2P65A

Crystal structure of the first nucleotide binding domain of chaperone clpb1, putative, (pv089580) from plasmodium vivax
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
185
structure length
185
Chain Sequence
QALEKYSRDLTALARAGKLDPVIGRDTEIRRAIQILSRRTKNNPILLGDPGVGKTAIVEGLAIKIVQGDVPDSLKGRKLVSLDLSSLIAGAKYRGDFEERLKSILKEVQDAEGQVVMFIDEIHTVVGAGAVAEGALDAGNILKPMLARGELRCIGATTVSEYRQFIEKDKALERRFQQILVEQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PF08_0063
total genus 67
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p65A00
5KTYA 2ZRCA 1W0KA 4LV5B 1UPTA 2OXRA 5CYOA 1VKJA 4YDHB 4TZ0A 3KTAB 1G7TA 5KSPA 3GJ7A 4WOPA 4V0MA 4CGZA 1JNYA 5KO2A 3U4QA 1SXJB 1W4RA 4Q4HA 2VP9A 3LX8A 5FOSA 4TYPA 2LWIA 2FG5A 3KJIA 5GJVC 2AX4A 1DARA 2NQ2C 3FPAA 4ZCLA 3K9GA 2ZYVX 5CK4A 1IHUA 1JQLB 3T1TA 5AUQA 1DOAA 4PZZA 5CM8B 4QBHA 4NYJQ 3QKRB 1HURA 3EG5A 1M1YE 4YDSA 1PZNA 1XU4A 4NCIA 5JJIA 4A0RA 1XTSA 2ZTSA 1LS6A 2W58A 2ERYA 1FPMA 3AF4A 2ZI6A 3CNOA 4JMPA 2O8FA 1FUKA 3GFPA 4ESHA 1HE8B 3M1IA 4BZQA 2OBNA 4KAXA 2I1QA 2RGBA 4LBVA 1UKZA 3QVUA 2J0QA 2PZEA 2ZRFA 3TUJC 5H8WA 1KHTA 1H8EA 4OQFA 5ELXA 2OAQ1 4AYXA 1JR3D 1N0VC 2JDID 1EFCA 1QHYA 3UG6A 1S96A 3GLHB 4RFSB 3U3MA 1E2MA 4MGZR 3Q7QA 4DBLC 2X2EA 3CWQA 1OF1A 3CB4A 3CRRA 4CT5A 4B3GA 3IIKA 2F9MA 1YQTA 2WBLC 5KSZA 3X1DA 3NKVA 2CHVA 1SKYE 2FV8A 1P2SA 1X8LA 3MG9A 4QGAA 3T15A 2I1VB 1RVDA 2JJ2D 5D3MA 4OI0A 3TMKA 2G88A 4TQUS 3C16C 1E2JA 1E32A 1KO4A 4PZYA 2VP0A 1ZJ6A 3E5HA 1OW3B 3LV8A 1CJVC 1DS6A 1Q1BA 4QGFA 2V55B 2QENA 2WIAA 3MGCA 1TL7C 4PZLA 2HT6A 5F98A 4ASUD 1CBUA 2ZR0A 3NBYC 2WKQA 1TUIA 4BFWA 4LDJA 1BH2A 4RCYA 4D6PA 1GILA 4HAWA 1AZSC 1U98A 2WJIA 421PA 3UWOA 2F3TA 2C77A 4Q47A 3CNLA 4BFVA 4OI2A 4UNNA 1N6KA 3EPHA 1ZBDA 4J0QA 2QGNA 3LY5A 3K09A 1JXMA 4PAMA 2QAGC 3B1YA 4MYCA 3U5ZB 1QG2A 2P67A 3QKSB 4PHFA 2BKEA 2H16A 4A1FA 1ZM4A 2FSHA 2CXXA 1H65A 1OIWA 2ZE5A 2ZRGA 1E1RD 2OO7A 1ZP6A 2J3EA 5DH9A 4R71A 1MABA 721PA 3B13B 1MKYA 5IK2D 5AJYA 2WSSD 3W34A 4I1OA 5FOTA 2YYZA 2Z83A 4OHWA 5IRCD 3QXSA 3SI7A 1T4GA 4Q66C 2NPFA 1Z6GA 2CVHA 2ZSAA 4CW7A 3VR1A 2GZDA 4P0TA 3GP8A 2D7DA 5G3ZA 2JLYA 1Z47A 2J0VA 2QMOA 3BRWD 3GJXC 4ZDWA 5KPDA 4QBGB 1P6XA 2WOOA 2R65A 1W36B 3QKRA 4A8JC 3MWKA 4CF7A 1DELA 4XVUA 5JRZA 1D2EA 1TQDA 3QUSA 5J47A 2D7CA 3BFKA 4IXMA 2HF9A 1U0LA 1E94E 4AKIA 3A4NA 1E2NA 1KY3A 3RS7A 3W5JA 1T0HB 2CE2X 3U3RA 2W2TA 4KSBA 4NYMR 2FEMA 1KK1A 3R7WB 1HE1C 4XSGA 4QNRA 1N6NA 3TGPA 4C0BA 4K46A 1Q3HA 3GPLA 1DAFA 3W8RA 4IFEA 1WBBA 2QMEA 5HCIA 1N0WA 3Q3JB 5IK2A 2IA5A 4DDWA 2ZE8A 2QL6A 3AKCA 4XVRA 2XOKA 3NC0C 1CEEA 2FZ4A 2Z43A 3ZZTA 1G3QA 2UZIR 1IY0A 2A5DA 2XJ9A 1A5TA 3VR4A 1GVNB 2WKRA 4Q1FA 1Z0FA 1U0HC 4KCGA 5H70A 2CL7X 3WNCA 2PBRA 1OH7A 4GP7A 4F92B 2Z4SA 3UMFA 4BFXA 4F93B 1ZC4A 3QIAA 3RNLA 4C0SA 1FOEB 1P2UA 5GJBA 1VCNA 4IEIA 5FUXA 3T06B 4WA7A 4TSFD 4HAXA 1Q44A 3RAPR 1ZRHA 1Z22A 4B44A 1E6CA 2IYLD 2YVUA 3M4YA 4ASUA 5JI3E 4V03A 2H8KA 3HPRA 3VAAA 3MWJA 3K0EA 4AKEA 1YKSA 3B1XA 2WWXA 1GWNA 4LHYA 3U7FB 1W46A 5JJKA 3AVOA 1DBSA 3G82C 4D81A 4EPRA 1BYUA 3PITA 2XNSA 1VECA 1U9IC 3AVUA 4LJAA 4ZKDA 3W6NA 1Q3TA 4IFBA 1G4UR 1KGDA 4Z8YA 2GETA 3QEOA 1IXZA 4PC1A 2GVDC 3I73A 4HDQB 1JB1A 4PTLA 4D0GA 3O8BA 1GNRA 3ZDQA 4KHZA 4DKXA 5A4JA 5HTKA 4BLTA 4ZCMA 1IN8A 1XTIA 3TNFA 1RRCA 3NG1A 4OQNA 1VG1A 4LHVA 3GJ3A 3O8DA 1CJMA 3B82A 3DMDA 3QF4B 1R8SA 1L4YA 2XZPA 2XAUA 4DZZA 3EAQA 1N5IA 2WJHA 4A0GA 2WKPA 1RPZA 2RGXA 1N2CE 5DSZA 2ECKA 1E0SA 1VDZA 5KDDA 1XTJA 2BCJQ 1VIYA 1C1YA 1G3IA 4B6EA 2WOJA 1GRRA 2BCGY 3FKQA 3FVQA 2GK7A 3ZGXA 3L0IB 3EASA 3BB4A 2OHFA 1UKVY 1TUEA 4NYMQ 4AYWA 5J40A 1D2NA 4JLAA 2A9KA 4ZKEA 2QSZA 4QHTA 3C15C 3HJNA 3OEHA 5AUPB 4LGMA 1N3BA 5E3HA 2W0MA 3PEYA 5J5CA 2FEOA 2B7BA 2ZI3A 1XCPA 1AIPA 4EDHA 3Q9LA 1KSHA 1VMAA 1S9DA 4TTRA 3LX5A 3KXKA 4M21A 3SJBA 4CT4B 1YRBA 5K8LA 4JVMA 1PVOA 2XNDD 1DPFA 2VH5R 2NO1A 5AWFC 1W2HA 2IUTA 1KK3A 1OB5A 4NYIR 3D31A 2CJWB 4FI3C 4LC1A 1JR3E 4M53A 2VYFA 1P9WA 4S35A 4YQFA 4Q9HA 1E2LA 3EW9A 2R62A 5CB6A 4XJXA 4OJQA 4ZO4A 4BFUA 4B2PA 4ARZA 1GKIA 4B74A 2OLKA 1N0UA 3A1SA 5FOVA 2H17A 1OH8A 4U00A 4LYFA 2D4HA 1E0JA 2HXSA 5FUVA 5CIQA 3A36A 1GKYA 5L3RA 1HT2E 2GJ9A 3B1VA 4I99A 4MITA 2IYTA 2ZJOA 1OB2A 2CCJA 4D0NA 2QNRA 2PLFA 4BRWA 4IOJA 2OCAA 5DYGA 2EYUA 3W6PA 2P5SA 4JLBA 1GDDA 1G6HA 2Q3MA 1OXUA 1G8HA 2RH5A 1LW7A 1Z6TA 2BBTA 4IOMA 1NY6A 3AVVA 2DWPA 3WNBA 1N6OA 5DI3A 5E7JA 2GCOA 3B85A 3FFAA 4HLUA 5JS7A 1I4LD 1R0WA 1E2EA 4P33A 4P4SA 4Q9IA 4RSGA 4UXIA 3VKGA 4DLSA 1VYTA 3LDAA 1PJRA 1P61B 2NIPA 1BIFA 3Q7PA 3IUYA 4RD0A 1A1VA 4QRHA 2ZM5A 1AJEA 2RGDA 1SULA 4HB2A 2QGZA 5EZ6B 4BFTA 2O8DA 3CH4B 2GWHA 3EZ9A 2WZQA 2JEOA 4E07A 1E2GA 4UXHA 5HKKD 3IIMA 2VA8A 3NDBB 4TLAA 2EFHB 3GEIA 2IYZA 1QRAA 2QT1A 2HEIA 3QBVA 5DGXA 4DB4A 4MRSA 3LW8A 4GNKA 3QXXA 2QUZA 3AM1A 3AVWA 5KOYA 1NN0A 1KK2A 2XXAA 3EIQA 2L0XA 4S2EA 5E4FA 2G77B 4TL6A 4NKRA 4IDQA 1Z0JA 3F3YA 2A30A 3TIFA 3WP0A 2DFTA 4ILEA 3SQXA 4URXR 4A2QA 2QBYB 1NVXQ 1TPZA 2REOA 2F3RA 4EPYA 1SXJA 1UBCA 1S1CA 4GDFA 4HLQB 4YXWD 2DFKB 1E9RA 3K1JA 1W5SA 2BIFA 4B3DA 4B33A 3PQCA 3EC1A 5F3WB 1TAGA 2BBSA 3BFVA 3TUIC 1E9SA 4Q01A 