2P6VA

Structure of tafh domain of the human taf4 subunit of tfiid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
89
Chain Sequence
SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSPQPYLVPFLRSLPALRQLTPDSAAFIQQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 4
publication title Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2p6vA00
2KNHA 2H7BA 2PP4A 2P6VA
chains in the Genus database with same CATH superfamily
3MYIA 2AU5A 4CDAA 3M79A 2BC5A 4LLCA 2L9JA 2NSFA 3PCVA 3K1IC 3EHNA 2CDQA 1TWCA 2XL8A 4R32A 4E7SA 5D92A 3RYLA 3LS1A 5BQHA 1E2XA 3U8PA 3ZTMA 4RDAA 5A6BA 1EI7A 1PD1A 3AG4C 2HSQA 4BEMJ 3A9CA 4EBKA 3ZIBA 1O87A 4FWVA 2VC9A 3UR3C 3B0UX 1ZHZA 2A1DD 4PJLA 1N1CA 2XLWA 3OEOA 3GEEA 4ONSA 1E84A 4KNVA 4BPMA 2PX0A 2QTVA 2YL0A 1G5ZA 2FAPB 2BL2A 1LM3B 4MVOA 2XM0A 4DJ9A 1UG7A 4Q5SF 1LE2A 2YHSA 1L3PA 4ULVA 1GM5A 2Y3GA 3VM6A 1MNDA 1FTSA 2CGEA 4JCZA 5COGA 4O7GA 3FOPA 2NPUA 3UMKA 4IWBA 2J9BA 1BZ4A 1Q0DA 1YDIA 3HKKA 4MVUA 1HMDA 3U2LA 4CIPA 2HMQA 2YVKA 4WJ0A 4YT4A 3EGXB 3AJMA 3DXJF 1S7ZA 3UMIA 2J0WA 5JVEA 5AGFA 4XQ1A 3QZCA 5L0IA 4BJ5C 2VH3A 4Z9HA 1KNYA 5L3VA 4YJWA 4AX2A 1LKXA 2HV7A 4BJ5A 3FDQA 4G7ZF 2OCCC 4MQ9F 4JRZA 4EBBA 2G3KA 3TJ5A 1QLEC 3MLGA 4DRJB 2PFDA 2YLGA 2G3VA 4I1OB 3SZRA 4DVZA 4C3DA 1R4TA 3JT1A 3V5XA 4WGYA 1CGNA 4CDVA 2NG1A 1V74B 3K33A 1OXBA 1VK5A 2OU6A 5F28E 3TJ6A 4CBEA 1CGME 1H6GA 2XXAA 5EGYA 3FOOA 4XEKA 5CI8A 5T1DB 3HJCA 1B68A 1YA7O 1YYJA 3TULA 3U0CA 4E18A 5JLIA 3ITFA 1M6TA 3KMIA 5F5HA 5L0CA 4XEFA 4Z9IA 1OCRC 1ORJA 2YL3A 3IQCA 1OKKD 3ZTZA 1JMWA 2VCCA 1NU7D 2XL4A 1QSPA 4LDQA 1VOMA 3C8GA 1WWPA 2DB4A 2G62A 2HSBA 2R7UA 2Y3BA 1SR2A 3C63A 4YT8A 1M2OA 2OJED 3S0XA 3UNGC 5JUAA 1F1MA 4C7OA 4DOZA 1HW2A 1RJ9B 2IYLD 4JJFA 4RD9A 4J7TA 4AK9A 1G8XA 1QPUA 4EIYA 2R7QA 1YJGA 2ZXWC 5HV9A 4U5FE 5GPGB 5FCLA 2XLEA 2I8BA 1WOLA 4IAQA 2YLDA 2L6HA 2XRHA 4E0IA 1NZEA 1D0YA 4IJJA 4MTFA 5HSWA 1RJ9A 256BA 3IEEA 1QZXA 4OINF 4F4BA 4OD5A 1VYKA 1H9GA 1RXQA 3ABKC 2R7OA 3Q7GA 3Q7LA 1T01A 5AC5A 4NTBA 2XLOA 4KBLA 3NKDA 5JS5A 1HW1A 3POVA 2EIKC 1ORYA 3GORA 3HNJA 2XXAB 4NTFA 4MTOA 3W2VA 3GM2A 4NQFA 1TR2A 2R9RB 2R03A 3MBGA 3NYLA 4IB4A 4J30B 2P61A 4YN0B 4ZLCA 1C02A 1D0XA 3T6JA 4B6IA 3C18A 3HLZA 1HMOA 3GM3A 2Q9BA 2Y39A 3R2PA 3PHF2 2AWCA 4P9FA 4IAOA 4X0RA 3WAQA 5T3WA 4N06A 2EIJC 2CNWA 2A0BA 1A41A 1IW7F 2A6HF 2KJGA 4I44A 4O6MA 1LI7A 2X51A 4U5BE 1QKRA 3HNKA 3U8VA 2DYRC 1CGOA 4Q7CA 5B1AC 2J9WA 4U5DE 5L0JA 3GWNA 3E70C 4N6CA 1V54C 5COMA 3WG7C 1OW8A 3RIPA 4C3EA 2DGJA 2L7AA 3C8ZA 5JSLA 1A0BA 2B0JA 3X2QC 2R7WA 3ABLC 1YZCA 1QQ3A 1R5ID 4U9DA 5KYWA 1ZHTA 1OQCA 1KTMA 3LUTB 2PP4A 4A4AA 4EUKB 4YL1A 3ZWIA 1PD0A 3NMJA 1MMNA 1JPJA 3DKAA 1U0BB 4EHPA 1MQVA 4Q4ZF 2GFHA 3RQEA 1DOVA 1VTMP 4OIRF 5KYYA 3LLKA 1T6UA 3T4RA 1WASA 2XS8A 3WHNA 5B3SC 1V4AA 5E2QA 3S84A 4JE9A 1TWGA 4YL3A 1FMVA 3FVYA 1Z7Qc 1TFKB 1OR2A 3JZ0A 1WATA 3NKEA 4NTAA 3RKOF 3ZC4A 3C8GD 2ASRA 4AL1A 4W8KA 3H65A 1ZYRF 4NC3A 4CS9A 3L34A 1H9TA 3O10A 3U9JA 4A2NB 3ZVRA 4JTCB 4WGZA 1I4YA 2J46A 3EG9A 3FAJA 3K7DA 2QY9A 2QNLA 4MVRA 4O6NA 2LQGA 2KGOA 3AGUA 4FX5A 1CPRA 4LDKA 1YAUO 4E17A 2WB7A 5K0IA 1APCA 2Q3TA 3LS0A 5IY5C 4XLPF 4H4KC 2R7VA 4MVQA 4JTAB 3EQLF 1PV3A 4XWJA 3SNHA 2EPLX 3ABMC 3DAFA 2Z15A 4G78A 2KNHA 1EKYA 4PFPA 4ANJA 1ZZPA 4MS2A 3EZHA 1NSGB 4FAPB 3TK0A 3AG1C 1E85A 4IARA 5L0FA 2WL8A 1Z63A 2IM8A 1MMDA 1Q0GA 3DZAA 1TFOB 3IQ5A 1JR8A 4YK5A 1Q0KA 3ZQYA 5DS6A 5F5FA 5A69A 3SEOA 2IXOA 1LS1A 3H2VA 4W8PA 1HY5A 2AVKA 2ICWG 3GM1A 