2P6VA

Structure of tafh domain of the human taf4 subunit of tfiid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
89
Chain Sequence
b'SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSPQPYLVPFLRSLPALRQLTPDSAAFIQQSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators.
pubmed doi rcsb
molecule keywords Transcription initiation factor TFIID subunit 4
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2p6vA00
2P6VA 2H7BA 2PP4A 2KNHA
chains in the Genus database with same CATH superfamily
3IPMO 3KYJA 3FDQA 3K7DA 3FOOA 4U9EA 2IYLD 2MHRA 2LFFA 4LLEA 1OKKD 3DAFA 2ZXWC 2J7PD 4IARA 2KC3A 4C3EA 4CS8A 3V7OA 4OINF 3W8IA 4U5CE 1CGNA 1SMYF 2X0CA 3VAYA 4JW1A 2HMZA 4Z9HA 4BJ5C 2EIKC 2ETSA 3EQLF 2Q4FA 2HFIA 1CGME 4FX5A 3NG1A 3QTHA 2EILC 2I15A 3G4ZA 3QMKA 1AUEA 4MVOA 4JRZA 1VLTA 1MQVA 5L0CA 1OW7A 1SR2A 4MTFA 1PCXA 4Q5SF 1Z6AA 2YLIA 2ASRA 2IXPA 3EG9A 3E70C 4PFOA 3V5YA 2A68F 3W8HA 2L81A 1YA7O 2YQYA 2NUTB 2CGEA 1H9GA 3FAJA 4N6HA 3EGXB 4CDVA 3C8ZA 3U8VA 4P6IC 2LD6A 1RKCA 1U6HA 4UDVA 2R02A 3SP1A 4YWQA 1G8XA 2UUHA 5IY5C 3L1MA 4YT4A 4NTFA 2J0XA 2Y39A 2A0UA 1LIHA 3LLKA 3CZ6A 2AU5A 2QUPA 1ZHWA 2JD3A 2QNLA 4HEAJ 3S28A 5DLJA 1HY5A 4O7GA 3FMSA 1LKXA 3ABKC 3S90A 4QI2A 3AG2C 3JRTA 1R5ID 4IAQA 4JTCB 3ASNC 2J46A 1ST6A 4H4KC 4KBLA 2XLMA 4Z9IA 3W2VA 3GANA 1D0YA 4OIQF 4DVZA 2R7SA 1DOWA 3ASOC 3SXMA 2WVOA 1M2VB 2HJMA 3EZIA 1JRAA 4KI2A 1Q0DA 2EIJC 1APCA 4E7ZA 1HW2A 2LSEA 4U5GA 2GA0A 1OCCC 2IXOA 3RH3A 1LM3B 1KNYA 1WN0A 2L9JA 4XEFA 1CPQA 1TWAA 2ZXOA 4JCHA 3ZTZA 4OD5A 1OCZC 1ZYRF 3NYMA 2HJ3A 3K1IC 4AL0A 2P61A 4MVUA 5L0GA 1L7CA 3A11A 3FVYA 2NUPA 3H2UA 3LS1A 2W45A 4O6YA 5DS6A 3RIPA 2R05A 3K1HA 1FNTc 4JEAA 3C8GA 1W2WA 2DGJA 3KH2A 4JIOA 4CDYA 4WJ0A 1K04A 2UUIA 2PX3A 3H65A 4G0HA 2P1AA 2I8BA 4K7BA 2WB7A 1MNEA 1FMVA 3KMIA 1V54C 3U9MA 1LVKA 3LJBA 2Q3TA 4P9FA 1YJGA 3TOMA 5B3IA 2J9BA 4A4AA 1XZPA 3MYIA 4KNWA 4E18A 3UMHA 4CS9C 4E7SA 2YLDA 3DM9B 3L34A 2P0NA 2HZ8A 3RFYA 2TMVP 5L0FA 3ABMC 2G62A 4PJNA 3PMRA 3TOLA 4K1OA 2V26A 5E2QA 1QVXA 2PX0A 2YL7A 4MW8A 1SYQA 3C8GD 4NY3A 3TJ5A 2XSEA 2IXMA 2EINC 1LS1A 3CEXA 1S05A 3M15A 4LERA 4ONSA 2QY9A 3ZVRA 2CCYA 2Y3HA 2D5RB 4LLCA 2YRFA 3EZHA 3HNLA 4MVRA 2XL4A 4FWVA 4G7ZF 2VCCA 4DRHB 2F22A 5A6KA 3JCUQ 1JAFA 4MTGA 3RF3A 4CX9A 5BQIA 4W8KA 2B0JA 3GM3A 3TULA 2L6HA 2Z15A 1YLMA 2H7OA 4XPXA 5DQZA 5KYWA 2L7AA 1VMAA 4U5FE 1N1CA 2FAPB 1UG7A 1QZXA 3GEEA 3HNKA 3U3FA 2YVKA 1R4TA 3I4UA 2E87A 4DBRA 2XL8A 3B29A 2WL8A 4P9TA 4WGZA 4DVYP 3SYNA 3B9QA 2JX0A 5BUOA 2LK4A 4H54A 1C02A 2EIMC 2WZLA 4EIYA 5AC5A 1Z7Qc 2YLGA 5KYUB 3U0CA 5KYXB 1Q0GA 1LI5A 1BZ4A 2J0WA 1VK5A 1ZU5A 2WZGA 3DAGA 3DMDA 5DVWA 2Q7RA 3X2QC 4JVSA 5T1DB 3PHF2 2MWQA 1VTMP 1AVOB 2OQMA 3EGDA 2R7VA 4A2NB 4E17A 1U0BB 3SXZA 4MTOA 1H6GA 3LEOA 3B71A 4C7OA 1M2OA 1RJ9B 3H2VA 2KJGA 4DRJB 3LEVA 1OW6A 1ZW3A 4HE8D 2OU6A 2XM0A 1U89A 4G7HF 1OXKA 2OOCA 4IJJA 1AEPA 1O5HA 2EPNA 5L0DA 1NFOA 4DJ9A 2LIGA 1JPNA 3MFNA 4AE4A 1FR0A 4QI0A 5JSLA 3AG1C 5KYYA 2A6EF 2Q9BA 1BBHA 3QW1A 4EUKB 4MVQA 3GEHA 5BQGA 2NUPB 2YL0A 5CI8A 2J9WA 1RCPA 1FTSA 1UFBA 2XXAA 1E83A 1J8YF 4XEVA 5T3TA 3U8PA 1FAPB 2XLHA 1WOLA 4GQHA 1HE1A 3O10A 4IAOA 5A6AA 3ABLC 3QZCA 5JP7A 2XM4A 4LACB 2Q9CA 4OIPF 1LI7A 2NSFA 1YZAA 4MNDA 1SF8A 3OA1A 2C04A 4BEJA 1G4US 1T5OA 2H8AA 2J9VA 3HLZA 3KKBA 3M4CA 3N2ZB 3US6A 4E0IA 2KGOA 4JC7A 4PACA 2FFHA 1JR8A 4RDAA 3FOPA 1D0ZA 5L3VA 2A69F 3UNGC 5B3SC 1WTYA 5D92A 4JURI 1Q0KA 2VCBA 4QDLA 3WHNA 3JYYA 3RW0A 3X1OA 3NDBB 2OEXA 1Q0FA 