2GA 1KFJB 3WGNA 4OX9B 4KPFC 1A04A 5EE0A 3IIIA 4Z4IA 2QMEA 3FTDA 4I8XA 3HDQA 1EA7A 2QD1A 1U0FA 3DT9A 2RK3A 4WEOA 1P1FA 5TGZA 2FSUA 4D3SA 1GDHA 4KIUA 3QKWA 5H7XA 3FCUB 3NVAA 1P2VA 3I09A 1PJLA 4KN5A 3RUAA 5JQWA 4IX1A 3HSYA 4DNPA 3W5VA 3G0DA 3P94A 3PWTA 1AV7A 1IPEA 3LT2A 4PGMA 4EJ2A 3ECCA 4CW7A 4BNDA 3L49A 2QTHA 1EXDA 2JW5A 1VBFA 3CT6A 4B44A 3DT8A 4LJLA 3D1VA 1QRTA 3BWMA 3T35A 2CCGA 2ZGVA 3NRJA 5FWXA 3W5CA 3WYEA 1FMJA 1SURA 4A1FA 1DOAA 2GVDC 5ER6A 3SYTA 3LV8A 1U7UA 4IGAA 4C4XA 4AZTA 3V1KA 4LG1A 3LUBA 3LO8A 5ALQA 1VE3A 7AT1A 5KHLB 4ADSG 4JYAB 2MSNA 3DOHA 2ECOA 3LXXA 2O07A 4GP7A 1KDZA 4G67A 1XTTA 3N05A 4OMUA 4GEGA 5HQ3B 2PA0A 2Z6AA 2J3IA 3MNFA 4F11A 1I3KA 2NLOA 4OBXA 4ZRDA 1FVHA 2AX4A 2HD4A 1CRQA 3DHNA 1T36B 1LS1A 1AGNA 3KDAA 1JNYA 1ENOA 1D2CA 1ZH8A 3NTXA 4MAAA 4UOEA 5JNSA 4GKJB 4O2BA 3TPZA 3DKIA 3NBFA 2NTVA 3NEYA 3G5LA 3AB7A 1U0HC 3VR6D 1HL3A 4F93B 2YDYA 2Z83A 4XVQA 3M81A 5CBPA 1N0VC 5ALKA 4B4KA 3RG2A 4IFEA 2I3AA 3NT5A 2WU8A 1XCOA 4EYQA 4KITB 3WAGA 3OMWA 5DO9A 2EEPA 3WLQA 4YT8A 1N5DA 1IIRA 4P53A 2OFFA 1E8MA 1R6VA 1X1EA 5DTQA 3HCAA 3RVPA 3T0IA 5KSZA 1WAMA 4MDFA 1MTOA 4NV3A 1SHKA 2ARKA 3UWDA 4R9RA 3W5UA 3IXLA 2DMRA 3V4PB 2Y1KA 2ZYTX 1A88A 2Y71A 4C0AC 1T0JB 2ZUDA 4AKTA 1QLHA 3IO3A 2PUBA 2AC2A 2YX1A 3VMFA 4PXAA 2K5UA 2HUPA 2W90A 1GFZA 3EAQA 4LE1A 2ZQ5A 4WKBA 2RI1A 4MDHA 1IHOA 4Y0AA 4GZLA 2H65A 4OKIA 3BK7A 1UJ2A 1OI7A 4JA2A 1CZUA 1J5PA 3C3AA 3S1AA 5LP1A 4L6IA 1H6BA 4JHXA 2KX7A 2ZDQA 3P4XA 3UAVA 1IK6A 4N4AA 3TW8B 1GILA 1SZCA 2WIBA 4N9WA 3HB0A 2C7QA 3FAKA 3OPYB 3DW3X 1I2AA 5TQ2B 3FR8A 5A06A 3AH8A 2HL6A 3A28A 4HDQB 5AVXA 3JAWB 2JBHA 4WA8A 3Q7IA 1GDDA 5LOVB 1JDSA 5EWJA 4E5NA 1LB1B 3WLKX 4JVNA 1OXVA 1ZU4A 4UCWA 4ZC1A 3UXMA 5A02A 4PW0A 5KIAA 3ORYA 3Q3IA 4EHLA 1EM8A 3PUIA 1L8LA 1Y8QA 3EVNA 2ZE6A 3KQWA 4MS4B 4LDJA 1DL5A 4Q4AB 3HDGA 1CPYA 2VJYA 1FNBA 2C5FA 3RNOA 4BWYA 4PNPA 1Q0HA 3KYCA 3WAJA 1ZW6A 3OPNA 2NV0A 3GLGE 1JJAA 3X1DA 3ZY3A 3IRUA 3S5JA 3B1WA 3VPFA 1BFUA 2GBFA 2BM8A 1J4AA 2EJBA 4IMIB 4MGZR 2JGRA 1DBVO 