2P6NA

Human dead-box rna helicase ddx41, helicase domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
163
structure length
160
Chain Sequence
LDVIQEVEYVKEEAKMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGCTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX41
total genus 54
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p6nA00
2AD1A 2NPFA 2QTVB 1Q1ZA 3OAAD 3EASA 2P5TB 3AP3A 2QE7D 2BDTA 4FCTA 2PCLA 1QZXA 3EWAA 3LXRA 4QBGB 4KVGA 3RS7A 2HF9A 4GRAA 3MWJA 4LJ7A 2D62A 1XMSA 4YMUA 1SVKA 4B76A 3QKRA 2OE2A 2ZRMA 3DO6A 3ETLA 4RCYA 1OB5A 2NPIA 3B1YA 4JLKA 4CF7A 3KL4A 3C41J 2EVWX 2ZJAA 2ZUDA 1JEDA 4V03A 2YOHA 2R6FA 4M1OA 3T1VA 3VU9A 3CF0A 3U44B 2IBMA 2WKPA 4KJZA 5EP4A 4RD2A 1QHYA 1IQPA 1UEIA 2ZU0C 4RD4A 1RC8A 1ZNXA 1NVVR 1NBMD 3BFXA 4TN1A 2ONKA 4FWIB 4DJTA 4LGMA 3SC3A 4FMDB 3GP8A 1R5OA 5CLLA 1ZM4A 2QAGC 4XSGA 4KITB 1SXJE 2O8DA 3P27A 4F91B 4QGGA 1T3HA 1XZPA 3TR5A 4A15A 4A9AA 2W6JA 3AF2A 1KZGB 4TQUS 1OXTA 2LCFA 3CR7A 4BFUA 1UF9A 1XEXA 4KSCA 2WWYA 1CR1A 1UBGA 1ZNYA 2ZRDA 3BJIC 3RRZA 1E9CA 2ZITA 4YXWD 2EYQA 4WAUA 2OFWA 4X8LA 2W58A 4Q4AB 4OQLA 1E1RA 4AIIA 3UMSA 1F6BA 1E2JA 2VHQA 2VHUA 3CNNA 1Z0FA 2WJGA 1JR6A 5EXTA 2CHGA 2BBSA 3BC1A 1WB9A 3NDBB 4ZDIA 3ZVNA 5K8LA 1BYUA 4Q1CA 3QPUA 4K8OA 1E79D 1W49A 2IW3A 1KK0A 1KSGA 2NOAA 3BH0A 3ZD7A 5FOTA 1QDEA 3SS8A 1OHHA 4P32A 5JS8A 2OBLA 3NDPA 4RSGA 4YXWA 1XX6A 3TUIC 4TLBA 4EPRA 2IYZA 1UDXA 1GZSA 2JGNA 4NMMA 4PZLA 2MSEB 4HLUC 3GLGB 3U4QB 1XXHB 2F6RA 1N6RA 2F1HA 2PL3A 2C77A 4Q7MB 3QE0A 4PC1A 3I3SR 4B3BA 3A58B 1XWIA 5TARA 2BV3A 4PZZA 1BMFD 4Q7LA 2HXYA 1KMHA 2JCSA 2XAUA 3MFYA 2ZREA 1RRCA 2A78A 1E9AA 1R0YA 4F38A 1YZQA 2Q6TA 2BKUA 2D7CA 1Z47A 5K8UA 4O25A 3WY9A 4KO8A 1G8FA 1VIYA 4ARZB 1Z07A 5KDOA 4HDOB 3SOPA 1YU9A 3JVUA 3ZIAA 1NVUQ 3UG7A 1U2RA 5HPYB 5KPDA 3TQCA 2ODNA 2BCJQ 3C8UA 5BYKA 3BERA 2ZQ5A 1AKYA 1KI3A 4BZXA 3GJ8A 3T1TA 3O8BA 4KFTA 2KI5A 1JPJA 1MO6A 1WF3A 5FBVB 2O0HA 5K8TA 1FL9A 1XB2A 4JSYA 1XD8A 3IHLA 4RFSB 2J3EA 3CZQA 5L3VA 4KV9A 3QG5A 4TL6A 2XZLA 2CL6X 2EYUA 3EWSA 3GQBA 4OJKA 4EQ6B 4ZDKA 3KKPA 4P4UA 4JLAA 4BRUA 4F7WA 4QBIA 1E2LA 2O8CA 4LOAA 2RGNA 3SJZA 5H8WA 3LWNA 4URZR 1CJUC 1EWRA 4IDQA 3SYLA 5FOUA 3NEYA 4P4TA 3CRVA 3WXMA 5KUTA 1UAAA 4YMWA 3KQHA 3FOZA 2WJYA 4E5UA 3KJGA 5EE1A 1R10A 1HTWA 3THWB 2ZRHA 1M7HA 4Z8XA 5TDHA 1DELA 1Z0JA 3BFVA 3W6OA 4BECA 4DDTA 3EX7C 3PEUA 3A1TA 4FW9A 1K6MA 5IHPA 4NU0A 2ZETA 3NC0C 1RKBA 1L4YA 1KI4A 3W6PA 1D2NA 3Q5EA 4A0HA 1E9FA 1X8LA 1F2TA 1CJTC 3EZ7A 5GADl 2VBCA 1OFIA 2OO7A 4GOKA 3GLGA 4LUCA 4H9GA 3SEAA 4U00A 2KE5A 121PA 4YDHB 1TF7A 4LHWA 4EPTA 1R8QA 2GVDC 2QU8A 1FX0A 2C8VA 2CJWB 1XDBA 4MKGA 3IEUA 1G1MA 3LH5A 2XEXA 4AYXA 2JJ1D 1YQTA 4FD2A 1Z0DA 4Q4AA 1YR8A 2IYRA 3Q7QA 1IXSB 2N42A 2R65A 2OBNA 2QPAA 3KQKA 4XVQA 1OH7A 3TH5A 2QI9C 2RGCA 1CRPA 1NY5A 5FBWB 2YC4C 4MUAA 2CE2X 1AM4D 3CPJB 3IQXA 2WPDD 1CR0A 4R2IA 1HY3A 1K5GA 2LKCA 2ZRJA 4PQYA 4D0GA 4M9XA 2N46A 1OIVA 4PAQA 4TLDA 4LK2A 4P33A 1HA3A 4LPKA 3TK1A 4JIMA 4HAVA 3K0AB 1VCMA 1E79A 1NLZA 1KO1A 2ATVA 3HU2A 4W7SA 3W6NA 4D0NA 4FMBB 4POAA 1A82A 5FUXA 1S4QA 4NYIQ 2ORWA 5H68A 4DDWA 3Q8XB 1D9ZA 1Q0UA 3SZRA 3GLGE 4KCGA 4RY2A 1S0UA 2ZS7A 3CPEA 5G41A 1AN0A 2RMKA 1TMKA 1Q57A 2OCAA 2WOOA 3VHXA 1E1QA 1SXJB 2W2XA 3B7GA 2VQSA 1T9HA 2BJWA 5G40A 1W36D 2MSCB 2QUZA 4L9SA 1OXXK 2FA9A 4IKEA 4Q02A 1LNZA 2IYLD 1AZSC 1E96A 1U98A 2BIFA 2XB4A 3CF2A 3GFTA 4YDSA 5FBLB 3QXSA 3WYAA 1RRGA 4M21A 1ZU4A 4YC7A 4PSKA 1AKEA 3N2EA 1BS1A 1Q3HA 1WRBA 3A4MA 3E2IA 2XXAA 1G20E 2GXSA 2JEOA 1FUKA 2GBLC 2YWEA 1JI0A 5JECA 3KQLA 3ZIAD 1RVDA 2RGBA 2H16A 1KO8A 4FCWA 3PUYA 3U2QA 1NVVQ 2ZSFA 1BH2A 2HXSA 4JLVA 5KSPA 1N5IA 3GEEA 1WMSA 1G8PA 2X2FA 1YZKA 2GVZC 1KI6A 5BWMA 2BM1A 1SXJC 6Q21A 4ZKDA 1VHTA 1ELOA 5P21A 4NYIR 2PT5A 5CB6A 2O8EB 2GEVA 4C7OB 4B32A 3B1XA 4GOJA 421PA 4TQAA 4TMZA 1E9BA 2G88A 4ZDWA 1ZD9A 1ZUNB 2VSFA 4JLMA 2XOKA 5JJIA 1D5CA 4URXR 3K8YA 4PO8A 2WMNB 2ZEJA 5DHAA 1IXRC 3KXIA 3FKSD 1J8MF 2V1UA 3GJ3A 3EAQA 3W3AA 3I92A 2QPTA 4JJKA 3U44A 2YJTD 1YZTA 3C15C 4BFXA 3RC8A 1NKTA 2NO0A 2E87A 2FV8A 3AVOA 4G5QA 4EFLA 2BWJA 4WZAE 3GLFB 4AWXA 4BFWA 1YZUA 1KJZA 2QZ4A 2CCKA 5DIFA 4BFVA 2DR3A 4Q19A 3L2OB 4AC9A 3HYRA 4CT5A 2GAOA 2J7PD 2QM7A 1VECA 4B2IA 3T1QA 4M1SA 2WIAA 2WOJA 2OHFA 1U9IA 1JR3A 4I1VA 4OQMA 3QKSA 4B33A 5JCPA 1N25A 4A8JA 4JLJA 2JLUA 4C7OA 1MT0A 1FQJA 1T0JB 4KFSA 4OBEA 1U90A 3VR4A 1XBTA 2LWIA 1EWQA 4IFBA 1NNEA 3CO5A 4LV5B 1UM8A 1XZQA 1T4GA 1II9A 2GAAA 4NYJR 2BBOA 5EP2A 4EAQA 3OHMA 1DAGA 2C2HA 3ASYA 2RH5A 4EPXA 1CJVC 3CUEF 2O52A 4TMXA 1WA5A 3EC2A 1IJEA 3B1ZA 1IXZA 3D3QA 4QJ4A 1JR3E 2OSBA 2GZAA 2IS4A 1GWNA 1VIAA 2AFHE 3D31A 4JSTA 2GZDA 2GXQA 4LJAA 1XMVA 1X1RA 1X6VA 3SN6A 3TAUA 4C0SA 3SNHA 1JAHA 1N5KA 2R6DA 3LW7A 1WCV1 3QUSA 2QRZA 4URVR 1P2UA 2WJVA 2ZIAA 1NSTA 5D3QA 4LYAA 1DOAA 3SHFA 3VR1A 3U7HB 1XD2B 2V54A 3X1XA 5CB8A 4TL9A 5H1YA 5UKDA 2NO7A 2VP5A 3LDAA 4Q7KA 2ZRIA 3FE2A 4JVSB 1N2CE 1RW4A 5FUVA 2PEZA 1G5TA 1QBKC 1SGWA 1R5BA 1UPTA 2RGXA 1ZRHA 3IDQA 1II0A 4CW7A 2JA1A 2O8FA 3MWKA 3KKNA 2DYKA 4CZ2A 2UKDA 3P26A 5BYJA 2QORA 4TQ9A 1SULA 2VSXA 1JQLB 1HURA 