2P6VA

Structure of tafh domain of the human taf4 subunit of tfiid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
89
Chain Sequence
SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSPQPYLVPFLRSLPALRQLTPDSAAFIQQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 4
publication title Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2p6vA00
2PP4A 2P6VA 2KNHA 2H7BA
chains in the Genus database with same CATH superfamily
1YARO 1WASA 3PMRA 2G3VA 3AG4C 3RIPA 3ZTMA 5HSWA 2R7SA 2LK4A 1NFOA 4DRJB 1Z5ZA 4KNWA 1E2XA 4WABA 4MTFA 4D4XA 3MFNA 4KI2A 5A6BA 2EPLX 2A6EF 2Q7RA 1U6HA 1U89A 2L6GA 2L9JA 2AP3A 3H65A 3KYJA 4PJJA 2LSEA 1M2VA 2Y3GA 2OOCA 2J9WA 3RQFA 1E86A 2QE9A 2XS8A 3PCVA 2Y39A 4J30B 3FXHA 2HV6A 1VB5A 1GGQA 1FFTC 1XZPA 4GQHA 4YL1A 2A6HF 5L0GA 4GYTA 5KYUB 3ZTZA 1LS4A 3S29A 3JYYA 1TWGA 3K1IC 3V5XA 5HV9A 5KYXB 3B0UX 3HJCA 3PHF2 3B9QA 3SNHA 4FAPB 3FMSA 4A2NB 5FCLA 3I5QA 5BQIA 4OD4A 4JCZA 2OJED 2JD3A 4F4BA 4CSAC 2J9BA 3QVYA 3DMDA 3A11A 3O55A 2AWYA 4L6RA 5L0HA 1C17M 2FFHA 1QQ3A 3LNRA 2XS1A 3V5YA 3ZSUA 5DS4A 2L6FA 2W4MA 3J06A 2YLIA 4JJGA 4NTAA 3AG2C 1JMWA 4KC9A 4XQ1A 3SXKA 4YT2A 2HUJA 1JPNA 2IXMA 2A0UA 2OJQA 2EPOA 2Q9BA 4XPXA 3W8HA 2LIGA 1T6QA 3GODA 4G78A 1OKKD 3JCUQ 4Q5SF 2PNOA 1D1BA 4CJGA 3HNKA 3RW0A 4U5DE 1ORSC 2R7WA 4MVQA 5JP7A 2XSEA 3LS1A 1MMGA 1TFKB 2H7VC 4E7SA 1IW7F 2J7PA 4LLEA 1DOWA 2EIKC 2PF4E 2E87A 2XLMA 3S9OA 3ZG1A 3SXYA 1TR2A 5KYXA 1M6TA 4LLCA 2LP4A 3U2MA 5A6AA 4JRZA 2WVOA 3ZDLA 4DOZA 3US6A 1G8XA 5DLJA 2HMQA 5D91A 3G4XA 2WL8A 1D1CA 1G5ZA 3FDQA 1Z63A 1BBHA 4MW8A 3JSEO 1LE2A 1Y4CA 2YQYA 1V55C 1YJGA 2W45A 3HNIA 3QVZA 3RF3A 4DXWA 2H7BA 5B1AC 4E7ZA 3DZAA 3WODF 3VRCA 2YLGA 5F28E 4DRHB 3M1CB 3GANA 3HNJA 2Z15A 1RKEA 4Z9IA 3T4RA 2H7OA 1NU7D 3JRTA 3U5SA 5AC4A 1A7DA 2J46A 1FMVA 3DD7A 2AU5A 2PBEA 1YA9A 4X0RA 3RQGA 5KYWA 1G4WR 4QI2A 3DWWA 1VMAA 3HKKA 4O7GA 2ZPAA 4MNDA 3QW1A 4E17A 3T6BA 3MBGA 1NSGB 2VH3A 1ORJA 3F46A 4LDQA 1A7EA 1OCZC 2C04A 2HZ8A 4JEBA 1TWHA 3FHDA 