4KXMA 4OG2A 2EZ4A 4JI8B 1D7OA 2MSLA 3RIGA 4BQIA 2I2AA 121PA 2NVOA 3MFQA 4RKRA 2PMEA 3EZXA 4CV2A 4XTRA 4MQMA 4RKEA 1CJSA 1SXPA 3WIVA 1YWGO 1RXCA 4GECA 2X8AA 4Q24A 1P1BA 3HB4X 2A1UB 5CTJA 2J0EA 5C4IA 3GI1A 4TXMA 2IHUA 1LKZA 2LNDA 2QTAA 3STHA 3HC7A 4BGIA 4YXWD 4JD5A 5AVJA 4FZ3A 2J5QA 4J07A 4Q4JA 4UXIA 4DLRA 2R1VA 5FLXA 1AGYA 1J21A 2JFOA 2JAOA 3U3DA 4C7XA 1BDMA 1OILA 2IYZA 3IMEA 4XVRA 2WIGA 1NSFA 4BECA 4COKA 2HRQA 4O4HB 4RTLA 3BZWA 3COSA 3EH2A 2WD9A 4PSVA 4WZ6A 2YL2A 1PJTA 5I7WA 2D2FA 5AM1A 2VRBA 5FL7A 5JLJA 4AF6A 4MWTA 5D6NA 3LUPA 1LDNA 2FX3A 2CJPA 4CL3A 1N6KA 1FVXA 1VIAA 2GXSA 3ZGOA 3NDJA 4L28A 2ZT6A 4XX1A 5CT8A 3O8RA 3LW7A 3AL0C 3AI2A 4I3GA 3WBKA 5JDCA 2O1EA 1BYIA 2F59A 2WNIA 4U39A 1F2UB 3B9RA 3FWHA 5EXDA 3UGTA 4K87A 4GZMA 2PT7A 5AWFC 3VHXA 3HL0A 3MINA 4XB1A 1T5BA 2TSYB 2ZITA 3EXHC 3JVDA 2QB5A 2AFIE 3ESZA 3AUJB 2CLCX 4Y1RB 4XPIA 3TSOA 2F1IA 4E31A 1G8KA 4Q1DA 4ZI3A 5KTYA 1X7HA 2EGUA 4RHXA 3UGJA 1UWKA 4URYR 2M6RA 4NICA 4EVRA 4FJ1A 2OHVA 4Y67A 5K8LA 1L4NA 3TTTA 3L0ZA 4GOJA 1JKFA 2YFQA 3GH3A 5AKJA 5GONF 3VPBA 4A82A 5IAJA 4AFNA 4O6VA 2ZAMA 3VNRA 5CFRA 2SKEA 3Q0EA 2FX2A 1Y63A 3E9YA 4DCNA 2QN6A 1VGRA 3HI4A 1XALA 2FK8A 2BR3A 2JLRA 1ML4A 3GAMA 4IWXA 4HATA 5IU6A 3OQMA 1GQOA 4IKOA 4NBTA 5FT9A 1QAMA 2H59A 4HPWA 4I9UA 5ARDA 4UPEA 4Q7KA 4E2ZA 2X4IA 4Y1GA 5ERYA 1I94B 1SIUA 1Z2PX 2ZSBA 2IUTA 2WD7B 4II2A 1VMKA 3HJBA 2R8EA 4H6XA 1WB5A 1XZEA 3K73O 4L75A 1GA1A 1PD1A 5ALXA 1O96A 4IGKA 5KNDH 2K7FA 4KC0A 2WM9B 1E5VA 3QUQA 4YAUA 3UICA 4YRBA 2FFHA 1FNNA 2NV2B 4QKQA 5KTKA 3CNOA 2QSZA 2WUFA 4PIMA 1M8KA 2I2WA 3T95A 4YRSA 3DGFC 1U2GC 2Q0QA 2GBIA 3PQFA 3R75A 4WZAA 2QG4A 2REQB 3AHHA 4RSMA 3EXEB 3HBFA 3C45A 1CY7A 1ZCBA 2GRAA 2HHLA 3PGVA 5F2KA 2XNDA 4GXQA 2CLEB 3MJ4A 3JS5A 4BZWA 4L8GA 2FJ0A 3ZWAA 2FOIA 4NG5A 4KWEA 3EUFA 1YIDA 2WOJA 3GW8A 4TLMB 5BV7A 3WVNA 4G5FA 3F6BX 1YA8A 2O0LA 3GCWA 5KWSA 3WP0A 2PX6A 1AIPA 2J1LA 3FGOA 2QN9A 4EVSA 4AKGA 1TW3A 2PZEA 1X0XA 5HJ5A 3UWKA 2P75A 3OTOB 5CT4A 2R6JA 4IIEA 1PJQA 5F7OA 3BCUA 1UL1X 5EEHA 