3M0EA 5GJBA 2L0XA 1NJGA 5AJWA 5JI2E 1IY0A 1OF1A 2YHSA 3QI2A 3WMEA 4BLRA 1MKYA 4ESHA 3TGPA 3IQWA 5L8VA 2RGEA 4A2PA 1W4BA 3HJNA 4PPFA 2R62A 3MG9A 3DZ8A 1ZU5A 5IT5A 1UKZA 2FE4A 1KAOA 4GPTA 1QRAA 4RD1A 3GJ0A 5J4VA 2IXFA 1PLJA 1W4AA 1XCPA 3MUFA 1XTKA 2P0EA 4HZUA 3FFBA 1ETUA 3B60A 2CHQA 4QC2A 2PJRA 1KK1A 1AQYA 1Q1QA 2ZVQX 1N6OA 1RFLA 4UQOA 2V8OA 4PPQA 4AD8A 3FB4A 2D74A 4JT4A 2GJ9A 3RRYA 3TW8B 5FPKA 4NPHA 3RLFA 1I2DA 3DPUA 2J0UA 3GEIA 3MLEA 3DKVA 1CLUA 1GKYA 2BJVA 4EPWA 1OXUA 1UJ2A 2AXPA 4OQNA 5AUOB 3OE7D 3FTQA 1K5DA 2PLRA 2DFLA 1VPLA 3L0PA 1GL9B 3K70D 2BHRA 2QBYA 3QF4B 4Q03A 4LJ4A 1YZLA 1GRQA 3BAFA 1COWD 5AJXA 4DBLC 1UBEA 5EE3A 1OKKD 3FPAA 3B8HA 1Q20A 1TL7C 4B3CA 2XB2A 4QGAA 4P0TA 2G9NA 3UIEA 5GJVC 3TMKA 4KYIB 4WOPA 1ESNA 2FPMA 1W0JA 3AKDA 2IL1A 5FL3A 1BO6A 1II8B 4JBXA 5D3MB 5JWHA 2H5EA 5EJEA 1QHGA 2YC2C 3BD9A 4LJYA 4OQXA 3I8SA 4PAOA 2PZGA 1VG1A 5FTJA 2IX3A 5FR2A 1U8AA 3VR2A 1MH1A 3TUJC 4ZIRB 2RGDA 3PCRB 1TPZA 3PUXA 5JJLA 4ZI3A 1ZUIA 1Z5ZA 4M9SA 1N3BA 3C5HA 4AURA 4JLPA 1GILA 5F2EA 1OPXA 2GJSA 2V55B 2QBYB 3LY5A 1U0HC 2Q0HA 1TU4A 3MRSA 3CWQA 1W0JD 1P62B 2P65A 1J2JA 1Q1EA 1UADA 4RD0A 2ZRAA 4ZCIA 4ZPXA 4EJSC 3WRXC 1XNJA 4NHOA 2IF2A 1S96A 3RNLA 1YKSA 2R9VA 3H2YA 1H8EA 2VPPA 3HDTA 3I8XA 4EJSA 1NY6A 4G01B 4X8MA 1DAKA 1FQKA 821PA 4HZIA 3L8YA 5DSZA 2B8WA 4KXFB 5DISB 1SKYE 4MDFA 1JXMA 4Q5IA 2CEAA 4LHVA 4NCIA 1T6NA 2XJ9A 1VYVA 1WP9A 3B1VA 4PSAA 3K9HA 4NCHA 1R0WA 3RSOA 5EXXA 4CDGA 4M22A 3N70A 1GNRA 2IYQA 2G77B 2GF0A 2P67A 4OK6A 3ZH9B 1E4VA 1HYQA 1J90A 2JDID 2YWGA 2A9KA 2O0JA 2PT7A 2MMGA 4PC6A 2OXRA 1RYFA 1AS0A 4OQFA 1XRJA 4OK5A 1SVSA 3A4LA 1W44A 4EFMA 3IBGA 5FI0B 5L3SB 1DAHA 4WZBE 3CRW1 4Q9LA 2EFCB 3RDPA 3EPKA 1K8RA 2QY9A 4QGHA 2XTMA 2AKAB 1DO2A 1N5JA 5CLQA 3M1IA 3U3KA 2GETA 2R44A 3CH5A 3ZJYA 3AGPA 3MMPA 2F9LA 3U4QA 3A6PC 4DCVA 2JLQA 3NG1A 3SE0A 5CITA 1CEEA 1EFHA 2QTFA 3V00A 2WJJA 4HLCA 1A2BA 1RJ9B 1FP7A 5KPJA 1FP6A 3K70C 3CR8A 2O0KA 1LS6A 2FOLA 4A4DA 3VKWA 4DT1B 3NH6A 2ZR0A 2XSZD 2VHJA 5LB2A 1I2MA 2GDJA 2ZI5A 1KDTA 4LPSA 3EA0A 2J0UB 4B35A 1P72A 3CPHA 2FSFA 1XU4A 5L3QA 2C9CA 1IM2A 1N6IA 2Z4SA 3PQCA 2OM2A 1OE0A 2A5JA 3LQQA 4A82A 2OBMA 4PANA 1SHZA 2VF7A 3U7GA 1QHHB 1OIXA 1R0XA 2QNRA 5BXQC 4G0NA 4MA4A 1XEXB 4JKIA 1NVXQ 3QKUA 5DI3A 3DM5A 3GJ6A 3J81k 2AWOA 1RE0A 4LWZA 5B58C 1FX0B 3K9NA 4QJ5A 2IWHA 4LSGA 4CEHA 5J40A 1FOEB 4V0OA 4A2WA 3CNLA 4OI2A 1SVIA 5C4MA 5HR5A 2D06A 4AKEA 1JNYA 1LW7A 3N5CA 1IOZA 3L0IB 4AY2A 1GKUB 3TJZA 3ZD6A 1COWA 3GLIA 4RD3A 1WDTA 1JJVA 5BW8A 1IN5A 1S3SA 4HB4A 5M04A 3TUZC 2IYXA 1U8ZA 2OXCA 2Z6VA 3BXZA 3IO3A 3HPQA 4NBSA 1F2UB 1KY3A 1LVGA 2XXAB 4IJMA 3WP1B 3KUDA 3REFA 1TEVA 4TYNA 1QHNA 3THWA 1NSFA 2ZJZA 3M4YA 3R7WB 1H8HD 3CRRA 2QMOA 3SYNA 4I99A 5HZKA 3KKQA 5EXSA 5GJCA 2AR7A 3RWOA 1XPOA 1W4RA 4PFSA 1YVDA 1Z6XA 2IEZA 2ZI7A 5KTYA 4GDFA 1Z0AA 1ZCAA 2XTZA 4DLZA 3KB1A 1NJFA 4M1YA 3FKQA 4IRUB 2F1IA 3CONA 4RVCA 1G4AE 2ZJBA 3U7FB 1C4OA 4ASUA 1YE8A 3MGCA 1EFUA 1J7KA 621PA 4GI7A 5HE8A 2NO9A 3I5XA 3M6AA 4OKSA 4B34A 3RAPR 1S1CA 1W2HA 4IDNA 3BH6A 4KVAA 1PVOA 2JJ1A 5TV2A 2HJGA 4O2LA 4TMKA 4DB4A 1SKYB 3F0TA 1KK2A 2FJUA 5J47A 5HKKD 2O8DB 5FOSA 1BIFA 1G3IA 5JMTA 1UKEA 2QSZA 2R6CA 1U8YA 1WE2A 1FMJA 2ZJ8A 3IEVA 2G0TA 3BWDD 3ZGXA 2F3TA 4Z54A 2ZR9A 4KFRA 4BFYA 2QPOA 2P6RA 4P3YA 1QVRA 1EFCA 4A1FA 2WZQA 3UK6A 3REGA 2IT1A 5C1BA 1EFTA 8OHMA 5LD2C 5KNDA 4Z1MD 4DRZA 2W0SA 3AP1A 3D7MA 2ZM5A 2O8FB 1XMIA 1IN6A 4F4JA 3THYB 1Q1BA 1CXZA 3K53A 1GUAA 1IN7A 2QROA 3EC1A 3WBJA 5IK2D 3GJXC 4QBHA 4LHZA 3X1ZA 1XTJA 3AKEA 5BN3A 4PC7A 3BE4A 4HAWA 2Q21A 3BGWA 1T5LA 4XH9B 1RPZA 3B82A 3VHLB 2HYIC 3LFUA 1SZPA 3LLUA 4DSOA 1G6OA 4B75A 1KNQA 4IOLA 4A0GA 1F2UA 2MSDB 4JS0A 4JYBA 2FFHA 4UNQA 4RZXA 1NN3A 1M34E 5JZVA 4Q1AA 4DLVA 2AWNA 2VP2A 2EWVA 3KKMA 1VCIA 3UWOA 2C9OA 2GEUA 2ZVPX 2ZSDA 4M53A 2C04A 2CK3D 5JSZB 1R2QA 2WWWA 3UXMA 4MH0R 4NCJA 2YNMA 1TNDA 1KZ7B 1QHHA 3Q7PA 4BLPA 4DZZA 4L15A 2D3WA 3ZLJA 1ZNWA 2J7KA 2G1KA 2ZAOA 4HLDA 2GXUA 3P32A 1D2EA 4UKDA 2FH5B 5IRCD 5J4HA 3R8CA 4AG5A 1BKDR 1L8QA 5JRZA 4JLNA 3KXKA 2A5YB 1XCMA 4I1UA 2HT1A 4A8JB 2VA8A 4P31A 4U02A 4PTLA 2WBLC 4V02A 4BLSA 4R71A 1U9IC 1R5NA 3ZZ0A 5DYIA 1P61B 2WWHA 3IIJA 4XSHA 2FF7A 1DVRA 4XVUA 2FPKA 2UZIR 3EG5A 3QKSB 1E9DA 4OL0A 1TAGA 2BC9A 2OUKA 1HQCA 1KK3A 2FGKA 3W3ZB 2ZS9A 3LVRE 3OFNA 5J4KA 2XOKD 2NGRA 4PX9A 4C4PA 3KDSE 4TSFD 2BMEA 1XTRA 3ASZA 1G19A 3FKSA 2WAXA 4TYPA 1E1QD 3SJBA 5TXGA 3I5YA 1NP6A 2QGZA 2B7BA 2G0NA 2NZ8A 3G82C 4QL3A 1VG9B 5CJPA 2VYFA 3QSYA 3RHFA 4MDEA 5AK0A 3K70B 1G3RA 4IEEA 1KI7A 5FL7D 1XF9A 1SXJA 4FWTA 2CL7X 4BPBA 2ZYTX 3RS5A 4A2QA 2ZANA 3TIFA 2GJKA 2F9MA 3AKCA 4JL8A 3BORA 2HF8A 4C0KA 2FMXA 3NBFA 1T5IA 1GNQA 2DFKB 4Q47A 1XPUA 1S9HA 3DMNA 5FH9A 1KNXA 2VHCA 2BMFA 2QTHA 4QNMA 4W5HA 2QEQA 2IHYA 3QJYA 4HB0A 4N1AA 1XJQA 5FOWA 4C0BA 1W5SA 3AF3A 3QG1A 3QF4A 1C9KA 2JJ2D 1CR4A 4P4SA 4Z51A 3K9LA 2GNOA 3AM1A 5KHOC 1F48A 3UMRA 2FU5C 5FTNA 4LJ6A 4MRVA 2QT0A 4UXIA 3K0EA 5EE9A 2EFHB 3B5JA 1NN5A 5E4FA 5FBRB 1XPRA 1I4DD 4RKEA 2Z83A 1E2IA 3E70C 3T61A 1RIFA 2OFOA 3RRNA 1GDDA 4IXMA 2YOGA 4RCZA 1ZD8A 1G3MA 2B7CA 