4U5HA 5B1BC 3Q7LA 4YT5A 4AK9A 4EUKB 3EQLF 3V7OA 1MQVA 1VLTA 3T6GB 3H2VA 2M4EA 5EK0A 3T6JA 3E70C 3PDMP 1SF8A 4YK5A 2P1AA 4IGGA 3JTLO 5JSLA 5CIVA 3OA1A 1FMWA 5E33A 2KJGA 3DE8A 1YYXA 2W4BA 1I5NA 1ZHYA 3NKDA 2CYDA 1QKRA 4J7YA 2EILC 1F1MA 1CGOA 3NG1A 4UDVA 4OIQF 2LD6A 2ZD9A 4EKWA 2EPKX 5T3TA 2EINC 4CS7A 3E9VA 3N2ZB 4P6IC 1NLXA 3CAXA 3B0PA 3QMKA 4U9EA 4HFFB 3U8PA 2J8WA 4CX9A 5EGYA 1LI7A 3C62A 2XRHA 3EFOB 1Q0MA 3IQ5A 2YLDA 1SR2A 2Q4FA 1K04A 3C63A 1GM5A 1V54C 4CDAA 3M79A 5L0DA 1MMDA 4N4WA 2A69F 3HNLA 3GWLA 4YT8A 3POVA 1QLEC 3U8VA 3U9JA 3ZIBA 1ZYRF 2GDCA 2KGOA 1FFHA 1T9KA 1JRAA 1UFBA 1OQCA 2OG2A 1HMDA 2NUPA 2RSEB 1AUEA 3AOUA 3K6BA 2OCCC 3U3BA 3DAGA 3F47A 4K0DA 5E3AA 4JEAA 3UR3C 3EGDA 3VM6A 1SMYF 3GEHA 3RKOF 1V74B 4IARA 3R2PA 2XL8A 4U5CE 4WJ0A 4G7HF 2XLVA 4JZAA 4N06A 2HFIA 5KYYB 2EPMX 2Y69C 3K1IA 4KBLA 4RBNA 3W2WA 2DB4A 2J0XA 2VC9A 2R7QA 3AQCA 4CIHA 3BRJA 2LFFA 5A6KA 1K40A 1XWJA 3U9MA 2FGYA 3L8JA 4BG0A 3JRMO 3KKBA 1LE4A 4NTBA 2XLEA 4JTDB 5KYNA 2VCBA 3AJMA 4ER9A 5T1DB 4CSAA 1U0BB 2XLHA 3CEXA 2MHRA 3T9OA 2YHSA 2L6HA 4BJ5C 1ZW3A 4C3DA 3EGXB 4EWCA 1L7CA 3JSZA 2P0NA 4CDVA 4HE8D 2IXOA 4PFPA 5GPGB 1D0ZA 2R7UA 1K05A 4PFOA 2HJMA 2JX0A 1S05A 2YL0A 3EG9B 4U5EE 4EHPA 5L0FA 4RD9A 4JW1A 5JS5A 3ZC4A 2O9XA 3C8GD 3DJUB 1MMNA 4D4NA 2WZFA 3TJ6A 4I1MA 3JYHA 4XPYA 1R5ID 2BC5A 4DJ9A 3AG1C 3ZVRA 3H2UA 1M57C 4DVYP 5L3VA 1H9TA 2WVQA 4PJNA 2P7VA 3IQTA 4YJWA 2R05A 4FX5A 4XLNF 3IEEA 2BL2A 3A9CA 3SZRA 5BQHA 3U0CA 1BDJB 2NG1A 3MYFA 4O6MA 4JC7A 2HSQA 1A41A 2JPUA 1JAFA 4P9TA 2NSGA 2YWAA 3NRHA 3TJ5A 3K7DA 2LCHA 3VF0A 2XL4A 3GEIA 1WGWA 2V26A 5COMA 5KYUA 4XLPF 1JOGA 5BUOA 3MLGA 3O39A 4JIOA 4YN0B 3TOMA 2TMVP 2OQMA 3DJNB 4CDYA 1NBBA 1FAPB 2L81A 1FTSA 4MVOA 2QNLA 2KYHA 3RYLA 5F5FA 2J45A 1LPEA 2R7OA 3LS0A 4ULWA 4U5GA 3LLIA 4XPWA 4W8KA 3GM2A 2IXNA 1T6IA 4JVSA 2R03A 1Z7Qc 4CS8C 1QSPA 1KNYA 2GA0A 1EA8A 4C7OB 1XZQA 3TK0A 3O10A 1PCXA 2CW0F 1N1CA 4LERA 4K7BA 3ECSA 4CS9C 2YL3A 4OIRF 1ZZPA 4JURI 4AL1A 4EBKA 2LQGA 