3RVZA 4NCQA 3DWWA 3LNRA 2ZPAA 1YVIA 1PCXA 4LERA 4XEVA 1RMVA 2W4BA 2OOCA 2WVQA 3L0IA 3VRCA 5CIVA 3C8GB 5KYNA 4OIPF 1LPEA 1T9KA 2JPUA 4JW1A 2JX0A 2NSGA 4D4NA 1JRAA 2VCBA 4PJJA 4OD4A 4KI2A 1G4US 3HTKC 3UGOA 3CSKA 2C04A 2OJQA 4C7OB 5A6AA 1K40A 1I4ZA 3Q6NA 2RSEB 4AE4A 2CNWD 1Z23A 2L6GA 2WZFA 3ATPA 3LEVA 4HE8D 1ZVZA 1ZHWA 1OCZC 1D1BA 3AGTA 3JCUQ 1OW7A 3DI5A 4U9EA 1BR4A 1D1AA 3QTHA 4PACA 2GDCA 2PBEA 3VAYA 1FMWA 2HMZA 4XLNF 1NU9C 2A69F 2F22A 2LSEA 3KH2A 1A7VA 2EPNA 2KK1A 1LIHA 1O3UA 1FAPB 2XL6A 3LESA 3O39A 3OWTA 2Y3HA 3QVYA 2R7TA 4CSAC 3GODA 2IBFA 2IXPA 3JYYA 2TMVP 2LFDA 2FGYA 1ST6A 4CSAA 1VMAA 2A6EF 4LLEA 2YZSA 2R25A 2R7RA 3NYJA 1RKCA 2J45A 2W4MA 3DM9B 2QE9A 3NRHA 3HNLA 2JD3A 1SYQA 2EPKX 2IXNA 3ZG1A 4G7OF 2XS1A 4FESA 3JTLO 2VCAA 3PDMP 1I5NA 2KYHA 2LCHA 4EKWA 1FFHA 1U89A 3EFOA 2EPMX 1IZMA 2BE5F 3N24A 4BJ1A 3X1OA 4G7HF 2A68F 2WZLA 1FFTC 1LE4A 1VLTA 3DMDA 3L8JA 3B0VC 2Q00A 4XPWA 1AVOB 2V26A 3ZQVA 4BG0A 2HZ8A 3GEIA 1GS9A 2J9UA 3BEHA 3JRMO 2P0NA 3PMRA 4N6HA 5BQGA 2L6FA 5DS5A 2H7BA 2CYDA 4LDRA 4MVSA 1EQ1A 2H7OA 4I3MA 5TJ5E 2UUIA 4CIHA 3V5YA 4MNDA 2OEXA 1WN0A 3CZ6A 4Z9JA 1ORSC 3RF3A 5DS4A 3GEHA 3HNIA 1VB5A 3L1MA 3RFYA 1NFOA 3AG2C 4O6YA 4XTKA 5B3IA 3TD7A 2HJ3A 5KYWB 4JCHA 3WODF 4ER9A 4MW8A 3JYHA 1NLXA 1TWHA 3EHMA 1YYXA 4PK4A 3RH3A 2J7PA 5L0DA 1BR2A 2R7XA 2IOQA 3DE9A 1C17M 3QW0A 3S29A 4JIOA 1K05A 1M2VA 3AOUA 3CAXA 3F47A 4XPXA 3SYNA 2R02A 5FZTA 5KYYB 3ASOC 3AG3C 3ASNC 2H7VC 2ZD9A 1SZIA 1NFNA 5E3AA 3V7OA 2MHRA 3VYWA 1JPNA 1E83A 2GA0A 4CS8C 2Y69C 3CEXA 5DVWA 2Y3DA 1VYIA 1LS4A 2LK4A 2WVOA 2HV6A 3A11A 2KW3C 4JKVA 4PJMA 4CJGA 4CS8A 5KYUB 2J0XA 2HJMA 1WTYA 2PF4E 4YL0A 1BR1A 2OQMA 3B9QA 2XLHA 1RCPA 3C7JA 1ZW2A 3IPMO 2PX3A 2EIMC 1A7EA 2GAQA 2XSEA 1JAFA 2YEVA 3EG9B 3DAGA 3G4XA 4P9TA 3T6BA 1YARO 3AQBA 3S27A 3NMKA 3FAPB 4H54A 4MW3A 3SXMA 3O55A 1LVKA 4G0HA 3OA1A 2XLDA 2W45A 4M63A 1NBBA 5COFA 4CS9C 5KYUA 2W9YA 3W4YA 4CS7A 4YT2A 3RVYA 4J7YA 4DBQA 1Y4CA 1M57C 3V5ZA 2D4UA 4PR9A 1SMYF 1ZHYA 4J32B 4K7BA 3QVZA 4PJNA 2NUTA 3K1IA 3US6A 2NUPB 1XZPA 2ETSA 2MWQA 1L7CA 3LLIA 4JURI 5DLJA 1M56C 1FNTc 2A0UA 4QI0A 4GYTA 1OCCC 4P6IC 1BDJB 2ZXOA 2LP4A 3DJUB 3TQOA 3H2UA 2UUHA 3EZIA 2B0HA 2DI3A 4KNWA 4JTDB 2NUPA 3NG1A 4K0DA 2EINC 3MX3A 4JZAA 2P6VA 5EK0A 3K66A 3Q6MA 1SF8A 3S9OA 1K04A 3NYMA 3M4BA 2L81A 2P7VA 3IQTA 1TQGA 4JEBA 1ZU4A 2AWYA 4AE4B 1Q0MA 2ZXPA 4QI2A 3AQCA 4ZLDA 4L6RA 4DBRA 3CQZA 3JSEO 3ECSA 5E33A 1WGWA 2GWWA 2HS5A 3VF0A 5BQIA 5L0HA 2J9VA 2LFFA 2OKUA 2OEVA 1ZHXA 2PNOA 4EBJA 3NDBB 1G4WR 3K6BA 2HFIA 1VLSA 2MYSA 2C03A 3FMSA 1XWJA 4E7ZA 4AL0A 5L3QA 4JEAA 5A6JA 1DOWA 1ZW3A 3M1CB 3U9MA 3M15A 3ZDLA 1HE9A 2J8WA 3GWLA 3SP1A 1Z5ZA 2KSFA 2AP3A 3LAYA 4U5EE 4BJTA 4CX9A 1UFBA 5BUOA 4U5CE 2Q9AA 2J7PD 1S05A 1T6QA 2YLIA 3EH2A 3I5PA 3SXYA 3N0TA 3T6GB 2YWAA 2WZGA 1O5HA 3EGXA 2IXMA 4WABA 4QDLA 3K1HA 4IRUA 5DQTA 1GGQA 3KPHA 1W2WA 3EFOB 3KL4A 4HEAJ 4DRIB 4MTGA 2KC3A 5D91A 1D1CA 1TKNA 3LJBA 2Q7RA 1A7DA 2Q4FA 1RKEB 4JVSA 3T9OA 3TOLA 4MVMA 3SXZA 3W2WA 3IHUA 4MVZA 3RW0A 1H7IA 3L8IA 5E3CA 5JRAA 1E86A 3MYFA 3R7CA 3G50A 5B1BC 5JT4A 1D0ZA 2QLAA 4YWQA 3E9VA 5T3TA 2VB6A 3QMKA 2ZXRA 2H8AA 1Y6DA 3DJNB 3LEOA 1J8MF 3BRJA 3EGDB 3U5SA 4D4XA 3DE8A 5KYXB 2HKVA 2YQYA 1MMAA 3O6XA 3W8IA 1ZU5A 3GANA 3KYJA 3S28A 4OIQF 1LI5A 1RKEA 4EWCA 4E0HA 1MNEA 2M64A 2LIGA 2XLVA 1NG1A 3JRTA 3RQFA 3W8HA 4LACB 4K1OA 4OIOF 3SXKA 1EA8A 2R05A 1JOGA 3I5QA 1XZQA 3UGPA 1U6HA 1T5OA 4DVYP 3N2ZB 3EJNA 3B0PA 3DM5A 2EPOA 3EGDA 4JC7A 