3IBYA 5KNBA 3TSZA 1ZW6A 5SZKB 4B3GA 1IN4A 1W0KA 3P20A 4LBWA 1OLOA 4DCTA 5JFGA 3OIUA 3EPLA 1OFHA 2HLDD 5CJ2A 2JLXA 4QGFA 5KSYA 1Z6GA 4PHTA 3HPRA 2J7PA 2EFDB 5A0FA 5EZ5A 1TF2A 4DCUA 5IK2A 2ZRPA 1YHNA 3H4MA 3AVUA 2GJAA 1N0VC 4Q4LA 1U99A 5LD2B 4OYHA 4HDCA 4DCSA 4LY6A 4UXJA 4B2LA 3PVSA 2F7SA 2ANBA 4M2LA 5EP3A 4GZMA 3LQRA 3AVQA 1KO5A 5CIWA 4MRSA 1ZM3A 3IO5A 5AUPB 1N6PA 5J5CA 4LJ8A 1XTQA 2A30A 4BE7B 1XJ0A 3TSOA 2WSSA 3PEWA 4OHYA 2CLDX 2VF8A 3TLXA 3OIVA 3ZS9A 1IY1A 1NMYA 3ICEA 2CCGA 1LF5A 2P6UA 3ADKA 4MRRA 521PA 1FTSA 1RZ3A 4AKGA 2VLIA 2W6IA 1NI3A 4OHXA 1Z0IA 2DBYA 3CX6A 3MJRA 4MGIR 5LDDC 1XD9A 2TMKA 1F60A 2DFNA 3W5JA 4M1TA 1E6CA 3K9GA 2KB0A 1LY1A 2WSMA 4X8OA 3IIKA 1EK0A 1ZP6A 3VFDA 3MD0A 4NYMQ 5HTKA 1JEEA 1KI6B 2OAQ1 2BKEA 4NZYA 4EIWA 3I72A 4C2TA 1TADA 3IUYA 2GK7A 2ZR7A 3LBHA 4TZ0A 3ECCA 2AXNA 4M9QA 2QRNA 4BUJA 4LV8B 4KU4A 2ZRGA 4B71A 1S2MA 1HE1C 4OI4A 1G5RA 1ZIPA 1RYHA 2PZEA 5DN6A 2W6ID 2OESA 2KWIA 4K81B 3G0HA 4IOMA 3KUCA 4BFZA 1OKKA 2MMCA 4KSBA 4OHVA 1J99A 1VKJA 4XVRA 4IW3B 3RANA 5K8IA 4IOKA 4Q00A 1TTTA 3PG5A 5C2JB 5G3YA 1N0WA 1KKLA 4LCBA 5TY0A 2Y8EA 2PEYA 2AKYA 1H65A 4S35A 1HT2E 4JL6A 1AJEA 3A1WA 2ODWA 4CEIB 2OILA 4S2EA 2GEDA 1G17A 3GLHB 4D81A 3DZDA 3QKRB 1TUIA 2QQ0A 2QT1A 4UNRA 3PITA 1FNMA 4DSNA 2J0SA 3B85A 5EZ6B 3AVXA 2WWGA 3LRPA 1HT1E 1MO3A 2ZI9A 3O8DA 3TW4A 3EPJA 3LX8A 4Q9JA 2WV9A 3X1DA 1AK2A 1Z3IX 1RRPA 4XTCS 3A1VA 3W90A 4EKDA 3DOEA 3FMPB 4ZO4A 4C0HA 3Q85A 1G21E 3OAAA 3AVVA 2P2LA 1IAQA 3GLIB 1W2GA 4YQFA 2PLFA 4IDPA 5KO2A 4NONA 3U60B 2ZRCA 4LHYA 4V0ME 4M1KA 3T12A 3KKOA 1KMHB 1KI8A 1YR7A 3LA6A 3QXCA 4RZUA 2J0QA 3QQ5A 4LHXA 1Z2AA 5CYPA 1N6HA 3GCGA 1UFQA 3DVLA 4IFEA 1G3UA 1FTNA 2FSIA 1F3OA 2F43A 2YV5A 2YZ2A 3KXLA 3WYGA 4FIDA 4PHFA 3P1JA 4Q1DA 3I32A 3QVUA 1F5NA 4BRWA 2OV2A 4LBVA 1G8HA 2CHVA 3V4FA 2BM0A 2Z4RA 3AQ4A 1E4YA 3WMFA 1MV5A 1MRNA 4V0MA 1YZNA 3VNVA 3PJRA 4Q9IA 4MRNA 4CYMA 1AIPA 1JB1A 1ZM2A 2GCNA 3PEVA 4KHZA 5KDLA 5DGXA 3GMTA 3U61B 3DOFA 5HKKA 2HEIA 2GCOA 3U3OA 4ESVA 1PV4A 3AH8A 3C5CA 4DDUA 1OH8A 4AI6A 3IILA 4EDHA 4D4LA 3LO5A 3NC1C 2O8CB 2O8BB 2YOFA 3ND8A 3VNUA 1E69A 4DKXA 4NCKA 3H0KA 2FFAA 3QBVA 1J70A 1E1RD 4FCVA 2RCNA 2GK6A 2ZXUA 3NTUA 3H86A 1N6LA 4GSYA 4UNPA 4Q4HB 2Q3MA 3QXXA 4NL4H 1U0JA 1ZD1A 4V0KA 2EFGA 4JVNA 3KB2A 4CEHB 2QP4A 3BIFA 2QA5A 4D4KA 1CP2A 1W47A 2ZUCA 1VYUA 2XSZA 2QAGA 1Q3TA 1H8ED 3O8RA 4URUR 1KJWA 1IY2A 1EGAA 3VR5A 2GZHA 3BRWD 4JLOA 4LX0A 2ZU6A 2PMKA 1NLFA 1Z83A 1VTKA 2SHKA 1KGDA 3FDIA 2P6NA 2ZRKA 1OH6A 2H57A 1ZM9A 1T8UA 1KO4A 4DSTA 1RJ9A 4TZ6A 3EARA 4M4SA 1R7RA 2ZUBA 5EXPA 2Z0MA 2CJWA 1Z0KA 2N1BA 4U7DA 1EFRA 2CK3A 3D6TB 3T15A 1QF9A 4HSEA 4JKYA 1NF3A 1KOFA 4LC0A 3QKTA 4DIDA 1YRAA 3ZS8A 2G3YA 221PA 1E0JA 4FN5A 2G6BA 1J8YF 5J4LA 1AQUA 2GA8A 2HV8A 5DI9A 5TVKA 4C0AC 1NL3A 4V0LA 4DCNA 1KDOA 1UBFA 3OEEA 5HCIA 5JI3E 3HYTA 2JIZD 2ONJA 2JLZA 3Q72A 2WWXA 3RS3A 1PZNA 3TBKA 2YWFA 1YR6A 4J0QA 2CXXA 3HP1A 4QRHA 4JMPA 4GMXA 4US2R 2I1QA 2ZYVX 3FHCB 3PXGA 3K0CA 2NG1A 4MYCA 1QG2A 2PH1A 1VMAA 3KJHA 5ELXA 4ACAA 2RB4A 2XNSA 4TT3D 1KHTA 5LB4A 2HJVA 3QPVA 4DLYA 2XZPA 2A5GA 4MQBA 3VQTA 5LPNA 2H18A 2XNDD 1QG4A 3BBPA 4BFTA 4EPVA 3OEED 2B92A 1XP8A 1X1SA 3QNUA 3MSXA 3QXHA 1GNPA 2Q9BA 1HE8B 4Q18A 4ABYA 1DPFA 4B74A 4ASUD 2JLYA 2VH5R 4FMCB 4XWKA 4G5RA 3B9QA 4EQ6A 3FMOB 1AGPA 3VR3A 1HUQA 2DWOA 3FFAA 1GP2A 4PAMA 5FL7A 1SQ5A 1VG0B 2IF0A 4HATA 3GFOA 2C98A 2OLKA 4QXAA 4BZQA 4GT1A 3TRFA 1L7VC 3DEFA 3PUVA 3W34A 2Q9CA 4QJ3A 2VP0A 3HU1A 4IDOA 1X86B 2J46A 4I4LA 3BB1A 3L8ZA 3ND9A 1E2QA 2A7QA 2G83A 3LV8A 4JBYA 1X3SA 4LYJA 1QHSA 4NKRA 4B3DA 4D4JA 4TYWA 2WJIA 3FYHA 3VAAA 4W5JA 3KFXA 2XGJA 4Z1MA 1GRRA 4NP6A 5FI1B 5JJKA 4I1OA 2VP6A 3WNCA 2Q3HA 3UMFA 1YJ5A 1G16A 3RRMA 1QHIA 1TX4B 5DO9A 1E2NA 2VL7A 1PUIA 4CEJB 3GFPA 1DARA 3T5GA 3CX8A 2QMHA 4II7A 4YMTA 4XD7D 3LX5A 1E2DA 2X8AA 3X1WA 5JBQA 1Z6AA 5HZHA 2BCGY 3ADBA 1KI1A 3SBEA 2XTNA 1MABB 4XJXA 3IIMA 4HB3A 4MYUA 4B47A 3KQNA 2BBWA 1E2PA 2FG5A 3AKYA 4DSUA 2GILA 3FWYA 3GJ7A 3V4RA 1U0LA 4Q1EA 3R9WA 1KTVA 4NDZA 2KSQA 4GMDA 1KSJA 3NKVA 2X1VA 1LB1B 2ZRFA 2BMDA 1E2MA 2ZE8A 4D4MA 5KDDA 4ILEA 4C0LA 4TMVA 4XIGS 3B13B 1CR2A 5DYGA 3UPUA 2WAYA 1AZTA 1Y63A 1W4CA 3QPWA 3QVVA 4QFMA 1B23P 1NRJB 2A5DA 3EIEA 3T5DA 2F1JA 4IEIA 3U3RA 2H7VA 2ZTSA 4WZ6A 1ZCBA 4DB2A 5JCZA 4DVGA 2PX3A 2AD5A 1W7AA 2GKSA 4N0EA 2ZPTX 1S9DA 3RYTC 5CDFE 4G5OA 4N3NA 3WYFA 1PLKA 2IUUA 4M0LA 2CVFA 2H17A 1OB2A 5JWRA 1Z22A 1F2TB 1LS1A 4OI1A 4OK3A 1ZC3A 2C95A 1US8B 3C14C 3T06B 4W9MC 4TMTA 3B2EA 4TL7A 3RWMB 2JJ8A 1KYIA 1XD2A 1RRFA 2YYZA 2ZRBA 1DAEA 3QY0A 2O5VA 1E2GA 1Y3AA 1LTQA 1W5TA 1YZGA 4NTZA 1KSHA 3NXSA 5SZHB 4N0DA 2UZ3A 3GLFA 4AKIA 1G6HA 1I4LD 4US1R 4IXNA 4JVMA 5CIQA 3SYKA 2AN9A 1XEFA 3D8BA 5F3WB 1TQ2A 3ZYCA 1EXMA 3WBKA 2VP4A 4Q9KA 1GSIA 4TYQA 1GG2A 3BOSA 1G18A 2Q9AA 4LJ5A 2C5LA 2RAPA 4FI3C 3SBDA 3ZZTA 2I1VB 5EUMA 1GITA 1EG7A 3BB3A 3QF7A 4PHHA 3ADCA 3H1TA 4EUNA 2JJ2A 1FUUA 1G7CA 4BLQA 1KY2A 3W8NA 4IVPA 1X8KA 4B48A 4Q21A 4R9UC 5TB5A 1Q12A 1NN1A 5E7JA 5H70A 5B64A 1GL6A 1DADA 3WNBA 2J87A 1NN0A 3THXA 1Z28A 3LLMA 3AVTA 2WIBA 1ZYUA 5C46F 4BLOA 1IBRA 1GFIA 