4RJLA 2ZRHA 3LLUA 4G5SA 3WMGA 2ZJAA 3UATA 5F9HA 4LSGA 1F2UA 4BFZA 1Z08A 3D3QA 4NCJA 2ZYTX 1XD2A 1XPUA 3AKEA 3T1VA 5L3QB 1KMHA 2C2HA 2VRWA 2E87A 4R2HA 4X8HA 3REFA 4TYYA 3HU3A 2JLQA 1I2MA 2UVQA 2G9NA 1XEXA 1CKEA 3VX3A 2ZJYA 4EAQA 4FIDA 1N6RA 1P62B 5TV2A 3ADBA 2F1JA 3IDQA 1HUQA 1X6VA 4CVNA 1G18A 4NDZA 3LWNA 3LRPA 5FPTA 1CIPA 2VHCA 1II8A 2WTUA 1ELOA 1JAHA 1KJWA 1HEIA 1K6MA 1KMQA 3PV0A 1US8B 1QBKC 4DT1A 1AS0A 1W1WA 1W4CA 2JJ1A 4UNPA 5HPYB 3KJGA 1NJGA 2WJVA 1XRJA 4GOKA 3RDPA 1RE0A 3HU2A 4GZMA 3NHBA 3I32A 1CLUA 1E2HA 4L5BA 4PQRA 3U7HB 4M0LA 5J4HA 2J7PD 2R44A 3QY0A 4US2R 3OZXA 4GT1A 4MDFA 4KVAA 2FFBA 5M04A 3PCRB 2PZGA 1B23P 4NP6A 4A36A 2CDNA 1BOFA 3OE7A 4C3ZA 3KKOA 1XMIA 2FSGA 2WWHA 3RHFA 5EXXA 3T5DA 3T12A 1X86B 1NN5A 4XWAA 3I4LA 4R9UC 2CHGA 3ND9A 2J5XA 1FX0B 3P20A 2QT0A 4Q4AB 2WPDA 3OIYA 1NBMA 3GLFB 1ONBA 3BK7A 2NGRA 1W36D 4DUGD 3L8ZA 3BH7A 4LX0A 3CX8A 1MV5A 1YHNA 1KOFA 5SZJA 1G5TA 2OSBA 2D62A 4Q1DA 2KBFA 2ORWA 4Q9KA 5EE0A 3SC3A 2H18A 2F1RA 3K0CA 2BWJA 4G01B 2C5LA 2AHOA 3HU1A 2R6DA 2VF7A 4NCKA 4Q02A 5C46F 2HV8A 2MMGA 2CNWD 2H57A 4EUNA 2P6RA 4JLNA 2ZI9A 1KKLA 2QP3A 2QTVB 1OYYA 3PIRA 1G17A 3CO5A 3SYNA 1DAMA 1M7HA 1Q20A 1TF7A 1AGRA 3H84A 3FMOB 2Q3HA 3KKQA 2GJAA 4QJ3A 2NMVA 3BE4A 1VG9B 4URYR 4RZ3A 4D4MA 3PEVA 2FN4A 3GLGA 3ZVMA 5FR2A 1SVIA 3BH0A 1VHTA 3IIJA 5A5GA 5HCNA 4XOIA 2GESA 3KB1A 4Z8XA 5L3SA 2X1VA 4HEJA 3OF5A 4G3XA 4MUAA 1GAJA 2IXEA 1EGAA 4DRZA 2XX3A 4PC7A 4WVFA 2NO7A 1OT3A 4EIWA 1HQYE 1AM4D 2WMNB 2J45A 3BB1A 3BERA 5D3QA 2AFIE 1TF2A 1KDOA 2W6JA 3Q5EA 3PXGA 3SYLA 1E69A 3QJYA 4QL3A 3WRXC 5CLQA 3ICQB 1W5TA 2FGJA 1FMLA 1XEWX 1WRBA 1CRQA 1XXHB 2EQBA 2W6IA 1EFRA 1OKKD 4DSNA 1UBEA 3ADKA 1KMHB 4GZLA 1KO7A 1TQ2A 2FPKA 5FUWA 5FPYA 3ZVNA 1JAIA 1NJFA 2Q9CA 2WICA 4PX9A 5BQ5A 3IKJA 1KZ7B 1RRGA 1E3MA 3LBIA 1FTSA 4PHHA 2C8VA 4JL5A 5ANRB 1XD9A 2PT7A 4MKHA 1YR6A 3F5FA 1R0ZA 5FBWB 5KNCA 2FX3A 4BWYA 1CR4A 1IN4A 1ZUIA 3B78A 1ZUNB 3OEEA 3LVQE 4RKEA 3KZ1E 1EXMA 1NN1A 1HH4A 2V3CC 1GOTA 3R8FA 1GRQA 2ZXUA 3K8YA 2D2EA 3GFOA 4A6PA 1UM8A 2B6HA 3OE7D 2QROA 2WIBA 2QRNA 3GQBA 4FW9A 4CRWB 3ZZUA 3C5CA 3MMPA 1OSNA 1QHGA 2ZVQX 3OHMA 4KBFA 4E5UA 2P65A 4F4CA 3PEWA 2JJ2A 1W2GA 4HDCA 2WWFA 2O8DB 3QENA 3R9WA 2PEZA 4QGHA 4DSTA 5BWMA 1UEJA 3M6AA 4B75A 1XTKA 5TVKA 1AKEA 2X19A 3CWZA 4XTCS 2IYWA 3FKSD 4AG6A 1S3SA 3CR8A 1MT0A 2GCPA 4BEJA 4POAA 1EFTA 3F8TA 1BKDR 4WAUA 1P5ZB 4JVNA 3PUZA 4JLMA 4OHVA 5BW8A 4AWXA 3AV0B 3VHLB 2CCGA 2PX0A 3QKTA 4W5WA 3RABA 3VKWA 2EU8A 3CIOA 1UDXA 4G5QA 2DBYA 2HDNB 2ZSEA 3NXSA 4TN1A 3ZYCA 1Y63A 2P5TB 4EJSA 3WBKA 1Y3AA 2A7QA 5FTNA 3WYGA 5JSZA 2BVNA 1CR2A 1ZM2A 3L0SA 3NBZC 4LYHA 4Q1AA 3VR6A 2HJVA 3U6BA 1L8QA 1Q1QA 4HAUA 4IJMA 4Q1EA 2C04A 4TYWA 1OKKA 2DPXA 2YC4C 5C2JB 2RCNA 2WPDD 2JJ8A 3WXMA 1N6HA 3EZ6A 5CIWA 3TSWA 5LB2A 4OJKA 5D3MB 4PSVA 1MRNA 1WA5A 4D0LB 2PLRA 1DTSA 1R6BX 1G3MA 2CLSA 2ZYUX 5TMPA 4A2PA 4JBWA 1M8PA 2FFAA 1MABB 2Z0MA 4M9QA 1CULC 4PXAA 4TLEA 4P32A 2IX3A 4QHYA 3R8CA 4HAVA 4HLUC 4MYTA 2ZI7A 3FDIA 5DN6A 4ACBA 1Q22A 821PA 3X1ZA 2WMOB 2GKSA 1D5CA 1A82A 5K8IA 1KKMA 3V4FA 1AA9A 3VQTA 4MDEA 2R2AA 1XJ0A 3LXRA 3TSOA 4B2IA 2O0HA 5JFGA 2ATVA 3KUCA 4LI0A 1XFAA 3IHLA 5JEDA 1O3YA 3FMIA 5B2ZA 1NL3A 4GOXA 4EPWA 2OILA 3QQ5A 4TWZA 4KU4A 1W7AA 4I81A 5EE9A 1NIPA 2EWWA 1W4AA 2NO6A 2RKOA 2ANCA 2AK3A 2GRJA 3DL0A 1E9BA 1QDEA 3PJRA 2A78A 4Q48A 4IRUB 2GVZC 2BHRA 4RKFA 4DIDA 521PA 4Q03A 4EPTA 1QZXA 5IF9A 2JATA 2ZJ5A 1OXSC 1ZNZA 3CKLA 1YR8A 4QJ4A 1D2MA 2ORVA 5E95A 2G6BA 2I4IA 1QHNA 4TLDA 4DHEA 5C4MA 2A5FA 2QAGA 1OYWA 1FQJA 2DR3A 2B21A 5FBLB 3TRFA 3AKYA 4LRWA 1CU1A 3THOA 4DDUA 4Q4AA 2OZEA 4MUBA 2QE7D 2WWWA 3IQWA 3HYTA 4MQBA 4KFSA 2VP4A 3UWKA 4LV6A 4PR0A 5TB5A 1E1QD 1JJVA 1I2DA 1OFHA 2LCFA 3RS0A 4AK9A 5EZ5A 1J90A 3VMFA 2EVWX 2JLSA 1J99A 4DCVA 3I92A 5EUQB 2A3RA 2WWIA 4E03A 3U7EB 4L8GA 3EC2A 5L3VA 4NHOA 1E2IA 3FMFA 3FTQA 4M22A 4WZAE 4B35A 1LF0A 3R20A 3GJ8A 3E1SA 1PUJA 4G5OA 3CPHA 1NVWQ 2QORA 4GMXA 1G6OA 4PAQA 4DLXA 1EFUA 1E9EA 2MSCB 2NPIA 2RMKA 1I4TD 3MD0A 4M1YA 4ZPXA 5AK0A 5H68A 4Q7JB 2IUSA 4OI4A 1L7VC 3NH6A 3SU8A 3U4QB 3S1AB 4HB0A 1IQPA 4B34A 4JLPA 2FPLA 5E7MA 4NH0A 4MYUA 1U8ZA 1Z2AA 3NBFA 4CEHB 1Z0KA 3OFNA 4XH9B 5JWHA 2IL1A 2QTHA 3DKVA 3B2EA 5FI1B 1M7GA 4QXAA 3SOPA 1D8TA 2QI9C 1VTKA 4DSUA 4A2WA 2JDIA 4FXPA 3RC3A 4M9ZA 1LTQA 2QE7A 1M6NA 2RGGA 3K53A 1A7JA 4RD6A 4R7ZA 3A1WA 2C9OA 2FPMA 2CL6X 2PX3A 1DVRA 4M2LA 1DG3A 2FSIA 4DC9A 1YZKA 5GADl 1E4YA 2IYQA 4URWR 4P31A 4L4UA 1SVLA 4XWOA 4H9GA 2ZJ8A 1NIJA 1P9RA 1V5WA 4HI0E 3LBNA 3SHFA 5FBVB 3AGQA 4XVQA 2OE2A 3HPQA 3B1WA 4KSCA 4GSYA 1K5DA 3Q8XB 1NP6A 3TBKA 3TVTA 5BYKA 1XJCA 1EESA 2ZSBA 1RJ9B 3RRMA 3KL4A 4JKYA 1LV7A 4YONB 3GLFE 1RIFA 1GL9B 2AR7A 2BOVA 3EPKA 1ZC3A 3A4MA 4K8OA 2GXUA 1WXQA 3H86A 1RKBA 4DWJA 1DEKA 1NKTA 3RS5A 3B9QA 1NVUQ 2C9CA 2FWRA 1KI9A 5FI0B 2XNDA 2DFNA 1XBTA 4JYCA 1KAOA 2CBZA 2BKUA 4WZBE 2Q6TA 1NMYA 2O0JA 5FOUA 1T0JB 3ZJYA 1KSGA 3U44B 3A1UA 3L0OA 3VR5A 4QKQA 1H8HD 3VKHA 1FMJA 2OEPA 3C41J 3WYFA 1U99A 1JALA 1SVMA 1XCMA 2V7QA 4DDTA 4Q9LA 4NZYA 2GXAA 1JI0A 4JZKA 2O0KA 4OBEA 1Z6YA 3RRYA 3T35A 5EE3A 2G0TA 4CZ2A 3AH8A 4HDOB 3FGNA 