4IGGA 5CI9A 5KYXA 1M2VB 2E87A 3NMIA 3J06A 1OCOC 4UDVA 1YZAA 1OW6A 1OXKA 2DYSC 2Q9CA 2WVNA 3B29A 3JSZA 5A6BD 5AC4A 3RQGA 5JP7A 3U3BA 2VASA 3LNMB 4I1MA 2X0CA 1C03A 4HFKB 4CDYA 1GQAA 2P1AA 4GEHA 4PFOA 3M4CA 3S90A 3EPVA 1TWAA 2OG2A 2YRFA 4BEJA 2D5RB 3KYIA 3UMHA 3ZSUA 3U2MA 1Q0FA 2YL1A 1J8YF 3C62A 2KQ9A 4ULWA 5L0GA 4XPYA 3B71A 3G4ZA 4KC9A 4HFFB 5A6KA 4BJ6C 5DQZA 4U5HA 1AUEA 2RD9A 1QVXA 3FHDA 4DRHB 1T6IA 2LD6A 4BJ6A 2M4EA 3KKBA 1Z3IX 4GQHA 2YL7A 4DXWA 2R7SA 1AEPA 2XM4A 3I4UA 1BBHA 5EHHA 4YT5A 4N4WA 4C3BA 1V55C 2O9XA 3EH1A 3FXHA 2QUPA 2FFHA 4NY3A 2HUJA 1OR3A 1MMGA 2NUTB 3F46A 1KU2A 1OKKA 2I15A 2CCYA 4O79A 1HE1A 4U5GA 3QW1A 1YLMA 2YKZA 4RBNA 1CPQA 3DD7A 1YA9A 3TOMA 1FR0A 1Z6AA 4CJOA 3IQ6A 2EILC 2XLMA 2V3CC 2CW0F 4JJGA 3MFNA 3U3FA
chains in the Genus database with same CATH topology
4LLCA 2L9JA 3K1IC 3EHNA 2CDQA 1TWCA 4E7SA 5D92A 3RYLA 3LS1A 4RDAA 1PD1A 3AG4C 3ZIBA 1O87A 4FWVA 3UR3C 3B0UX 1ZHZA 2A1DD 4PJLA 1N1CA 3OEOA 4KNVA 2PX0A 2QTVA 4Q5SF 2YHSA 2Y3GA 1MNDA 1FTSA 2CGEA 4O7GA 3UMKA 4IWBA 4YT4A 3EGXB 3DXJF 1S7ZA 3UMIA 2J0WA 3QZCA 4BJ5C 2VH3A 5L3VA 4YJWA 4AX2A 1LKXA 2HV7A 4BJ5A 3FDQA 4G7ZF 2OCCC 4MQ9F 4EBBA 2G3KA 1QLEC 3MLGA 2PFDA 2G3VA 4I1OB 3SZRA 4DVZA 4C3DA 3JT1A 2NG1A 3K33A 4CBEA 1VK5A 5EGYA 5T1DB 5CI8A 3HJCA 3ITFA 3KMIA 5F5HA 1OCRC 1OKKD 1NU7D 2XL4A 1VOMA 2G62A 2R7UA 2Y3BA 1M2OA 3S0XA 3UNGC 4C7OA 4DOZA 1RJ9B 2IYLD 4JJFA 4RD9A 4AK9A 1G8XA 2R7QA 2ZXWC 4U5FE 5FCLA 2I8BA 2XRHA 1NZEA 1D0YA 4IJJA 5HSWA 1RJ9A 3IEEA 1QZXA 4OINF 4F4BA 4OD5A 1VYKA 3ABKC 2R7OA 3Q7GA 3Q7LA 4KBLA 3NKDA 3POVA 2EIKC 2XXAB 3W2VA 1TR2A 3NYLA 4J30B 4YN0B 4ZLCA 1D0XA 3T6JA 4B6IA 3HLZA 2Q9BA 2Y39A 3PHF2 4IAOA 4X0RA 5T3WA 4N06A 2EIJC 2CNWA 1IW7F 2A6HF 2KJGA 4I44A 4O6MA 2X51A 4U5BE 2DYRC 4Q7CA 5B1AC 2J9WA 4U5DE 3E70C 1V54C 3WG7C 3RIPA 4C3EA 2DGJA 2B0JA 3X2QC 2R7WA 3ABLC 5KYWA 1ZHTA 2PP4A 1PD0A 1MMNA 1JPJA 4Q4ZF 2GFHA 4OIRF 5KYYA 3LLKA 3T4RA 5B3SC 5E2QA 1TWGA 1FMVA 3FVYA 3NKEA 3RKOF 3ZC4A 4W8KA 3H65A 1ZYRF 4CS9A 3L34A 4A2NB 3ZVRA 3EG9A 2J46A 3K7DA 3FAJA 4O6NA 2QY9A 4FX5A 2KGOA 4XLPF 2WB7A 2Q3TA 3LS0A 5IY5C 4H4KC 2R7VA 4XWJA 3EQLF 3SNHA 3ABMC 3DAFA 2Z15A 2KNHA 4PFPA 4ANJA 3EZHA 3AG1C 2WL8A 1Z63A 1MMDA 3DZAA 5DS6A 5F5FA 3SEOA 2IXOA 1LS1A 3LNRA 2ZPAA 1PCXA 4LERA 2W4BA 2WVQA 3L0IA 4OIPF 5KYNA 4JW1A 4PJJA 4KI2A 4OD4A 3HTKC 3UGOA 3CSKA 2C04A 4C7OB 3Q6NA 4AE4A 2CNWD 1Z23A 2WZFA 3LEVA 4HE8D 4WJ0A 1ZHWA 3JCUQ 1OCZC 1D1BA 1D1AA 1BR4A 3VAYA 1FMWA 4XLNF 1NU9C 2A69F 2LSEA 3KH2A 3O39A 3OWTA 3LESA 2Y3HA 2R7TA 4CSAC 3GODA 2IXPA 2FGYA 1ST6A 4CSAA 1VMAA 2A6EF 4LLEA 2YZSA 2R7RA 3NYJA 2J45A 2W4MA 3DM9B 3NRHA 2JD3A 3ZG1A 2IXNA 4G7OF 4FESA 1FFHA 3EFOA 1IZMA 2BE5F 3N24A 4BJ1A 3X1OA 4G7HF 2A68F 2WZLA 1FFTC 3DMDA 3B0VC 2V26A 4BG0A 2J9UA 3PMRA 5DS5A 2H7BA 2H7OA 4I3MA 4CIHA 4MNDA 3CZ6A 5DS4A 3RFYA 4O6YA 3AG2C 4XTKA 3TD7A 5KYWB 4JCHA 3JYHA 1TWHA 3EHMA 4PK4A 3RH3A 2J7PA 2R7XA 1BR2A 2IOQA 3S29A 3SYNA 3WODF 1M2VA 3F47A 5KYYB 3ASOC 3AG3C 3ASNC 2H7VC 5E3AA 1SZIA 3V7OA 3VYWA 1JPNA 4CS8C 2Y69C 5DVWA 2Y3DA 1VYIA 2WVOA 2HV6A 4CS8A 2KW3C 4PJMA 5KYUB 2J0XA 2PF4E 1BR1A 3B9QA 2PX3A 2EIMC 2XSEA 2YEVA 3EG9B 3T6BA 3DAGA 3AQBA 3S27A 1LVKA 4G0HA 3OA1A 2W45A 4M63A 4CS9C 5KYUA 2W9YA 4CS7A 4YT2A 4DBQA 1M57C 1SMYF 1ZHYA 4J32B 4K7BA 4PJNA 2NUTA 2NUPB 2MWQA 3LLIA 4JURI 5DLJA 1M56C 4QI0A 4GYTA 1OCCC 4P6IC 2ZXOA 3DJUB 3EZIA 4KNWA 2NUPA 3NG1A 4K0DA 2EINC 3MX3A 4JZAA 2P6VA 3K66A 3Q6MA 1SF8A 3NYMA 4AE4B 2L81A 2P7VA 4QI2A 1ZU4A 