3LDGA 4OU5A 3BFPA 1BA3A 1KI4A 4KLZA 1YAJA 4LHXA 4L3WA 1PS9A 1Y6JA 4AZ3A 1XDDA 5DH9A 3DHYA 4KQWA 1RR6A 4QICA 4R1OA 1EFUA 3THXB 2FPMA 5I9TA 3BHJA 3LOPA 3RJMA 1QRSA 1OGYA 1QBGA 2FPOA 4MVJM 4HQRA 4NEHB 3DMRA 3R3YA 4B3CA 1WXHA 4KFRA 1R4NB 3KALA 5EWMB 1RLOA 2Z08A 4TLAA 2H2HA 4YRDA 3OCVA 4DADA 5JQGB 2AK2A 4R2IA 3KZCA 1NWCA 2O2JA 4MB0A 1NLUA 4HUQA 3S2FA 2RBGA 1J06A 4HF7A 5CB0A 4IRXA 2R1TA 4KWIA 1XLWA 3IJPA 3FLEA 3ONVA 1KO5A 4YCNA 3ASUA 4PC1A 3B9PA 4N5MA 3T7TA 3ZV5A 2IDJA 2ECFA 1F12A 2W2OA 3OPYA 1ZGZA 4NS4A 3IB3A 4N49A 5JXJA 1NT2A 1UAYA 3O5AA 2RGNA 4IH9A 3QKIA 2C2WA 1C1HA 2NPFA 4MUYA 1A5SB 3RHTA 4YMIA 3T7DA 1NW4A 4IQ4A 1FFWA 1OOEA 3M5PA 4P7JA 5JWHA 3UKOA 1MENA 1JEOA 5B64A 3EXG1 2EFJA 3N2GA 3DYIA 2FG5A 1MDBA 1TRKA 3H0EA 1U99A 1FDOA 3Q41A 4NYIQ 3ELWA 2WBLC 1FBNA 5EY5B 1DKPA 3BF8A 1LZLA 4DV0B 4IHQA 5DHRA 2RCNA 4U5XA 1WZUA 2R2GA 3QP9A 5AKEA 2X58A 4KI7A 4MLDA 4BB9A 10MHA 5IKXA 1FLAA 1G291 4BJ3A 1RXWA 4LY9A 2WWTA 1PV4A 3H4TA 3F78A 3UWMA 3BILA 5SY6A 2CJXA 2PLAA 5DEOA 3E5NA 1ZUNA 3IT3A 1H2WA 2A1TR 2OD2A 5KYVA 4RMNA 2JD2A 5SZKB 1Z47A 3F9IA 3R8FA 4TSFD 5HF9A 3PJGA 2IXFA 4FHGA 2ILVA 3IUJA 3VR0A 2DXIA 2D3TA 3TD2A 1YSCA 3ENWA 3E15A 3MJCA 1MNQA 5AM3A 1T5OA 4D81A 2ZM6B 4JIGA 3TJMA 1XJ0A 1OKKD 3SHWA 2XTAA 4E70A 1VTKA 4BP1A 4CFZA 2PWAA 4DCGA 4KR7A 2HCTA 1QRUA 3A6ZA 4MW0A 4A2WA 1RWOA 4NBWA 1JA9A 4C7VA 2VHEA 1M0EA 2AH5A 4HWSA 4CIBA 2IXDA 2QRVB 3M6UA 3RHZA 3GJ8A 2JI9A 3H16A 2QR2A 5T6MA 5AOVA 5A9TA 5WRFA 3LW8A 2V58A 4D97A 5AIBA 4MPJA 4Q93A 1C8KA 1PW7A 3M9WA 3IUPA 1H1LA 2QTBA 1IATA 2OCGA 1CHNA 2RKOA 2C2BA 2HCJB 3PTZA 3LXMA 1RHUA 4MHSA 3VR3A 5IHPA 4BLWA 3PPWA 3UV6A 3KDSE 4KH0A 3JRWA 1PIWA 3EIQA 3QPVA 1QHHB 2QT1A 3T7AA 4YTEA 2G25A 3K30A 2RG1A 4TROA 4CKZA 1L5VA 2QXUA 1BGWA 3NC4A 4FYXA 2WVAA 4GQIA 3GZNA 3FMVA 1HRKA 3KTAA 1P19A 3NT2A 4AS3A 3CVWA 5I45A 1RABA 1MVOA 3NGMA 3IB6A 3JPWA 1AB5A 2W6JD 2BWJA 3C70A 3F7MA 1TT5B 1NUAA 1I3MA 3NVMB 2XVAA 1X1QA 4J2OA 4L5AA 5HSGA 4YT2A 4A2QA 3WNQA 1L7BA 1Q16A 3FSEA 3GDOA 4GKKB 1J20A 5DK6A 1R4AA 3H9QA 