1J70A 1SXJC 4OHZA 1G8YA 3NC1C 1ZIOA 2O8FB 4PPQA 1NBME 4QG7A 4V0OA 1NLYA 2XXAB 2YWGA 2CNWA 1R0XA 2Q0HA 4RZXA 3I5YA 1F2TB 1DAGA 1Z07A 1FNMA 1FZQA 2ODWA 3CX7A 3OEED 1JJ7A 1U2RA 5FPSA 5G40A 3ZS9A 3GLHA 4RFSA 2ZS9A 1NVVR 4Z1MA 2VP6A 3TSZA 3BGWA 4EPVA 3BJIC 1NNEA 2Q9AA 1KTVA 3BBPA 2G0NA 3L43A 3KQHA 3PUWA 3TE6A 1GZSA 1G64A 5FR1A 3TVDA 4LJYA 2CJWA 1G9XA 5EP1A 1SVKA 2UZ3A 4TZ6A 3DKPA 2YC2C 2ZSFA 3RRZA 3GJ4A 2FOLA 2JLVA 3PG5A 2O8CB 2JLRA 4C0QC 4KJZA 2GCNA 2CLDX 4HAYA 2IYVA 4AYTA 1T8TA 1DAIA 4OK6A 3TAHA 1E2KA 4PC2A 4GL2A 4U5XA 1HYQA 3W9YA 3AVQA 3AVXA 1KI3A 3KQUA 1XX6A 2CEAA 4TL7A 5HR5A 4LHZA 1OH6A 1M34E 3RSOA 3GFTA 1WB9A 2IYYA 4D80A 2XSZD 4URZR 5FL3A 1E2DA 2OG2A 1II8B 3P4YA 2V1UA 1NI3A 3CRMA 2AKAB 3A6PC 5FBRB 4DIEA 2BBOA 2EFDB 4C30A 4B71A 5FTJA 3VR2A 3EIEA 1QG4A 2BM0A 2FU5C 2JLZA 1E2QA 1GKUB 2BV3A 3MAAC 3ZIAA 4UNRA 5LD2B 4Q00A 4XWKA 1X1RA 5F2EA 2WVJA 3QKSA 4G5GA 4F38A 1P73A 4DXAA 4N3NA 2GDJA 2ZR9A 4HUQA 5KNDA 1J8MF 4L9WA 4Q7KA 1SHZA 4BLRA 3L0PA 4KODA 2VHUA 3DEFA 4XIGS 2OESA 1S2MA 4V0LA 2YJTD 3QPVA 4LPSA 3T5GA 3EPJA 2BC9A 1E2FA 2ZJBA 2ZAOA 1G7CA 2IHBA 2OFXA 1T9HA 3EA5A 2IBMA 4JKIA 4C0AC 3DPUA 1AZTA 1XPRA 1XWIA 4LJ5A 1I4DD 2WJGA 3SFZA 2QSYA 2YINC 1Z0DA 4R98A 2ZS8A 1KSFX 4G1UC 5K8UA 2QMHA 3GEHA 4KYIB 4FCVA 1YZLA 1YZUA 5FOXA 3M0EA 3W3ZB 2QAGB 4MKFA 3QXCA 3F0TA 2VSFA 1II0A 4V02A 2PZFA 5K8TA 2NO0A 2D74A 2GJKA 3OFND 1T3LA 2YWFA 4M1SA 3NTUA 4LYAA 2QBYA 4DCUA 5AR1A 2PCJA 2HXYA 2FDCA 4JJZA 4UXJA 3FB4A 4OK5A 1XZQA 4BZPA 2VSXA 4JBXA 4F4JA 4YMWA 1WMSA 3REGA 1YZNA 2G3YA 3LQQA 3OIVA 2IWHA 2V54A 2VP5A 2N46A 1D6JA 3BH6A 4Q5IA 1VIAA 2ZPTX 3NWJA 2AWOA 2QMUA 4L15A 2YOHA 5SZHB 1AKYA 3W3AA 1P72A 2PCLA 2GBLA 2ZI5A 2J87A 3NEJA 3OESA 4LJ6A 4Q1CA 8OHMA 1S3GA 4QBFA 1E9FA 5JHGB 3PFIA 5KYKA 5LDDC 2VP2A 1KDTA 1G5PA 1CF4A 1FP7A 2GHIA 5UKDA 2P6UA 1NSTA 4B32A 1S9HA 3IGFA 4Y0AA 2XB2A 2DYKA 1N5LA 1F2TA 4CEHA 2IS4A 4YMSA 1PLKA 1TQ4A 2K5UA 1G5RA 1Q57A 4PANA 3U6KA 1US8A 2FFHA 4JYBA 3SFVA 1HTWA 3QI2A 4M9XA 2IS1A 3E2IA 1ZMXA 2ZQ5A 1KNXA 2F1IA 5B64A 2V4ZA 4EPXA 2NOAA 2J59A 2RB4A 3GCGA 5KHOC 3ONWA 1KI4A 3LW7A 4Q18A 1R10A 2FH5B 5GVRA 2YKGA 5JBQA 1VCIA 4O2LA 1GFIA 4D2IA 2C96A 4DCTA 2DCUA 1RYFA 2H7VA 2VLIA 5CM9C 4AURA 4LYJA 3RVBA 4AKHA 4NYIQ 1JEEA 5SZIA 1W48A 2ZS7A 4II7A 4NTZA 4BQSA 1WF3A 4NONA 4O3MA 1KI6B 3L2OB 1HV8A 3FE2A 5TXGA 1KI8A 3QVVA 5C4GB 3CONA 3MJRA 4HATA 4BFSA 3AF2A 2FSFA 5AJWA 4TMKA 5TARA 2RGEA 3CBQA 4WBSA 2CK3A 1X8KA 3KKNA 4OQLA 5EXTA 3SYKA 5HZKA 3CW2A 4A15A 3SBEA 1Z0AA 1E1RA 1LFDB 1LNZA 1VG0B 4PC6A 5KDLA 4M9SA 3G5UA 4V0ME 5EP4A 1PUIA 1Q0UA 4JL6A 4LV8B 3I8SA 3C14C 2AFHE 3T61A 3OEHD 1EFHA 4YXWA 1OFTA 4KVGA 1ZM3A 5JCZA 4KI0A 4B47A 2ZRPA 3DO6A 4M4SA 2KBEA 5AUNB 3ADDA 2Z5FA 3DOEA 4TTPA 3GD7A 1WP9A 3T34A 1VG8A 3LBHA 1QHSA 1W44A 2B8WA 3X1WA 2OFOA 3ECCA 3WHLA 2VIIA 3KQKA 3SE0A 1TADA 5JMTA 1FNNA 4NE2A 2Z6VA 3RS3A 4BFYA 1E0KA 4F7WA 1MRSA 4AIIA 4HZIA 3D6TB 3I62A 3WP1B 4KBGA 3K9HA 1IN7A 4PPGA 2AWNA 5AJVB 4FMCB 5CB8A 4PPFA 2ZRKA 1ZD1A 1RW4A 1P3JA 3BC1A 3OIWA 2Y8EA 5JJLA 2I3BA 3FHTA 3K0SA 2DB3A 1XMJA 3TQCA 2RHMA 4JIMA 2AXNA 4B3FX 3T1QA 3IBGA 3C7KA 1UJ2A 1F6BA 2XZOA 1NSFA 2PT5A 121PA 2RGCA 2ZITA 1T91A 2VF8A 2GTPA 4LC0A 1NKSA 4RZUA 4YC7A 1CRPA 2EYQA 4ZDIA 1S0UA 1V43A 1DAHA 2GBLC 5CLLA 4JT2A 1SVSA 3TUZC 3CR7A 4AY2A 1T5LA 1KI2A 3IPYA 3VX4A 3AF3A 4V0KA 4N0DA 4HZUA 2VSOA 3GLIB 3KJHA 4NCNA 2LKCA 2IYXA 4MGIR 1G1MA 1M2OB 4IXNA 1RRFA 4W9MC 4EJSC 1G3UA 4M1KA 4RD4A 4K81B 4ZDKA 1T5IA 3AUXA 3NBXX 1G16A 5C18A 3JVUA 4P4SB 3ICEA 4M1MA 4IDPA 3KQNA 2YNMA 1E1QA 2PJZA 1RRPA 2J0UA 2IEYA 1MH1A 2ORIA 1SGWA 3L82B 1WCV1 3PUXA 4LOAA 3V9PA 4LBZA 1KO5A 2EWVA 3H0KA 4DB2A 5CJ2A 1XB2A 2OBLA 2P3SA 2WAXA 2ZRIA 621PA 3FMPB 1OE0A 3QBTA 4BLPA 3AB3A 1GUAA 2ZANA 2VHQA 5IDVA 4EQ6A 1DO2A 4BEBA 1W0JA 1VYUA 3A1TA 3A8TA 1A4RA 1W4BA 3FYHA 3KXLA 3RC8A 3U61B 4M1TA 2IYUA 4HB4A 2CK3D 1XPOA 2DWOA 2YWEA 4A6XA 1Z2CA 3CRW1 3SZRA 3P1JA 5DHFA 4OI1A 1PLJA 3K0FA 1U81A 3N2IA 5DI3B 2H5EA 3K9LA 1N5KA 4ACAA 1VCMA 4IOLA 5DHAA 4C9BA 4QOSA 2XB4A 4LBWA 1KO1A 2ZETA 4MRVA 4A82A 3ZVLA 3UPUA 3VU9B 4KXFB 1U0JA 2VEDA 3AP3A 2OCYC 3RLFA 4G0NA 3BORA 4NPHA 2HT1A 1FP6A 4QFMA 2ZRAA 4ZI2A 2HF8A 2KWIA 1AS2A 2ZSDA 3H2YA 4TSFA 2R8RA 2FE4A 5KNBA 4CEJA 2JLUA 2IS2A 1QHHB 4P4TA 3K70C 3SBDA 4FD2A 4DLUA 1T3SA 4PPNA 4C4PA 2N1BA 4X8OA 2QPOA 1G8GA 5DN6D 3CRQA 5CJPA 3QPUA 4R2IA 1COWA 4L16A 3TJZA 5IHPA 1XEXB 1G20E 1YZGA 5DLQC 1KY2A 4P3YA 4LJ4A 2BJVA 3I1FA 3QG1A 1ZIPA 2ZIAA 2EFCB 5CDFA 4DCSA 5J4KA 4CEJB 1D9ZA 3TKLA 3WMFA 3KQLA 2IS6A 1E99A 1N6PA 3PENA 2XOKD 3VNVA 1NF3A 3X1YA 4LK2A 1ZYUA 5FFMA 4FWTA 1G4AE 1L2TA 4D4JA 4B43A 2IUUA 1W36C 1Z63A 4KO8A 1E9DA 2IXGA 4A8JB 1S4QA 2ZRMA 2XJ4A 4I4LA 4TT3A 3KXIA 2J7PA 3AF0A 2VO1A 3N5CA 4FMDF 1SZPA 5EP2A 3DM5A 3K0AA 1XD8A 5P21A 2NZ8A 5EXPA 1GTVA 3SJZA 4F4IA 1ZUHA 5E7IA 1XP8A 1YRAA 4AD8A 4PAOA 1DAEA 4MA4A 4US1R 2QP4A 1ODFA 3U3OA 4MRRA 3RS2A 1OIVA 2NTYC 1GL7A 3C4JA 2ZYWX 2F7SA 4P4UA 4A9AA 2QM8A 1G21E 4BECA 3U60B 3ASYA 4IOKA 2O8CA 3BS4A 3K0AB 3I72A 4XD7A 2WHXA 3ETLA 2CE7A 5IT5A 3CZPA 2GK6A 2R6AA 5DO9A 2O52A 4DJTA 1IBRA 1FUUA 1D9XA 3SDZA 4DLZA 