4ULWA 1WATA 4BJ5A 1TWCA 4AK9A 1D0XA 1YZCA 1Y4CA 3QVYA 3T9OA 4W8PA 1M56C 3NRHA 1XZQA 4MVMA 2XLOA 3LNRA 4C3DA 3C7JA 4DXWA 3EPVA 2NPUA 1C03A 2ZXPA 4CS7A 2PNOA 1BR2A 1I4ZA 2Y3BA 1CGOA 1MNDA 4BJ6C 3GEIA 2WVQA 5A69A 3R7CA 1NU7D 2LP4A 3C18A 3CAXA 3B0UX 2XLVA 3ECSA 2YWAA 3Q7LA 1TWGA 3DJNB 5F5FA 5CIVA 2IOQA 4GYTA 2XS1A 3LAYA 1JPJA 3F46A 2R7XA 2LCHA 1RKEB 4KNVA 4B6IA 4XEKA 3JSEO 2DYSC 2AP3A 2JPUA 1LS4A 2Q00A 2AWCA 2XLWA 3HKKA 4IWBA 3RYLA 3N0TA 1NBBA 2HV6A 3RQGA 3UGPA 4YJWA 4D4NA 3MX3A 1B68A 1NSGB 2HUJA 3HNIA 3JZ0A 5A6BA 3RKOF 1FMWA 1ORSC 3S27A 5K0IA 4F4BA 4JEBA 1H9TA 2XRHA 3TQOA 5HSWA 2XLEA 4I1MA 2EPKX 2GFHA 3PCVA 4WGYA 2PBEA 256BA 4EBKA 2EPMX 4XLPF 1ZHYA 5E33A 4CBEA 3EFOB 3U2LA 3K6BA 4PJMA 5TJ5E 1E2XA 3V5XA 3UGOA 1H7IA 3G50A 3NYJA 4RD9A 1LE4A 1HE9A 2W9YA 3UR3C 4CIHA 4YT5A 1SZIA 1F1MA 3WG7C 1OQCA 3T4RA 3VF0A 4XWJA 2R03A 1Z63A 4CIPA 3FXHA 1Z3IX 3U3BA 5A6JA 4JJGA 4YT8A 3GM1A 3RVZA 1E85A 1LE2A 2WZFA 1NFNA 3WAQA 2G3KA 4OIRF 4RBNA 3AG3C 3U2MA 1QQ3A 1TR2A 3EH2A 4NTBA 2AVKA 3NKDA 2NUTA 3ZDLA 3E9VA 4N06A 4O6NA 4BEMJ 4XLNF 3EGXA 3W2WA 4AE4B 3RVYA 4DBQA 1HMDA 2CDQA 3GWLA 2R7UA 3C63A 2H7VC 2QLAA 3IQ5A 3I5QA 1OCOC 3FAPB 3M1CB 1MMDA 3QW0A 4PR9A 4X0RA 1A7VA 1TFKB 1YYXA 3IHUA 3SXYA 2EPOA 2M4EA 3EG9B 1QKRA 1S7ZA 5EHHA 3UMIA 2R7OA 5L0HA 4I3MA 4Q4ZF 1OR2A 1D1AA 4BG0A 1D1CA 1V74B 3S9OA 1EQ1A 3EH1A 5CI9A 3TK0A 4E0HA 4U5HA 4J32B 4ZLDA 3MBGA 1GQAA 3O55A 3NKEA 5HV9A 1M6TA 2P7VA 2YL1A 4CJOA 3S84A 3DWWA 1ZHZA 3DD7A 2PP4A 3DE9A 4WABA 3T6JA 3UMKA 2Y3DA 2ZD9A 2AWYA 2ZPAA 4YT2A 5L0JA 5GPGB 3Q6NA 1LPEA 4YL1A 1I4YA 4K0DA 2P6VA 2MYSA 2A0BA 2LQGA 3HJCA 4ULVA 3POVA 1FFHA 3IQ6A 4PJLA 2LFDA 2L6GA 4YN0B 2VB6A 2IXNA 3M4BA 2NSGA 3DZAA 2QTVA 3AGTA 3ATPA 4CS8C 3ITFA 4JTAB 3IQCA 4JCZA 3RQFA 4ER9A 1TQGA 3LS0A 4CSAA 1A7DA 3LESA 3W4YA 5DQTA 2KSFA 1T6IA 4L6RA 3IEEA 3BRJA 2G3VA 4D4XA 3R2PA 4XTKA 3ZTMA 3ZQYA 5KYNA 4EHPA 2VC9A 1A7EA 2YZSA 2XLDA 4G78A 1Z5ZA 4JE9A 4AX2A 3C8GB 3SXKA 5EGYA 4I1OB 3ZG1A 4EBBA 1QLEC 1VYIA 3G4XA 4FESA 4JKVA 5L0IA 3B0VC 1EA8A 4XQ1A 2OKUA 3GM2A 2Y69C 3AG4C 4YK5A 3O6XA 1JMWA 3T6BA 2IM8A 2M64A 2NG1A 2VASA 1VLSA 3AJMA 3EJNA 1K05A 3IQTA 4MS2A 1C17M 1Z23A 1G5ZA 3HNJA 4MW3A 4JZAA 1TWHA 2O9XA 5B1AC 3RQEA 2KYHA 3DXJF 3SEOA 3ZWIA 1YYJA 1K40A 5JT4A 4CJGA 1NG1A 3Q7GA 1NU9C 1TFOB 1VYKA 3O39A 1EI7A 4LDKA 2R9RB 4JTDB 3U5SA 1E84A 5DS5A 5COFA 4IB4A 1T6UA 1G4WR 2YEVA 3GWNA 2PFDA 4ANJA 4ZLCA 1BDJB 1MMNA 4O79A 4AL1A 4U5BE 3L8JA 2CNWA 2HSBA 4MVSA 3VRCA 5JLIA 3TD7A 1ZHTA 1A0BA 2KNHA 2HMQA 3DKAA 3HTKC 3DI5A 4U9DA 5E3AA 5E3CA 2V3CC 1QPUA 2A1DD 3DJUB 3K33A 1BR1A 2Q9AA 3KL4A 3K66A 1IZMA 1VOMA 4N4WA 3ZQVA 1PD1A 1WWPA 4DOZA 3AQCA 2ZXRA 1MMAA 3FHDA 4EKWA 3MLGA 4PK4A 5KYUA 3OWTA 4U5DE 4G7OF 2KK1A 4MVZA 5KYXA 5KYWB 2PF4E 3TJ6A 3GORA 1A41A 3S29A 2HSQA 1WGWA 2A6HF 1VB5A 2GWWA 5T3WA 1T01A 4J30B 1M57C 2OG2A 2YL3A 2ICWG 1PV3A 1PD0A 3LNMB 1KTMA 2J45A 2CNWD 4XPYA 1GM5A 4BJ6A 2L6FA 2RD9A 4DRIB 1RJ9A 4N6CA 2OEVA 5COMA 1HW1A 2OCCC 4J7TA 2YHSA 1ZW2A 2YKZA 1ZVZA 2KW3C 5D91A 3CSKA 3L8IA 1ORYA 1YDIA 2FGYA 3JTLO 3BEHA 2BE5F 1J8MF 2IBFA 2R25A 3T6GB 4LDRA 2R7TA 3EGDB 3K1IA 3I5PA 1ORJA 4U5EE 3ZSUA 1IW7F 3JYHA 2Y3GA 5JVEA 2WVNA 4C7OB 1V4AA 2D4UA 2J9UA 4JJFA 4FAPB 3Q6MA 1XWJA 2XS8A 3JRMO 1HMOA 4XPWA 3ZIBA 5A6BD 1I5NA 2R7QA 3U9JA 2BC5A 2CYDA 2GDCA 3NMJA 2OJED 4IRUA 1Y6DA 2DI3A 3OEOA 5B1BC 4OD4A 5FCLA 5KYYB 1YAUO 4GEHA 4HFFB 3AQBA 5EK0A 1NLXA 4R32A 1OW8A 2H7BA 1ZU4A 1EKYA 3DM5A 4EBJA 3AGUA 3M79A 2XXAB 3WODF 3VM6A 3LUTB 