2ZXPA 3AQCA 4ZLDA 4DBRA 3CQZA 3ECSA 5E33A 1WGWA 2J9VA 1ZHXA 3NDBB 3K6BA 2MYSA 5L3QA 2C03A 4E7ZA 3M1CB 3SP1A 1Z5ZA 3LAYA 4U5EE 4BJTA 5BUOA 4U5CE 2Q9AA 2J7PD 3EH2A 3I5PA 3N0TA 2WZGA 1O5HA 3EGXA 2IXMA 4QDLA 3K1HA 4IRUA 5DQTA 1W2WA 3EFOB 3KL4A 4HEAJ 5D91A 1D1CA 1TKNA 3LJBA 4JVSA 3W2WA 5E3CA 5B1BC 1D0ZA 4YWQA 3E9VA 5T3TA 2VB6A 3QMKA 2ZXRA 3DJNB 1J8MF 3EGDB 5KYXB 3O6XA 1MMAA 3W8IA 4OIQF 1ZU5A 3GANA 3S28A 4EWCA 1MNEA 1NG1A 3JRTA 3W8HA 4LACB 4OIOF 3I5QA 3UGPA 4DVYP 3N2ZB 3EJNA 3B0PA 3DM5A 3EGDA 5CI9A 5KYXA 1M2VB 2E87A 1OCOC 3JSZA 2DYSC 2Q9CA 2WVNA 2VASA 4I1MA 4HFKB 4GEHA 4PFOA 3EPVA 1TWAA 2OG2A 4BEJA 2D5RB 3UMHA 3ZSUA 1J8YF 4ULWA 2KQ9A 4KC9A 4HFFB 4BJ6C 5DQZA 4U5HA 3FHDA 4BJ6A 2M4EA 3KKBA 1Z3IX 2R7SA 3I4UA 5EHHA 4YT5A 4C3BA 1V55C 2O9XA 3EH1A 2FFHA 4NY3A 1MMGA 3F46A 2NUTB 1KU2A 1OKKA 4O79A 4U5GA 4RBNA 2XXAA 3DD7A 1Z6AA 2EILC 2V3CC 2CW0F 4JJGA 4YT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNH A;  2H7B A;  2PP4 A;  2P6V A; 
#chains in the Genus database with same CATH topology
 3MYI A;  2AU5 A;  4CDA A;  3M79 A;  2BC5 A;  4LLC A;  2L9J A;  2NSF A;  3PCV A;  3K1I C;  3EHN A;  2CDQ A;  1TWC A;  2XL8 A;  4R32 A;  4E7S A;  5D92 A;  3RYL A;  3LS1 A;  5BQH A;  1E2X A;  3U8P A;  3ZTM A;  4RDA A;  5A6B A;  1EI7 A;  1PD1 A;  3AG4 C;  2HSQ A;  4BEM J;  3A9C A;  4EBK A;  3ZIB A;  1O87 A;  4FWV A;  2VC9 A;  3UR3 C;  3B0U X;  1ZHZ A;  2A1D D;  4PJL A;  1N1C A;  2XLW A;  3OEO A;  3GEE A;  4ONS A;  1E84 A;  4KNV A;  4BPM A;  2PX0 A;  2QTV A;  2YL0 A;  1G5Z A;  2FAP B;  2BL2 A;  1LM3 B;  4MVO A;  2XM0 A;  4DJ9 A;  1UG7 A;  4Q5S F;  1LE2 A;  2YHS A;  1L3P A;  4ULV A;  1GM5 A;  2Y3G A;  3VM6 A;  1MND A;  1FTS A;  2CGE A;  4JCZ A;  5COG A;  4O7G A;  3FOP A;  2NPU A;  3UMK A;  4IWB A;  2J9B A;  1BZ4 A;  1Q0D A;  1YDI A;  3HKK A;  4MVU A;  1HMD A;  3U2L A;  4CIP A;  2HMQ A;  2YVK A;  4WJ0 A;  4YT4 A;  3EGX B;  3AJM A;  3DXJ F;  1S7Z A;  3UMI A;  2J0W A;  5JVE A;  5AGF A;  4XQ1 A;  3QZC A;  5L0I A;  4BJ5 C;  2VH3 A;  4Z9H A;  1KNY A;  5L3V A;  4YJW A;  4AX2 A;  1LKX A;  2HV7 A;  4BJ5 A;  3FDQ A;  4G7Z F;  2OCC C;  4MQ9 F;  4JRZ A;  4EBB A;  2G3K A;  3TJ5 A;  1QLE C;  3MLG A;  4DRJ B;  2PFD A;  2YLG A;  2G3V A;  4I1O B;  3SZR A;  4DVZ A;  4C3D A;  1R4T A;  3JT1 A;  3V5X A;  4WGY A;  1CGN A;  4CDV A;  2NG1 A;  1V74 B;  3K33 A;  1OXB A;  1VK5 A;  2OU6 A;  5F28 E;  3TJ6 A;  4CBE A;  1CGM E;  1H6G A;  2XXA A;  5EGY A;  3FOO A;  4XEK A;  5CI8 A;  5T1D B;  3HJC A;  1B68 A;  1YA7 O;  1YYJ A;  3TUL A;  3U0C A;  4E18 A;  5JLI A;  3ITF A;  1M6T A;  3KMI A;  5F5H A;  5L0C A;  4XEF A;  4Z9I A;  1OCR C;  1ORJ A;  2YL3 A;  3IQC A;  1OKK D;  3ZTZ A;  1JMW A;  2VCC A;  1NU7 D;  2XL4 A;  1QSP A;  4LDQ A;  1VOM A;  3C8G A;  1WWP A;  2DB4 A;  2G62 A;  2HSB A;  2R7U A;  2Y3B A;  1SR2 A;  3C63 A;  4YT8 A;  1M2O A;  2OJE D;  3S0X A;  3UNG C;  5JUA A;  1F1M A;  4C7O A;  4DOZ A;  1HW2 A;  1RJ9 B;  2IYL D;  4JJF A;  4RD9 A;  4J7T A;  4AK9 A;  1G8X A;  1QPU A;  4EIY A;  2R7Q A;  1YJG A;  2ZXW C;  5HV9 A;  4U5F E;  5GPG B;  5FCL A;  2XLE A;  2I8B A;  1WOL A;  4IAQ A;  2YLD A;  2L6H A;  2XRH A;  4E0I A;  1NZE A;  1D0Y A;  4IJJ A;  4MTF A;  5HSW A;  1RJ9 A;  256B A;  3IEE A;  1QZX A;  4OIN F;  4F4B A;  4OD5 A;  1VYK A;  1H9G A;  1RXQ A;  3ABK C;  2R7O A;  3Q7G A;  3Q7L A;  1T01 A;  5AC5 A;  4NTB A;  2XLO A;  4KBL A;  3NKD A;  5JS5 A;  1HW1 A;  3POV A;  2EIK C;  1ORY A;  3GOR A;  