1R0YA 4LBYA 3KB2A 4TT3D 2Q21A 3SR0A 2RHDA 5CDFE 3RYTC 2QRZA 3MJHA 1Q1ZA 5SZKB 4GBMA 3B8HA 3MFYA 3CUEF 1UBFA 4CYMA 2CVFA 2IYSA 3MSXA 1TU4A 4O2RA 4MGYR 4Q19A 1NG1A 1SVWA 2AKYA 2DFLA 3KKMA 3S1AA 5FOWA 4PSAA 2ZRLA 2RGAA 3VNUA 5JLJA 3R9IA 4ZIRB 1E4VA 2IYRA 5HE8A 2O8BA 2ZRBA 1H8ED 2XTMA 3O47A 2ONJA 4AG5A 3SJCA 4B2LA 4ARZB 1B0UA 1OHHA 3EZ7A 4FMBB 3IBYA 1XCGB 2FNAA 4BLQA 2OT3B 3GMTA 1ZVQA 1N6LA 3GJ5A 4A0HA 1BMFA 5JHHB 3BAFA 4XD7D 2MSDB 1LVGA 3LQRA 1JPNA 1R4AA 4TMWA 3TR5A 3UG7A 2GF0A 2R6GA 4M1OA 2HJGA 1ZAKA 3L8YA 4TMTA 2F55A 2GNOA 1JECA 1LF5A 1RZ3A 2VTKA 4LUCA 5L3SB 2GAAA 4YLGA 4MRNA 4UJ3A 1Z5ZA 4A92A 1K5GA 3EIHA 2ODNA 2JASA 1TU3A 1P4SA 3EZFA 4B48A 1GG2A 4GRAA 2VHJA 4Q4HB 4BGDA 4JBYA 4ZI3A 3ZD7A 1J2JA 4PSKA 4RD3A 4JLOA 2OXCA 1GNPA 1JXOA 1FW6A 1AQYA 1RJ9A 1YR7A 3JVVA 3RANA 2BMEA 2EFGA 4WXPA 3U7GA 3IPXA 1W49A 1O87A 5JEEA 1HQCA 2ZE7A 4RFVA 3ZQJA 3A58B 2QTFA 1KIMA 4GPTA 4EFNA 4TMVA 2ZAMA 4BRUA 1J7KA 4LHWA 2CMKA 2H1LA 2BMJA 2GZHA 4TMXA 3KTAA 5FTLA 4M1WA 1XTRA 1JR3A 2BM1A 4TQ9A 4TYQA 4Q7MB 3ZQ6A 3ZH9B 3DMNA 2BJWA 1P9NA 4HLCA 3WY9A 3I3SR 4KV9A 2JGNA 2GEDA 1YZQA 3HR7A 4C7OB 1HY3A 1Z29A 1QVAA 2QM7A 1M74A 2RGNA 3DDCA 1PV4A 4ABYA 3AVTA 4IVRA 4W5HA 3ZIAD 4PQYA 1LY1A 3Q5DA 2OM2A 3C8UA 5FPHA 4U7DA 3MUFA 1UEIA 3IILA 3N70A 2YHSA 1P7CA 2AL7A 4X8MA 2HLDA 3GLIA 2FGKA 2BMDA 4B6FA 3KJEA 4DCNA 5BYJA 4LJ7A 1DAKA 3W5IA 1TEXA 1LS1A 4EQ6B 5AUOB 3GJ0A 1L4UA 4Q21A 1E0AA 3SN6A 3I8XA 4DT1B 2V7QD 1P75A 2B7CA 3LFUA 3KFVA 5LB4A 3THXB 2PMKA 1W0JD 2FFQA 3I61A 3EX7C 2J0UB 3PR1A 1S8FA 2OUKA 3A37A 3K0FB 4QJ5A 4BLSA 3OAAA 1BYIA 3HDTA 4JJKA 3KX2A 1GSIA 2W83A 3A4LA 2OLJA 4YMUA 3W90A 3UK6A 4ERNA 4ESVA 2FA9A 2QU8A 1Z06A 4ZCIA 1KYIA 1E9AA 2BBWA 2NZJA 1IY2A 3CPJB 3ZVRA 2FJUA 2VBCA 4Z51A 4C0LA 1E79D 3B6EA 4C0KA 5JSZB 3DZDA 2NG1A 1W0KD 2VPPA 3VR3A 3WNDA 3AQ4A 5DISB 1YZTA 3N2EA 3ZZ0A 2YOGA 2QG6A 1UAAA 1BMFD 4HUQB 3BOSA 3E70C 1KDPA 4QGGA 1Z6XA 2ERXA 3AVPA 1YR9A 5B30A 1G7SA 3IEUA 1EWRA 1UBGA 2DWQA 1HA3A 3VFDA 3BD9A 3QOFA 1AGPA 1U94A 2BEKA 2WAYA 2JIZD 3TW8B 4DDVA 2ZVPX 3TW4A 1Z0IA 1G7RA 1SKQA 4TQAA 2BMFA 2PEYA 2A5GA 4HYYA 1MO6A 3V4RA 3GJ6A 4QM6A 1ZCBA 1E96A 3EZ2A 3MLEA 4JVSB 2IEZA 2ASEA 3WRYC 1OFIA 4LHXA 1IM2A 2QPTA 2AD1A 4EFLA 3WHKA 4JS0A 2GXSA 4IVQA 1G3RA 5J4VA 5L3QA 1Z6AA 1MO3A 1QHHA 1ZNYA 2QY9A 2ZU6A 3NH9A 4A4DA 3D8BA 3B1ZA 2GF9A 2QP9X 2F9LA 4DVGA 3U3JA 1Z3IX 4JLKA 2IF0A 5FBQB 2YOFA 2JJ1D 3THWB 5EE5B 1U9IA 4ITRC 4FCTA 5KUTA 2CL0X 2WWGA 3ND8A 4A0FA 3U3KA 5A0FA 3GLIE 1KSJA 4GFDA 3BWDD 1QHXA 4DLVA 1S1MA 1SQ5A 3QF4A 1KZGB 1QVRA 2GZAA 2W00A 3QPWA 1W47A 5LBIA 2F43A 1AK2A 3W6OA 1CJKC 2F6RA 3MCAA 1ZU4A 5G3YA 1VCOA 3O8CA 4LJ8A 4E09A 4C2UA 3QSYA 2IF2A 3FHOA 2IT1A 2AN9A 3KDSE 5EJEA 4E22A 4HLDA 1G8PA 1OXXK 2E9SA 5JS8A 3MWYW 3THYB 1KAGA 5FH9A 4AKGA 2D2FA 4L9SA 4UNQA 2OBMA 4IHQA 1BS1A 4QHSA 4WXRA 1F2UB 3DOFA 4KLNA 3CF2A 1NG9A 1CTQA 3U44A 5CYPA 3H4MA 4FMDB 1FL9A 5DNYB 2AD5A 3DZ8A 4DLYA 2ZU0C 3AGPA 4B3CA 5FPKA 5JI2E 4TL9A 1XF9A 4C0HA 4OHXA 1SXJD 3RWMB 3QF7A 4Q4JA 1IAQA 3P27A 1OV4A 4GI7A 2AK2A 1NVVQ 2BDTA 2REXB 1QHIA 1WE2A 4AC9A 1YVDA 3P4XA 3THXA 2KI5A 1DG1G 1TX4B 1XXHA 3QXJA 3IO5A 1WQ1R 4JSYA 3IO3A 4N0EA 3GLGE 4W7SA 3C5HA 4D25A 1T8UA 2RAPA 2IXFA 2ONKA 1C9KA 1NY5A 4URVR 3BFXA 5DI9A 4EFMA 2J46A 5GJWC 3CPEA 3D7MA 2FMXA 1ZNWA 1E2PA 4H1VA 2V9PA 4A8JA 3TH5A 2MSEB 221PA 3LNCA 1TQ6A 2WJJA 3HR8A 4WIAA 4TLCA 4I1SA 5BN3A 2A2ZA 3AP2A 2ZRNA 3SJAA 3CF6R 3QKUA 5LPNA 5LD2C 1ZD8A 1AS3A 2KE5A 2FZLA 1OH5A 2C95A 4BLOA 2A5JA 1KNQA 1IONA 5EP3A 1WBDA 1ZM9A 2J0SA 3G0HA 1FFHA 1E98A 4AI6A 2X2FA 3AKDA 4B3XA 4Z54A 5BXQC 2ANBA 4LWZA 3EWSA 3KUDA 5FTMA 1RYHA 3WYAA 4IKEA 4OL0A 4PHGA 5TY0A 5AJXA 1F48A 2Q3FA 1XXHE 2QQEA 4JLJA 4M8NE 1G41A 1YJ5A 3FFBA 3TLXA 3EPLA 3SHWA 3HWSA 1DADA 2HLDD 2WV9A 1AN0A 2QAJA 2Z4RA 3P26A 4GMDA 3UXMA 2HYIC 1XEWY 3KFXA 1U90A 1UFQA 2GJSA 5BN4A 3CZQA 5KSOA 1DE0A 1X1SA 1Q21A 2C99A 3K09C 2O8BB 1TNDA 3V00A 1IJFA 2KJQA 4NYJR 4PO1A 3H1TA 1C4OA 4IW3B 4XTRA 4MYHA 2ZUBA 4OQMA 1EFRD 1F5NA 2GAOA 4KFTA 1K8RA 2IK8A 1E79A 1G291 1JPJA 1RFLA 1GM5A 5JWOA 1E9CA 3DVLA 3B9PA 3QG5A 2ODEA 4PO9A 2JCSA 2H92A 4DLTA 4UNSA 3RSLA 5L8VA 3DM9B 1ESMA 2WWYA 1TEVA 4Q9JA 1U8AA 4URUR 5G41A 4LPKA 5B57C 4CEIA 4MKIA 3TQFA 2JA1A 4B76A 4OKSA 4DEYA 1KI1A 2DHRA 1ETUA 4DLWA 3AEZA 3THWA 2XTNA 1VYVA 4Y0VA 1IXSB 1HT1E 1R5OA 2PJRA 4CEIB 1IY1A 4FN5A 4HSEA 3FOZA 3LA6A 2J7KA 3P32A 2CHQA 2V1XA 1Z8FA 1ZINA 2G1JA 4TMZA 3NEYA 3SEAA 2QZ4A 1CJTC 1ZCAA 1TMKA 1IN6A 2XZLA 2C9YA 4NCHA 2GXQA 3JZMA 2TMKA 4FCWA 1NLZA 4MH0R 1SKYB 2WM9B 4KFRA 3CF0A 2LKDA 5CK5A 3TK1A 4QNMA 2ZREA 4QC2A 2RGNC 3UIEA 2GEUA 5DYIA 3RWOA 4FINA 2JAQA 3BXZA 1XMSA 2VHTA 4MRPA 5F9FA 2PMDA 4JLDA 2W6ID 5B58C 3B60A 4NL4H 3EXAA 3OIUA 4YMTA 1VPLA 5FL7D 2OAP1 4NMMA 4ZDJA 1FQKA 3LLMA 1KJZA 3UMRA 4EKDA 2X8AA 4KITB 1UF9A 2F1HA 2FF7A 5G53C 2W6JD 4IDOA 1MR3F 2XSZA 3UANA 2ZI4A 2BEJA 3OAAD 2J1LA 2OFWA 3MWLA 2B8TA 3FKSA 4DEXA 1ZM7A 2O8EB 2P6NA 4O0MA 5GJCA 5CITA 1R2QA 2QN6A 1WDTA 1J8YF 3SNHA 3EWAA 3LXXA 2IWRA 1H8HA 4H1UA 2EW1A 4LZZA 3A1VA 5FUYA 1VHLA 4HB3A 2V8OA 1M7BA 4JSTA 3VU9A 4F91B 4RZ2A 1EK0A 2WJYA 3O8RA 3RRNA 1Z83A 