1SUAA 3TN7A 3WGJA 3TLZA 1FXSA 2UXBB 3IQWA 4ENVA 1YRQA 3NDPA 2Z8YA 4E11A 16PKA 1MQAA 1AN0A 4AWBA 1AGXA 2V7PA 2QSUA 2CEKA 2X15A 3TQTA 3WB9A 3TL6A 4MWZA 4BN4A 2O1WA 2Q29A 4BU0A 2I3ZA 3OX1A 5IHXA 4QZVA 3U2QA 1APBA 1SRRA 3JWPA 4DUYB 2WPDD 2H00A 3DXXA 1T0IA 4G5RA 2QU8A 2J4CA 4LVOA 1Y3CE 1XTUA 2CUTA 4QNRA 1E5XA 2Z0MA 4LRYA 1YVUA 2Q45A 2WTXA 4JMPA 3U37A 4IUDS 4A5SA 4J03A 2WUDA 5EPUA 3EDQA 3OT5A 4Z8YA 1W36C 1TIPA 1IUNA 3EGXB 3EVGA 5DM2A 2Y9MB 3DQPA 3C16C 1NVEA 4PYQA 2PUJA 1Q3TA 3DFFA 3G6KA 4GGPA 4NAVA 1IZ7A 1J0CA 3DXZA 3QNWA 4P4GA 4WFJA 2XZPA 4R8RA 2PMCA 1BU5A 4CU2A 2BMFA 2IUEA 5ICGA 3QX3A 1UFKA 3UHFA 5G0UA 2WJIA 3GLVA 3K9CA 4BPRA 4RIGA 2E0IA 1M67A 2B2CA 1YQWA 2F00A 2PRJA 3EOZA 4UUNA 3AEYA 3DP7A 1V4BA 3NTOA 1I5OA 4FZ5A 2BVNA 1NVTA 4MVJE 4QU9A 4Y2GA 1YHYA 2WT4A 4JX9A 2WSMA 3DBOB 2H0AA 2BUAA 3G2OA 3DM5A 3IULA 4UPVA 4GPBA 3DH0A 1Y6QA 3KAPA 1OBVA 1U0RA 5KJCA 2ZRDA 3NBQA 5EKTA 6GPBA 1WBJB 3GFQA 3EXG2 3R6LA 4PONA 5JVDF 2WAOA 1U5BB 2DRIA 3OJOA 5CHEA 1GFWA 5AW6A 3ZCVA 4FDUA 1MMFB 2HHJA 5FNVF 3SF8A 1YJ8A 2GXAA 4QM7A 2C2GA 3H0CA 1CP2A 3CEMA 4KRYA 1DLJA 5H83A 1Z7WA 3CR7A 2MYTA 4XYGA 4ZOLA 4FS8A 2R8ZA 4NCHA 3RRBA 3ZE6A 4JGGA 5LQNA 3A2KA 2R5FA 2OP1A 3VC3A 3ZHVA 2JFVA 1NG1A 1SPBS 4BKMA 3AM4A 2PPLA 3B12A 1K5PA 1A7KA 4JDPA 3SX4A 3RSSA 3E1GA 2IY9A 1ZK1A 1NQWA 2P5TB 1LGYA 3KZOA 1EP9A 4R1SA 2FZCA 2L0XA 5EQJB 3PPVA 3RUCA 3SHTA 3UT5A 5FH9A 4G1FA 4XVCA 1WNFA 2DQYA 4DXDA 1EP3B 3WDLA 5KMGA 3L8HA 1OGJA 1WW8A 4OM7A 5D87A 4Q15A 1W19A 5E6SA 2BKVA 2QUJA 3WQRA 4BLRA 5A9SA 5HUJA 1ODTC 2ZG6A 4Q34A 1II8B 5DHFA 4JU9A 1KI3A 1FFCA 2AVDA 2VP4A 3NKLA 2XNDD 3PXXA 5DSTA 3G2LA 3N9IA 3GA0A 3D6JA 2PUHA 1VBKA 4LS3A 2DQ4A 3WRWA 1W88A 4HR7A 1M7HA 1P1RA 5EWJB 2JJMA 3LUDA 2D1FA 5IYZA 4EKGA 3QSGA 4I5GA 2CKMA 3M83A 2XMCA 4IO1A 4I5IA 5DNDA 2W2MA 1O0BA 4MV1A 4GPEA 3HUEA 1R3UA 4FGZA 5GONA 3AVUA 4JYMA 3IJEB 4ZYUA 4X94A 4DC9A 5F76A 3E84A 1ADFA 1HBJA 4XR4A 4R1NA 2Z3VA 4BJHB 2BISA 2IZ7A 2ZPAA 3S1AB 3NGXA 1T0UA 1BCRA 2UZ0A 4LDQA 3CJQA 3SS9X 4YNBA 4XX0A 4A16A 