1W48A 5JS7A 3A37A 3RC3A 2OCBA 2VIIA 1UKYA 3CB4A 4Q4HA 3T35A 4C0JA 4JT2A 2GCOB 1JQJC 4DLUA 4A8JC 1GIAA 3CBQA 5FTKA 3H84A 2IYYA 5B30A 4PC2A 1M74A 1M6NA 4JZKA 3CRMA 5AR1A 1KIMA 5FBQB 3W8RA 1OH5A 1E0KA 1Q22A 5EE0A 3SR0A 3THYA 2CLSA 4L4UA 5C18A 1GAJA 4JLDA 3AEZA 4OI0A 3A1UA 1OFUX 1KI9A 2VEDA 4JL5A 4JYCA 2AX4A 1XFAA 2FEMA 2IXEA 2YWHA 3DM9B 2FSGA 1NBME 2EW1A 3C7KA 3TR0A 2O8EA 1FZQA 3AUXA 3EZ6A 2H1LA 4MGZR 4BGDA 3SJCA 2PCJA 2DPXA 1Z06A 1OFTA 1S3GA 3F5FA 2IEYA 2PZFA 3K09A 2QE7A 1NIJA 1SVMA 4XWOA 2QMEA 1P75A 3NH9A 2ZJ5A 4PPGA 4BASA 2EU8A 4OJQA 1P9WA 4M1MA 2PMDA 1SVWA 2QG6A 1M7BA 4ON9A 3OEHA 2FEOA 2RGGA 4KBGA 4TTQA 5HE9A 4GFDA 1E9SA 2B6HA 3GJ4A 3MCAA 2PJZA 2D7DA 4WW0A 5KSZA 3F8TA 3NWJA 4HUQB 5GJWC 4AYWA 1CF4A 5DHFA 3EIHA 4F4CA 4EJSB 4QKQA 3K1JA 2GBLA 3P4YA 3SJAA 4CEIA 1HV8A 3NBXX 2KBFA 2JDIA 2O8BA 2NZJA 1P2TA 2HLDA 3AF0A 1IJFA 2RHMA 2PBRA 5AJVB 2OAP1 3JZAA 5G3ZA 1EX6A 1OYYA 2YVUA 1KSFX 5F98A 2BVNA 3L43A 4L9WA 1WQ1R 4LRWA 1E94E 3AB3A 5C4GB 1M7GA 3GD7A 3AUYA 2IUSA 3U3JA 2QGNA 4B3XA 2IYWA 1SHKA 1OIWA 1EX7A 4A92A 1CBUA 5DLQC 1KDPA 1UEJA 1I4TD 2H92A 1II8A 1OYWA 3ONWA 1BYIA 1XEWX 2ZAMA 1B0UA 5L3SA 4LYFA 1NG1A 1EFRD 4BWYA 2CLCX 1BOFA 2CMKA 2FFBA 3EZFA 1FFHA 2OCYC 4BEJA 3I62A 3I4LA 2C96A 2J1LA 1ANKA 1E2FA 1UKVY 4UJ5A 3RABA 2AFIE 4QBFA 2K5UA 4AKHA 1OHHD 1CTQA 3PUZA 3LXXA 1GL7A 2XITA 2A5FA 2GRJA 3HWSA 4BEBA 4HUTA 1VCOA 2E1RA 2R8RA 4XWAA 3WMGA 4CRWB 4XOIA 4WIAA 2FZ4A 4A0RA 1W36B 1Z08A 4M8NE 5CYOA 2HDNB 1U81A 4DHEA 2QP9X 3WNDA 2GJ8A 4FMDF 4B44A 1E2EA 4P4SB 1MR3F 2NTYC 4DT1A 3UATA 1VHLA 1AA9A 1JECA 3AF4A 2QAJA 5BQ5A 3U3MA 3UANA 2CVHA 3EPHA 1P4SA 4QHSA 3CZPA 2IS2A 2F1RA 3BK7A 2Z43A 1A4RA 1W46A 1XMJA 4F92B 1E0AA 1CIPA 2DB3A 1Z6YA 2ZYWX 1P7CA 2ORVA 2P3SA 4ZV4A 2V1XA 5JHGB 3EA5A 3SQXA 2ZROA 5FPTA 4H1VA 4A0FA 1GM5A 1LF0A 2VP9A 5EE5B 1DE0A 3HR7A 4EPYA 2OLJA 3B1WA 1G64A 2FFQA 1SVLA 3OZXA 2FDCA 3HU3A 3NVAA 2HCJB 1CJMA 1P60A 3OE7A 1CJKC 1G5PA 1DTSA 3RS4A 2HYDA 1T3SA 1P5ZB 3MWLA 2IC5A 1P3JA 2KJQA 3THOA 3T34A 1T8TA 4WA7A 1CU1A 3TAHA 4DLWA 4U5XA 3IPXA 1Z2CA 3A36A 2GHIA 3AP2A 5KYKA 3QIAA 4US0R 2ZSBA 2D2FA 3SFZA 3ZZUA 4QNRA 3GEHA 2QM8A 4URWR 2ODBA 3TE6A 1A7JA 1PUJA 3PUWA 1PLLA 3TQFA 1GOTA 1YRBA 2OCPA 4DUGA 5CM9C 4MYHA 2WKQA 3LVQE 4IHQA 2G1JA 4BFSA 3WP0A 2FZLA 3AVYA 2ZI6A 1DG3A 2H8KA 4ZI2A 3ZDQA 3KQUA 2RGAA 4EFNA 2OZEA 2ZSEA 1Q21A 3SI7A 4A36A 1E9EA 3AVWA 1VCNA 4F4IA 3KTAA 4XD7A 2WJHA 3U6KA 4PHGA 3KJIA 3FMIA 4KLNA 1XEWY 4PR0A 3S1AA 2V6JA 4Q48A 1GTVA 2ORIA 1PJRA 1XXHE 4Z8YA 4DXAA 3KFVA 4X8HA 2DWPA 2IUTA 4JJZA 4NYJQ 1TU3A 2IS6A 1N6KA 5JSZA 3CWZA 3KJEA 2GTPA 2EFEB 4JBWA 5A4JA 1TQDA 1E98A 4WBSA 2DWQA 2VHTA 2E9SA 1G9XA 1TF5A 3VU9B 1S8FA 2IS1A 4L16A 3DMDA 2WWFA 2GWHA 4DWJA 3EW9A 4B43A 2ZE5A 1ZVQA 3GJ5A 4PO9A 5CM8B 2ERXA 4DEXA 1G8YA 4WVFA 4IVRA 3AF1A 1ZC4A 4GP7A 3UKDA 4HAYA 4HYYA 4E22A 4O2RA 4DLXA 1BMFA 4GBMA 2AK3A 4ZCLA 3VMFA 2B8TA 1P2VA 3VX4A 2NO1A 1CULC 2WHXA 4NCNA 1KAGA 4BZPA 2OFXA 4PXAA 4FMCF 2ANCA 4D25A 3PR1A 5B57C 3K09C 1MOZA 4MRPA 2AHOA 1V43A 1OJLA 1S1MA 3O8CA 5FFMA 2Q3FA 4YONB 4ZKEA 1P6XA 2XJ4A 3QOFA 4RZ2A 1JBKA 4TL8A 2V7QA 4RKFA 3OIYA 3FVQA 2F43B 2HT6A 2AL7A 2JLWA 3B9PA 1MABA 1E2HA 1G8GA 1WBDA 4HAUA 3I61A 4D26A 2ATXA 5DNYB 5JLJA 2J59A 2JLVA 3QENA 4M1WA 5FUYA 1W1WA 1CKEA 2VSOA 1DAIA 2DFTA 4DLSA 4G3XA 2DCUA 1IHUA 1ZAKA 5G53C 3PENA 2REXB 3ZQJA 2REOA 4MITA 3OIWA 3NEJA 2JIZA 2IYTA 4B6FA 4A6PA 1ZM7A 3OF5A 1M2OB 3FMFA 1Q44A 4MYTA 5KOYA 1MO5A 2QP3A 1VG8A 1E9RA 3GLHA 4GZLA 1G291 4LI0A 3TSWA 4D2IA 5HCNA 3PIRA 2IYUA 4E07A 3BB4A 3LBNA 4KODA 2GXAA 5DE3A 3RS2A 2FWRA 2ZYUX 2CDNA 1T3LA 5FTMA 4C9BA 3IGFA 1XTIA 1SKQA 1P2SA 1SXJD 3CRQA 1ZINA 3K0CC 4QHTA 4ZDJA 3TVTA 1OXVA 4AYTA 4CT4B 3VR6A 1DS6A 1OXSC 1V5WA 4RFSA 4G1UC 3KX2A 3N2IA 1LV7A 1D6JA 3SDZA 1VYTA 4YMSA 4TTPA 3Q3JB 5FPSA 4B6EA 2IYVA 4WXPA 2J41A 3RVBA 3EZ2A 2WICA 2WTUA 2XX3A 3THXB 4RJLA 4GL2A 2JASA 4JVLA 2ODEA 4UNNA 5AJYA 1H8HA 2ERYA 2REBA 2R2AA 4LBYA 1AGRA 1WBBA 4I81A 2F55A 1TUEA 4AK9A 3EIQA 3OESA 1D2MA 4HUQA 4LDJA 1DBSA 3HR8A 4C0QC 4CIDA 3B78A 1NLYA 3VKHA 2BEKA 1N5LA 1GRNA 3AVPA 3K0FA 4ARZA 2BEJA 2WPDA 1N6NA 4GOXA 4LZZA 2NIPA 4L8GA 2AK2A 5IDVA 4D82A 4GNKA 2I3BA 2WWIA 1W0KD 5FUWA 1VDZA 4TLEA 4IVQA 1ZUHA 3QEOA 2P5SA 2QMUA 3CM0A 1JALA 1M1YE 1AS2A 2IYSA 1CS4C 3CH4B 3OEHD 1WXQA 3TKLA 3UWKA 721PA 2CNWA 4UXHA 1ZBDA 2I4IA 1G41A 2DHRA 4HDQB 1G4UR 4MUBA 1QVAA 4ITRC 2QL6A 3R9XA 3C16C 3WHKA 1JAIA 1UBCA 4RZ3A 5F9HA 2W00A 2ZE7A 5TMPA 1DG1G 3MWYW 4NH0A 4NYMR 2W0MA 5GVSA 4B3FX 5E95A 1G7TA 1KDRA 5F9FA 3AV0B 1MO4A 3U6BA 1Z63A 3W5IA 2XZOA 1ZNZA 1XCGB 4B2PA 2J45A 3ZVLA 5B2ZA 3ZVMA 3R8FA 4RD6A 3VTKA 1XJCA 2CNWD 1KMQA 2BOVA 2EWWA 4HLQB 4KBFA 4HZUB 2CE7A 3CW2A 1UDWA 4KYUA 4HLUA 4Y0VA 3UG6A 4C3ZA 2V4ZA 1NMZA 2D4HA 2WM9B 2V7QD 1OT3A 3FGNA 1DO0A 2GESA 3NIBA 2VRWA 2ZI4A 1ZJ6A 4UNSA 2V3CC 2HUPA 3CLVA 1KKMA 1P73A 5LBIA 2X2EA 3L0OA 4ACBA 4DLRA 1FPMA 1ZMXA 2JATA 2IA5A 5FOXA 2OEPA 3ZVRA 1FNNA 3GLFE 4LV6A 5L3QB 1OW3B 1OSNA 2IK8A 2X19A 3LW8A 4Q1FA 4TT3A 3GLIE 2ZJOA 5SZIA 5DN6D 4UJ3A 3QBTA 3R7WA 4MKFA 2V9PA 2BBTA 4ZCMA 1R4AA 2FN4A 1R6BX 2FX3A 