4IEEA 3LVRE 3B7GA 4BZXA 4PHTA 4KFUA 1UKEA 3QEJA 3FHCB 2N42A 1FX0A 5EXSA 5JZVA 1SXJE 1MOZA 5FL7A 1A2KC 4TLBA 1F3OA 4YMVA 5JCPA 1UDWA 1XNJA 1ZU5A 1N6IA 4X8LA 2ZJ2A 4CIDA 2GA8A 4PFSA 4NBSA 4RCZA 2J9RA 1NBMD 3QXHA 1UKYA 2OCPA 4C7OA 3UMSA 3CRVA 4US0R 4CDGA 1NN3A 4UQOA 5JECA 3PUVA 4IDHA 4G5RA 1KDRA 3HYRA 3ZS8A 3K9NA 2D3WA 4KYUA 4Q1BA 3U2QA 3I5XA 2XEXA 2ZEJA 4UJ5A 1TF5A 2ZROA 1R5BA 1CXZA 3K0CC 4JT4A 3K70D 2GILA 4FWIB 2ZJZA 2IW3A 4RVCA 3GLFA 1MO4A 4JLVA 3EA0A 5C1BA 2W2XA 1U8YA 1PLLA 4GOJA 4LCBA 5J4YA 2YWHA 2ODBA 4BASA 4Q7LA 3SQWA 3CX6A 3VHXA 6Q21A 3LAWA 3THYA 3CM0A 4BPBA 2X77A 2PH1A 4RD1A 2JLWA 2C03A 2KSQA 5GVSA 4U02A 1AQUA 4IDNA 5JWRA 3TR0A 4B73A 1YU9A 1GITA 3CLVA 2SHKA 3RS4A 2A5YB 4Q4JB 2QA5A 2C78A 2P0EA 5KPJA 4W5JA 1F60A 2P2LA 4D4KA 1IJEA 1DO0A 4I1UA 2DY1A 2XITA 5EQTA 5HZHA 1CJUC 2ZRDA 3AVYA 1XD2B 4GP6A 1R5NA 1TTTA 2VQSA 1A2BA 4HZUB 3ADCA 3QNUA 4B3BA 2UKDA 3IQXA 1KI7A 2CLCX 2ZE6A 4MGKR 1KK0A 2WSSA 1NLFA 3PUYA 4OYHA 1XEFA 2F43B 2NO9A 4HAZA 1LB1B 2R6FA 3SS8A 1XDBA 4EJSB 3LH5A 1OHHD 1GIAA 1P2VA 4O25A 4DUGA 4DSOA 3ZD6A 1X8JA 3NDPA 1SVOA 5BN5A 1OIXA 1NRJB 2QQ0A 1GP2A 3LO5A 1EG7A 1JEDA 2E1RA 1G19A 3HP1A 3PVSA 5AJZA 4D82A 1EX6A 2PL3A 1CP2A 1P2TA 4I1VA 1KJYA 1COWD 4D4LA 3BIFA 2V6IA 5TDHA 2B92A 1QF9A 1OFUX 4PC3A 5HE9A 1XMVA 4OQXA 2OCBA 1MO5A 3GLHE 4ZV4A 1SHKA 3UKDA 5JRJA 1IOZA 1JQJC 2ZUCA 1ESNA 1XZPA 3X1XA 1JBKA 5KSYA 2MMCA 2EFEB 3Q85A 1Q1EA 2HUPA 3ASZA 2AXPA 4QBIA 3EARA 2YZ2A 1RC8A 2G1KA 2CCKA 2XGJA 1OJLA 1OXTA 2IHYA 1ANKA 1CS4C 1ZD9A 3J81k 1G8FA 1GL6A 2W2VA 3AP1A 4NU0A 1Q12A 3X2SA 1OLOA 4PQFA 1R7RA 2ATXA 1NMXA 3R7WA 4C0JA 4QM7A 1EX7A 1KI6A 3LD9A 3JZAA 2V6JA 1UADA 5HKKA 3B5JA 1ZNXA 5DE3A 4BE7B 1BO6A 3KKPA 3GEEA 3PEUA 3WMEA 4MKGA 5J4LA 2OV2A 5EUMA 2O8EA 3MRSA 2ZRJA 4KLZA 4V0NA 4TYNA 1CR0A 4UKDA 4JVLA 2R9VA 4DLRA 4JL8A 5DIFA 2HYDA 2HCBA 3CH5A 2G83A 1GRNA 3K70B 3R9XA 3ZLJA 2WSMA 3FWYA 1R8QA 2O5VA 3IEVA 3BB3A 1FTNA 2C98A 1NMZA 2YV5A 2REBA 2W0SA 1YE8A 1P60A 1N5JA 1KO8A 2Q9BA 2ZUDA 3WBJA 1T6NA 4FMCF 2XTZA 2IC5A 4OK3A 4PO8A 2JLXA 1ZW6A 5EE1A 2HCJB 4RY2A 1IXRC 3NHAA 2QPAA 3Q72A 2D06A 4IVPA 4BUJA 2GCOB 3AF1A 2KB0A 5H1YA 1GNQA 1OXVA 1Z28A 3GLGB 2ZR7A 4Z1MD 4OHYA 4Q4LA 4TTQA 4N1AA 1IN5A 3W8NA 4HUTA 3T1OA 2GEVA 4ZIRA 4D26A 2VL7A 1T3HA 1XTQA 1EWQA 4ON9A 3DHWC 3CNNA 3NIBA 5KU1A 1X3SA 2JIZA 3IHWA 3TAUA 3NVAA 5FTKA 1JR6A 1OPXA 4LY6A 2QEQA 4TL8A 1N25A 2J41A 4RD2A 1XJQA 5KDOA 2R6CA 4WW0A 4WZ6A 1CR1A 2GJ8A 3AUYA 1II9A 3VTKA 4XSHA 4C2TA 3QE0A 4LJ9A
chains in the Genus database with same CATH superfamily
5KTYA 3FFXA 3NOQA 4CCYA 2R68A 2BCEA 4LV5B 4IMIB 4C1NA 3BULA 4NOJA 4KXLA 4PYJA 2HJHA 2VKQA 1T3TA 1P3Y1 1RHUA 4NY1A 4YDHB 1KMCA 3QE2A 2E37A 4RWZA 4XM1A 2V6FA 5CPFA 5ALHA 5JAMA 3WAKA 3JD0A 1WQ3A 4FVTA 1W4RA 1J9EA 3C74A 3VC3A 3V5NA 3FJYA 3ML1A 5FOSA 1LRLA 4BJ6A 2E4YA 2VZ0A 4LMBA 3HXTA 3RD5A 4YT8A 3T38A 1NMSA 2FZVA 4I50F 4YX9A 2AX4A 2EBWA 4A0SA 2DERA 2CHUA 3AIIA 2GPWA 1FX1A 4ZCLA 3FZQA 2B1JA 2FCRA 1WSDA 2YTZA 2ZYVX 4YBRA 5CK4A 2VHYA 5DYTA 5JTTA 4H6WA 4M8LA 4WKGA 5AUQA 1IY9A 2H9AA 4PZZA 3G8YA 1OA1A 5CM8B 2TSYB 4CMEA 4EUSA 4YRDA 5IDWA 1JG1A 2PMFA 5JZMA 1XU4A 2XWSA 3F4LA 4NCIA 4OXKA 4XDHA 4A8TA 5JJIA 2JCYA 2JFUA 2ZTSA 3QHAA 1HE3A 4IO1A 4W99A 1FNDA 1I94B 3RTBA 4DOMA 2AF3C 1TT5A 1C80A 1XMPA 3OBBA 3KHKA 4NE9A 1I5RA 1KH1A 4MCIA 1LWNA 1JIUA 5B37A 2NXWA 1JIXA 4ESHA 2SNIE 4EHIA 1EVYA 1HE8B 1NUAA 1V8BA 1YAJA 1YHZA 3LG2A 4EL5A 2WNHA 4KOEC 3CRZA 3W5VA 4IDFA 2J0QA 3OO0A 3TUJC 5JIBA 1KHTA 1BWSA 3I76A 4JC8A 3ZKWA 3WFIA 2XCOA 2PKEA 4JBNA 2B69A 2OAQ1 2C29D 4M9CA 3PZBA 4RJIA 3UG6A 2UVPB 5LYJF 2CNLA 4MGZR 4EO7A 4KYVA 3CB4A 4N8EA 3UWDA 5DRTA 1UKBA 2ZLBA 2A0UA 1FEZA 4J0JA 2ECOA 2QAIA 3IIKA 1PR5A 3RQSA 3UAOA 2R8XA 2A14A 2QDKA 2NAFA 5KSZA 5IJAA 3WTCA 4PBSA 4S04A 3NKVA 3KKZA 1J23A 2CHVA 4J49A 1P2SA 1TJNA 1X8LA 3MG9A 2I1VB 5KTMA 1OX4A 3TD6A 5HWSA 4R7TA 4OI0A 1BEZA 3OPMA 4F1WA 2K2WA 4PZ9A 3AJEA 2VP0A 2VWHA 2DOKA 2JW5A 4KZKA 3SR4A 3E5HA 4S1OA 3WC4A 3LV8A 3BD6A 2FX2A 4M49A 1DS6A 4X90A 5IMBA 3A7EA 1T43A 1ZN9A 5ILQA 1M5RA 4ARAA 4URFA 1KAQA 5DTMA 1J22A 1VPTA 3SQOA 1PQUA 2V55B 3HN7A 3O4FA 5LXTF 2QENA 2WIAA 4TV9F 1YUNA 4PIVA 4TV8A 3M6WA 2BHTA 4X3CA 3ZN2A 1T35A 4J1TC 4QOEA 2ZDHA 3SC2A 3GU3A 4KH1A 3DUFB 4O6VA 4B9AA 1G5FA 3QPAA 1ETHA 1LBTA 2FJ0A 4BFWA 1BH2A 1QO0D 4H4CA 1WSBA 2W2QA 5EI5A 2C9ZA 4KX3A 3UK2A 2BUAA 5DXAA 4LDQA 3EVCA 2A9QA 1JDBC 2Y1FA 1YIDA 1UAGA 1W85A 1XTTA 4J3JA 2F3TA 5ITZA 5JCXA 3F6BX 1P7ZA 4BFVA 2CD7A 2HU5A 1Y42X 1X1BA 1N6KA 3WRXA 3EPHA 1NYLA 4REQA 2O6LA 1YHYA 4Q1VA 3UGTA 3VR4D 1NM5A 3Q3EA 1O9GA 1CUGA 2PX8A 3B1YA 3KYBA 4FDVA 4R2JA 1KDZA 1QG2A 2P67A 3QKSB 4EATA 4F9EA 3RF6A 1AHPA 4JOCA 3BF8A 4XRGA 2CXXA 2ZE5A 2ZRGA 2WHPB 3BMOA 1NHWA 2B78A 3NTLA 5E6SB 1UDBA 2IDJA 2J3EA 2R00A 4IIUA 4NX2A 1MABA 3JWJA 5DH9A 2NV2B 4CM5A 5FLXA 1L4MA 4ZCPA 4BFLA 3TQRA 1YMQA 2O2JA 3BGSA 2PXCA 1E2BA 3TM5A 3PNKA 3RS8A 3T5TA 5C4IA 2Q62A 4D02A 4U3JB 3TE7A 1QKJA 5FOTA 2QQFA 5BW5A 3CLUC 3DPIA 4KIFA 5IRCD 2BPOA 4ITVA 4WK2B 3QYJA 2X1MA 4Q66C 2W71A 3MMNA 1JNXX 2NPFA 3OX4A 2ZSAA 3SI7A 1KQGA 3VR1A 3INRA 1OFGA 3CXRA 1DX6A 5JXGA 