2XLWA 4H54A 2G3KA 1RCPA 3FOOA 4NY3A 5JUAA 2R02A 4BJ6C 5E3CA 2HJ3A 3KPHA 4A4AA 2X51A 2C03A 1CGNA 1VLSA 1VTMP 2PX3A 1C03A 3RH3A 1E84A 1T6UA 4O6NA 2IM8A 2XM0A 2X0CA 3QZCA 2IXPA 2V3CC 4OIPF 3UMIA 5L3QA 3B0VC 1QVXA 4NQFA 5CI9A 5B3IA 4IAOA 5A69A 2D5RB 5L0CA 2OEXA 3L1MA 3AG3C 5L0IA 4W8PA 2WZLA 3KL4A 3FOPA 4M63A 3S0XA 1OXBA 1I4YA 2D4UA 3AGTA 4O6YA 2Q9CA 4BJ1A 3O6XA 2RD9A 3KYIA 4RDAA 3NDBB 2NUTB 3CQZA 1BR4A 4CJOA 2FAPB 3WAQA 4P9FA 4NTFA 3EH1A 1KU2A 2Q00A 4JTCB 2XLOA 3FAJA 4XTKA 2AWCA 1GS9A 4FWVA 2YVKA 4PR9A 2B0JA 3S90A 3SXMA 1ZU4A 3ASNC 2YKZA 3HTKC 2DYSC 2YEVA 3EZIA 4JKVA 2WB7A 3B29A 1RJ9B 2J0WA 3M4BA 2Y3DA 1D1AA 1J8YF 2Y3BA 4Q7CA 1BZ4A 3TQOA 1L3PA 2BE5F 3L0IA 3NYLA 5COFA 3Q6MA 1SZIA 4EBBA 3IQ6A 5TJ5E 4I1OB 2J7PD 1A7VA 1O3UA 3DXJF 1WN0A 2Y3HA 4HFKB 4Z9JA 4E18A 1FR0A 3W8IA 3OEOA 2QTVA 4Q4ZF 2YRFA 4DBQA 3RVYA 2Q9AA 3K33A 1H9GA 1AEPA 3Q6NA 2GWWA 4I3MA 4ONSA 3N24A 2ASRA 2QUPA 1YYJA 1LIHA 5D92A 1AVOB 1C02A 1M2OA 2HKVA 4GEHA 1OR3A 3AGUA 5IY5C 1EQ1A 5A6BD 3M4CA 3SYNA 4BJTA 4N6HA 2R25A 3LJBA 1V4AA 2KK1A 1M2VB 1OXKA 3EHMA 1PD0A 2ZXWC 4DVZA 4MTOA 2KQ9A 1VYKA 3B71A 3OWTA 4PACA 3X2QC 4PK4A 3L8IA 1OKKA 1RXQA 4MW3A 4BJ5A 1A0BA 1YVIA 5JRAA 1EKYA 1HW2A 3LEVA 3NMKA 3UMHA 1EI7A 3EFOA 4O79A 1RKCA 4N6CA 3JT1A 3JZ0A 3ZQVA 1G4US 3EZHA 3S27A 2A68F 3TOLA 5B3SC 3GM1A 4OIOF 2VB6A 3FAPB 2VASA 1Q0DA 1YA7O 4J7TA 4JCHA 4XEKA 3S28A 4JTAB 4BPMA 2Q3TA 1YDIA 4BEJA 1LVKA 5K0IA 4DBRA 4U9DA 3S84A 1Q0FA 2IBFA 1MNEA 4U5BE 2PFDA 1SYQA 2EIMC 3IHUA 2P6VA 4G0HA 4IAQA 5AGFA 4PJLA 3ZQYA 2VCAA 2KW3C 1OCCC 5EHHA 3DI5A 2CCYA 2YZSA 3ABMC 1W2WA 4LACB 2A0BA 3GEEA 1TWCA 5CI8A 4C3EA 3G4ZA 1O87A 4H4KC 3SXZA 1Z3IX 1E85A 2CDQA 2ICWG 3X1OA 5DVWA 1TFOB 1OW8A 3LAYA 1O5HA 1WWPA 4CIPA 4WGYA 3RFYA 2ETSA 5FZTA 2XXAB 5KYYA 1Q0KA 2ZXOA 5DQZA 3WHNA 3CZ6A 1ST6A 3NMIA 3W2VA 1WTYA 2A1DD 2MWQA 3V5ZA 1IZMA 4HEAJ 2HV7A 2KNHA 3AQBA 3CSKA 3EJNA 3U3FA 1R4TA 1YAUO 5DQTA 1MNDA 1DOVA 2I8BA 4CS8A 4I44A 2DYRC 1LM3B 2J9VA 3W4YA 5BQGA 2HMZA 2LFDA 4MVMA 