3A4NA 3NBZC 4Q4JA 4R98A 2QENA 2IXGA 4DDVA 4PPNA 4WXRA 4BQSA 3BFKA 3Q9LA 4GP6A 4MKHA 4E03A 1NMXA 2QQEA 3L82B 3QEJA 4OHWA 3T1OA 4ERNA 4BLTA 4CEJA 2Z5FA 1NIPA 1TQ6A 2ZSAA 5JEDA 2J5XA 2ZS8A 1KI2A 1O87A 2RGNC 2JLRA 3B6EA 3DKPA 2VO1A 3R20A 2B21A 4PC3A 3I1FA 2IWRA 2DY1A 2WKRA 4LBZA 4R7ZA 4K46A 3RSLA 1JR3D 3KTAB 3OFND 3CNOA 4FXPA 4KAXA 5EP1A 5JRJA 4TYYA 5GVRA 4TSFA 5DI3B 5FPHA 2ZE6A 4DC9A 4W5WA 2CCJA 3E1SA 1G7RA 1E32A 2R6GA 4E09A 3LAWA 3IPYA 3IKJA 4DLTA 3V9PA 2ZJ2A 1JJ7A 2C9YA 3DDCA 3JZMA 3K0AA 4Q66C 4D6PA 2HCBA 5ANRB 4IOJA 3VX3A 3VKGA 1L4UA 4Q1BA 4QM7A 4DEYA 4CGZA 4L5BA 1QHXA 3NBYC 5KU1A 5FOVA 1G3QA 2JAQA 1IN8A 4TWZA 5AUQA 3W9YA 4QG7A 2IHBA 1E3MA 1HH4A 5CDFA 3QXJA 4G5GA 2ECKA 4F93B 3DL0A 4CVNA 5JWOA 1LFDB 1FW6A 2FGJA 1D9XA 4C2UA 4YLGA 4KFUA 2ZJYA 1DEKA 2ZRNA 1N0UA 3CX7A 2R6AA 1DAFA 4RFVA 3O47A 1A5TA 4AG6A 3I73A 1U94A 5AUNB 2QAGB 1R8SA 3MJHA 1X8JA 4TLAA 5EUQB 1US8A 3LD9A 2NMVA 2QSYA 4QOSA 3F3YA 3L0SA 4ZIRA 3ADDA 3PV0A 4NE2A 2GF9A 4PSVA 1YR9A 3TNFA 5JHHB 3KZ1E 5E7MA 2PX0A 2X77A 1C1YA 2UVQA 1A2KC 4I1SA 1CRQA 4QHYA 4TTRA 1P9RA 1Z8FA 4A6XA 4PQRA 2W2VA 4D80A 3BS4A 2C78A 2NQ2C 5BN4A 4M9ZA 1D8TA 1OV4A 2A2ZA 4O0MA 3A8TA 2J0VA 2QN6A 4Q7JB 4DIEA 1ESMA 1IONA 3FHOA 4JLBA 2V6IA 4Q4JB 3SHWA 4URYR 5FTLA 2FSHA 2D2EA 1ZIOA 3K0SA 2W6JD 2FNAA 5SZJA 2F3RA 2BMJA 1Z29A 5KSOA 4HB2A 3GPLA 1A1VA 2WMOB 3C4JA 1R0ZA 4KLZA 5A5GA 3BH7A 3CF6R 1JXOA 1FMLA 3LNCA 1T91A 4MGYR 3WHLA 3LBIA 3TVDA 3ICQB 3PFIA 3DHWC 2C03A 1HQYE 5E7IA 2VTKA 2WSSD 5EQTA 1O3YA 5J4YA 3EZ9A 5E3HA 1G7SA 2ASEA 4PZYA 5FR1A 5JEEA 2OT3B 1E0SA 5D3MA 2NO6A 2J9RA 1M8PA 3PEYA 1W36C 4OHZA 3NHBA 2RHDA 4HI0E 1XTSA 2EQBA 1NG9A 3EXAA 1HEIA 4Q9HA 4YMVA 2RKOA 3WRYC 1GVNB 5FPYA 5KNCA 1MRSA 3S1AB 3U7EB 4LJ9A 3X2SA 4KI0A 1ONBA 2A3RA 4G5SA 4PQFA 5BN5A 2YKGA 2KBEA 3U5ZB 1DAMA 2ZI3A 4HEJA 1XXHA 2W83A 4LC1A 3CIOA 2WVJA 5L3RA 2OG2A 3K0FB 2W2TA 3IHWA 4PO1A 4LYHA 2XNDA 4Q01A 1NVWQ 2GCPA 1GKIA 4FINA 1E99A 1T0HB 3CKLA 1E2KA 3SFVA 4TLCA 1NKSA 1AS3A 2ZRLA 3P4XA 3Q5DA 2YINC 1TQ4A 2JLSA 5CK5A 4B73A 5AJZA 4HAXA 3G5UA 3MAAC 2CBZA 4MKIA 1P9NA 4IDHA 3A1SA 4DUGD 3GLHE 2FPLA 2LKDA 5CK4A 2C99A 5AWFC 4C30A 1KO7A 4O3MA 4TMWA 3R9IA 1JPNA 1EESA 3X1YA 3AGQA 3SQWA 4V0NA 3FHTA 4H1UA 4QM6A 4XTRA 4Y0AA 4D0LB 1ODFA 3NHAA 5DH9A 3JVVA 3SU8A 3E5HA 5IF9A 1TEXA 3RS0A 2CL0X 4HAZA 4R2HA 4MGKR 3ZQ6A 1L2TA 1SVOA 1NBMA 1KJYA 1Z6TA
chains in the Genus database with same CATH superfamily
2AD1A 1Q1ZA 4TKLA 1E7WA 3FTCA 4YO7A 3PXDA 2QE7D 4RNDB 2PCLA 3ZDYB 1X2EA 1QZXA 3GPIA 4NV3A 4F2PA 4IS2A 2GZ2A 4MVJF 2X42A 5ILQA 4YCSA 1AF4A 1GEGA 3TSCA 5ISMA 2CFSA 3ZCUA 3DE1X 1F5SA 2BE9A 3GG9A 5K8VA 3QKRA 3VR2D 5JJIA 4UARA 1T5SA 2C42A 1RLIA 2YVQA 1WW2A 3WMRA 1RAHA 2PWPA 1SBIA 3KL4A 4HWPA 2K7FA 1BCRB 1G2QA 2Q1XA 2R6FA 2W2NA 2YOHA 1XDUA 3GVHA 3L93A 2NXJA 2DE0X 4GP9A 5BSEA 4BXOB 3QJGA 3U44B 4KJZA 1FX1A 1SG6A 1QHYA 2ZU0C 4RD4A 1ABBA 1HDXA 1NVVR 1OLUA 4TN1A 4FWIB 2EHDA 4DJTA 2HWXA 3OCXA 4LGMA 5A7HA 3GLSA 1EVQA 1R5OA 5LJLA 2RC5A 2O8NA 3LNTA 5CT9A 3TG2A 1ZM4A 3SZUA 4XSGA 3FA2A 3TMYA 4BQRA 4D3FA 2PQ2A 1JEYB 1FFSA 4D9CA 3P27A 4UNIA 2LGJA 2QRLA 1XZPA 3OT5A 4JR1A 4M0PA 2W6JA 2E7ZA 4ZYLA 4X1IB 2ABWA 2FKNA 4CODB 1GY8A 4IIJF 4UPVA 2LCFA 1E3QA 1O95D 3CR7A 2VXCA 4ZTBA 4ARSA 4R7TA 4UU1A 1ID1A 1MJFA 4FDMA 1JA9A 2ZRDA 1PAUA 3BJIC 2QF7A 3B70A 3HGQA 1ISIA 4ILKA 5JYCA 2EYQA 3KT8A 4NNOA 4L72A 2VAWA 2QVLA 4Q4AB 4QSMA 4OQLA 2O1XA 4KAAA 3CUTA 3UMSA 2QV0A 2VHQA 4DR6B 2AN1A 1CY2A 2CHGA 1Z38A 4ZDIA 1Z2DA 2IE8A 4RJJA 1YCDA 3C5VA 5K8LA 2ZYIA 1Y9ZA 2ZULA 3OA0A 4K8OA 4Q1CA 3D59A 5JXGA 3L4JA 4GZ5A 4N8EA 2HGZA 4LY3A 2IW3A 2H3HA 1L5WA 1QO0A 1KSGA 5BN3B 5JSYA 5I7WA 3SS7X 1I0ZA 2H5LA 1QMGA 5KYUB 1X1AA 5FOTA 3DMTC 3ZC3A 4P32A 1PD0A 2H4HA 2OR3A 3U9TA 5EIOA 1LLFA 4XB2A 4GXQA 2W2KA 4TLBA 3VU1A 5B4TA 3OP1A 4NMMA 3WGTA 4F6CA 2NSLA 4HLUC 4HAOA 1N4AA 3GLGB 3QV2A 4BVFA 2Q6IA 4BV2A 4UHBA 1PNTA 1QV7A 2GN4A 4M0DA 4KNYA 4BCDA 1E4EB 1IHPA 4J16C 1ZWLA 3Q2KA 4GYWA 4DIMA 1NNUA 2BV3A 1UANA 3DL2A 1Z4PX 1HSZA 4YWHA 4EKIA 1BMFD 4Q7LA 3ENQA 1LCIA 2G07A 1ABFA 2JCSA 4MUJA 5AW5A 2A78A 5AQEA 3ZY6A 1Y1PA 1NJ8A 1YZQA 4N49A 1M1YA 3OFSA 2PRSA 4C01A 5IH7A 5BRJA 5K8UA 3WY9A 1JIUA 3H9UA 4ARZB 4JJIA 4NAHA 1ST3A 5ENVA 4O4IB 3T3MB 3BCSA 2HV9A 3A06A 3ESCA 4MCAA 3TQCA 3TVYA 3MERA 4EL5A 2BCJQ 1PJ8A 5MN4A 4N5MA 2ZFUA 5E2BA 1LXCA 1SFRA 2ZQ5A 3CXRA 3OX1A 4Q93A 4ETMA 5JFTA 1KI3A 4PZEA 3T1TA 4RCVA 1KRWA 4CKCA 1NW5A 1MO6A 1K7FB 3EEFA 2OCKA 4K8RB 1TYDE 4P4GA 4WCFC 3OKAA 4ETWA 4PYNA 1F06A 3OE1A 3JAWA 1B2LA 4KV9A 4Y7DA 1T3GA 5K0EA 3EQ7A 2PH5A 2V74B 5TQ2A 2EYUA 3FGZA 1AHPA 3P9YA 5KX5A 1DC8A 2BFFB 4P4UA 3F7TA 1E2LA 4JIGA 3ENZA 4QBIA 4R1NA 2HPHA 3SJZA 3LOQA 1IOWA 3PNVA 2A0XA 5EPOA 1Z13A 2Y0BA 1FE8A 2F00A 1CD5A 1EWRA 2CLLB 3SYLA 2XUGA 3NEYA 2C61A 4MSUA 4Q7QA 3TOCA 1CUIA 4X66B 3WXMA 1ZA2A 4YGYA 3KQHA 1WHTB 4CUZA 4G0WA 1R10A 2ZSUA 1M7HA 4U7GA 3EX7C 2C7GA 1JHYA 1FRNA 2BGIA 4G4SP 3A1TA 3DOCA 4D0RA 3AI2A 2RK4A 1Q7RA 3HBMA 2CY0A 4NU0A 3RROA 9LDBA 5F51A 1P7VA 1QANA 3NC0C 3SEFA 5B1SA 4DV0B 1D2NA 4K9QA 2FLKA 1E9FA 3L1IA 1R12A 5FFNA 5A3QA 3ETCA 3SQMA 3ZE1B 