1Z47A 1PZXA 2DKNA 1MQ9A 1VIVA 2J0VA 2PHZA 2TRSB 3E7WA 4LRSB 2CLHB 4X0EA 4DQXA 1YOVB 3EOBI 4KQMA 3TLMA 2YDXA 3R3WA 1PDOA 3H2KA 3MWKA 4M6WB 4LXYA 1DELA 2JA2A 2X0JA 5ER6A 4CF7A 2CV2A 4YRIA 1WZ2A 1RHKA 3K1AB 3HUTA 4G0MA 2D7CA 2RJOA 3BFKA 4PM4A 2Q46A 5J47A 3HBLA 3QJ5A 4OHKA 3RBAA 3J80A 1HLFA 4AKIA 2W6CX 1O9BA 3MF4A 1KY3A 2TMDA 3C6XA 3QLUA 5B58T 2CE2X 1JAYA 2HRDA 2IBSA 4KSBA 4AG3A 2DBVO 1E1YA 5EPEA 3N2KA 1R8XA 5IAEA 5TF4A 1Y4SA 5LQAA 4B84A 4XI9A 4DV7B 3IOBA 1Q3HA 1YL6A 1ICEA 4DANA 3GPLA 1HNNA 4JQZA 3EGOA 2X40A 1P39A 3UHPA 2CSXA 4XLTA 2WVHA 7GPBA 2VS1A 1UBNA 4PG8A 2XWQA 2XNJA 3MCWA 3CT4A 5A6SA 4E4RA 1S2IA 2XWPA 1CEEA 2Z43A 1UOEA 2Z98A 1H0RA 3OQMA 2UZIR 1IY0A 3E1GA 3KNZA 4QDJA 3KT8A 2VFAA 3S99A 1EB8A 5HIMA 5BSTA 3VR4A 4BXOA 1ZL2A 4KCGA 3FSJX 3F1LA 4JDPA 2BW0A 2CL7X 4Q1FA 5GGXA 5H70A 3RU2A 3WNCA 4RDHA 3DMRA 2OHOA 4EKNB 4F97A 2NTNA 3CT6A 1JDUA 1V6SA 4TVKA 3TRIA 1NF9A 4ZAXA 4NMXB 3TM4A 2EARA 4EF5A 1VHQA 2BSAA 1ZC4A 2C5GA 2VJMA 1FS5A 3ZW8A 1P2UA 4FT2A 4YR7A 3M9XA 4CL2A 4MEBA 1B3BA 4Y1EA 1CQJA 1P5JA 2LCIA 3H5NA 4H77A 5CUQA 3RO7A 3D3EA 4WA7A 5E6UB 1OBCA 2VDWB 4EP1A 4F85A 1ADJA 1Q44A 3RK4A 2EF1A 4J94A 4B44A 3FI0A 4GP9A 1RLJA 1YC2A 2IYLD 1J5PA 2YVUA 3HU5A 3M4YA 4V03A 5IC6A 5LZ5A 3RSGA 1L1QA 2PLAA 2V7BA 3HPRA 4WCFB 3STUA 3NBMA 3O73A 3WGVA 2F8TA 4X54A 2PD6A 3B1XA 1VRWA 4UPVA 4AS1A 3AVOA 4KIWA 1DBSA 2KLHA 1PD0A 5I9MA 1MIOB 1BYUA 2CUKA 2R97A 3PITA 5JNUA 3OMXA 2C59A 4K9KA 1T2NA 1U9IC 3AVUA 4BNUA 1SCIA 3QM1A 5TMDA 4LJAA 3D7NA 1EP3B 1GA6A 2GUWA 4X1YA 3SM9A 3SPXA 4ZCRA 4IFBA 5EXDA 1G4UR 4C6RA 1P0CA 2GD1O 1JLMA 2HO4A 4Z8YA 3DD5A 2GSDA 1BEEA 2PS3A 3WLSA 4V0RA 2FR1A 5KAMA 1S3FA 2Z09A 3KOXA 3Q40A 4PC1A 4YASA 3SZOA 4YR9A 5KX5F 3U4QA 4KKXB 4D0GA 1GNRA 4GUDA 1Z16A 4KHZA 4DKXA 3TQOA 3JTMA 3GLKA 4LECA 4O4IF 4QYIA 4F6RA 1RI2A 2PQ6A 1TLLA 3NG1A 5H9WA 3COYA 4OQNA 4X91A 1GYRA 3O8DA 3GA5A 3U39A 1CJMA 1I30A 1QLJA 4BQIA 2KM1A 4BCDA 3KS9A 1CY0A 2O20A 3LTEA 4DV6B 1K0FA 2XGMA 2XZPA 1U2ZA 4JB8A 8LDHA 3ORFA 3C6KA 4D44A 1Q6YA 2SKCA 3V3TA 1RPZA 1FYEA 1L1EA 3N0WA 4PFQA 5U4QA 5T67A 1ES9A 3W8EA 4XWWA 3MJVA 4KR2A 2NUAA 1VDZA 1ORHA 2DX7A 1IM8A 1LTHR 3FPLA 4G67A 1XTJA 2CF5A 3IEIA 1GCIA 2BCJQ 3CZ9A 1AO3A 3RKSA 3HVIA 1G3IA 1P1RA 1V39A 5LZ4A 3GFQA 4B17A 4EY3A 2WOJA 2BCGY 5CHEA 1ONSA 2EV9A 2X2PA 3L0IB 1A4UA 3EASA 1UKVY 4OF4A 3B3FA 4DW8A 4JDUA 1UWCA 1W5AA 5CD9A 2QSZA 4WFJA 1ZAYA 3ZY6A 2ORYA 4HDNB 4QPPA 1CPYA 1N3BA 2LRHA 2YXEA 8GPBA 2W0MA 3PD7A 4OOFA 3PEYA 4J2TA 1DEAA 1KRXA 2EZ9A 5J5CA 3HRKA 1T9BA 1QYIA 1AIPA 4EDHA 1ECBA 3Q9LA 5IKXA 4NDNE 3K9WA 1SOUA 3LX5A 3KXKA 1A4XA 2VHVA 1YRBA 1SCNE 3UQYS 3VDNB 4N48A 4JVMA 1I7DA 1ZL0A 3EEIA 2REQA 2XNDD 1G8KA 3O7WA 3TGWA 4WLEA 4HQRA 4PS0A 1PVOA 3R4CA 2IUTA 1NJSA 5TMBA 1KK3A 1H9BA 4CL0A 3TQHA 3WGZA 3NKLA 4LC1A 2YDYA 2Z3VA 4LCJA 1X7DA 5HBRA 3VYSB 4YQFA 3MC1A 4RPHA 2PRYA 1T4MA 2BI7A 3C43A 5TVGA 3FKJA 4ZO8A 4NESA 5IASA 3W5CA 5CB6A 4XJXA 2ZWPA 5A5EA 3DUFA 4AY4A 1F4VA 4FYIA 1PRYA 2ZUWA 4WZAA 4ZALA 4W8GA 4B2PA 2I4MA 1T5HX 2VSQA 4D9NA 5CJJA 4B74A 2OLKA 8OHMA 5IVHA 5FOVA 5LN1A 3UOGA 1NW6A 4DLLA 2PXXA 3I2JA 1UBRS 3FAZA 2BKAA 3CX4A 1QPBA 5JSUA 3E9ZA 1E0JA 4TZKA 4MVWA 3K5PA 4Z4EA 3PF9A 2Q5FA 3H42B 2HCRA 3WGYA 1UDAA 1C7QA 1KFJB 4DN6A 3B1VA 2RG7A 2XECA 4DG5A 5CDGA 5HJ5A 3DLBA 1BRTA 2VA9A 3OZUA 5BSKA 1AKMA 4G86A 2VK8A 4S24A 1F5SA 2CXRA 1EB9A 1DJQA 2GZMA 4D0NA 1L7OA 2PLFA 1LH0A 3PDCA 4ZODA 4UTVA 2NO5A 1D1SA 4EA6A 1J1IA 2XQJA 3MYYA 2P5SA 4I50B 4O8CA 2JGMA 1GDDA 4NK4A 1EFKA 2P8SA 1K1EA 3IMCA 3VO9A 5DNAA 4ALLA 4YV2A 5HRAA 2IP2A 4J90A 5LMZA 4KE9A 1HG1A 5ICEA 5ER9A 5IHXA 1E3WB 1LW7A 1Z6TA 3H5IA 1P7PA 5CFMA 2WK1A 1EA7A 4IFTA 4ND3A 4R9RA 5BUSA 3U09A 4N3CA 3MW8A 5I7UA 5J63A 5JS7A 5B1IA 3IUMA 1I4LD 3K92A 1LSJA 4P4SA 4NU8X 1YRQA 3G2MA 4P33A 4PPYA 4RSGA 4UXIA 4WESB 1VYTA 5AI9A 1I14A 3SEQA 5C8ZA 4BMVA 4YDQA 2NIPA 3W2FA 4KQHA 3PHIA 4WD3A 3U0VA 5LCXA 3CVJA 2OGUA 4QRHA 3ZNQA 2RGDA 3GDFA 4ZTUB 3E9CA 2WTEA 2JEOA 4E07A 1GUYA 5EMLA 4DR3B 1PJ3A 2ZJ0A 5BNFA 2RAVA 3IIMA 1GCGA 1M67A 2ZDGA 3GARA 5I4CA 2FP4B 2HD4A 2XXBA 1WPRA 2HEIA 3H4IA 2IYFA 3K73O 1YGYA 3QBVA 4DRYA 5DGXA 1TVMA 4OKIA 4MRSA 5CHYA 4KIUA 3QXXA 3FVTA 2R8ZA 4KN5A 1YDFA 2L0XA 2E1PA 4S2EA 4QAQA 5EIAA 5JVDF 4J16A 4IDQA 3H9UA 2J9FA 3MUEA 1E5TA 1YMVA 1BDMA 2DFTA 3QPCA 4ILEA 3DCNA 3FWPA 4IF6A 4URXR 4UPDA 1K98A 3H5VA 3KLNA 1YCFA 1Z2EA 3TIXB 1G66A 1TPZA 4N5LA 3U3XA 2F3RA 3DV0B 4QT0A 1UBCA 2EOAA 4HJXA 4HEHA 3QELB 1JG3A 3R2JA 4IMPA 4TKUB 1R5JA 3KSMA 1SD5A 1CJBA 3EC1A 4RLHA 3BFVA 3M49A 1E9SA 2OENG 3FCSB 1D5WA 4C06A 4EELA 4YJ3B 3P71T 2ZJAA 3MBIA 5F9HA 2VNKA 3ICVA 2E3JA 4MLZA 1ODLA 3ZD9A 2G17A 2GX6A 4K9NA 4K9SA 3ZE0B 2R11A 3FRIA 1OTHA 2PBZA 2VNSA 1XROA 2YJZA 2Y1WA 1ISRA 3QLVA 1KMHA 4QO7A 4UNIA 3REFA 4O02B 1JG4A 1ZMRA 5L3QB 2QN9A 2CZCA 4NBKA 4CU2A 3K16A 4DDHA 2UVQA 1LLCA 3EW7A 4IIEA 3JR3A 1GZ6A 2C3MA 3E9DA 1DMSA 2G9NA 5A7FA 3O4HA 1ZK1A 2ZULA 1I7LA 3VNSA 3WYDA 4DKJA 4CFYA 5TV2A 2I4OA 1SO8A 4OH1A 2X8JB 1HUQA 1YB7A 1NV8A 2Y1XA 3ZV4A 5K20A 5EEHA 1G18A 3QU7A 1DBPA 3LRPA 3ONEA 5FPTA 1NR5A 3G2NA 4CKWA 4RF2A 1KJWA 1OT5A 1SU7A 2AH5A 4NFLA 4DSZA 2AFIA 4KGZA 