3QW0A 2IOQA 3Q7GA 1Q0GA 3C18A 3SEOA 3FVYA 4B6IA 3EGXA 5JVEA 4CS9A 4ZLCA 1OCRC 2CNWD 2R9RB 3NYJA 4LDRA 1NU9C 4XWJA 1T5OA 4OD5A 2J9UA 1BR1A 1B68A 1CPRA 2XL6A 4IJJA 3EH2A 4BJ6A 1ZHTA 1PV3A 3EG9A 5JLIA 1NFNA 1M56C 4C3BA 1RKEB 3DE9A 4G7OF 3GM3A 5AC5A 2MYSA 4FESA 3U2LA 5KYWB 2XLDA 4NCQA 3GWNA 3LESA 5L0JA 1RMVA 4E0HA 2XXAA 1VYIA 4IB4A 2GFHA 2OU6A 2NPUA 1HY5A 1T01A 2AVKA 4J32B 4R32A 5JT4A 2XM4A 2KSFA 1FNTc 3KMIA 3NKEA 4MQ9F 1JPJA 3IPMO 3M15A 4WGZA 256BA 3HLZA 3LNMB 3MYIA 2ZXRA 3K1HA 2B0HA 1ZW2A 3BEHA 3VYWA 4LDKA 3DM9B 1S7ZA 3GORA 4NC3A 4U5FE 4YWQA 2R7XA 1QZXA 2CGEA 1ZVZA 3WG7C 2OKUA 1NZEA 1D0YA 2KC3A 4JE9A 3UGPA 1ORYA 4MS2A 3C8ZA 3MX3A 1OW6A 4XEFA 4ULVA 4YT4A 1Z23A 3C8GB 3EPVA 4PJMA 4ZLDA 1LI5A 4IWBA 1HE9A 1OR2A 3QTHA 3TULA 1KTMA 2VCCA 1H7IA 1BR2A 4MVSA 1H6GA 4AX2A 4C7OA 1HE1A 3RQEA 4KNVA 3DM5A 3ABKC 2M64A 1YLMA 4AE4B 1TKNA 3N0TA 4CBEA 1I4ZA 3DAFA 3UNGC 2R7TA 4G7ZF 2W9YA 2YL1A 2ZXPA 1NG1A 4EIYA 2EIJC 3UGOA 1MMAA 1VOMA 5DS5A 4ANJA 3I5PA 2WVNA 3NYMA 4EBJA 2EPNA 3ITFA 2DI3A 2UUIA 1PD1A 2H8AA 1J8MF 1LS1A 3ASOC 3ZWIA 1ZU5A 1TQGA 3ABLC 3C7JA 2DGJA 1ZHXA 1YZCA 3RVZA 2NUPB 4XEVA 4MVUA 4QDLA 1QPUA 2IYLD 5A6JA 3VAYA 2OEVA 2L7AA 1JR8A 3G50A 3LEOA 4MVRA 3EGDB 4Z9HA 3R7CA 1Y6DA 3LUTB 2YL7A 4YL3A 4MTGA 3DKAA 3SP1A 2GAQA 3C8GA 4DRIB 1APCA 1ZHWA 2NUTA 1HMOA 1E83A 2UUHA 3ATPA 1ZHZA 2HSBA 3LLKA 3L34A 2F22A 5E2QA 2HS5A 5T3WA 1VK5A 4BEMJ 5DS6A 4AE4A 2QLAA 1Z6AA 2WZGA 2I15A 1HW1A 2R7RA 1TWAA 4YL0A 4MVZA 4IRUA 1RJ9A 3TD7A 1WOLA 1WATA 3KH2A 2R7VA 4JJFA 1OCOC 2PX0A 3UMKA 2PP4A 3I4UA 1GQAA 2NSFA 3NMJA 1YZAA 1OW7A 2P61A 3EHNA 2G62A 1D0XA 1LKXA 4K1OA 5COGA 2QY9A 3K66A 4AL0A 4QI0A 2CNWA 1CGME 1CPQA 1UG7A 3IQCA 4OINF 4E0IA 5F5HA
chains in the Genus database with same CATH topology