1OCRC 4CS9A 3N24A 2J8WA 2DYRC 4YL3A 3PDMP 1T9KA 1YA9A 5JRAA 3DE8A 2B0HA 1TKNA 4NCQA 3QVZA 1CPRA 2QE9A 1YARO 2RSEB 4HFKB 5JUAA 2HKVA 1D1BA 1GGQA 4O6MA 5JS5A 4EWCA 3AOUA 4I44A 2BL2A 1M2VA 3JT1A 3KYIA 1WASA 4OIOF 3KPHA 2HS5A 3LLIA 3SZRA 1KU2A 4BJ1A 4IGGA 3VYWA 2W4BA 2VH3A 1MMGA 5FZTA 3NYLA 2R7RA 4KC9A 3B0PA 1L3PA 1BR4A 1OR3A 2C03A 4BJTA 5DS4A 3ZC4A 1ZHXA 2KQ9A 1RKEA 1NZEA 3SNHA 2CW0F 3JSZA 3J06A 3L0IA 4NQFA 3F47A 5AGFA 1OKKA 2J7PA 1ZZPA 1YVIA 1V55C 3GODA 3MYFA 1RXQA 3EHNA 4MQ9F 1DOVA 3A9CA 4PJJA 4YL0A 4Q7CA 2HV7A 3C62A 4CSAC 2VCAA 1T6QA 3CQZA 5COGA 1QSPA 4CDAA 4NC3A 2X51A 3NMKA 4NTAA 2W4MA 4PFPA 4BPMA 4C3BA 5L3QA 1OXBA 1Q0MA 3V5ZA 5BQHA 4J7YA 5F28E 5F5HA 4M63A 1E86A 2EPLX 2GAQA 3EFOA 3NMIA 2R7WA 1GS9A 4Z9JA 3EHMA 4LDQA 1JOGA 3S0XA 2DB4A 1O87A 2XL6A 1RMVA 5AC4A 1FFTC 1O3UA 2OJQA
chains in the Genus database with same CATH topology
3FDQA 3K7DA 2IYLD 4LLEA 1OKKD 3DAFA 2ZXWC 2J7PD 4C3EA 4CS8A 3V7OA 4OINF 3W8IA 4U5CE 1SMYF 3VAYA 4JW1A 4BJ5C 2EIKC 3EQLF 4FX5A 3NG1A 2EILC 3QMKA 1PCXA 4Q5SF 1Z6AA 4PFOA 2IXPA 3EG9A 3E70C 2A68F 3W8HA 2L81A 3FAJA 2NUTB 2CGEA 3EGXB 4P6IC 3SP1A 4YWQA 1G8XA 5IY5C 4YT4A 2J0XA 2Y39A 3LLKA 3CZ6A 4HEAJ 5DLJA 1ZHWA 2JD3A 3S28A 4O7GA 4QI2A 1LKXA 3ABKC 3AG2C 3JRTA 3ASNC 2J46A 1ST6A 4H4KC 4KBLA 4OIQF 2R7SA 3W2VA 3GANA 1D0YA 4DVZA 3ASOC 2WVOA 1M2VB 3EZIA 4KI2A 2EIJC 4E7ZA 2LSEA 4U5GA 1OCCC 2IXOA 3RH3A 2L9JA 1TWAA 2ZXOA 4JCHA 4OD5A 1OCZC 1ZYRF 3NYMA 3K1IC 4O6YA 3FVYA 2NUPA 3LS1A 2W45A 5DS6A 3RIPA 3K1HA 1W2WA 2DGJA 3KH2A 4WJ0A 4G0HA 2PX3A 3H65A 2I8BA 4K7BA 2WB7A 1MNEA 1FMVA 3KMIA 1V54C 1LVKA 3LJBA 2Q3TA 4KNWA 3UMHA 4CS9C 4E7SA 3L34A 3DM9B 3RFYA 3ABMC 2G62A 4PJNA 3PMRA 2V26A 5E2QA 2PX0A 4NY3A 2XSEA 2IXMA 2EINC 1LS1A 4LERA 2QY9A 3ZVRA 2Y3HA 2D5RB 4LLCA 3EZHA 2XL4A 4FWVA 4G7ZF 3JCUQ 4W8KA 2B0JA 2Z15A 2H7OA 5DQZA 5KYWA 1VMAA 4U5FE 1N1CA 1QZXA 3I4UA 2E87A 4DBRA 2WL8A 4DVYP 3SYNA 3B9QA 5BUOA 2EIMC 2WZLA 5KYUB 5KYXB 2J0WA 1VK5A 1ZU5A 2WZGA 3DAGA 3DMDA 5DVWA 3X2QC 4JVSA 5T1DB 3PHF2 2MWQA 3EGDA 2R7VA 4A2NB 4C7OA 1M2OA 1RJ9B 2KJGA 3LEVA 4HE8D 4G7HF 4IJJA 1O5HA 1JPNA 4AE4A 4QI0A 5KYYA 3AG1C 2A6EF 2Q9BA 2NUPB 5CI8A 2J9WA 1FTSA 2XXAA 1J8YF 5T3TA 4IAOA 4OIPF 3ABLC 3QZCA 4LACB 2Q9CA 4MNDA 1SF8A 3OA1A 2C04A 4BEJA 2J9VA 3HLZA 3N2ZB 3KKBA 2KGOA 2FFHA 4RDAA 1D0ZA 5L3VA 2A69F 3UNGC 5B3SC 5D92A 4JURI 4QDLA 3NDBB 3X1OA 4ULWA 4BJ5A 1TWCA 4AK9A 1D0XA 1M56C 3NRHA 4C3DA 3LNRA 3EPVA 2ZXPA 4CS7A 1BR2A 2Y3BA 4BJ6C 1MNDA 2WVQA 1NU7D 3B0UX 3ECSA 3Q7LA 1TWGA 3DJNB 5F5FA 2IOQA 4GYTA 3LAYA 2R7XA 1JPJA 3F46A 4KNVA 4B6IA 2DYSC 3RYLA 4IWBA 3N0TA 2HV6A 3UGPA 4YJWA 3MX3A 3RKOF 1FMWA 3S27A 4F4BA 2XRHA 5HSWA 4I1MA 2GFHA 4XLPF 1ZHYA 5E33A 4CBEA 3EFOB 3K6BA 4PJMA 3UGOA 3NYJA 4RD9A 3UR3C 2W9YA 4CIHA 4YT5A 1SZIA 3WG7C 3T4RA 4XWJA 1Z63A 1Z3IX 4JJGA 4YT8A 2WZFA 2G3KA 4OIRF 4RBNA 3AG3C 1TR2A 3EH2A 3NKDA 2NUTA 3E9VA 4N06A 4O6NA 4XLNF 3EGXA 3W2WA 4AE4B 4DBQA 2CDQA 2R7UA 2H7VC 3I5QA 1OCOC 3M1CB 1MMDA 3ZIBA 4X0RA 4ANJA 3EG9B 2M4EA 5EHHA 1S7ZA 3UMIA 2R7OA 4I3MA 4Q4ZF 1D1AA 4BG0A 1D1CA 3EH1A 5CI9A 4U5HA 4J32B 4ZLDA 3NKEA 2P7VA 1ZHZA 3DD7A 2PP4A 3T6JA 3UMKA 2Y3DA 2ZPAA 4YT2A 3Q6NA 4K0DA 2P6VA 2MYSA 3POVA 3HJCA 1FFHA 4PJLA 4YN0B 2VB6A 2IXNA 3DZAA 2QTVA 4CS8C 3ITFA 3LS0A 4CSAA 3LESA 5DQTA 3IEEA 2G3VA 5KYNA 4XTKA 2YZSA 1Z5ZA 4AX2A 5EGYA 4I1OB 3ZG1A 4EBBA 1QLEC 1VYIA 4FESA 3B0VC 2Y69C 3AG4C 3O6XA 3T6BA 2NG1A 2VASA 3EJNA 1Z23A 4JZAA 1TWHA 2O9XA 5B1AC 3DXJF 3SEOA 1NG1A 3Q7GA 1NU9C 1VYKA 