3HNJ A;  2XXA B;  4NTF A;  4MTO A;  3W2V A;  3GM2 A;  4NQF A;  1TR2 A;  2R9R B;  2R03 A;  3MBG A;  3NYL A;  4IB4 A;  4J30 B;  2P61 A;  4YN0 B;  4ZLC A;  1C02 A;  1D0X A;  3T6J A;  4B6I A;  3C18 A;  3HLZ A;  1HMO A;  3GM3 A;  2Q9B A;  2Y39 A;  3R2P A;  3PHF 2;  2AWC A;  4P9F A;  4IAO A;  4X0R A;  3WAQ A;  5T3W A;  4N06 A;  2EIJ C;  2CNW A;  2A0B A;  1A41 A;  1IW7 F;  2A6H F;  2KJG A;  4I44 A;  4O6M A;  1LI7 A;  2X51 A;  4U5B E;  1QKR A;  3HNK A;  3U8V A;  2DYR C;  1CGO A;  4Q7C A;  5B1A C;  2J9W A;  4U5D E;  5L0J A;  3GWN A;  3E70 C;  4N6C A;  1V54 C;  5COM A;  3WG7 C;  1OW8 A;  3RIP A;  4C3E A;  2DGJ A;  2L7A A;  3C8Z A;  5JSL A;  1A0B A;  2B0J A;  3X2Q C;  2R7W A;  3ABL C;  1YZC A;  1QQ3 A;  1R5I D;  4U9D A;  5KYW A;  1ZHT A;  1OQC A;  1KTM A;  3LUT B;  2PP4 A;  4A4A A;  4EUK B;  4YL1 A;  3ZWI A;  1PD0 A;  3NMJ A;  1MMN A;  1JPJ A;  3DKA A;  1U0B B;  4EHP A;  1MQV A;  4Q4Z F;  2GFH A;  3RQE A;  1DOV A;  1VTM P;  4OIR F;  5KYY A;  3LLK A;  1T6U A;  3T4R A;  1WAS A;  2XS8 A;  3WHN A;  5B3S C;  1V4A A;  5E2Q A;  3S84 A;  4JE9 A;  1TWG A;  4YL3 A;  1FMV A;  3FVY A;  1Z7Q c;  1TFK B;  1OR2 A;  3JZ0 A;  1WAT A;  3NKE A;  4NTA A;  3RKO F;  3ZC4 A;  3C8G D;  2ASR A;  4AL1 A;  4W8K A;  3H65 A;  1ZYR F;  4NC3 A;  4CS9 A;  3L34 A;  1H9T A;  3O10 A;  3U9J A;  4A2N B;  3ZVR A;  4JTC B;  4WGZ A;  1I4Y A;  2J46 A;  3EG9 A;  3FAJ A;  3K7D A;  2QY9 A;  2QNL A;  4MVR A;  4O6N A;  2LQG A;  2KGO A;  3AGU A;  4FX5 A;  1CPR A;  4LDK A;  1YAU O;  4E17 A;  2WB7 A;  5K0I A;  1APC A;  2Q3T A;  3LS0 A;  5IY5 C;  4XLP F;  4H4K C;  2R7V A;  4MVQ A;  4JTA B;  3EQL F;  1PV3 A;  4XWJ A;  3SNH A;  2EPL X;  3ABM C;  3DAF A;  2Z15 A;  4G78 A;  2KNH A;  1EKY A;  4PFP A;  4ANJ A;  1ZZP A;  4MS2 A;  3EZH A;  1NSG B;  4FAP B;  3TK0 A;  3AG1 C;  1E85 A;  4IAR A;  5L0F A;  2WL8 A;  1Z63 A;  2IM8 A;  1MMD A;  1Q0G A;  3DZA A;  1TFO B;  3IQ5 A;  1JR8 A;  4YK5 A;  1Q0K A;  3ZQY A;  5DS6 A;  5F5F A;  5A69 A;  3SEO A;  2IXO A;  1LS1 A;  3H2V A;  4W8P A;  1HY5 A;  2AVK A;  2ICW G;  3GM1 A;  3RVZ A;  4NCQ A;  3DWW A;  3LNR A;  2ZPA A;  1YVI A;  1PCX A;  4LER A;  4XEV A;  1RMV A;  2W4B A;  2OOC A;  2WVQ A;  3L0I A;  3VRC A;  5CIV A;  3C8G B;  5KYN A;  4OIP F;  1LPE A;  1T9K A;  2JPU A;  4JW1 A;  2JX0 A;  2NSG A;  4D4N A;  1JRA A;  2VCB A;  4PJJ A;  4OD4 A;  4KI2 A;  1G4U S;  3HTK C;  3UGO A;  3CSK A;  2C04 A;  2OJQ A;  4C7O B;  5A6A A;  1K40 A;  1I4Z A;  3Q6N A;  2RSE B;  4AE4 A;  2CNW D;  1Z23 A;  2L6G A;  2WZF A;  3ATP A;  3LEV A;  4HE8 D;  1ZVZ A;  1ZHW A;  1OCZ C;  1D1B A;  3AGT A;  3JCU Q;  1OW7 A;  3DI5 A;  4U9E A;  1BR4 A;  1D1A A;  3QTH A;  4PAC A;  2GDC A;  2PBE A;  3VAY A;  1FMW A;  2HMZ A;  4XLN F;  1NU9 C;  2A69 F;  2F22 A;  2LSE A;  3KH2 A;  1A7V A;  2EPN A;  2KK1 A;  1LIH A;  1O3U A;  1FAP B;  2XL6 A;  3LES A;  3O39 A;  3OWT A;  2Y3H A;  3QVY A;  2R7T A;  4CSA C;  3GOD A;  2IBF A;  2IXP A;  3JYY A;  2TMV P;  2LFD A;  2FGY A;  1ST6 A;  4CSA A;  1VMA A;  2A6E F;  4LLE A;  2YZS A;  2R25 A;  2R7R A;  3NYJ A;  1RKC A;  2J45 A;  2W4M A;  3DM9 B;  2QE9 A;  3NRH A;  3HNL A;  2JD3 A;  1SYQ A;  2EPK X;  2IXN A;  3ZG1 A;  4G7O F;  2XS1 A;  4FES A;  3JTL O;  2VCA A;  3PDM P;  1I5N A;  2KYH A;  2LCH A;  4EKW A;  1FFH A;  1U89 A;  3EFO A;  2EPM X;  1IZM A;  2BE5 F;  3N24 A;  4BJ1 A;  3X1O A;  4G7H F;  2A68 F;  2WZL A;  1FFT C;  1LE4 A;  1VLT A;  3DMD A;  3L8J A;  3B0V C;  