3PMRA 2G3VA 3AG4C 3RIPA 5HSWA 2R7SA 1Z5ZA 4KNWA 4KI2A 2A6EF 2L9JA 3H65A 4PJJA 2LSEA 1M2VA 2Y3GA 2J9WA 2Y39A 4J30B 2HV6A 1FFTC 2A6HF 4GYTA 5KYUB 3S29A 1TWGA 3K1IC 3B0UX 5KYXB 3HJCA 3PHF2 3B9QA 3SNHA 4A2NB 5FCLA 3I5QA 4OD4A 2JD3A 4F4BA 4CSAC 3DMDA 2FFHA 3ZSUA 3LNRA 5DS4A 2W4MA 4JJGA 4YT2A 3AG2C 4KC9A 1JPNA 2IXMA 2Q9BA 3W8HA 3GODA 4Q5SF 1OKKD 3JCUQ 1D1BA 4U5DE 2R7WA 2XSEA 3LS1A 1MMGA 4E7SA 2H7VC 1IW7F 2J7PA 4LLEA 2EIKC 2PF4E 2E87A 3ZG1A 5KYXA 1TR2A 4LLCA 2WVOA 4DOZA 1G8XA 5DLJA 5D91A 2WL8A 1D1CA 3FDQA 1Z63A 1V55C 2W45A 2H7BA 5B1AC 4E7ZA 3DZAA 3WODF 3M1CB 3GANA 2Z15A 3T4RA 2H7OA 1NU7D 3JRTA 2J46A 1FMVA 3DD7A 4X0RA 5KYWA 4QI2A 1VMAA 4O7GA 2ZPAA 4MNDA 3T6BA 2VH3A 3F46A 1OCZC 2C04A 4AK9A 1TWHA 3FHDA 4U5HA 5B1BC 3Q7LA 4YT5A 3EQLF 3V7OA 2M4EA 3T6JA 3E70C 1SF8A 3OA1A 1FMWA 5E33A 2KJGA 2W4BA 1ZHYA 3NKDA 4OIQF 3NG1A 2EILC 5T3TA 4CS7A 2EINC 3E9VA 3N2ZB 4P6IC 3QMKA 3B0PA 5EGYA 4HFFB 2XRHA 3EFOB 1V54C 1MMDA 2A69F 4YT8A 3POVA 1QLEC 3ZIBA 1ZYRF 2KGOA 1FFHA 2OG2A 2NUPA 3K6BA 2OCCC 3DAGA 3F47A 4K0DA 5E3AA 3UR3C 3EGDA 1SMYF 3RKOF 4U5CE 4WJ0A 4G7HF 4JZAA 4N06A 5KYYB 2Y69C 4KBLA 4RBNA 3W2WA 2J0XA 2R7QA 3AQCA 4CIHA 2FGYA 4BG0A 3KKBA 5KYNA 4CSAA 5T1DB 2YHSA 4BJ5C 4C3DA 3EGXB 4EWCA 3JSZA 4HE8D 2IXOA 4PFPA 1D0ZA 2R7UA 4PFOA 3EG9B 4U5EE 4RD9A 4JW1A 3ZC4A 2O9XA 3DJUB 1MMNA 2WZFA 4I1MA 3JYHA 3AG1C 3ZVRA 1M57C 4DVYP 5L3VA 2WVQA 4PJNA 2P7VA 4YJWA 4FX5A 4XLNF 3IEEA 3SZRA 2NG1A 4O6MA 3NRHA 3K7DA 2XL4A 1WGWA 2V26A 5KYUA 4XLPF 2R7TA 5BUOA 3MLGA 3O39A 4YN0B 3DJNB 2L81A 1FTSA 3RYLA 5F5FA 2J45A 2R7OA 3LS0A 4ULWA 4U5GA 3LLIA 4W8KA 2IXNA 4JVSA 4CS8C 4C7OB 1PCXA 2CW0F 1N1CA 4LERA 4K7BA 3ECSA 4CS9C 4OIRF 4JURI 2G3KA 4NY3A 4BJ6C 5E3CA 2X51A 2C03A 2PX3A 3RH3A 4O6NA 3QZCA 2IXPA 2V3CC 4OIPF 3UMIA 5L3QA 3B0VC 5CI9A 4IAOA 2D5RB 3AG3C 2WZLA 3KL4A 4M63A 3S0XA 4BJ1A 4O6YA 2Q9CA 3O6XA 4RDAA 3NDBB 2NUTB 3CQZA 1BR4A 3EH1A 1KU2A 3FAJA 4XTKA 4FWVA 2B0JA 1ZU4A 3ASNC 3HTKC 2DYSC 2YEVA 3EZIA 2WB7A 1RJ9B 2J0WA 2Y3DA 1D1AA 1J8YF 2Y3BA 4Q7CA 2BE5F 3L0IA 3NYLA 3Q6MA 1SZIA 4EBBA 4I1OB 2J7PD 3DXJF 2Y3HA 4HFKB 3W8IA 3OEOA 2QTVA 4Q4ZF 4DBQA 2Q9AA 3K33A 4I3MA 3N24A 5D92A 1M2OA 4GEHA 5IY5C 3SYNA 4BJTA 3LJBA 1M2VB 3EHMA 1PD0A 2ZXWC 4DVZA 