3O39A 5DS5A 2YEVA 2PFDA 4ZLCA 1MMNA 4O79A 4U5BE 2CNWA 3TD7A 1ZHTA 2KNHA 5E3AA 3HTKC 5E3CA 2V3CC 2A1DD 3DJUB 3K33A 1BR1A 2Q9AA 3KL4A 3K66A 1IZMA 1VOMA 1PD1A 4DOZA 3AQCA 2ZXRA 1MMAA 3FHDA 3MLGA 4PK4A 5KYUA 3OWTA 4U5DE 4G7OF 5KYXA 5KYWB 2PF4E 3S29A 1WGWA 2A6HF 5T3WA 4J30B 1M57C 2OG2A 1PD0A 2J45A 2CNWD 4BJ6A 1RJ9A 2OCCC 2YHSA 2KW3C 5D91A 3CSKA 2FGYA 2BE5F 1J8MF 2R7TA 3EGDB 3I5PA 4U5EE 3ZSUA 1IW7F 3JYHA 2Y3GA 2WVNA 4C7OB 2J9UA 4JJFA 3Q6MA 2R7QA 4IRUA 5FCLA 5B1BC 3OEOA 4OD4A 5KYYB 4HFFB 4GEHA 3AQBA 2H7BA 1ZU4A 3DM5A 2XXAB 3WODF 1OCRC 4CS9A 3N24A 2DYRC 1TKNA 4HFKB 1D1BA 4O6MA 4EWCA 4I44A 1M2VA 3JT1A 4OIOF 3LLIA 3SZRA 1KU2A 4BJ1A 3VYWA 2W4BA 2VH3A 1MMGA 3NYLA 2R7RA 4KC9A 3B0PA 1BR4A 2C03A 4BJTA 5DS4A 3ZC4A 1ZHXA 2KQ9A 1NZEA 3SNHA 2CW0F 3JSZA 3L0IA 3F47A 1OKKA 2J7PA 1V55C 3GODA 4MQ9F 3EHNA 4PJJA 4Q7CA 2HV7A 4CSAC 3CQZA 2X51A 5L3QA 2W4MA 4PFPA 4C3BA 5F5HA 4M63A 3EFOA 2R7WA 3EHMA 3S0XA 1O87A 1FFTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2H7B A;  2PP4 A;  2KNH A; 
#chains in the Genus database with same CATH topology
 3IPM O;  3KYJ A;  3FDQ A;  3K7D A;  3FOO A;  4U9E A;  2IYL D;  2MHR A;  2LFF A;  4LLE A;  1OKK D;  3DAF A;  2ZXW C;  2J7P D;  4IAR A;  2KC3 A;  4C3E A;  4CS8 A;  3V7O A;  4OIN F;  3W8I A;  4U5C E;  1CGN A;  1SMY F;  2X0C A;  3VAY A;  4JW1 A;  2HMZ A;  4Z9H A;  4BJ5 C;  2EIK C;  2ETS A;  3EQL F;  2Q4F A;  2HFI A;  1CGM E;  4FX5 A;  3NG1 A;  3QTH A;  2EIL C;  2I15 A;  3G4Z A;  3QMK A;  1AUE A;  4MVO A;  4JRZ A;  1VLT A;  1MQV A;  5L0C A;  1OW7 A;  1SR2 A;  4MTF A;  1PCX A;  4Q5S F;  1Z6A A;  2YLI A;  2ASR A;  2IXP A;  3EG9 A;  3E70 C;  4PFO A;  3V5Y A;  2A68 F;  3W8H A;  2L81 A;  1YA7 O;  2YQY A;  2NUT B;  2CGE A;  1H9G A;  3FAJ A;  4N6H A;  3EGX B;  4CDV A;  3C8Z A;  3U8V A;  4P6I C;  2LD6 A;  1RKC A;  1U6H A;  4UDV A;  2R02 A;  3SP1 A;  4YWQ A;  1G8X A;  2UUH A;  5IY5 C;  3L1M A;  4YT4 A;  4NTF A;  2J0X A;  2Y39 A;  2A0U A;  1LIH A;  3LLK A;  3CZ6 A;  2AU5 A;  2QUP A;  1ZHW A;  2JD3 A;  2QNL A;  4HEA J;  3S28 A;  5DLJ A;  1HY5 A;  4O7G A;  3FMS A;  1LKX A;  3ABK C;  3S90 A;  4QI2 A;  3AG2 C;  3JRT A;  1R5I D;  4IAQ A;  4JTC B;  3ASN C;  2J46 A;  1ST6 A;  4H4K C;  4KBL A;  2XLM A;  4Z9I A;  3W2V A;  3GAN A;  1D0Y A;  4OIQ F;  4DVZ A;  2R7S A;  1DOW A;  3ASO C;  3SXM A;  2WVO A;  1M2V B;  2HJM A;  3EZI A;  1JRA A;  4KI2 A;  1Q0D A;  2EIJ C;  1APC A;  4E7Z A;  1HW2 A;  2LSE A;  4U5G A;  2GA0 A;  1OCC C;  2IXO A;  3RH3 A;  1LM3 B;  1KNY A;  1WN0 A;  2L9J A;  4XEF A;  1CPQ A;  1TWA A;  2ZXO A;  4JCH A;  3ZTZ A;  4OD5 A;  1OCZ C;  1ZYR F;  3NYM A;  2HJ3 A;  3K1I C;  4AL0 A;  2P61 A;  4MVU A;  5L0G A;  1L7C A;  3A11 A;  3FVY A;  2NUP A;  3H2U A;  3LS1 A;  2W45 A;  4O6Y A;  5DS6 A;  3RIP A;  2R05 A;  3K1H A;  1FNT c;  4JEA A;  3C8G A;  1W2W A;  2DGJ A;  3KH2 A;  4JIO A;  4CDY A;  4WJ0 A;  1K04 A;  2UUI A;  2PX3 A;  3H65 A;  4G0H A;  2P1A A;  2I8B A;  4K7B A;  2WB7 A;  1MNE A;  1FMV A;  3KMI A;  1V54 C;  3U9M A;  1LVK A;  3LJB A;  2Q3T A;  4P9F A;  1YJG A;  3TOM A;  5B3I A;  2J9B A;  4A4A A;  1XZP A;  3MYI A;  4KNW A;  4E18 A;  3UMH A;  4CS9 C;  4E7S A;  2YLD A;  3DM9 B;  3L34 A;  2P0N A;  2HZ8 A;  3RFY A;  2TMV P;  5L0F A;  3ABM C;  2G62 A;  4PJN A;  3PMR A;  3TOL A;  4K1O A;  2V26 A;  5E2Q A;  1QVX A;  2PX0 A;  2YL7 A;  4MW8 A;  1SYQ A;  3C8G D;  4NY3 A;  3TJ5 A;  2XSE A;  2IXM A;  2EIN C;  1LS1 A;  3CEX A;  1S05 A;  3M15 A;  4LER A;  4ONS A;  2QY9 A;  3ZVR A;  2CCY A;  2Y3H A;  2D5R B;  4LLC A;  2YRF A;  3EZH A;  3HNL A;  4MVR A;  2XL4 A;  4FWV A;  4G7Z F;  2VCC A;  4DRH B;  2F22 A;  5A6K A;  3JCU Q;  1JAF A;  4MTG A;  3RF3 A;  4CX9 A;  5BQI A;  4W8K A;  2B0J A;  3GM3 A;  3TUL A;  2L6H A;  2Z15 A;  1YLM A;  2H7O A;  4XPX A;  5DQZ A;  5KYW A;  2L7A A;  1VMA A;  4U5F E;  1N1C A;  2FAP B;  1UG7 A;  1QZX A;  3GEE A;  3HNK A;  3U3F A;  2YVK A;  1R4T A;  3I4U A;  2E87 A;  4DBR A;  2XL8 A;  3B29 A;  2WL8 A;  4P9T A;  4WGZ A;  4DVY P;  3SYN A;  3B9Q A;  2JX0 A;  5BUO A;  2LK4 A;  4H54 A;  1C02 A;  2EIM C;  2WZL A;  4EIY A;  5AC5 A;  1Z7Q c;  2YLG A;  5KYU B;  3U0C A;  5KYX B;  1Q0G A;  1LI5 A;  1BZ4 A;  2J0W A;  1VK5 A;  1ZU5 A;  2WZG A;  3DAG A;  3DMD A;  5DVW A;  2Q7R A;  3X2Q C;  4JVS A;  5T1D B;  3PHF 2;  2MWQ A;  1VTM P;  1AVO B;  2OQM A;  3EGD A;  2R7V A;  4A2N B;  4E17 A;  1U0B B;  3SXZ A;  4MTO A;  1H6G A;  3LEO A;  3B71 A;  4C7O A;  1M2O A;  1RJ9 B;  3H2V A;  2KJG A;  4DRJ B;  3LEV A;  1OW6 A;  1ZW3 A;  4HE8 D;  2OU6 A;  2XM0 A;  1U89 A;  4G7H F;  1OXK A;  2OOC A;  4IJJ A;  1AEP A;  1O5H A;  2EPN A;  5L0D A;  1NFO A;  4DJ9 A;  2LIG A;  1JPN A;  3MFN A;  4AE4 A;  1FR0 A;  4QI0 A;  5JSL A;  3AG1 C;  5KYY A;  2A6E F;  2Q9B A;  1BBH A;  3QW1 A;  4EUK B;  4MVQ A;  3GEH A;  5BQG A;  2NUP B;  2YL0 A;  5CI8 A;  2J9W A;  1RCP A;  1FTS A;  1UFB A;  2XXA A;  1E83 A;  1J8Y F;  4XEV A;  5T3T A;  3U8P A;  1FAP B;  2XLH A;  1WOL A;  4GQH A;  1HE1 A;  3O10 A;  4IAO A;  5A6A A;  3ABL C;  3QZC A;  5JP7 A;  2XM4 A;  4LAC B;  2Q9C A;  4OIP F;  1LI7 A;  2NSF A;  1YZA A;  4MND A;  1SF8 A;  3OA1 A;  2C04 A;  4BEJ A;  1G4U S;  1T5O A;  2H8A A;  2J9V A;  3HLZ A;  3KKB A;  3M4C A;  3N2Z B;  3US6 A;  4E0I A;  2KGO A;  4JC7 A;  4PAC A;  2FFH A;  1JR8 A;  4RDA A;  3FOP A;  1D0Z A;  5L3V A;  2A69 F;  3UNG C;  5B3S C;  1WTY A;  5D92 A;  4JUR I;  1Q0K A;  2VCB A;  4QDL A;  3WHN A;  3JYY A;  3RW0 A;  3X1O A;  3NDB B;  2OEX A;  1Q0F A;  4ULW A;  1WAT A;  4BJ5 A;  1TWC A;  4AK9 A;  1D0X A;  1YZC A;  1Y4C A;  3QVY A;  3T9O A;  4W8P A;  1M56 C;  3NRH A;  1XZQ A;  4MVM A;  2XLO A;  3LNR A;  4C3D A;  3C7J A;  4DXW A;  3EPV A;  2NPU A;  1C03 A;  2ZXP A;  4CS7 A;  2PNO A;  1BR2 A;  1I4Z A;  2Y3B A;  1CGO A;  1MND A;  4BJ6 C;  3GEI A;  2WVQ A;  5A69 A;  3R7C A;  1NU7 D;  2LP4 A;  3C18 A;  3CAX A;  3B0U X;  2XLV A;  3ECS A;  2YWA A;  3Q7L A;  1TWG A;  3DJN B;  5F5F A;  5CIV A;  2IOQ A;  4GYT A;  2XS1 A;  3LAY A;  1JPJ A;  3F46 A;  2R7X A;  2LCH A;  1RKE B;  4KNV A;  4B6I A;  4XEK A;  3JSE O;  2DYS C;  2AP3 A;  2JPU A;  1LS4 A;  2Q00 A;  2AWC A;  2XLW A;  3HKK A;  4IWB A;  3RYL A;  3N0T A;  1NBB A;  2HV6 A;  3RQG A;  3UGP A;  4YJW A;  4D4N A;  3MX3 A;  1B68 A;  1NSG B;  2HUJ A;  3HNI A;  3JZ0 A;  5A6B A;  3RKO F;  1FMW A;  1ORS C;  3S27 A;  5K0I A;  4F4B A;  4JEB A;  1H9T A;  2XRH A;  3TQO A;  5HSW A;  2XLE A;  4I1M A;  2EPK X;  2GFH A;  3PCV A;  4WGY A;  2PBE A;  256B A;  4EBK A;  2EPM X;  4XLP F;  1ZHY A;  5E33 A;  4CBE A;  3EFO B;  3U2L A;  3K6B A;  4PJM A;  5TJ5 E;  1E2X A;  3V5X A;  3UGO A;  1H7I A;  3G50 A;  3NYJ A;  4RD9 A;  1LE4 A;  1HE9 A;  2W9Y A;  3UR3 C;  4CIH A;  4YT5 A;  1SZI A;  1F1M A;  3WG7 C;  1OQC A;  3T4R A;  3VF0 A;  4XWJ A;  2R03 A;  1Z63 A;  4CIP A;  3FXH A;  1Z3I X;  3U3B A;  5A6J A;  4JJG A;  4YT8 A;  3GM1 A;  3RVZ A;  1E85 A;  1LE2 A;  2WZF A;  1NFN A;  3WAQ A;  2G3K A;  