3UC5A 1T2UA 1U28C 4DCGA 1QBKC 3ICPA 4DT1A 4FNMA 2JJ1A 2KMLA 4UNPA 4LI3X 5AVOA 3WGJA 3SXUA 3ZOKA 4ALIA 4EA8A 1L5HB 5B3KA 3KJGA 3RDPA 5TIIA 2A7XA 2F62A 4YV1A 4GZMA 2PIAA 4MS4B 4D3XA 3W5AA 3HEAA 5AKGA 2E82A 4Y2PA 1EPUA 5K3AA 4W5OA 4EKEA 1M76A 4H6XA 1EUCB 1KY4A 2R44A 1C3OB 2ZBVA 1L4LA 1XLTC 4MVCA 4MUJA 4H3SA 3T3DA 4DDKA 4GT1A 4L73A 3T4UA 2UZ1A 4EG5A 3L6EA 3PCRB 2PZGA 2E18A 3RRJA 3S44A 5FWXA 1CIJA 4NP6A 5ALTA 2RHGB 3KLMX 4C6HA 1SKAA 1V0JA 2FSGA 4E1VA 4RL4A 3OI7A 3ABZA 3EXEB 2IP1A 3L8CA 3COWA 3OCYA 3E5NA 3I4LA 5CG2A 1RAFA 2DSNA 4OMUA 5K0FA 1FX0B 2WPDA 3SK0A 1NBMA 2GZ3A 2NN3C 2WVGA 3DZCA 3RKUA 4Z4FA 5ECWA 1OOEA 2AE1A 2CD9A 3L8ZA 3BH7A 4LX0A 1M6VB 4WCFA 4DC1A 2FK8A 1YHNA 5ELLA 5SZJA 1ZGZA 4NU6A 3UV3A 3KV3O 1Z6PA 4Q1DA 2I65A 2MR6A 2OCGA 2B25A 3O0DA 3P96A 2I1WA 2NZVG 4OCZA 5EE0A 1XK6A 4KQ9A 4XIIA 2O2GA 1MG0A 4HDNA 2Q8NA 2AHOA 2WEKA 3HU1A 4NCKA 4WK4B 5I4KA 2HL6A 4ZYLA 2GN4A 1N7JA 1KGSA 4RIFA 3AKZA 1LBHA 1R00A 5ICMA 3CJTA 2P6RA 2W2LA 4JIGA 3U4AA 3WX0A 1FZTA 4UDOA 1IWOA 1OYYA 2BGJA 1XQXA 3SYNA 4KLRA 1Q20A 1HFKA 5L6LB 3MWEB 1TF7A 2LE0A 3HR4A 3I42A 1AZLA 2ZW9A 3CUUA 4Q9NA 1M0EA 2EQAA 3BA1A 2WLTA 1VG9B 3NRJA 4Z9XA 5A2GA 2EJCA 3L93A 3DDNA 3ZHTA 1H1DA 2CMGA 5FR2A 4PN7A 3EFEA 3IIJA 4P3KA 5EZYA 1JZSA 2HA2A 3N28A 5HCNA 4D8WA 1NLMA 3KB1A 4MVJD 3C3WA 4J16C 3HB4X 1BTOA 2G4LA 1QDUA 4NBUA 4BQPA 2HRQA 4HTFB 3WZLA 2IXEA 5BWBA 1T8YA 2VK4A 4DRZA 2XX3A 4PC7A 3P8ZA 1NI4B 1B2LA 1EQUA 1HDRA 2ZAGA 2OORA 1KBQA 3DNFA 3MTDA 4Z3DA 3RKRA 3T7IA 1AM4D 1HOTA 4PGMA 2IZZA 3BB1A 5LNK1 2GM5A 4MQFA 4QGBA 2WKWA 4P83A 3L7CA 5D3QA 2AFIE 1TF2A 4ONEA 3PXGA 4YMHA 3BHNA 3HKBA 1HR0B 2WMYA 3LPMA 1ISIA 2YW2A 4HNQA 3L5KA 2H4FA 3HDGA 4G97A 4PINA 1CRQA 3S0JA 2EQBA 5DF1A 4A10A 3PYXA 4GZLA 4JUAA 3ZBQA 3M89A 3ZVNA 2FPKA 5IM5A 3W5BA 1JAIA 2ZIZA 2Q9CA 3O4JA 5BQ5A 4UUMA 5DULA 1FP4B 1DIHA 2BT4A 3DKKA 1RZVA 1E3MA 3LIIA 5H81A 4AZWA 3FF1A 1XD9A 4YALA 4MKHA 3QYPA 4DLNA 1R0ZA 5KNCA 1HDXA 4BWYA 1ZUIA 2QUHA 1ZUNB 2II6A 3B78A 1J0EA 3LVQE 3KZ1E 3QPDA 2Z8YA 1NN1A 5D86A 1HH4A 5HDBB 1C7FA 4Q6BA 2V3CC 4O4JF 4MS1B 1YASA 1A2OA 1FXWA 2AOVA 3CSDA 3E8MA 3IESA 3QVKA 4JEIA 2D2EA 2ZXUA 1EJ0A 1YB5A 3I45A 1UM8A 2WIBA 2QRNA 3GQBA 1OBOA 1KQPA 4CRWB 1VMKA 1JDNA 1KZ1A 2RHJA 3MMPA 3Q4GA 2ZVQX 1W96A 1P4HA 3K0HA 5IJ9A 1L4FA 1ZKDA 2JJ2A 2WQ6A 1QVVA 4HDCA 2CBXA 5B6PA 3QENA 3JQEA 4II2A 5CNKA 4DSTA 3H8JA 1YC5A 3AG6A 3M6AA 4B75A 5JJCA 5K3EA 3WAGA 1AKEA 1QFZA 5JD6A 2XUQA 4AG6A 4QFCA 1K92A 2D0PB 3F8TA 4HVAA 1BKDR 3PI7A 4POAA 4WAUA 1QE0A 5EQFA 4HD8A 1Q84A 2JB9A 3PUZA 4JLMA 1UJ4A 2AGVA 4OHVA 5KYUA 1CHNA 2BFPA 5DM0A 3USES 4DMGA 2PX0A 2RGUA 1J2RA 3DVAB 3FFTA 3QKTA 5JE8A 3VHRA 3TMAA 3VKWA 4CMEC 4G1CA 3CIOA 2P3OA 3P97A 4J1NA 4QFDA 3PL1A 2ARKA 1LJLA 4JBGA 2DBYA 5A4MS 2HDNB 1DWPA 2JGLA 5DLEA 2Q27A 1Y63A 1MA3A 2CUZA 1BS2A 4ZEOA 3ZYCA 3WQSB 3GAMA 2A7QA 4HDRA 3VOBA 4FPXA 1KEEA 1QH1A 2XY4A 3JQGA 3NBZC 4ENPA 2HO5A 5T64A 4GMHA 3U6BA 1Q1QA 4HAUA 4QBKA 4DMLA 2PGOA 4Q1EA 1RI4A 4XCQA 4ZCQA 3QELA 4TKUA 2YC4C 1E3WA 2RCNA 3LWDA 1V9CA 2JJ8A 1GPWB 3W2IA 4KXNA 1X87A 1OWNA 4TKLA 1MO2A 1U0RA 3OE1A 1E9VA 1WO8A 1CDOA 4OJKA 4PSVA 1ECLA 1MRNA 2BE9A 2VUUA 4LZLA 3F98A 3WV5A 2BF4A 2PLRA 3N7UA 4K9DA 3MXTA 3UB4A 4JBWA 5ENZA 4EFDA 4INOA 4M9QA 5T4HA 1P2DA 2PKWA 3DEKA 4P32A 4ZOEA 4QHYA 4L8WB 4HLUC 4WBXC 5C35A 4MYTA 1RI1A 3A9VA 1CG6A 3D7LA 3N6RA 1IVNA 5DN6A 4C22A 2YVAA 3DJFA 1TTHA 1A82A 2NU9A 1WLYA 1LW6E 2RH4A 5DCUA 5K8IA 4MDEA 1H93A 4P2GA 3BJRA 5KVSA 4AXXA 4HVTA 3LT5A 3LNTA 1EWTA 1ZVKA 3KB8A 4B2IA 3WKAA 4L7VA 4DIMA 5CIYA 3KUCA 1NONA 2OYSA 3IS3A 4RQUA 3ESXA 1KZ4A 4Q34A 2FZCA 5JCJA 1WVIA 4E13A 1T4CB 3IHLA 1R37A 5DHTA 4GI5A 4FT4A 4AJKA 3VFDA 4C29A 4XX1A 3H2HA 1TTPB 2Q1UA 5K0NA 4GOXA 3F78A 3QQ5A 4IXWA 4TWZA 5EMHA 4EB3A 4YRCA 1W7AA 4XFKA 3GGSA 5AKLA 5CTAA 3LFHA 1JHMA 1P1KA 5DWDA 3IB3A 5EKDA 4BGUA 4KH0A 4KQEA 2ANCA 1R15A 2AK3A 5CT4A 1U0GA 3ZNPA 4RIHA 3QVGA 3EIXA 3PJRA 1DJMA 1T8RA 1I0IA 1NVBA 2NYVA 4YRMA 2BHRA 3G88A 4RKFA 4E15A 1RR6A 4CLDA 3NV7A 1I5OA 1Q0RA 3OFKA 4G1VA 3T3EA 1ZNZA 3M4NA 3OTGA 3FOAA 1YUBA 2OKCA 4QJ4A 5JZ9A 1MTZA 3U1VA 2ORVA 1FK8A 1FQWA 1GZ5A 5J1SB 4KXQA 3QRWA 5CW1A 3V8PA 3F5MA 4DHEA 1LDYA 1VKHA 2H3HA 1OYWA 2DR3A 5FBLB 2X5XA 4HS4A 1RQ7A 2DP4E 3GEDA 4CE6A 3JQ9C 1GPMA 1JZTA 1Q11A 5CXXA 5HG0A 4F4UA 4F71A 3FZEA 5D5PA 1XHEA 3D1VA 1A2QA 4IINA 3IUSA 3CF4A 1E62A 2VP4A 1Z18A 3UJBA 3W78A 3IE1A 2DQSA 4ZV7A 2VNHA 3CURA 3IEVA 1KHHA 4FS3A 5CPBA 1PS9A 2Y05A 5EZ5A 3PF8A 2JLSA 1J99A 1JJFA 1OWOA 1YZHA 1Z0UA 2ZT6A 3I92A 5IAGA 3RU9A 4C6SA 5K05A 1B0ZA 3L4SO 1QU2A 2Y9PB 3EWIA 3VYTB 3U7EB 2Q5LA 4IJVA 5JXWA 3DNPA 1IDN1 1IG0A 1Y7PA 1IRXA 4IGIA 4PZCA 2PDAA 3LX4A 1FXUA 1NW7A 2R84A 2X9LA 4KAJA 2O3QA 4M22A 4WZAE 4B35A 4MIOA 3R20A 5LMUB 3QUAA 3E1SA 1GLNA 4UEQA 3CPHA 3E9YA 5IEJA 4RTQA 3HBAA 1N9GA 4D3DA 4PAQA 4DLXA 3GMSA 4Y6LA 1GPKA 1RWBA 2FOXA 2B5OA 1E9EA 2VAPA 4NICA 5AVZA 3DYIA 5H68A 2GYVA 5LL6P 1XNGA 4BVLA 4XPZA 2IUSA 3B20A 3QLUC 3VC2A 4EGQA 4CKEA 3HEMA 5LQKA 3U4QB 1U8CB 4FJ1A 2A1IA 1OR8A 1RQLA 4DM3A 4PBRA 5ICCA 1XRRA 2FN9A 3KQPA 4JLPA 1JSCA 4PAGA 5E7MA 5LIPA 5JYDA 4MYUA 3NBFA 2JVJA 1Z0KA 