1JMVA 2W11A 2VBCA 1DBVO 3KALA 2OO7A 2NTEA 3TTUA 4LUCA 4H9GA 4ZCTA 4LNAA 4N39A 4MHOA 4OHRA 2KE5A 3N8HA 1HL7A 3OSZA 5CFQA 4HWOA 1T1GA 3KR9A 2OB1A 1PL7A 3AETB 1NRXA 3L6RA 3ONVA 3UCXA 3PIDA 2M9MA 3OQBA 1FX0A 1P1RA 2QM3A 1R5JA 4NEQA 4KZKA 4PRZA 3QITA 4Z7NB 1VLHA 3S7TA 1HETA 1YWGO 1T9AA 3TL3A 1W85B 2XYGA 1C29B 1EP2B 4I1PA 1XLTA 3E82A 4CKEB 1Z0DA 3BSFA 2YNMC 1YR8A 2UUOA 3H9QA 3HLTA 4FR0A 3I6MA 1ZN7A 2AOTB 2N42A 3OA2A 1D2GA 1G1AA 4LQLA 3ER8A 2QPAA 5LBUA 3KQKA 4G6ZA 3GLVA 4XX0B 1OH7A 2PUBA 2YHAA 4YRAA 2C2MA 1NY5A 1KMIY 1C0LA 1MTZA 3E3OA 3WLTA 3CPJB 3FCUB 1N1MA 3IQXA 1CR0A 4NU8X 1NUSA 5KREA 5BR4A 2PMBA 1TCVA 1PSWA 3G2PA 4M9XA 1NQXA 1DKRA 4YQYA 1U2SA 4CIXA 4YS6A 2H11A 2Q0QA 3OCCA 4O2AB 4PAQA 1KAEA 5IW8A 4DA7A 2C4TA 4LPKA 1OAOC 2Z3VA 1WG8A 3MHPA 1VCMA 4R31A 4ZYTA 5CB4B 1NLZA 3LL4A 4L6IA 3HU2A 3S1SA 4FMBB 3NGXA 2POCA 3SC4A 4NYIQ 3Q8XB 1ZJJA 2VS1A 1W8IA 1YZFA 4HDMA 3UK1A 4ECEA 4KCGA 4BFCA 1FJ2A 4OJYA 1WZIA 1QQ6A 3CPEA 5G41A 3OQMA 2RMKA 2HWUA 1Q57A 2OCAA 2WOOA 3OECA 2VQSA 1T9HA 1WS6A 2ZBEA 1QF7A 3L7OA 4TRNA 1TFRA 4QULA 1ECBA 2CNKA 1E6UA 5CTJA 2V5VA 1SUSA 2C7VA 4Q02A 2PMWB 1AZSC 3C4VA 3CF2A 1E60A 1EFVA 3IMFA 3I01A 4DQXA 3QXSA 1N0HA 2Y1FA 3WYAA 4O4JB 6ABPA 4ER6A 2H1CA 1RRGA 1SCUB 4YC7A 5YASA 5EJ8A 1M1ZA 3SQOA 3T3OA 1HM5A 2ICAA 3KZKA 3N2EA 5KVVA 1BS1A 3WYCA 1Q7GA 5ALRA 3L49A 1MB4A 1XQVA 2WJWA 4LXYA 4AWBA 2XXAA 5A6SA 2XMCA 3V80A 3ZK7A 2JEOA 2GXSA 2V7EA 2A84A 1H3FA 3K5HA 3KPJA 3P9QA 4IXTA 4EW2A 5HIAA 5GIPE 5A2QA 4MK4A 2G6TA 4R8SA 2Q4RA 3JARA 3F4BA 2CN1A 4EG8A 1TZJA 3UJ8A 5F7ZA 1UXOA 4Y2XA 5IX8A 3FUVA 5HJ7A 1NVVQ 1SKBA 2OVBA 1M5TA 3CJRA 3CVVA 1BH2A 2VBIA 3K8ZA 3I9MA 4KOEC 3W5VA 5LMCA 4OU5A 4I5DA 3F6PA 2JHCA 3GEEA 4MVJG 3HVRA 1WMSA 4ZU6X 4ZK2A 4W99A 4B85A 1YZKA 5BWMA 5LQAA 2UYHA 4PGGA 2DUUA 4ZKDA 1ELOA 2RARA 2PT5A 5FNZA 4C7OB 3ZXYA 2F1OA 4GOJA 1D6MA 4TMZA 2IU3A 1AQ6A 4JENA 1CUWA 4RABA 1ZD9A 1ZUNB 1DKOA 3JARB 3KAQA 3OFVA 1XQ6A 1DMSA 2P5UA 4G07A 1VL5A 5CVDA 5ED4A 4W6ZA 3K8YA 5DHAA 2ZEJA 4GRIA 3RK4A 1J8MF 3GJ3A 3W3AA 1M8KA 3I92A 3CH7A 3O3NB 1W2WB 4MW0A 4JJKA 1SCDA 4B17A 4U5QA 3U44A 3QPAA 1UXJA 2O7NA 1N9KA 4BFXA 1J25A 4W7HA 1BCRA 4EGJA 1L4GA 2NO0A 2FV8A 3HKEB 4XJTA 3UT5B 2B4YA 2BWJA 4WZAE 2Z8ZA 3GLFB 5G1OA 1AH2A 2ROQA 1EIZA 2QZ4A 5C9ZA 2HMVA 1RYNA 3L2OB 2P2CA 3DNMA 3PTLA 4I8IA 2V4UA 3AW8A 2GAOA 1UJBA 2J7PD 2NV0A 1EM8A 1R0RE 5FYQA 3RUIA 4BAUA 5CDUA 5HRUA 4PGHA 3NHLA 3RTDA 5F5NA 1T25A 4OQMA 4YIKA 1RAIA 1EB8A 6GPBA 1NJ6A 1J39A 3DP9A 4EY4A 2XUFA 3U1BA 2IYPA 2HCTA 2EL9A 3OCZA 4JLJA 2JLUA 1E7RA 3AEYA 2WUWE 3ON5A 3A32A 3DYBA 3PKJA 2GTIA 1U90A 4KFSA 2X2OA 4DTCA 4XDGA 4IFBA 3MJTA 1NNEA 3NX4A 5TF4A 1Q91A 3WNZA 4RE5A 1UJ5A 3KK0A 3ZHQA 1EQAA 3OHMA 1DAGA 5INTA 1L5NA 1Y37A 2TMGA 2R86A 2E6KA 3OZFA 3C1UA 2B9EA 3F3MA 4EPXA 1IXZA 4P7BA 1L7BA 2FK7A 4JSTA 4L0CA 5ALOA 4ENSA 2ECQA 4MAAA 5JH7B 2GXQA 5AXBA 1X1RA 3COZA 3MOGA 3K05A 3RI3A 3ZK8A 2Q4BA 1CZUA 4DHWA 4IMRA 1TIKA 3DPIA 4JEIA 5E6RB 1QFMA 3T5TA 4ZXPA 1IOLA 2WJVA 4BVJA 2ZIAA 1TCCA 4OXQA 3IEMA 4LYAA 2Q07A 4P58A 1DOAA 3IVGA 1GA4A 1NP7A 4I50A 4PW0A 4LWQA 3X1XA 4KYTA 3ZI4A 3OT4A 4UEJA 3WFZA 4PX3A 4E11A 4YRMA 4Q7KA 4AY5A 3Q9UA 4JVSB 2O07A 3NPMA 3KYCA 1RWVA 3N9IA 5HVNA 4FE4A 1SGWA 2RGXA 3L7BA 4WKCA 3LPAA 1ZRHA 5T4BA 5E1DA 1TKAA 1R3UA 1GL3A 3KKNA 4H3SA 3I12A 4WLEA 1UBTS 2FW8A 2UKDA 3GFVA 3QWFA 4L5IA 3JQ9A 1Q5PA 4RDHA 1XUOA 4UFOA 5ERXA 5BQFA 2VDRB 2VSXA 3MINB 1HURA 1DKQA 1I24A 2CDAA 3HL4A 4OBBA 1PGJA 2Y92A 3WWEA 1KFJB 3NFRA 2NZ2A 2G9ZA 1M75A 2M6KA 3ZXUB 2Y77A 3Q40A 2QU7A 1GPNA 4JDPA 2YHSA 3QI2A 4CGYA 2H2DA 4ESHA 3TGPA 3IQWA 3PC7A 3V8NA 2OVFA 4I4CA 3MG9A 3DZ8A 1UXIA 5DGCA 1JR2A 2HRZA 1Y8RA 1NW8A 1UKZA 4GNRA 1QRAA 2JH8A 4RD1A 5IC4A 2IXFA 1K8YB 1PLJA 1XCPA 1EQUA 3REOA 1RYDA 4QC2A 3E5MA 3OPMA 4ARVA 1XDSA 2DLNA 2PAFA 1Q1QA 2ZVQX 2FSPA 1RFLA 3VV3A 1FDOA 4IJKA 2BFFA 3UHJA 5FPKA 3DZHA 3RLFA 1I2DA 2GERA 5BOSA 5DGIA 2HJRA 2J0UA 3GEIA 4Q4CA 3PD1A 3ZWOA 1CLUA 5GM2A 1GKYA 1V47A 3OCUA 3ZGNA 1ML4A 2AXPA 2R6R1 4XR9A 2O1SA 3EZYA 1EAYA 3H7AA 1VBFA 3GA7A 3FTQA 2GM5A 4OQNA 4XFKA 4BN4A 5J2TA 4NATA 4E51A 1BFUA 2PLRA 1JJBA 2DFLA 3OJOA 1L8LA 4IG9A 3CLSD 3RYFA 1P4HA 2R47A 1V25A 3EVNA 2QBYA 2R3SA 4ZC1A 3EYAA 3STUA 4PVDA 2FLVA 3AJ9A 3G2OA 4DBLC 1COWD 3QU7A 4OOEA 3V1YA 5I4IA 4X1YA 3QWAA 5DHTA 1R0SA 4G1VA 3JQGA 2PFGA 3T3NA 5A05A 3A9CA 4D0NA 4MINA 2G9NA 3UIEA 5JS2A 3H5RA 3HGMA 2WUFA 3H99A 1ESNA 1NLUA 2FPMA 2UDPA 3GDHA 4DIFA 5EZYF 1L1EA 2JFWA 2JHGA 2XT6A 1EVIA 3CLKA 1BO6A 1XPJA 4FDAA 4YRNA 2ES4A 4FFRA 4NOJA 2GD0A 5D3MB 1UOPA 2H9YA 2H5EA 2VHXA 4LJYA 4LVOA 5SY9A 4QYIB 1C2YA 4E7OA 2VH1A 1D07A 1K4KA 2BTOA 1JZQA 2RGDA 3EIWA 3EBOA 3QYPA 4W63A 2WD7A 5DYNA 3USES 2FXVA 3NUGA 3PUXA 4CFYA 3PTAA 4C1NA 1ZUIA 4ER7A 3C5HA 4V39A 3MMSA 3PLAE 4PLTA 2PX8A 2I7DA 2OGUA 1KFBB 3SM3A 1OPXA 2WIDA 2HL6A 3GWZA 1RRMA 2P2YA 5DLPA 4HHEA 5DN9A 1YDFA 3IUEA 3ESXA 1CT9A 1PYGA 1J2JA 3JR7A 3OOYA 4RVUA 3QUBA 5F76A 1UADA 2VPYA 1Z4IA 2ZPUA 4RD0A 4ZCIA 5AQ1A 2WF5A 3FYTA 1WETA 1QLHA 1B2RA 1XNJA 5GZ1A 4J0HA 1S96A 1TW2A 1OA0A 4S05A 2JFXA 3UJPA 2JIRA 1I3KA 2EKLA 2VPPA 3I8XA 2WIKA 3A2NA 2QWXA 