4OIR F;  4RBN A;  3AG3 C;  3U2M A;  1QQ3 A;  1TR2 A;  3EH2 A;  4NTB A;  2AVK A;  3NKD A;  2NUT A;  3ZDL A;  3E9V A;  4N06 A;  4O6N A;  4BEM J;  4XLN F;  3EGX A;  3W2W A;  4AE4 B;  3RVY A;  4DBQ A;  1HMD A;  2CDQ A;  3GWL A;  2R7U A;  3C63 A;  2H7V C;  2QLA A;  3IQ5 A;  3I5Q A;  1OCO C;  3FAP B;  3M1C B;  1MMD A;  3QW0 A;  4PR9 A;  4X0R A;  1A7V A;  1TFK B;  1YYX A;  3IHU A;  3SXY A;  2EPO A;  2M4E A;  3EG9 B;  1QKR A;  1S7Z A;  5EHH A;  3UMI A;  2R7O A;  5L0H A;  4I3M A;  4Q4Z F;  1OR2 A;  1D1A A;  4BG0 A;  1D1C A;  1V74 B;  3S9O A;  1EQ1 A;  3EH1 A;  5CI9 A;  3TK0 A;  4E0H A;  4U5H A;  4J32 B;  4ZLD A;  3MBG A;  1GQA A;  3O55 A;  3NKE A;  5HV9 A;  1M6T A;  2P7V A;  2YL1 A;  4CJO A;  3S84 A;  3DWW A;  1ZHZ A;  3DD7 A;  2PP4 A;  3DE9 A;  4WAB A;  3T6J A;  3UMK A;  2Y3D A;  2ZD9 A;  2AWY A;  2ZPA A;  4YT2 A;  5L0J A;  5GPG B;  3Q6N A;  1LPE A;  4YL1 A;  1I4Y A;  4K0D A;  2P6V A;  2MYS A;  2A0B A;  2LQG A;  3HJC A;  4ULV A;  3POV A;  1FFH A;  3IQ6 A;  4PJL A;  2LFD A;  2L6G A;  4YN0 B;  2VB6 A;  2IXN A;  3M4B A;  2NSG A;  3DZA A;  2QTV A;  3AGT A;  3ATP A;  4CS8 C;  3ITF A;  4JTA B;  3IQC A;  4JCZ A;  3RQF A;  4ER9 A;  1TQG A;  3LS0 A;  4CSA A;  1A7D A;  3LES A;  3W4Y A;  5DQT A;  2KSF A;  1T6I A;  4L6R A;  3IEE A;  3BRJ A;  2G3V A;  4D4X A;  3R2P A;  4XTK A;  3ZTM A;  3ZQY A;  5KYN A;  4EHP A;  2VC9 A;  1A7E A;  2YZS A;  2XLD A;  4G78 A;  1Z5Z A;  4JE9 A;  4AX2 A;  3C8G B;  3SXK A;  5EGY A;  4I1O B;  3ZG1 A;  4EBB A;  1QLE C;  1VYI A;  3G4X A;  4FES A;  4JKV A;  5L0I A;  3B0V C;  1EA8 A;  4XQ1 A;  2OKU A;  3GM2 A;  2Y69 C;  3AG4 C;  4YK5 A;  3O6X A;  1JMW A;  3T6B A;  2IM8 A;  2M64 A;  2NG1 A;  2VAS A;  1VLS A;  3AJM A;  3EJN A;  1K05 A;  3IQT A;  4MS2 A;  1C17 M;  1Z23 A;  1G5Z A;  3HNJ A;  4MW3 A;  4JZA A;  1TWH A;  2O9X A;  5B1A C;  3RQE A;  2KYH A;  3DXJ F;  3SEO A;  3ZWI A;  1YYJ A;  1K40 A;  5JT4 A;  4CJG A;  1NG1 A;  3Q7G A;  1NU9 C;  1TFO B;  1VYK A;  3O39 A;  1EI7 A;  4LDK A;  2R9R B;  4JTD B;  3U5S A;  1E84 A;  5DS5 A;  5COF A;  4IB4 A;  1T6U A;  1G4W R;  2YEV A;  3GWN A;  2PFD A;  4ANJ A;  4ZLC A;  1BDJ B;  1MMN A;  4O79 A;  4AL1 A;  4U5B E;  3L8J A;  2CNW A;  2HSB A;  4MVS A;  3VRC A;  5JLI A;  3TD7 A;  1ZHT A;  1A0B A;  2KNH A;  2HMQ A;  3DKA A;  3HTK C;  3DI5 A;  4U9D A;  5E3A A;  5E3C A;  2V3C C;  1QPU A;  2A1D D;  3DJU B;  3K33 A;  1BR1 A;  2Q9A A;  3KL4 A;  3K66 A;  1IZM A;  1VOM A;  4N4W A;  3ZQV A;  1PD1 A;  1WWP A;  4DOZ A;  3AQC A;  2ZXR A;  1MMA A;  3FHD A;  4EKW A;  3MLG A;  4PK4 A;  5KYU A;  3OWT A;  4U5D E;  4G7O F;  2KK1 A;  4MVZ A;  5KYX A;  5KYW B;  2PF4 E;  3TJ6 A;  3GOR A;  1A41 A;  3S29 A;  2HSQ A;  1WGW A;  2A6H F;  1VB5 A;  2GWW A;  5T3W A;  1T01 A;  4J30 B;  1M57 C;  2OG2 A;  2YL3 A;  2ICW G;  1PV3 A;  1PD0 A;  3LNM B;  1KTM A;  2J45 A;  2CNW D;  4XPY A;  1GM5 A;  4BJ6 A;  2L6F A;  2RD9 A;  4DRI B;  1RJ9 A;  4N6C A;  2OEV A;  5COM A;  1HW1 A;  2OCC C;  4J7T A;  2YHS A;  1ZW2 A;  2YKZ A;  1ZVZ A;  2KW3 C;  5D91 A;  3CSK A;  3L8I A;  1ORY A;  1YDI A;  2FGY A;  3JTL O;  3BEH A;  2BE5 F;  1J8M F;  2IBF A;  2R25 A;  3T6G B;  4LDR A;  2R7T A;  3EGD B;  3K1I A;  3I5P A;  1ORJ A;  4U5E E;  3ZSU A;  1IW7 F;  3JYH A;  2Y3G A;  5JVE A;  2WVN A;  4C7O B;  1V4A A;  2D4U A;  2J9U A;  4JJF A;  4FAP B;  3Q6M A;  1XWJ A;  2XS8 A;  3JRM O;  1HMO A;  4XPW A;  3ZIB A;  5A6B D;  1I5N A;  2R7Q A;  3U9J A;  2BC5 A;  2CYD A;  