2Q00 A;  4XPW A;  1AVO B;  2V26 A;  3ZQV A;  4BG0 A;  2HZ8 A;  3GEI A;  1GS9 A;  2J9U A;  3BEH A;  3JRM O;  2P0N A;  3PMR A;  4N6H A;  5BQG A;  2L6F A;  5DS5 A;  2H7B A;  2CYD A;  4LDR A;  4MVS A;  1EQ1 A;  2H7O A;  4I3M A;  5TJ5 E;  2UUI A;  4CIH A;  3V5Y A;  4MND A;  2OEX A;  1WN0 A;  3CZ6 A;  4Z9J A;  1ORS C;  3RF3 A;  5DS4 A;  3GEH A;  3HNI A;  1VB5 A;  3L1M A;  3RFY A;  1NFO A;  3AG2 C;  4O6Y A;  4XTK A;  5B3I A;  3TD7 A;  2HJ3 A;  5KYW B;  4JCH A;  3WOD F;  4ER9 A;  4MW8 A;  3JYH A;  1NLX A;  1TWH A;  3EHM A;  1YYX A;  4PK4 A;  3RH3 A;  2J7P A;  5L0D A;  1BR2 A;  2R7X A;  2IOQ A;  3DE9 A;  1C17 M;  3QW0 A;  3S29 A;  4JIO A;  1K05 A;  1M2V A;  3AOU A;  3CAX A;  3F47 A;  4XPX A;  3SYN A;  2R02 A;  5FZT A;  5KYY B;  3ASO C;  3AG3 C;  3ASN C;  2H7V C;  2ZD9 A;  1SZI A;  1NFN A;  5E3A A;  3V7O A;  2MHR A;  3VYW A;  1JPN A;  1E83 A;  2GA0 A;  4CS8 C;  2Y69 C;  3CEX A;  5DVW A;  2Y3D A;  1VYI A;  1LS4 A;  2LK4 A;  2WVO A;  2HV6 A;  3A11 A;  2KW3 C;  4JKV A;  4PJM A;  4CJG A;  4CS8 A;  5KYU B;  2J0X A;  2HJM A;  1WTY A;  2PF4 E;  4YL0 A;  1BR1 A;  2OQM A;  3B9Q A;  2XLH A;  1RCP A;  3C7J A;  1ZW2 A;  3IPM O;  2PX3 A;  2EIM C;  1A7E A;  2GAQ A;  2XSE A;  1JAF A;  2YEV A;  3EG9 B;  3DAG A;  3G4X A;  4P9T A;  3T6B A;  1YAR O;  3AQB A;  3S27 A;  3NMK A;  3FAP B;  4H54 A;  4MW3 A;  3SXM A;  3O55 A;  1LVK A;  4G0H A;  3OA1 A;  2XLD A;  2W45 A;  4M63 A;  1NBB A;  5COF A;  4CS9 C;  5KYU A;  2W9Y A;  3W4Y A;  4CS7 A;  4YT2 A;  3RVY A;  4J7Y A;  4DBQ A;  1Y4C A;  1M57 C;  3V5Z A;  2D4U A;  4PR9 A;  1SMY F;  1ZHY A;  4J32 B;  4K7B A;  3QVZ A;  4PJN A;  2NUT A;  3K1I A;  3US6 A;  2NUP B;  1XZP A;  2ETS A;  2MWQ A;  1L7C A;  3LLI A;  4JUR I;  5DLJ A;  1M56 C;  1FNT c;  2A0U A;  4QI0 A;  4GYT A;  1OCC C;  4P6I C;  1BDJ B;  2ZXO A;  2LP4 A;  3DJU B;  3TQO A;  3H2U A;  2UUH A;  3EZI A;  2B0H A;  2DI3 A;  4KNW A;  4JTD B;  2NUP A;  3NG1 A;  4K0D A;  2EIN C;  3MX3 A;  4JZA A;  2P6V A;  5EK0 A;  3K66 A;  3Q6M A;  1SF8 A;  3S9O A;  1K04 A;  3NYM A;  3M4B A;  2L81 A;  2P7V A;  3IQT A;  1TQG A;  4JEB A;  1ZU4 A;  2AWY A;  4AE4 B;  1Q0M A;  2ZXP A;  4QI2 A;  3AQC A;  4ZLD A;  4L6R A;  4DBR A;  3CQZ A;  3JSE O;  3ECS A;  5E33 A;  1WGW A;  2GWW A;  2HS5 A;  3VF0 A;  5BQI A;  5L0H A;  2J9V A;  2LFF A;  2OKU A;  2OEV A;  1ZHX A;  2PNO A;  4EBJ A;  3NDB B;  1G4W R;  3K6B A;  2HFI A;  1VLS A;  2MYS A;  2C03 A;  3FMS A;  1XWJ A;  4E7Z A;  4AL0 A;  5L3Q A;  4JEA A;  5A6J A;  1DOW A;  1ZW3 A;  3M1C B;  3U9M A;  3M15 A;  3ZDL A;  1HE9 A;  2J8W A;  3GWL A;  3SP1 A;  1Z5Z A;  2KSF A;  2AP3 A;  3LAY A;  4U5E E;  4BJT A;  4CX9 A;  1UFB A;  5BUO A;  4U5C E;  2Q9A A;  2J7P D;  1S05 A;  1T6Q A;  2YLI A;  3EH2 A;  3I5P A;  3SXY A;  3N0T A;  3T6G B;  2YWA A;  2WZG A;  1O5H A;  3EGX A;  2IXM A;  4WAB A;  4QDL A;  3K1H A;  4IRU A;  5DQT A;  1GGQ A;  3KPH A;  1W2W A;  3EFO B;  3KL4 A;  4HEA J;  4DRI B;  4MTG A;  2KC3 A;  5D91 A;  1D1C A;  1TKN A;  3LJB A;  2Q7R A;  1A7D A;  2Q4F A;  1RKE B;  4JVS A;  3T9O A;  3TOL A;  4MVM A;  3SXZ A;  3W2W A;  3IHU A;  4MVZ A;  3RW0 A;  1H7I A;  3L8I A;  5E3C A;  5JRA A;  1E86 A;  3MYF A;  3R7C A;  3G50 A;  5B1B C;  5JT4 A;  1D0Z A;  2QLA A;  4YWQ A;  3E9V A;  5T3T A;  2VB6 A;  3QMK A;  2ZXR A;  2H8A A;  1Y6D A;  3DJN B;  3LEO A;  1J8M F;  3BRJ A;  3EGD B;  3U5S A;  4D4X A;  3DE8 A;  5KYX B;  2HKV A;  2YQY A;  1MMA A;  3O6X A;  3W8I