1U7WA 1LSOA 3DHEA 4U7WA 4YUXA 1Z0FA 2VQ3A 3GJYA 4ZVQA 4KP7A 1YL5A 2P6OA 3HV0A 4MGIR 1E1CA 1OAOA 2DUNA 2ZT8A 1U7ZA 3E2MA 3EISA 2ZWPA 3ROPA 4BC1A 4EABA 3SOZA 5CT9A 1MJNA 2ZYIA 1RAFA 1NI3A 3OTHA 4RY0A 4CF4A 3LSYA 4H31A 5HTOA 2FPWA 3U7EB 1K9SA 4Z4CA 4RVUA 2CW5A 2FPGB 3K9HA 5FI5A 3L0IB 1PLJA 2QW8A 3IERA 3K2BA 4I9GA 1OWNA 4JZKA 4NZPA 3VH4A 3DEIA 2D0PB 3KEMA 1TIKA 2G70A 3C1OA 3R4CA 2IDKA 3FNGA 4PR0A 3BICA 3L8DA 3KZ1E 4KSYA 3E27A 1KO4A 2GDJA 3BEOA 1CRPA 1LCIA 3T3OA 1E7RA 2Y68A 4OHBA 1UT5A 5IWAB 2YZNA 1I13A 2FZWA 4K8RB 2ZLBA 2E4WA 1D2HA 2C2OA 2OCYC 4KACA 2C9ZA 5EVJA 2HQOA 2FHPA 1V7CA 5FAKA 1NURA 2HWYA 1P73A 5FUBA 1V95A 3LQFA 3CGWA 4EH1A 4BVFA 1NC1A 3OTQA 4QPZA 2I0FA 3MXOA 3U4QB 3A9CA 2GUWA 5CJ2A 4HLNA 3VPAA 5FWYA 1UIMA 4TV9F 3VZQA 5FNZA 1VPLA 1UEIA 3Q72A 4K26A 4PYMA 2IEDA 3GN2A 3ISJA 3BA6A 1X1RA 1FTWA 1WULS 3VAYA 3UJ7A 2HXSA 2PVSA 1MW9X 3HYLA 2VUUA 3EVCA 3KUDA 3KWFA 3OEWA 4ESOA 3EC7A 2ZREA 4RF2A 4F8JA 3AVXA 3EHDA 1WA5A 3G2HA 3IPAA 2OZEA 3OIGA 1SXJE 5TV2A 4ASUA 4JGBA 2WWRA 4KX3A 1Y4SA 2NU6B 2V7QD 4QTYA 3WISA 5KPDA 5BR1A 3I61A 1PWEA 3EG9A 5DHQA 3RT9A 3N7UA 4KR0A 3EPHA 1DJMA 4XWGA 4EWLA 3LKVA 4GBGA 5KYGA 1MZPA 4LUCA 3LGXA 3DV0A 5K05A 2F3RA 2VHUA 3LA8A 3GLSA 4KWTA 1SXHA 3L6UA 3W3AA 4JODA 4B3XA 3R44A 3C14C 4AJ9A 3T9BA 4PO3X 1B42A 1WXGA 4BL5A 4P36A 4CF5A 7MDHA 1VJ5A 4L8WB 1NXQA 2VTBA 4YFVA 2YMPA 4MWOA 5EG5A 2Q07A 2RE8A 5CYFA 2R6FA 4N7BA 2IBTA 1SKAA 2HJ9A 2IZZA 2HKIA 2QROA 2RC6A 3HWX1 4M0MA 5CK5A 3W5SA 4E5VA 1NVVR 3HPRA 2AI2A 1ATIA 4FYKA 1A4RA 1L4MA 5K8TA 2VK2A 5CA1F 4Z4QA 2FJUA 2YJ6A 2QMZA 5LCXA 3ZHOA 4YRLA 3S4YA 3CUTA 3IE2A 3OFVA 3R2JA 3WLAA 4CR7A 1ZHOA 3B89A 3BB3A 3AUYA 4RK7A 1I1NA 1Z4JA 3BXOA 4MPPA 3T7CA 4RX1A 3D6HA 4HVCA 4L76A 1L6RA 2FPIB 4GMGA 3MRXA 3V4OA 3FVWA 2HMVA 1BOOA 4F84A 1R66A 1ZM4A 4QBGB 3SS8A 3O2JA 3SQWA 5LYJF 4XLTA 1KJNA 1WDMA 3QVSA 5AHWA 1WZIA 4PG8A 4EPRA 3KEFA 1YAHA 2XUHA 1DT3A 1BD3A 1GPH1 1X1SA 2F4NA 4BFSA 1WETA 4PZDA 1PJ2A 4GGMX 2CDNA 2IOQA 4DGSA 3OE7D 2HNBA 2HOQA 3LBAA 3R5FA 3LLCA 1YDGA 