2GDC A;  3NMJ A;  2OJE D;  4IRU A;  1Y6D A;  2DI3 A;  3OEO A;  5B1B C;  4OD4 A;  5FCL A;  5KYY B;  1YAU O;  4GEH A;  4HFF B;  3AQB A;  5EK0 A;  1NLX A;  4R32 A;  1OW8 A;  2H7B A;  1ZU4 A;  1EKY A;  3DM5 A;  4EBJ A;  3AGU A;  3M79 A;  2XXA B;  3WOD F;  3VM6 A;  3LUT B;  1OCR C;  4CS9 A;  3N24 A;  2J8W A;  2DYR C;  4YL3 A;  3PDM P;  1T9K A;  1YA9 A;  5JRA A;  3DE8 A;  2B0H A;  1TKN A;  4NCQ A;  3QVZ A;  1CPR A;  2QE9 A;  1YAR O;  2RSE B;  4HFK B;  5JUA A;  2HKV A;  1D1B A;  1GGQ A;  4O6M A;  5JS5 A;  4EWC A;  3AOU A;  4I44 A;  2BL2 A;  1M2V A;  3JT1 A;  3KYI A;  1WAS A;  4OIO F;  3KPH A;  2HS5 A;  3LLI A;  3SZR A;  1KU2 A;  4BJ1 A;  4IGG A;  3VYW A;  2W4B A;  2VH3 A;  1MMG A;  5FZT A;  3NYL A;  2R7R A;  4KC9 A;  3B0P A;  1L3P A;  1BR4 A;  1OR3 A;  2C03 A;  4BJT A;  5DS4 A;  3ZC4 A;  1ZHX A;  2KQ9 A;  1RKE A;  1NZE A;  3SNH A;  2CW0 F;  3JSZ A;  3J06 A;  3L0I A;  4NQF A;  3F47 A;  5AGF A;  1OKK A;  2J7P A;  1ZZP A;  1YVI A;  1V55 C;  3GOD A;  3MYF A;  1RXQ A;  3EHN A;  4MQ9 F;  1DOV A;  3A9C A;  4PJJ A;  4YL0 A;  4Q7C A;  2HV7 A;  3C62 A;  4CSA C;  2VCA A;  1T6Q A;  3CQZ A;  5COG A;  1QSP A;  4CDA A;  4NC3 A;  2X51 A;  3NMK A;  4NTA A;  2W4M A;  4PFP A;  4BPM A;  4C3B A;  5L3Q A;  1OXB A;  1Q0M A;  3V5Z A;  5BQH A;  4J7Y A;  5F28 E;  5F5H A;  4M63 A;  1E86 A;  2EPL X;  2GAQ A;  3EFO A;  3NMI A;  2R7W A;  1GS9 A;  4Z9J A;  3EHM A;  4LDQ A;  1JOG A;  3S0X A;  2DB4 A;  1O87 A;  2XL6 A;  1RMV A;  5AC4 A;  1FFT C;  1O3U A;  2OJQ A; 
#chains in the Genus database with same CATH homology
 3FDQ A;  3K7D A;  2IYL D;  4LLE A;  1OKK D;  3DAF A;  2ZXW C;  2J7P D;  4C3E A;  4CS8 A;  3V7O A;  4OIN F;  3W8I A;  4U5C E;  1SMY F;  3VAY A;  4JW1 A;  4BJ5 C;  2EIK C;  3EQL F;  4FX5 A;  3NG1 A;  2EIL C;  3QMK A;  1PCX A;  4Q5S F;  1Z6A A;  4PFO A;  2IXP A;  3EG9 A;  3E70 C;  2A68 F;  3W8H A;  2L81 A;  3FAJ A;  2NUT B;  2CGE A;  3EGX B;  4P6I C;  3SP1 A;  4YWQ A;  1G8X A;  5IY5 C;  4YT4 A;  2J0X A;  2Y39 A;  3LLK A;  3CZ6 A;  4HEA J;  5DLJ A;  1ZHW A;  2JD3 A;  3S28 A;  4O7G A;  4QI2 A;  1LKX A;  3ABK C;  3AG2 C;  3JRT A;  3ASN C;  2J46 A;  1ST6 A;  4H4K C;  4KBL A;  4OIQ F;  2R7S A;  3W2V A;  3GAN A;  1D0Y A;  4DVZ A;  3ASO C;  2WVO A;  1M2V B;  3EZI A;  4KI2 A;  2EIJ C;  4E7Z A;  2LSE A;  4U5G A;  1OCC C;  2IXO A;  3RH3 A;  2L9J A;  1TWA A;  2ZXO A;  4JCH A;  4OD5 A;  1OCZ C;  1ZYR F;  3NYM A;  3K1I C;  4O6Y A;  3FVY A;  2NUP A;  3LS1 A;  2W45 A;  5DS6 A;  3RIP A;  3K1H A;  1W2W A;  2DGJ A;  3KH2 A;  4WJ0 A;  4G0H A;  2PX3 A;  3H65 A;  2I8B A;  4K7B A;  2WB7 A;  1MNE A;  1FMV A;  3KMI A;  1V54 C;  1LVK A;  3LJB A;  2Q3T A;  4KNW A;  3UMH A;  4CS9 C;  4E7S A;  3L34 A;  3DM9 B;  3RFY A;  3ABM C;  2G62 A;  4PJN A;  3PMR A;  2V26 A;  5E2Q A;  2PX0 A;  4NY3 A;  2XSE A;  2IXM A;  2EIN C;  1LS1 A;  4LER A;  2QY9 A;  3ZVR A;  2Y3H A;  2D5R B;  4LLC A;  3EZH A;  2XL4 A;  4FWV A;  4G7Z F;  3JCU Q;  4W8K A;  2B0J A;  2Z15 A;  2H7O A;  5DQZ A;  5KYW A;  1VMA A;  4U5F E;  1N1C A;  1QZX A;  3I4U A;  2E87 A;  4DBR A;  2WL8 A;  4DVY P;  3SYN A;  3B9Q A;  5BUO A;  2EIM C;  2WZL A;  5KYU B;  5KYX B;  2J0W A;  1VK5 A;  1ZU5 A;  2WZG A;  3DAG A;  3DMD A;  5DVW A;  3X2Q C;  4JVS A;  5T1D B;  3PHF 2;  2MWQ A;  3EGD A;  2R7V A;  4A2N B;  4C7O A;  1M2O A;  1RJ9 B;  2KJG A;  3LEV A;  4HE8 D;  4G7H F;  4IJJ A;  1O5H A;  1JPN A;  4AE4 A;  4QI0 A;  5KYY A;  3AG1 C;  2A6E F;  2Q9B