A;  1ZU5 A;  3GAN A;  3KYJ A;  3S28 A;  4OIQ F;  1LI5 A;  1RKE A;  4EWC A;  4E0H A;  1MNE A;  2M64 A;  2LIG A;  2XLV A;  1NG1 A;  3JRT A;  3RQF A;  3W8H A;  4LAC B;  4K1O A;  4OIO F;  3SXK A;  1EA8 A;  2R05 A;  1JOG A;  3I5Q A;  1XZQ A;  3UGP A;  1U6H A;  1T5O A;  4DVY P;  3N2Z B;  3EJN A;  3B0P A;  3DM5 A;  2EPO A;  3EGD A;  4JC7 A;  4IGG A;  5CI9 A;  5KYX A;  1M2V B;  2E87 A;  3NMI A;  3J06 A;  1OCO C;  4UDV A;  1YZA A;  1OW6 A;  1OXK A;  2DYS C;  2Q9C A;  2WVN A;  3B29 A;  3JSZ A;  5A6B D;  5AC4 A;  3RQG A;  5JP7 A;  3U3B A;  2VAS A;  3LNM B;  4I1M A;  2X0C A;  1C03 A;  4HFK B;  4CDY A;  1GQA A;  2P1A A;  4GEH A;  4PFO A;  3M4C A;  3S90 A;  3EPV A;  1TWA A;  2OG2 A;  2YRF A;  4BEJ A;  2D5R B;  3KYI A;  3UMH A;  3ZSU A;  3U2M A;  1Q0F A;  2YL1 A;  1J8Y F;  3C62 A;  2KQ9 A;  4ULW A;  5L0G A;  4XPY A;  3B71 A;  3G4Z A;  4KC9 A;  4HFF B;  5A6K A;  4BJ6 C;  5DQZ A;  4U5H A;  1AUE A;  2RD9 A;  1QVX A;  3FHD A;  4DRH B;  1T6I A;  2LD6 A;  4BJ6 A;  2M4E A;  3KKB A;  1Z3I X;  4GQH A;  2YL7 A;  4DXW A;  2R7S A;  1AEP A;  2XM4 A;  3I4U A;  1BBH A;  5EHH A;  4YT5 A;  4N4W A;  4C3B A;  1V55 C;  2O9X A;  3EH1 A;  3FXH A;  2QUP A;  2FFH A;  4NY3 A;  2HUJ A;  1OR3 A;  1MMG A;  2NUT B;  3F46 A;  1KU2 A;  1OKK A;  2I15 A;  2CCY A;  4O79 A;  1HE1 A;  4U5G A;  3QW1 A;  1YLM A;  2YKZ A;  4RBN A;  1CPQ A;  3DD7 A;  1YA9 A;  3TOM A;  1FR0 A;  1Z6A A;  4CJO A;  3IQ6 A;  2EIL C;  2XLM A;  2V3C C;  2CW0 F;  4JJG A;  3MFN A;  3U3F A; 
#chains in the Genus database with same CATH homology
 4LLC A;  2L9J A;  3K1I C;  3EHN A;  2CDQ A;  1TWC A;  4E7S A;  5D92 A;  3RYL A;  3LS1 A;  4RDA A;  1PD1 A;  3AG4 C;  3ZIB A;  1O87 A;  4FWV A;  3UR3 C;  3B0U X;  1ZHZ A;  2A1D D;  4PJL A;  1N1C A;  3OEO A;  4KNV A;  2PX0 A;  2QTV A;  4Q5S F;  2YHS A;  2Y3G A;  1MND A;  1FTS A;  2CGE A;  4O7G A;  3UMK A;  4IWB A;  4YT4 A;  3EGX B;  3DXJ F;  1S7Z A;  3UMI A;  2J0W A;  3QZC A;  4BJ5 C;  2VH3 A;  5L3V A;  4YJW A;  4AX2 A;  1LKX A;  2HV7 A;  4BJ5 A;  3FDQ A;  4G7Z F;  2OCC C;  4MQ9 F;  4EBB A;  2G3K A;  1QLE C;  3MLG A;  2PFD A;  2G3V A;  4I1O B;  3SZR A;  4DVZ A;  4C3D A;  3JT1 A;  2NG1 A;  3K33 A;  4CBE A;  1VK5 A;  5EGY A;  5T1D B;  5CI8 A;  3HJC A;  3ITF A;  3KMI A;  5F5H A;  1OCR C;  1OKK D;  1NU7 D;  2XL4 A;  1VOM A;  2G62 A;  2R7U A;  2Y3B A;  1M2O A;  3S0X A;  3UNG C;  4C7O A;  4DOZ A;  1RJ9 B;  2IYL D;  4JJF A;  4RD9 A;  4AK9 A;  1G8X A;  2R7Q A;  2ZXW C;  4U5F E;  5FCL A;  2I8B A;  2XRH A;  1NZE A;  1D0Y A;  4IJJ A;  5HSW A;  1RJ9 A;  3IEE A;  1QZX A;  4OIN F;  4F4B A;  4OD5 A;  1VYK A;  3ABK C;  2R7O A;  3Q7G A;  3Q7L A;  4KBL A;  3NKD A;  3POV A;  2EIK C;  2XXA B;  3W2V A;  1TR2 A;  3NYL A;  4J30 B;  4YN0 B;  4ZLC A;  1D0X A;  3T6J A;  4B6I A;  3HLZ A;  2Q9B A;  2Y39 A;  3PHF 2;  4IAO A;  4X0R A;  5T3W A;  4N06 A;  2EIJ C;  2CNW A;  1IW7 F;  2A6H F;  2KJG A;  4I44 A;  4O6M A;  2X51 A;  4U5B E;  2DYR C;  4Q7C A;  5B1A C;  2J9W A;  4U5D E;  3E70 C;  1V54 C;  3WG7 C;  3RIP A;  4C3E A;  2DGJ A;  2B0J A;  3X2Q C;  2R7W A;  3ABL C;  5KYW A;  1ZHT A;  2PP4 A;  1PD0 A;  1MMN A;  1JPJ A;  4Q4Z F;  2GFH A;  4OIR F;  5KYY A;  3LLK A;  3T4R A;  5B3S C;  5E2Q A;  1TWG A;  1FMV A;  3FVY A;  3NKE A;  3RKO F;  3ZC4 A;  4W8K A;  3H65 A;  1ZYR F;  4CS9 A;  3L34 A;  4A2N B;  3ZVR A;  3EG9 A;  2J46 A;  3K7D A;  3FAJ A;  4O6N A;  2QY9 A;  4FX5 A;  2KGO A;  4XLP F;  2WB7 A;  2Q3T