4UHBA 1R64A 2HQ1A 4K9MA 3F4BA 4M49A 1UK7A 3AONB 3LG2A 1W2HA 1UAGA 1X7WB 1H6AA 3GL9A 4DQKA 5U4QA 5FKJA 3A6LA 4OXIA 4GR9A 5E9WA 3RRNA 4TZ6A 3VYSB 1RIIA 1V3QE 3N7TA 4L72A 1RVV1 3OZAA 2CL5A 3A4LA 2OWEA 3FPKA 3JAKA 1TL7C 3RSGA 5JY1A 1TC2A 1IEVA 3G1WA 3WLEA 2EJWA 1P2DA 4UZEA 4NCBA 1TAUA 3VJKA 3THSA 2M1ZA 4L73A 3WSWA 2PGLA 4IJQA 1Q6ZA 1V3VA 3P9YA 3ZU6A 3JRNA 3OWOA 4JFAA 1Y48E 2FMFA 1T3HA 4BX8A 1MH1A 2XOEA 3FSRA 4URFA 2AZTA 4MKHA 4OQZA 1TZJA 2KHZA 2CLHB 3AR5A 1U7HA 4QXMA 5CXQA 1GGKA 5C3MA 1PQYA 4EW2A 4HLDA 1VLQA 3F1LA 2ZIXB 4IJWA 4EUKA 3DT6A 5A9RA 4YMVA 2ZPUA 3ECAA 3NG1A 1G1MA 2Z4SA 4F5EA 2J5KA 1K1EA 2WA2A 4IMJB 4MVJH 3N6RA 4ZYWA 1GXSA 5ECGC 2EVWX 1FP1D 2I8CA 3NASA 4MWCA 1MX3A 3M0EA 1O6BA 3VR2D 4MCJA 3SVTA 1YUMA 4L5CA 5CVJA 3VKWA 2PL5A 1E63A 1FRQA 3PQ6A 3RYHB 3UFXB 1EUZA 3AIOA 4IOKA 4IHJF 1QH0A 2VT6A 2GK4A 5LVAA 2IY7A 4LSGA 1I5EA 4CETA 5EIBD 5JMPA 1DELA 3KKMA 3PYXA 2P4EA 4L5JA 1VCNA 1YKGA 4TOIA 1WXXA 3P7MA 2PX8A 2XQJA 1W47A 3SICE 3GGDA 4PAOA 3S99A 2JLBA 3GRAA 4RMHA 2FOXA 2PZJA 4UE2A 1M83A 1KZHA 2VBIA 4UU7A 3FLAA 4DT1B 3VVLA 5BRNA 1Z6PA 4MS3A 3ZIAA 1KK1A 1A9XA 5K0EA 4LF7B 2DPGA 4QQ8A 1M2OB 1I4DD 4S04A 1QB7A 1AK1A 1ZIXA 3WDMA 2M6LA 1EWYA 2QPTA 4JJ6A 1KC3A 1VMIA 2HSEA 4FCWA 1XL1A 3WO0A 4X20B 2CZGA 4DQ0A 4RD2A 3DM9B 1HDIA 3K1AA 3O26A 4PE5B 4GHWA 1ZLXA 1VYVA 3AHEA 3PGKA 4Z3KA 4WK0B 2FA9A 3FBGA 5AJXA 4E09A 3V2GA 1A8QA 5JHHB 1TADA 5KMGB 4QA9A 5EERA 721PA 1WMBA 1ZIOA 1P7WA 4W5HA 1WZEA 1H0RA 2C95A 3JU3A 1YUNA 4BYMA 5I4BA 2PSSA 1JHMA 1VQ1A 3CMMA 1J2UA 2GJ8A 2C3PA 4KIWA 1X8XA 3OWXA 5AP9A 1V0JA 1WKBA 2YCLA 3TBKA 3WGLA 3LFTA 4BV8A 3LOUA 1TM2A 3G49A 3LE8A 1WZ2A 1ZVMA 1PNRA 1C3OB 1U1EA 3DUFB 3GFPA 1O08A 3KHTA 4LV6A 4M53A 4IIFA 4OFZA 4C4ZA 1PL0A 3HBMA 3BXZA 3OT1B 4OL0A 4MI6A 3M3PA 1DAFA 2IUSA 1MIOB 2X76A 1PLLA 3QKRB 2HSJA 3KR9A 5LQUA 2C9YA 4OKSA 2ZRCA 3CCBA 1UK9A 4D92A 4B84A 1ZI6A 3BTUA 4Y6LA 3W3ZB 3I2JA 1FDRA 2EBHX 1IVSA 2XT6A 1US8A 3N0WA 2OVBA 1KBQA 1G6HA 5AVZA 4JJ8A 3CLTD 2VJLA 5FPTA 4MDYA 1KTIA 3QPCA 2PG3A 4PQEA 