A;  2NUP B;  5CI8 A;  2J9W A;  1FTS A;  2XXA A;  1J8Y F;  5T3T A;  4IAO A;  4OIP F;  3ABL C;  3QZC A;  4LAC B;  2Q9C A;  4MND A;  1SF8 A;  3OA1 A;  2C04 A;  4BEJ A;  2J9V A;  3HLZ A;  3N2Z B;  3KKB A;  2KGO A;  2FFH A;  4RDA A;  1D0Z A;  5L3V A;  2A69 F;  3UNG C;  5B3S C;  5D92 A;  4JUR I;  4QDL A;  3NDB B;  3X1O A;  4ULW A;  4BJ5 A;  1TWC A;  4AK9 A;  1D0X A;  1M56 C;  3NRH A;  4C3D A;  3LNR A;  3EPV A;  2ZXP A;  4CS7 A;  1BR2 A;  2Y3B A;  4BJ6 C;  1MND A;  2WVQ A;  1NU7 D;  3B0U X;  3ECS A;  3Q7L A;  1TWG A;  3DJN B;  5F5F A;  2IOQ A;  4GYT A;  3LAY A;  2R7X A;  1JPJ A;  3F46 A;  4KNV A;  4B6I A;  2DYS C;  3RYL A;  4IWB A;  3N0T A;  2HV6 A;  3UGP A;  4YJW A;  3MX3 A;  3RKO F;  1FMW A;  3S27 A;  4F4B A;  2XRH A;  5HSW A;  4I1M A;  2GFH A;  4XLP F;  1ZHY A;  5E33 A;  4CBE A;  3EFO B;  3K6B A;  4PJM A;  3UGO A;  3NYJ A;  4RD9 A;  3UR3 C;  2W9Y A;  4CIH A;  4YT5 A;  1SZI A;  3WG7 C;  3T4R A;  4XWJ A;  1Z63 A;  1Z3I X;  4JJG A;  4YT8 A;  2WZF A;  2G3K A;  4OIR F;  4RBN A;  3AG3 C;  1TR2 A;  3EH2 A;  3NKD A;  2NUT A;  3E9V A;  4N06 A;  4O6N A;  4XLN F;  3EGX A;  3W2W A;  4AE4 B;  4DBQ A;  2CDQ A;  2R7U A;  2H7V C;  3I5Q A;  1OCO C;  3M1C B;  1MMD A;  3ZIB A;  4X0R A;  4ANJ A;  3EG9 B;  2M4E A;  5EHH A;  1S7Z A;  3UMI A;  2R7O A;  4I3M A;  4Q4Z F;  1D1A A;  4BG0 A;  1D1C A;  3EH1 A;  5CI9 A;  4U5H A;  4J32 B;  4ZLD A;  3NKE A;  2P7V A;  1ZHZ A;  3DD7 A;  2PP4 A;  3T6J A;  3UMK A;  2Y3D A;  2ZPA A;  4YT2 A;  3Q6N A;  4K0D A;  2P6V A;  2MYS A;  3POV A;  3HJC A;  1FFH A;  4PJL A;  4YN0 B;  2VB6 A;  2IXN A;  3DZA A;  2QTV A;  4CS8 C;  3ITF A;  3LS0 A;  4CSA A;  3LES A;  5DQT A;  3IEE A;  2G3V A;  5KYN A;  4XTK A;  2YZS A;  1Z5Z A;  4AX2 A;  5EGY A;  4I1O B;  3ZG1 A;  4EBB A;  1QLE C;  1VYI A;  4FES A;  3B0V C;  2Y69 C;  3AG4 C;  3O6X A;  3T6B A;  2NG1 A;  2VAS A;  3EJN A;  1Z23 A;  4JZA A;  1TWH A;  2O9X A;  5B1A C;  3DXJ F;  3SEO A;  1NG1 A;  3Q7G A;  1NU9 C;  1VYK A;  3O39 A;  5DS5 A;  2YEV A;  2PFD A;  4ZLC A;  1MMN A;  4O79 A;  4U5B E;  2CNW A;  3TD7 A;  1ZHT A;  2KNH A;  5E3A A;  3HTK C;  5E3C A;  2V3C C;  2A1D D;  3DJU B;  3K33 A;  1BR1 A;  2Q9A A;  3KL4 A;  3K66 A;  1IZM A;  1VOM A;  1PD1 A;  4DOZ A;  3AQC A;  2ZXR A;  1MMA A;  3FHD A;  3MLG A;  4PK4 A;  5KYU A;  3OWT A;  4U5D E;  4G7O F;  5KYX A;  5KYW B;  2PF4 E;  3S29 A;  1WGW A;  2A6H F;  5T3W A;  4J30 B;  1M57 C;  2OG2 A;  1PD0 A;  2J45 A;  2CNW D;  4BJ6 A;  1RJ9 A;  2OCC C;  2YHS A;  2KW3 C;  5D91 A;  3CSK A;  2FGY A;  2BE5 F;  1J8M F;  2R7T A;  3EGD B;  3I5P A;  4U5E E;  3ZSU A;  1IW7 F;  3JYH A;  2Y3G A;  2WVN A;  4C7O B;  2J9U A;  4JJF A;  3Q6M A;  2R7Q A;  4IRU A;  5FCL A;  5B1B C;  3OEO A;  4OD4 A;  5KYY B;  4HFF B;  4GEH A;  3AQB A;  2H7B A;  1ZU4 A;  3DM5 A;  2XXA B;  3WOD F;  1OCR C;  4CS9 A;  3N24 A;  2DYR C;  1TKN A;  4HFK B;  1D1B A;  4O6M A;  4EWC A;  4I44 A;  1M2V A;  3JT1 A;  4OIO F;  3LLI A;  3SZR A;  1KU2 A;  4BJ1 A;  3VYW A;  2W4B A;  2VH3 A;  1MMG A;  3NYL A;  2R7R A;  4KC9 A;  3B0P A;  1BR4 A;  2C03 A;  4BJT A;  5DS4 A;  3ZC4 A;  1ZHX A;  2KQ9 A;  1NZE A;  3SNH A;  2CW0 F;  3JSZ A;  3L0I A;  3F47 A;  1OKK A;  2J7P A;  1V55 C;  3GOD A;  4MQ9 F;  3EHN A;  4PJJ A;  4Q7C A;  2HV7 A;  4CSA C;  3CQZ A;  2X51 A;  5L3Q A;  2W4M A;  4PFP A;  4C3B A;  5F5H A;  4M63 A;  3EFO A;  2R7W A;  3EHM A;  3S0X A;  1O87 A;  1FFT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...