2KQ9A 1VYKA 3OWTA 3X2QC 4PK4A 1OKKA 4BJ5A 3LEVA 3UMHA 3EFOA 4O79A 3JT1A 3EZHA 3S27A 2A68F 5B3SC 4OIOF 2VB6A 2VASA 3S28A 4JCHA 2Q3TA 4BEJA 1LVKA 4DBRA 1MNEA 4U5BE 2PFDA 2EIMC 4G0HA 2P6VA 5EHHA 4PJLA 2KW3C 1OCCC 3ABMC 2YZSA 4LACB 1W2WA 5CI8A 1TWCA 4C3EA 1O87A 4H4KC 1Z3IX 2CDQA 3X1OA 5DVWA 3LAYA 1O5HA 3RFYA 2XXAB 5KYYA 5DQZA 2ZXOA 3CZ6A 1ST6A 3W2VA 2A1DD 2MWQA 1IZMA 4HEAJ 2HV7A 2KNHA 3CSKA 3EJNA 3AQBA 5DQTA 1MNDA 2I8BA 4CS8A 4I44A 2DYRC 2J9VA 2IOQA 3Q7GA 4B6IA 3SEOA 3FVYA 3EGXA 4CS9A 4ZLCA 1OCRC 2CNWD 4XWJA 3NYJA 1NU9C 4OD5A 2J9UA 1BR1A 4IJJA 4BJ6A 3EH2A 1ZHTA 3EG9A 1M56C 4C3BA 4G7OF 2MYSA 4FESA 5KYWB 3LESA 2XXAA 1VYIA 2GFHA 4J32B 3KMIA 3NKEA 4MQ9F 1JPJA 3HLZA 2ZXRA 3K1HA 3VYWA 3DM9B 1S7ZA 4U5FE 4YWQA 2R7XA 1QZXA 2CGEA 3WG7C 1NZEA 1D0YA 3UGPA 3MX3A 4YT4A 1Z23A 3EPVA 4PJMA 4ZLDA 4IWBA 4C7OA 1BR2A 4AX2A 4KNVA 3DM5A 3ABKC 4AE4B 1TKNA 3N0TA 4CBEA 3UNGC 3DAFA 4G7ZF 2W9YA 2ZXPA 1NG1A 2EIJC 3UGOA 1MMAA 1VOMA 5DS5A 4ANJA 3I5PA 2WVNA 3NYMA 3ITFA 1PD1A 1J8MF 1LS1A 3ASOC 1ZU5A 3ABLC 2DGJA 1ZHXA 2NUPB 4QDLA 2IYLD 3VAYA 3EGDB 3SP1A 1ZHWA 2NUTA 1ZHZA 3LLKA 3L34A 5T3WA 5E2QA 1VK5A 5DS6A 4AE4A 2R7RA 1Z6AA 2WZGA 1TWAA 4IRUA 1RJ9A 3TD7A 2R7VA 3KH2A 4JJFA 1OCOC 2PX0A 3UMKA 2PP4A 3I4UA 3EHNA 2G62A 1D0XA 1LKXA 2QY9A 3K66A 4QI0A 2CNWA 3Q6NA 4OINF 5F5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PP4 A;  2P6V A;  2KNH A;  2H7B A; 
#chains in the Genus database with same CATH topology
 1YAR O;  1WAS A;  3PMR A;  2G3V A;  3AG4 C;  3RIP A;  3ZTM A;  5HSW A;  2R7S A;  2LK4 A;  1NFO A;  4DRJ B;  1Z5Z A;  4KNW A;  1E2X A;  4WAB A;  4MTF A;  4D4X A;  3MFN A;  4KI2 A;  5A6B A;  2EPL X;  2A6E F;  2Q7R A;  1U6H A;  1U89 A;  2L6G A;  2L9J A;  2AP3 A;  3H65 A;  3KYJ A;  4PJJ A;  2LSE A;  1M2V A;  2Y3G A;  2OOC A;  2J9W A;  3RQF A;  1E86 A;  2QE9 A;  2XS8 A;  3PCV A;  2Y39 A;  4J30 B;  3FXH A;  2HV6 A;  1VB5 A;  1GGQ A;  1FFT C;  1XZP A;  4GQH A;  4YL1 A;  2A6H F;  5L0G A;  4GYT A;  5KYU B;  3ZTZ A;  1LS4 A;  3S29 A;  3JYY A;  1TWG A;  3K1I C;  3V5X A;  5HV9 A;  5KYX B;  3B0U X;  3HJC A;  3PHF 2;  3B9Q A;  3SNH A;  4FAP B;  3FMS A;  4A2N B;  5FCL A;  3I5Q A;  5BQI A;  4OD4 A;  4JCZ A;  2OJE D;  2JD3 A;  4F4B A;  4CSA C;  2J9B A;  3QVY A;  3DMD A;  3A11 A;  3O55 A;  2AWY A;  4L6R A;  5L0H A;  1C17 M;  2FFH A;  1QQ3 A;  3LNR A;  2XS1 A;  3V5Y A;  3ZSU A;  5DS4 A;  2L6F A;  2W4M A;  3J06 A;  2YLI A;  4JJG A;  4NTA A;  3AG2 C;  1JMW A;  4KC9 A;  4XQ1 A;  3SXK A;  4YT2 A;  2HUJ A;  1JPN A;  2IXM A;  2A0U A;  2OJQ A;  2EPO A;  2Q9B A;  4XPX A;  3W8H A;  2LIG A;  1T6Q A;  3GOD A;  4G78 A;  1OKK D;  3JCU Q;  4Q5S F;  2PNO A;  1D1B A;  4CJG A;  3HNK A;  3RW0 A;  4U5D E;  1ORS C;  2R7W A;  4MVQ A;  5JP7 A;  2XSE A;  3LS1 A;  1MMG A;  1TFK B;  2H7V C;  4E7S A;  1IW7 F;  2J7P A;  4LLE A;  1DOW A;  2EIK C;  2PF4 E;  2E87 A;  2XLM A;  3S9O A;  3ZG1 A;  3SXY A;  1TR2 A;  5KYX A;  1M6T A;  4LLC A;  2LP4 A;  3U2M A;  5A6A A;  4JRZ A;  2WVO A;  3ZDL A;  4DOZ A;  3US6 A;  1G8X A;  5DLJ A;  2HMQ A;  5D91 A;  3G4X A;  2WL8 A;  1D1C A;  1G5Z A;  3FDQ A;  1Z63 A;  1BBH A;  4MW8 A;  3JSE O;  1LE2 A;  1Y4C A;  2YQY A;  1V55 C;  1YJG A;  2W45 A;  3HNI A;  3QVZ A;  3RF3 A;  4DXW A;  2H7B A;  5B1A C;  4E7Z A;  3DZA A;  3WOD F;  3VRC A;  2YLG A;  5F28 E;  4DRH B;  3M1C B;  3GAN A;  3HNJ A;  2Z15 A;  1RKE A;  4Z9I A;  3T4R A;  2H7O A;  1NU7 D;  3JRT A;  3U5S A;  5AC4 A;  1A7D A;  2J46 A;  1FMV A;  3DD7 A;  2AU5 A;  2PBE A;  1YA9 A;  4X0R A;  3RQG A;  5KYW A;  1G4W R;  4QI2 A;  3DWW A;  1VMA A;  3HKK A;  4O7G A;  2ZPA A;  4MND A;  3QW1 A;  4E17 A;  3T6B A;  3MBG A;  1NSG B;  2VH3 A;  1ORJ A;  3F46 A;  4LDQ A;  1A7E A;  1OCZ C;  2C04 A;  2HZ8 A;  4JEB A;  1TWH A;  3FHD A;  4U5H A;  5B1B C;  3Q7L A;  4YT5 A;  4AK9 A;  4EUK B;  3EQL F;  3V7O A;  1MQV A;  1VLT A;  3T6G B;  3H2V A;  2M4E A;  5EK0 A;  3T6J A;  3E70 C;  3PDM P;  1SF8 A;  4YK5 A;  2P1A A;  4IGG A;  3JTL O;  5JSL A;  5CIV