3L8EA 4Q21A 4DKXA 4F1JA 5BQ3A 2Z2ZA 3I32A 3LH5A 1R1DA 2HAEA 4PVCA 3GVHA 3GG2A 2CMKA 4KLRA 3DNMA 4CUJA 3ESXA 1BDHA 4EDHA 4M0UA 4WEQA 1AOXA 2JFXA 3IILA 4NJOA 4OUDB 4QDJA 3PWKA 3TBHA 4K1XA 3QQPA 2VTEA 2RGCA 4OXNA 5DHTA 1PGPA 4DWWA 1IJFA 4P4SB 1NKTA 3DEKA 4TTTS 3RI3A 2XB2A 2CFSA 4W5JA 4A8HA 3IELA 1F38A 4RORA 4EB0A 1Q92A 1OREA 3QF7A 1BQEA 1OCEA 2L18A 1PZHA 2Q8PA 1QCYA 3D02A 4RA9B 2CDBA 3GK3A 1ZN8A 4I5EA 3ZK8A 3O8BA 4QC2A 2E48A 2RCYA 4QOSA 1ODJA 1SXIA 4A36A 4H27A 2J5BA 1QH1A 2JEOA 2Z95A 3JSAA 1W2WB 4B7CA 1ADGA 2OUIA 2P6NA 5FPQA 4P31A 4YP9A 1GLNA 3EA5A 1NUQA 4EUSA 4HDRB 3M3DA 3GDHA 1ZHFA 5CFMA 3CIOA 1E7SA 3ITDA 1OX6A 3GMTA 3NTLA 3RH0A 5JS1A 3N1UA 3QU2A 3HBNA 4KOEC 5C1OA 4Q9KA 3LUCA 1YASA 4OHCA 2SKDA 3SFVA 4UHHA 3OLXA 4RIIA 2O48X 3CRNA 3CLSD 3GIWA 4FCTA 4X61A 4A8JB 4AJPA 1LTHR 1HNXB 4LYFA 4UW9A 1ZM3A 1Z45A 2HWUA 3H3JA 4GZ3A 1L7XA 2P2YA 4G4JA 1V3UA 4WY2A 4JLOA 3AJAA 5DWVA 2QLLA 5LZ9A 1JYFA 1PGQA 1FFDA 4KZKA 5KQMA 1RYMA 1NRXA 4GPAA 4JUCA 1ZH0A 3BDVA 2OO5C 3HJHA 3OURA 2O8BB 1UFOA 2IF2A 3PUWA 5B7PA 1KJ8A 5LQCA 1J2YA 3D6NB 1CW2B 3THYA 1A72A 1PBTA 1GKUB 1E6MA 1TLTA 1MO3A 2EIXA 1YR1A 2I4OA 2PAFA 2PGXA 3QTBA 4DQXA 5BMVB 4QQKA 4I50F 1C7IA 2UUAB 2GD1O 2ZBFA 1M5UA 4BNVA 4DJAA 2X0NA 2XWSA 1A0OA 5LZ5A 1GZ7A 4HQFA 3TAXA 1ORVA 3V3TA 3NOQA 4O2AA 2HF9A 4EEZA 5B3JC 2D6FA 2OXRA 2WABA 4HYEA 4H0NA 1EQUA 3V8NA 3VDRA 4DIOA 3P52A 1NUPA 4KK4A 4M0CA 1Q1BA 3SPXA 3SXPA 2IPNA 5KHOC 1S1MA 2C7OA 3QBEA 4I4TB 1E3IA 4LOHA 2Y0DA 4DEVA 1M2WA 3JQGA 3CNNA 1SVKA 4QATA 1ZM9A 1NE7A 4DR4B 2QTFA 4ISBA 4Y6PA 5A4FS 2DFVA 3F49S 3AJ8A 3L7OA 2X7JA 4WIAA 4LDAA 1L7VC 2CCJA 3K71B 1HG0A 3ELUA 3TBFA 3SKXA 3L6BA 3L0DA 2ZROA 2CLDX 5EQFA 3PJEA 3TLJA 4AX4A 3KJFA 3DL0A 1XLVA 1W581 1Z6XA 3PDIA 2VA9A 1PSZA 4B40A 2FXVA 1LX6A 2GBPA 2P62A 3LHDA 3TIIA 1Y3AA 3ESQA 3KJGA 2YXPX 2BFPA 5AR1A 5LZ8A 2AHOA 3I2YX 2PZAA 3L0OA 3AM5A 4TUYF 3L0SA 2YWXA 5BW5A 3PD1A 2O6LA 1JWBB 1OYVA 4LDZA 1SEPA 4BJ5A 3UY4A 4F1WA 5BUQA 4E7OA 4M9ZA 3M1YA 4TS4A 3UJHA 4BTVA 1H9CA 2JZCA 3GGSA 5D5PA 