1IMOA 4FEYA 3UICA 1UBOS 4JB3A 1TGVA 3EEBA 3LGSA 2B8WA 3FCCA 3OG9A 1SKYE 5DSZA 4E33A 3QLJA 1LZLA 5GM1A 2PKRA 1P45A 1KPIA 3NANA 3FWPA 1X1BA 2FXIA 1ZH4A 4AN4A 4MTLA 4NCHA 3RSOA 3PJDA 4CDGA 1X9HA 1GNRA 3OUTA 2GF0A 2P67A 4HNSA 4J76A 1N57A 4U7PB 3ZH9B 1HYQA 1MC4A 1CP3A 2JDID 4QARA 2A9KA 4B40A 3GG2A 3MRXA 2JHPA 3EZLA 1A7AA 1ESZA 3CPSA 5FRDA 5HUHA 4R3WA 1I7QB 1VC2A 1ULZA 4IQ8A 3A4LA 1CZOA 5ALEA 3FUTA 4V1CI 2IEGA 1ZRNA 4U0KA 3KQSA 1DAHA 2RHCA 2BZ0A 4PX5A 3RDPA 2PUEA 4WTOA 2XADA 1J8VA 1JDJA 2QKYA 3IKVA 1H1LA 3TX6A 4BNHA 3KTOA 1DO2A 2H31A 1IRIA 2LRHA 4R1PA 1EVLA 1I14A 2HMUA 3EF0A 4L9AA 3TB4A 3NB0A 3VZBA 1Q83A 1SH7A 2JAHA 3GK3A 3LPDA 3WYBA 3ZJYA 4MI3A 4DCVA 1VHWA 3HA3A 4NABA 2O3JA 3RF7A 3NOQA 1CUHA 2OHOA 3W2IA 1XZHA 3O8NA 3KB6A 1WPQA 4PYMA 1LQ2A 5KPJA 2CBGA 2O0KA 2FOLA 4BQNA 2J5BA 3VKWA 4A4DA 2ZR0A 2D0OB 2BGTA 5J1TB 3A3OA 1I2MA 3K8OE 1JIQA 1YO6A 2ZI5A 3KR1A 5AVWA 1P72A 3CPHA 4NPAA 3W4KA 5KMGB 3ROTA 3BILA 2ZCUA 1NQVA 2Z3WA 3THSA 1N6IA 1UPCA 4F1KA 3Q8KA 2A5JA 2CZCA 2YV3A 3I1IA 4XJVA 5TSDA 1EXDA 2OBMA 4PANA 4TROA 3CX3A 3IP9A 3ZLVA 1SHZA 3DZCA 3LC1O 4GAEA 1PDWA 4L8WB 4QPJC 4D9HA 1QHHB 2QNRA 3WIDA 4OSEA 5KEIA 3DVRX 3TR6A 1XEXB 3A9SA 3L9XA 2GPTA 2DRIA 3JRNA 1ODJA 3A1DA 4Q05A 3GJ6A 5ARBA 1VKHA 4G84A 4XQ9A 4YP6A 3STXA 2AWOA 2PL5A 3KVNA 4GR4A 1SCNE 2F1KA 1FX0B 2Z5VA 3K9NA 4CFZA 4DXDA 3DMTA 1GPUA 4LSGA 1UUFA 1IQUA 1ECPA 2GPAA 2PLWA 1JKJA 3B6KA 3MTIA 3S27A 5AOBA 3MCTA 3WGKA 4JP8A 3CNLA 4LF9B 4ZQEA 1JQ3A 2NYAA 2O57A 3FVVA 3G89A 4AKEA 5TE9A 2Y66A 3N5CA 2KM1A 3L0IB 2RH9B 5H83A 1Q0ZA 4C7MA 4CV1A 1WDTA 2JGLA 1GLGA 1IN5A 2QNIA 4HB4A 2IYXA 1F20A 1V6AA 1C14A 4DQKA 1OBOA 5JBNA 1LVGA 2GEBA 5J2TF 3ER6A 4LG1A 3RHTA 3NM4A 4Z0HO 1PR1A 3L07A 4XPZA 4TYNA 2I8AA 2ZJ7A 2IEIA 3R7WB 3GLRA 1U9YA 4PZAA 3W78A 3KQOA 3TOSA 1DRVA 4MA5A 3TTWA 3NAQA 3UKOA 3VMMA 1LK7A 1DQYA 1QAOA 2AR7A 2I7TA 3CN9A 4HQKA 4ODIA 3V8MA 4DMKA 2CXHA 4EG1A 4Z3KA 1YVDA 4KRXA 5ERYA 4BO2A 4K6FA 3GB9A 4HGPA 3A1NA 4LJSA 3TZEA 2AG1A 4XGNA 3GDFA 5CFRA 4L0DA 3Q5GA 1FUYB 4H3KB 4GDFA 2WUEA 2LDBA 2PS9A 1OZHA 5FBKA 2PT6A 1OX4A 4YFYA 4JY7A 4XSVA 3FJ1A 3C6BA 3O4IA 1IUKA 1JDBB 2ZJBA 1GZUA 1XROA 1XRPA 2EW8A 2FSSA 5AKXA 5TGZA 3R0XA 5BWLA 1EFUA 1SQGA 1YBMA 2C4NA 1ZUNA 2C4HA 2NO9A 2PNFA 4GI7A 5HE8A 5SYAA 3M6AA 3EY9A 3L05A 4F8EA 5DX1A 1S1CA 2PX2A 1G6KA 1ZO8A 4LKRA 5ALUA 5I45A 2I91A 2JJ1A 1C7JA 5TV2A 4WOJA 1KU0A 4O2LA 4TMKA 1T15A 3GGPA 2IY8A 3T99A 3IUPA 3F0TA 1PL6A 1ZOOA 1KK2A 3WWDA 1RR6A 4CMIB 5HKKD 2X0RA 5FOSA 3MTDA 5JMTA 1UKEA 3RKUA 1TUBA 3P52A 1KH3A 1KOJA 2FWNA 1FMJA 2QSUA 4MJ7A 4XFJA 1MJNA 4IEFB 3S8MA 4CQMA 2CHFA 4Z54A 3R5FA 3IB6A 4H1WA 4KFRA 4F9TA 2E4UA 2O2YA 3T4PA 2WZQA 3MLAA 3UK6A 2FOIA 1BJTA 1I6LA 1A9ZA 2W90A 2OZPA 3S99A 3QGMA 3HB1A 2W0SA 1FNSA 3D7MA 4MICA 3KLNA 3D4OA 1SJ9A 4R8LA 5EUBA 3SY8A 4AMYA 1IN6A 3V4OA 5EIBC 3BE8A 4BNTA 2IFTA 4EKNB 2GQ0A 1BWPA 1CXZA 5D01A 1YS4A 1ZH0A 2IODA 1GUAA 3EC1A 4UU7A 4RL4A 5BMVA 4FYYA 1SCQA 1HOXA 1PJ2A 3HCDA 2PQ0A 2YBDA 1GZ6A 2HA4A 2Q21A 3FUCA 3BGWA 4XH9B 3TPFA 3IQDB 3B82A 3PI6A 4M49A 2HYIC 3LFUA 3LLUA 2QAIA 4IOLA 4C0BA 4FNGA 4JYBA 4UNQA 5JJCA 2AS0A 4FZJA 3KHKA 4Q1AA 1O58A 4RXMA 2IHJA 3KKMA 3LYAA 4PCUA 2C9OA 2VHWA 3PXAA 1G38A 1AD2A 3REQA 2ZVPX 1XCOA 4HNQA 1GR0A 2ZBDA 1P5JA 2TS1A 3NVDA 3OLVA 1R37A 5CGQB 3AL2A 3VSEA 5JXIA 2A7XA 4FHEA 1LVUA 4OTZA 1TNDA 1XHLA 2EBWA 1KZ7B 3KQWA 2VK2A 5TPZA 3PPXA 4BLPA 3H2SA 3PHBE 5AKZA 2GYYA 1MRZA 1ZNWA 2EZ8A 2G1KA 2YXLA 3BL6A 3K8QA 2GXUA 3SSAA 5HYVA 2ZIFA 1RP1A 4UKDA 5IRCD 3KO8A 3STHA 4AG5A 4E30A 2AC4A 3KXKA 3MUEA 2A5YB 1GTJ1 1XCMA 2ZUVA 5E6SB 3U0VA 3JVEA 4QEZA 4QATA 4J4BA 4XGQA 2HT1A 3RF6A 1VHJA 2VA8A 3C0KA 1JT2A 4P31A 3WNVA 2QZPA 3NO4A 3BWYA 2V7BA 1BDHA 4BLSA 3U7RA 1R5NA 3ZZ0A 4OUDA 3BSWA 4EZBA 1P3DA 2FUKA 1I3OA 3IIJA 4JITA 4B0PA 2G17A 3BYZA 1LJLA 3V8QA 3WYNA 4CMAA 1ZITA 3R5SA 2PRIA 3EG5A 3TLJA 1E9DA 4EQZA 3GH1A 2OUKA 2OCLA 3PCTA 2FGKA 3H13A 5EJ5A 4KQKA 3P2KA 3HXMA 2NTJA 2VCHA 2XOKD 5B3JA 4HEA6 4NFLA 3TJMA 3KDSE 4IDDA 4PIVA 1WUHS 1EYZA 2PKCA 3DA8A 3HA7A 4N4AA 3MBOA 4P3XA 5DCWA 1MJGM 2GASA 3SJBA 1JPVA 4RJKA 1NP6A 1RTTA 4RVDA 1RKQA 4WNIA 2G0NA 3SPXA 2CC2A 3KXPA 5JZBA 1ZK1A 3QSYA 3NHRA 1NVFA 4OYRA 5BMVF 3PFBA 3A14A 4W4TA 3K70B 4TX1A 1G3RA 3PIIA 4CG0A 1NYQA 1KI7A 1XF9A 1L7RA 2CXOA 4D79A 4BPBA 4A2QA 1T2NA 5JDCA 3TIFA 1KMNA 2C2ZA 4EUFA 2B34A 1V1JA 1P0QA 2F9MA 2NAPA 3FG9A 2WM8A 3EFEA 4HX9A 1PD1A 1PQ4A 2FMXA 4JL8A 1ISMA 2YASA 4OJMX 4AJ1A 2DFKB 1GNQA 3FI9A 4AJJA 4B6GA 4BFUA 5CTAA 4IZIA 2R1ZA 1GUDA 3N8KA 3DMNA 2HTFA 5HBRA 3V2HA 3ZNOA 3O8QB 2BFCA 2QTHA 4QNMA 1HMPA 2G9UA 4XLLA 4R0NA 2SECE 2H2AA 4CWAA 3L4BA 1XJQA 4X6LA 4EKYA 1V7ZA 3EGVA 1SG0A 3QF4A 2I80A 4JSRA 5F7JA 2EIHA 1GG5A 4PSUA 4RPHA 2GNOA 3UOGA 1T36B 3ZDAA 4D9MA 3PE3A 5DMHA 5FWXB 5TNXA 1NI4A 1HE4A 5FTNA 1OGIA 3TAXA 2J3HA 1O5TA 3EY4A 4LJ6A 3OJFA 3UPDA 2CFTA 4LZAA 4UXIA 5EE9A 4D41A 2EFHB 2HLPA 1SBNE 3QP9A 2C9MA 5E4FA 3OC6A 4M0FA 4NR0A 1SUFA 4WUVA 1TAHA 2Z83A 1LTHR 2OHJA 4QT0A 3E70C 1JFFB 2FMIA 2WF6A 5FFFA 1RIFA 3FHJA 1GDDA 3SQNA 1NOJA 3QWBA 5K3BA 1DMRA 1ZCZA 3JQ7B 4RCZA 2O14A 1KZ9A 1BSVA 1A8HA 