A;  3LS0 A;  5IY5 C;  4H4K C;  2R7V A;  4XWJ A;  3EQL F;  3SNH A;  3ABM C;  3DAF A;  2Z15 A;  2KNH A;  4PFP A;  4ANJ A;  3EZH A;  3AG1 C;  2WL8 A;  1Z63 A;  1MMD A;  3DZA A;  5DS6 A;  5F5F A;  3SEO A;  2IXO A;  1LS1 A;  3LNR A;  2ZPA A;  1PCX A;  4LER A;  2W4B A;  2WVQ A;  3L0I A;  4OIP F;  5KYN A;  4JW1 A;  4PJJ A;  4KI2 A;  4OD4 A;  3HTK C;  3UGO A;  3CSK A;  2C04 A;  4C7O B;  3Q6N A;  4AE4 A;  2CNW D;  1Z23 A;  2WZF A;  3LEV A;  4HE8 D;  4WJ0 A;  1ZHW A;  3JCU Q;  1OCZ C;  1D1B A;  1D1A A;  1BR4 A;  3VAY A;  1FMW A;  4XLN F;  1NU9 C;  2A69 F;  2LSE A;  3KH2 A;  3O39 A;  3OWT A;  3LES A;  2Y3H A;  2R7T A;  4CSA C;  3GOD A;  2IXP A;  2FGY A;  1ST6 A;  4CSA A;  1VMA A;  2A6E F;  4LLE A;  2YZS A;  2R7R A;  3NYJ A;  2J45 A;  2W4M A;  3DM9 B;  3NRH A;  2JD3 A;  3ZG1 A;  2IXN A;  4G7O F;  4FES A;  1FFH A;  3EFO A;  1IZM A;  2BE5 F;  3N24 A;  4BJ1 A;  3X1O A;  4G7H F;  2A68 F;  2WZL A;  1FFT C;  3DMD A;  3B0V C;  2V26 A;  4BG0 A;  2J9U A;  3PMR A;  5DS5 A;  2H7B A;  2H7O A;  4I3M A;  4CIH A;  4MND A;  3CZ6 A;  5DS4 A;  3RFY A;  4O6Y A;  3AG2 C;  4XTK A;  3TD7 A;  5KYW B;  4JCH A;  3JYH A;  1TWH A;  3EHM A;  4PK4 A;  3RH3 A;  2J7P A;  2R7X A;  1BR2 A;  2IOQ A;  3S29 A;  3SYN A;  3WOD F;  1M2V A;  3F47 A;  5KYY B;  3ASO C;  3AG3 C;  3ASN C;  2H7V C;  5E3A A;  1SZI A;  3V7O A;  3VYW A;  1JPN A;  4CS8 C;  2Y69 C;  5DVW A;  2Y3D A;  1VYI A;  2WVO A;  2HV6 A;  4CS8 A;  2KW3 C;  4PJM A;  5KYU B;  2J0X A;  2PF4 E;  1BR1 A;  3B9Q A;  2PX3 A;  2EIM C;  2XSE A;  2YEV A;  3EG9 B;  3T6B A;  3DAG A;  3AQB A;  3S27 A;  1LVK A;  4G0H A;  3OA1 A;  2W45 A;  4M63 A;  4CS9 C;  5KYU A;  2W9Y A;  4CS7 A;  4YT2 A;  4DBQ A;  1M57 C;  1SMY F;  1ZHY A;  4J32 B;  4K7B A;  4PJN A;  2NUT A;  2NUP B;  2MWQ A;  3LLI A;  4JUR I;  5DLJ A;  1M56 C;  4QI0 A;  4GYT A;  1OCC C;  4P6I C;  2ZXO A;  3DJU B;  3EZI A;  4KNW A;  2NUP A;  3NG1 A;  4K0D A;  2EIN C;  3MX3 A;  4JZA A;  2P6V A;  3K66 A;  3Q6M A;  1SF8 A;  3NYM A;  4AE4 B;  2L81 A;  2P7V A;  4QI2 A;  1ZU4 A;  2ZXP A;  3AQC A;  4ZLD A;  4DBR A;  3CQZ A;  3ECS A;  5E33 A;  1WGW A;  2J9V A;  1ZHX A;  3NDB B;  3K6B A;  2MYS A;  5L3Q A;  2C03 A;  4E7Z A;  3M1C B;  3SP1 A;  1Z5Z A;  3LAY A;  4U5E E;  4BJT A;  5BUO A;  4U5C E;  2Q9A A;  2J7P D;  3EH2 A;  3I5P A;  3N0T A;  2WZG A;  1O5H A;  3EGX A;  2IXM A;  4QDL A;  3K1H A;  4IRU A;  5DQT A;  1W2W A;  3EFO B;  3KL4 A;  4HEA J;  5D91 A;  1D1C A;  1TKN A;  3LJB A;  4JVS A;  3W2W A;  5E3C A;  5B1B C;  1D0Z A;  4YWQ A;  3E9V A;  5T3T A;  2VB6 A;  3QMK A;  2ZXR A;  3DJN B;  1J8M F;  3EGD B;  5KYX B;  3O6X A;  1MMA A;  3W8I A;  4OIQ F;  1ZU5 A;  3GAN A;  3S28 A;  4EWC A;  1MNE A;  1NG1 A;  3JRT A;  3W8H A;  4LAC B;  4OIO F;  3I5Q A;  3UGP A;  4DVY P;  3N2Z B;  3EJN A;  3B0P A;  3DM5 A;  3EGD A;  5CI9 A;  5KYX A;  1M2V B;  2E87 A;  1OCO C;  3JSZ A;  2DYS C;  2Q9C A;  2WVN A;  2VAS A;  4I1M A;  4HFK B;  4GEH A;  4PFO A;  3EPV A;  1TWA A;  2OG2 A;  4BEJ A;  2D5R B;  3UMH A;  3ZSU A;  1J8Y F;  4ULW A;  2KQ9 A;  4KC9 A;  4HFF B;  4BJ6 C;  5DQZ A;  4U5H A;  3FHD A;  4BJ6 A;  2M4E A;  3KKB A;  1Z3I X;  2R7S A;  3I4U A;  5EHH A;  4YT5 A;  4C3B A;  1V55 C;  2O9X A;  3EH1 A;  2FFH A;  4NY3 A;  1MMG A;  3F46 A;  2NUT B;  1KU2 A;  1OKK A;  4O79 A;  4U5G A;  4RBN A;  2XXA A;  3DD7 A;  1Z6A A;  2EIL C;  2V3C C;  2CW0 F;  4JJG A;  4YT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...