2A2ZA 2CL7X 1NVWQ 5AHRA 1SKYB 3GWZA 3L7IA 4L9SA 2GN1A 5JD5A 2C7PA 3M49A 2OTCA 4H1VA 2WAXA 5FL3A 4KIFA 4DAEA 5HZKA 2FN7A 2ZBUA 4C2TA 4FOPA 1C5KA 3QVGA 1QHFA 1RCTE 1YHNA 3C0KA 3K15A 5BMVF 1JLMA 4XJSA 4A6XA 3SF0A 3SE0A 3AZPA 4K8OA 2R2AA 4WCDA 2UUCB 1YDMA 1Q7GA 1N2IA 4F4JA 3OZEA 1K2WA 5DDIP 4OQQA 2Q5HA 2XE8A 1UBLS 1NZDA 5JSYA 1REQA 5GGYA 4XXHA 3WL3A 2AZ4A 1GAWA 2Y2VA 3WAKA 3SOPA 1GO2A 2IYFA 3GYBA 3D6FA 4JT9A 4O0LA 4PNZA 1PGOA 2PD3A 3OQ1A 3K6SB 5B3AA 1NU8A 4UNIA 3DMTA 1EP2B 3GIDA 2A59A 2VOEA 3W0LB 1M0SA 4YFYA 3W4IA 2IZOA 2KE5A 3WWYA 3ZNQA 1YI8A 3GUZA 4LVUA 5B37A 2YIJA 3NTQA 1R27A 3RUHA 1FDVA 2W9XA 2FQWA 4OSPA 1GSOA 3ZJ5A 1D8AA 3QNMA 4CM6A 3E5HA 1CP3A 1CS0B 1P2GA 1ZOSA 1SZDA 3QLEA 2GJSA 1DO2A 4X6XA 5DCYA 2WIFA 2KLBA 3RSZA 1OAAA 3CGGA 3V4VB 4B3JA 3LWZA 3QFFA 5IEBA 1TLFA 1IFXA 5GIOE 4OIFA 2VDKB 2J6HA 4GMXA 3IUEA 4OU4A 3AC0A 2HGSA 4O4LF 1VKJA 4Z86A 4Z7JA 2QE7D 2XEDA 1T9KA 2A0KA 1B16A 4J91A 5IT9A 4UBOA 3F6SA 1ZIPA 2P65A 1T9DA 5EKUA 2JZOA 3GLHE 3OIFA 3IAUA 4IDPA 1SVLA 1WUTA 1GYPA 1A2KC 1H0HA 2BY4A 5AK0A 5DSXA 3VU8A 4Q48A 4ZK6A 1CTQA 1N1MA 1GGNA 3PRJA 4EY8A 1CVIA 1WR8A 4DNOA 2GJAA 1XJWA 1AX9A 2NT3A 2YJGA 3PHJA 4QFDA 2QBYB 2FQ1A 1AKRA 3F6PA 3O4VA 4I6GA 4ETNA 3OF3A 2HNAA 4IM7A 1ZSYA 1CVRA 1NPYA 4EGQA 3KYIB 1Q22A 1EFAA 3HFGA 3JZAA 3PXCX 4DPMA 4R01A 3HXPA 3PC4A 4GXNA 3RFFA 3SZLA 3QUBA 3H19A 1Q1QA 4GOKA 4Q9LA 1YOVA 2O6HA 1F0NA 3TG8A 2I67A 1KRHA 1VZ3A 3N8HA 3T4PA 5EHZA 2AUNA 1CRZA 2G77B 1UEJA 1UMCA 2OPHA 5TC4A 5TQ0A 3KQLA 4WKNA 1W93A 3J81k 1KO1A 1VIMA 1X86B 4HADA 2JAXA 1DCKA 1T29A 4NNJA 1TPZA 3JVVA 5FUYA 2CHVA 3DTVA 3DJFA 4JJ7A 2QRLA 5KWEA 4W82A 2GN6A 3DTTA 2NVUB 3ROQA 4DABA 1WZCA 4AJLA 4BHTA 4GKBA 3D81A 4LRXA 4V1CA 2HBYA 4XQ0A 3OZSA 5ICFA 4ITUA 1HGXA 5THQA 3OZBA 4B8ZA 4MA0A 4UEWA 3D2LA 2AK3A 3M6LA 1KPIA 1NX9A 5AVVA 1YB6A 2ZAYA 4PLPA 4RLSA 3RRJA 2C1ZA 3ANTA 4PLZA 2EBWA 2F3TA 3ESAA 4N40A 4KI0A 4O29A 2E4YA 3RKRA 4DFDA 4RD4A 1RW4A 1EDDA 1KJJA 2WE7A 2FRDA 3FPEA 4CKBA 2YIVX 1VC2A 4PYRA 4PINA 5E6UA 2VQSA 1BE6A 3EZLA