2AI3A 2XQKA 3TSZA 1IDN1 1Q77A 2B1GA 4QWMA 1SIBE 2R84A 2QR2A 4GLOA 4DMFA 4H60A 2YHIB 2WF9A 2WP8J 4F04A 1COZA 3PHLA 4X63A 5JFGA 5HP4A 4V24A 3OFJA 4UTZA 1PVDA 3RW9A 3I64A 3VVLA 5H9WA 1JFVA 4QGFA 2EDAA 2PRKA 4CL3A 4AP5A 1Z7WA 2EFDB 2J7PA 1O0SA 2YJ6A 4BMSA 5C5CA 3AZQA 5MDHA 1VE3A 4ECAA 1WNTA 1WV0A 3H4MA 3AIOA 3O38A 3IVRA 4BJ1A 3ROPA 2IIPA 4IGAA 5JQGF 1N0VC 1TZ2A 2AMYA 3OI7A 4Q4LA 3DW1X 4DCSA 5C7IO 1XVIA 4LY6A 2NZUG 4UXJA 1XDWA 3RSCA 2F7SA 3ORFA 4MP6A 1NV9A 3KWMA 5DBOA 3JR3A 4GZMA 3DC7A 3AVQA 3NBMA 3PHHA 4NFSA 4LRXA 3ILSA 4MO9A 1UP6A 4YRPA 5HJEA 5ITZB 1N6PA 1U9CA 1VL2A 2F17A 1QPBA 2P9TA 1BTOA 1XTQA 2A30A 2WU3A 3R41A 4EGSA 1JU4A 1XJ0A 4KIGA 2WSSA 2RAUA 4EEKA 3ZS9A 1XLTC 4M0UA 1IY1A 4HEHA 2WQZA 3ICEA 1VJDA 4JFRA 4QU5A 4F1WA 4BB9A 3H5IA 3O7WA 3ANYB 4MRRA 4GXNA 521PA 4AKGA 3DFFA 1CCWA 1NI3A 3LPLA 3U19A 1Z0IA 3MJRA 4MGIR 2PZAA 4TUYB 3WL4A 5HTOA 1L5SA 1EU1A 4LZWA 1XD9A 2TMKA 3LPCA 1SB8A 5IH3A 2ZT8A 1L5LA 3K9GA 1KIFA 5JSHA 2GMWA 1PKXA 1Z75A 2RBKA 3ID6C 3IIKA 3MD0A 1EWYA 4X8OA 5GIOE 1RWNA 3TLGB 5EIFA 3EBLA 5IJAA 3AUJB 5CBPA 3EMVA 4MI9A 4I0WB 4NZYA 4ZOLA 3L06A 2HCRA 5KNCH 4KO4S 2DZDA 1UPAA 4A23A 3LBHA 2P75A 2ESRA 4O0LA 1K0FA 3VSCA 4KU4A 1JEYA 4J91A 3GPBA 1WQ3A 2NO4A 5JD3A 3OTHA 1ADGA 1J0XO 1WZEA 4LNUB 4OI4A 2PZEA 2W6ID 2W8ZA 4HUJA 2OESA 2IEAA 4L78A 1UBNA 1AKMA 4OO3A 5DX0A 4DKJA 1O9HA 1PEAA 4G1EB 4GBJA 4FGUA 3L1JA 4QDKA 5MFPA 2XEDA 4IW3B 2WJPA 3BMXA 5C2JB 1Y3DE 4IX1A 5LZ7A 3TTTA 3I30X 4LCBA 3L7LA 3HVIA 1NXPA 1SBTA 4FOSA 4E6PA 5C81A 2Y8EA 2HIMA 2B82A 2R7KA 4GVLA 1W35A 2VZ0A 2O2GA 3EXG1 1JT9A 3LBAA 4JL6A 3A1WA 1BGWA 2GN2A 2OILA 3C74A 2H2FA 1TUIA 1BU8A 3K96A 3L0ZA 3UV7A 4GZ6A 4UNRA 1P6UA 4NBRA 5HQ3B 1FNMA 4DSNA 1XF1A 2GD1O 2AG5A 3D6AA 5KYUA 5EZ6B 3AVXA 1TK2A 1C8VB 1ZOLA 4WADA 3OO0A 1G9TA 3LRPA 2C29D 4X64B 4DOMA 2ZI9A 4D9BA 3V5NA 5J2UA 2IZ7A 1TUBB 5B1YA 2NP6A 2CSUA 1S7CA 3T3IA 1J20A 4Q9JA 3KRTA 1A5SB 3EK2A 3I53A 3L7MA 3NCHA 1Y5MA 2WU8A 1FY2A 5EN4A 1VP9A 1IM8A 3A1VA 3X1DA 4EFDA 4II3A 1JWLA 2C9DA 5EHQA 4J7AA 5IUKC 3Q85A 2GARA 2VHVA 3DE0X 2ZUTA 3GLIB 5FLXA 1NYLA 3V7YA 1PBTA 1Z36A 4IDPA 4KDFA 5KO2A 4QX6A 1NF2A 1C4WA 2BHSA 5ECYA 1BS9A 2Z6QA 1ZNQO 2D2IA 3AM4A 2J0QA 1JDSA 2NUAA 3F6RA 3QQ5A 1DX6A 4ZV9A 1WXDA 1JHVA 4UFPA 3GCGA 5BWCA 5ITVA 1UFQA 3AO0B 3PCXA 1G3UA 5EJAA 5AW0A 2OCIA 1C8KA 2QTTA 1QFYA 1XYYA 2YV5A 3KXLA 4HRVA 5JH7F 4MO2A 5MFZA 1T3ZA 1Z6PA 3P1JA 4FHGA 4MUKA 4X7BA 1TECE 2XMSA 3GX1A 4LOLA 4DG5A 3V4FA 1ZZGA 3DDSA 2H06A 3D3WA 1XTTA 3AQ4A 3IQZA 3LKVA 4ZAZA 3RVMA 1JIIA 3RYIB 3WMFA 1MRNA 1AXGA 3VNVA 2BH2A 4E08A 4HJXA 3HTXA 3ULKA 4L50A 1AIPA 1JB1A 1LPAB 1PBNA 2R79A 3K2BA 3PEVA 2IXAA 3IOMA 4I7EA 4O2AF 5ABPA 3RSFA 2HEIA 4MOWA 2QOEA 4UUNA 3SS9X 4MAMA 3VH4A 4DQVA 4ESVA 4BL5A 5BW4A 3AH8A 2C3YA 1SR8A 4J0CA 1BXRB 3GA0A 2VQFB 3P5BA 1SK8A 4KVZA 1F7UA 2XCTB 1Y3FE 3G0IA 3T7IA 4DKXA 3L4EA 3HNOA 2RGWA 3H0KA 4NCKA 1CUYA 5CP8A 4YBRA 3ZW7A 1U0RA 3RREA 2RCNA 1HFEL 1Z3CA 2GK6A 3JRXA 3JWGA 4GSYA 1N6LA 5IFLA 1RQLA 4JOQA 3DVSX 2FLWA 1CSEE 4HBGA 4DLKA 2ZSKA 1PDOA 3B9BA 1ZD1A 2AX3A 3C45A 1MCZA 4JNKA 3TE7A 3W3AH 4TWBA 4Z7JA 2G1UA 1PV2A 4K7JA 2H0QA 4LTMA 4CEHB 3NJ4A 1V1RB 2EGUA 4C0XA 4UTRA 2I1LA 1CP2A 1KA9H 3CINA 2EDCA 2XSZA 4H7PA 2GPJA 4BKOA 1QFXA 2WHPA 2GCIA 1NBIA 1ZJWA 3MILA 1BVYF 1BDMA 4O4HA 3BRWD 2P9ZA 4Q9NA 1U63A 1EGQA 1IU9A 5DLEA 5AVUA 2JJYA 2P6NA 1UJCA 2O4UX 3RYFB 2JI6A 1T8UA 3SKXA 1O96B 3R0ZA 3T7CA 3ZGOA 2B98A 3EARA 5JY1A 1GV1A 2EZ9A 2XCOA 2PNJA 4AECA 3R7SA 2VJKA 4B4KA 2BDUA 1VBMA 2Z0MA 2CJWA 1C80A 2UV8A 1DIHA 5BV2P 3I42A 1CJBA 2CK3A 2H1WA 4P82A 2Q28A 1TTPB 3QX9A 3O4RA 3Q9SA 4HSEA 4I8XA 4XE5A 3RH0A 3SOZA 2YN0A 4KQIA 3QKTA 2I2DA 2D2XA 3KYDA 3W04A 4ENTA 4OB7A 5G4KA 1FFXB 5FOQA 1F2VA 1OMOA 2G3YA 4ZI3A 1D1PA 4HQFA 1IM5A 4X20B 2G6BA 4OREX 2O05A 4MWSA 4OXIA 2ATIA 4C0AC 1NL3A 2BFCB 2X7XA 3B89A 1KDOA 5J9FA 5JI3E 5HCIA 1IBMB 1GRCA 1K66A 1OC2A 3ANXA 2OB2A 2FX5A 3OT1A 4I6EA 4J49A 3Q72A 1Y33E 3H7IA 4OXXA 4QIHA 1PZNA 5EWJA 2X8WA 2PUDA 4KREA 4KIUA 5EWMB 1F7VA 4OGGA 1MH9A 1EM6A 4HH1A 4OV6B 1GFZA 4BMDA 1QRSA 3RUFA 4MYCA 4REOA 1F3LA 3QEKA 1RQNA 3MHTA 3GXOA 1VIMA 3KJHA 4ACAA 2XNSA 1KHTA 3LP8A 4G1BA 4UVIA 4FE7A 2ZUWA 3S2GA 3T94A 4DLYA 1RS0A 1RD4A 5LPNA 2H18A 2O54A 5T6BA 5A62A 2NYVA 3Q7EA 3B5IA 4EPVA 2FF5A 4YNBA 1X1SA 3QNUA 3VHQA 4J3JA 2IELA 3OLQA 3LSTA 1GNPA 1WU8A 3N59A 1MQ8B 1HE8B 4KQ1A 4B74A 1DPFA 4I9UA 5BOVA 4C78A 4LVCA 1RM3A 3UJBA 4G5RA 2Y99A 1PO7A 3B9QA 3WJ1A 2HSJA 1PE0A 1W85A 1WJGA 4MS3B 5GAJA 5I6DA 4JT9A 3DCIA 3R5HA 3GCXA 4R3NA 2ZJ4A 1F8GA 1JP7A 1B6GA 3FH0A 3OJEA 1VG0B 1Q19A 2IF0A 5FL7A 4GKJB 1NU8A 3RC8A 4CKZA 2CUZA 2C98A 1ECLA 2D13A 4QGSA 2XUIA 4QXAA 1S2OA 3TRFA 2NT4A 1AMOA 3PQ5A 1V71A 4GLLA 3HU1A 4LF6B 1ODSA 4ZEXA 1LW6E 3KUUA 3QVMA 3ZCRA 5JADA 4ZD6A 1KC3A 2CMGA 5ALWA 2X2PA 4P93A 2UZ1A 2A7QA 4ZQHA 3MZ0A 4JBYA 4LYJA 1B76A 1E1CA 3GVCA 3FYHA 1UK7A 2P4UA 2ZBVA 4ZVQA 3ZWDA 1QS0A 2XGJA 2H4WA 2HJHA 1BA3A 2OLEA 3D6VA 3I1YA 3NOXA 4GPEA 4LECA 2RE8A 3D3NA 4DIOA 1XKLA 3PNSA 3QOWA 2VP6A 4JB2A 3UGJA 5JMWA 2Q3HA 1HRDA 2QXYA 3M3HA 3UJ7A 1B8UA 4ZV7A 3LCJA 3BDVA 4X44A 3PNMA 4JQZA 4IXWA