1W9MA 1Q14A 2D2VA 1ODTC 2R96A 4X1OA 4E7PA 1WZCA 3B2EA 3HA3A 5FI1B 1Q95A 3BTVA 5EPUA 1BCSB 5BV0A 1IHPA 4BKMA 1I80A 3H0CA 5DM2A 3OQOA 1E5DA 3KVVA 3JCZA 2BHNA 4M9ZA 1LTQA 1QAMA 2RGGA 2IJGX 1KYVA 1TKRA 4RVHA 5M3BA 4E12A 3BMQB 1Z75A 3E27A 2VPQA 3SSMA 3QMPA 5AW4A 1DVRA 4M2LA 1UK7A 1YZKA 4EECA 2Y76A 4GR9A 2ECPA 3OPNA 5L4LA 3DDHA 4XWOA 2CZGA 1AA6A 2CN1A 3UC9A 4HI0E 3EFOA 5BSMA 5FYQA 3NTXA 2FPPA 4XVQA 2QD5A 5AESA 2EX0A 4MVJI 3Q8XB 1NP6A 4LWQA 2IOQA 3TBKA 2HDOA 4XGQA 4KLAA 4Y1RB 1L6IA 1UM9B 3NONA 4OYRA 4YO7A 2ZSBA 4ZOAA 5EZQA 3DLHA 4OAOA 4H1TA 1PJAA 1PWHA 1RIFA 4H3KB 1J2EA 2WIDA 4J75A 4J7UA 4V3CA 1RXIA 2ZVDA 1A7UA 4H7EA 1QTQA 4WESA 5IT0A 1G21A 1DEKA 3PHJA 1RD4A 4JGBA 3W0LB 4QTYA 2I34A 3ROTA 1NVUQ 4K9MA 1GYQA 3DBRB 1N8NA 4AUMA 1J56A 2UAGA 3FCOA 4FFVA 5IH3A 1IZ9A 5AHKA 2CBZA 1BJTA 1TD9A 1ULHA 2EJBA 2O0JA 1FFBA 4HL6A 4M0KA 4MTLA 4WZBE 5FOUA 2AS0A 3L0OA 5IWAB 3M5PA 1RYZA 4OHOA 2OEPA 1ESZA 2R8EA 4IAOA 1XCMA 4RFLA 1ISMA 3T99A 3OQIA 4Q9LA 3JZFA 1V47A 2AB0A 4NZYA 3MWFA 3EFBA 3ANLA 3VC1A 4OBEA 1Z6YA 5EE3A 2PGLA 1JQAA 2GPYA 4CZ2A 1CUDA 1TT5B 2Z5GA 3AH8A 3BJZA 4HDOB 4I2VA 2OOKA 4JAVC 1SXJC 3CLSC 4R8LA 1C7IA 4JR0A 4JD5A 2YJ6A 4RW0A 4LOKA 4PPQA 3Q2OA 4V0OA 1KE1A 4CF5A 2YWGA 3L4BA 2Q0HA 4Z2AA 7REQA 1DCFA 1KZYC 1F2TB 1VHJA 5KYXB 1FNMA 1AF4A 3EZLA 3FX2A 4B4KA 1JJ7A 3ZS9A 1VPEA 3PA8A 5KCZA 1TE2A 3QVGB 3GLHA 3HRHA 3TEMA 2ZS9A 4WDRA 1KZ9A 1NVVR 2FWPA 1HC7A 3VZSA 5BVGA 5HUJA 4Z1MA 1X0XA 2UYQA 3SDBA 1EK1A 4EPVA 3BBPA 4WFIA 2G0NA 1DV1A 1XZCA 3GCDA 3HUEA 3DL2A 3MT9A 4OXYA 5F4ZA 4REOA 4FWTA 3TE6A 1E4OA 5F77A 2HSDA 3O90A 3I3OA 3TVDA 5IANA 5EJGA 4BQRA 1VSUA 3VZQA 2X13A 3I6QA 2LUOA 3MD9A 2IBTA 2YC2C 2Y0DA 1KEUA 1PQYA 3H5WA 4C0QC 5AXAA 3M83A 4KJZA 3QW2A 4I6JA 4X6XA 1EBFA 2CLDX 3NVKI 4BX3A 3NT5A 1T1GA 2H85A 1TU0A 5EHQA 4DZTA 4EBBA 3KQWA 1JEQB 1G8JA 2JGDB 2VYCA 3L1JA 1E60A 1T8TA 3L7BA 4JQCA 4ND5A 4OK6A 4AYTA 2VTEA 3DC7A 2ZBFA 1ZDMA 1OXMA 3O4IA 4I5EA 4FOPA 5F5NA 1OLSA 3W9YA 3AVQA 3BSFA 3ZHRA 1BC5A 1JSXA 3PK0A 1E3JA 4BQQA 3NT4A 2H59A 4WBNB 5EJEA 2WRZA 3MM4A 4FX5A 3RSHA 3IP5A 2YR0A 4LHZA 1M34E 4MPTA 1NF8A 3GFTA 1QH1B 4AUKA 1E64A 2G1UA 4RTMA 2BE7A 1E2DA 1QP8A 3ACCA 4XFDA 5ARBA 5ESRA 4ANFA 3CRMA 2AR0A 3A6PC 5FBRB 2QXTA 2XMSA 1B6GA 4MW4A 4P53A 4DIEA 1CUVA 2BBOA 2EFDB 1ISJA 5FTJA 1MOQA 2RB5A 3HXLA 2IV3A 5CDTA 3V8QA 4FOTA 1GKUB 3A6EA 1CD5A 2BV3A 4QXPA 3S1LA 4UNRA 4Q00A 3VH2A 4L5IA 5F2EA 1R4MB 4CMBA 4F2HA 1JJAA 5THQA 1QJCA 1T9DA 1P73A 1RM5A 3JASA 1SWVA 4DXAA 5K5EA 1E7WA 2IY9A 2R60A 5ALYA 1PJSA 3T7RA 1QU3A 4Q7KA 5MN5A 3TD9A 4PG7A 1CJSA 2O8VA 1JQEA 4LXGA 3U19A 2BC9A 1DNPA 1PFYA 1ZGCA 4TV8B 2ZAOA 4C76A 5CA1F 5JY6A 2IZOA 5JS1A 2XT9A 5EIWA 3LYHA 4ZCSA 4B0OA 4JKIA 5DBEX 5KKAA 3Q3CA 2CY0A 5KS2A 2ZJ1A 3DPUA 1AZTA 3QKWA 1XPRA 4LJ5A 2A9FA 1GEEA 1I4DD 2H2FA 2XQKA 5K09A 2DH5A 3CVOA 3B6JA 2WFMA 3ENNA 1SCUA 2O2CA 3MUNA 4R98A 5DHSA 2ZFUA 2JH3A 1KSFX 4G1UC 1X3LA 2DULA 5ALFA 3GEHA 4MQLA 1CNFA 3L3BA 4RAOA 1YZLA 4AJLA 1YDMA 2QRQA 1GTZA 3W3ZB 3CR3C 4C4RA 2XADA 3B5IA 2EF0A 3BWBA 4V02A 3ZWOA 5AJTA 5K8TA 2A0XA 2D74A 3DFMA 3PICA 4WV3A 5JXJA 2V7PA 2YWFA 5JNVA 1EAYA 3PQ5A 4IQGA 4QA9A 4M1SA 5MHTA 4MW7A 1YO6A 3BVPA 2LIVA 2IOHA 1UIRA 2P9YA 3UPDA 5C8YB 3G0DA 5F64A 4JJZA 5CLJA 1QTRA 1U7HA 5EKXA 5GTDA 1QQAA 1NUPA 1P8JA 2P1ZA 2PS0A 3FB4A 3O5AA 4OK5A 1JEJA 1I2ZA 5GZ6A 4EW3A 4U7PB 4YMWA 1MUUA 1WCIA 4KQFA 5FORA 1RC1A 1T2FA 2AI1A 4O4JB 2V54A 1EG2A 1Q0PA 1Z6QA 2XDQA 3N39C 5CX1A 1D6JA 4IDBA 3X1MA 4D4IA 2Q28A 3IP1A 2ZPTX 4QQKA 5I7RA 2AWOA 2D0DA 1N2CB 1FE8A 1UMCA 3UT0A 1OI4A 1WHTB 3QMWA 4BQFA 3KOWA 4YROA 2BRUA 4RLFA 3TL3A 2PCLA 2Q3BA 2ZI5A 3CGWA 4WNAB 3MTAA 4PONA 1MAVA 2FUG6 3RVJA 5LDDC 3PR3A 5J23A 2W6OA 2YIJA 3U4IA 1XQ6A 4PRKA 3QBDA 1QFYA 3ORRA 2D1TA 4I8XA 5UKDA 1T8SA 1NSTA 3WKCA 2G08A 2OY0A 1S9HA 5EJ2A 1Y1QA 3IGFA 3U7QA 4KMRA 1KQ3A 4K05A 1RZUA 3U1TA 3ZVKA 3LK7A 4LZAA 2OHJA 1K7SN 2ACVA 4QLOA 4Z0NA 3U0BA 5E0OA 3LRXA 4YMSA 4Q93A 3V1LA 5BNZA 1PLKA 1ZK2A 4DCVA 4CMIB 1TQ4A 5IJWA 2GO1A 4LDRA 4BWVA 3WO0A 4H7PA 1US8A 5E6RB 5J2UB 3NTQA 4EG0A 2BEUB 1ZMXA 2ZQ5A 3E2IA 2H7XA 4X1KA 5KYYA 3KZVA 2C83A 2O8NA 3PC7A 4YA6A 2V4ZA 3E3NA 4JVOA 4R3NA 2RB4A 5BW6B 4ER5A 3LW7A 3G89A 1R10A 4Q24A 2YKGA 4O2LA 1Z5NA 4D2IA 3LT4A 3SHTA 4JMLA 4DQ0A 4DCTA 2WT8A 1ECFA 2BM9A 1RYFA 2BGTA 3OZFA 3O9VA 2H7VA 4K03A 4PYKA 3RPEA 3TLGB 1ML3A 4NLLA 4DQLA 5LQCA 4KUGA 2FPIA 4JJEA 4ESEA 1N3YA 5SZIA 2DFDA 4NTZA 1T5BA 4U6SA 2B4YA 3EVAA 4NONA 4R8MA 3MGBA 3L4KA 1KI6B 5DLDA 4O3MA 4HYQA 3FE2A 3IXQA 4DMRA 4RTOA 1KI8A 3Q10A 3QVVA 2BKXA 3EBPA 5BW4A 1RWPA 3PT5A 5BN3B 1UFRA 1VLHA 4TZTA 1ZR2A 5JG7A 4L6CA 4B3MB 3KV1A 5TARA 4W7HA 3VKUA 2RGEA 4HWKA 2PGIA 1GGKA 4WVLA 1XLTA 1X8KA 5EXTA 3SYKA 2RHTA 5KDLA 3C3BA 4YECA 1H66A 5TEVA 4M9SA 4ZQIA 1DQPA 4UAJA 3G5UA 1PEDA 3EQ2A 3RSSA 3A9TA 3I8SA 3AY0A 2K6GA 5EKTA 1SIBE 1N3IA 1LKZA 4AP6A 2UYHA 3T61A 1AKNA 2OORC 5ALWA 1X74A 1M2OA 3OEHD 4FFRA 1VGQA 1OFTA 1ODJA 2JFGA 5EERA 5B53A 4Q37A 5JCZA 1PQ4A 3AOEA 3DO6A 4UTOA 3PWZA 4TROA 3NRBA 4MQUA 4R01A 3D6UA 3ADDA 1U0SY 2YZGA 1GTG1 3PKIA 4JA2A 4O1HA 4UOQA 4MJXA 3T34A 4RKWA 4AX4A 4QVGA 5I8WA 3ILSA 3ZCXA 2Q0XA