A;  3OA1 A;  1FMW A;  5E33 A;  2KJG A;  3DE8 A;  1YYX A;  2W4B A;  1I5N A;  1ZHY A;  3NKD A;  2CYD A;  1QKR A;  4J7Y A;  2EIL C;  1F1M A;  1CGO A;  3NG1 A;  4UDV A;  4OIQ F;  2LD6 A;  2ZD9 A;  4EKW A;  2EPK X;  5T3T A;  2EIN C;  4CS7 A;  3E9V A;  3N2Z B;  4P6I C;  1NLX A;  3CAX A;  3B0P A;  3QMK A;  4U9E A;  4HFF B;  3U8P A;  2J8W A;  4CX9 A;  5EGY A;  1LI7 A;  3C62 A;  2XRH A;  3EFO B;  1Q0M A;  3IQ5 A;  2YLD A;  1SR2 A;  2Q4F A;  1K04 A;  3C63 A;  1GM5 A;  1V54 C;  4CDA A;  3M79 A;  5L0D A;  1MMD A;  4N4W A;  2A69 F;  3HNL A;  3GWL A;  4YT8 A;  3POV A;  1QLE C;  3U8V A;  3U9J A;  3ZIB A;  1ZYR F;  2GDC A;  2KGO A;  1FFH A;  1T9K A;  1JRA A;  1UFB A;  1OQC A;  2OG2 A;  1HMD A;  2NUP A;  2RSE B;  1AUE A;  3AOU A;  3K6B A;  2OCC C;  3U3B A;  3DAG A;  3F47 A;  4K0D A;  5E3A A;  4JEA A;  3UR3 C;  3EGD A;  3VM6 A;  1SMY F;  3GEH A;  3RKO F;  1V74 B;  4IAR A;  3R2P A;  2XL8 A;  4U5C E;  4WJ0 A;  4G7H F;  2XLV A;  4JZA A;  4N06 A;  2HFI A;  5KYY B;  2EPM X;  2Y69 C;  3K1I A;  4KBL A;  4RBN A;  3W2W A;  2DB4 A;  2J0X A;  2VC9 A;  2R7Q A;  3AQC A;  4CIH A;  3BRJ A;  2LFF A;  5A6K A;  1K40 A;  1XWJ A;  3U9M A;  2FGY A;  3L8J A;  4BG0 A;  3JRM O;  3KKB A;  1LE4 A;  4NTB A;  2XLE A;  4JTD B;  5KYN A;  2VCB A;  3AJM A;  4ER9 A;  5T1D B;  4CSA A;  1U0B B;  2XLH A;  3CEX A;  2MHR A;  3T9O A;  2YHS A;  2L6H A;  4BJ5 C;  1ZW3 A;  4C3D A;  3EGX B;  4EWC A;  1L7C A;  3JSZ A;  2P0N A;  4CDV A;  4HE8 D;  2IXO A;  4PFP A;  5GPG B;  1D0Z A;  2R7U A;  1K05 A;  4PFO A;  2HJM A;  2JX0 A;  1S05 A;  2YL0 A;  3EG9 B;  4U5E E;  4EHP A;  5L0F A;  4RD9 A;  4JW1 A;  5JS5 A;  3ZC4 A;  2O9X A;  3C8G D;  3DJU B;  1MMN A;  4D4N A;  2WZF A;  3TJ6 A;  4I1M A;  3JYH A;  4XPY A;  1R5I D;  2BC5 A;  4DJ9 A;  3AG1 C;  3ZVR A;  3H2U A;  1M57 C;  4DVY P;  5L3V A;  1H9T A;  2WVQ A;  4PJN A;  2P7V A;  3IQT A;  4YJW A;  2R05 A;  4FX5 A;  4XLN F;  3IEE A;  2BL2 A;  3A9C A;  3SZR A;  5BQH A;  3U0C A;  1BDJ B;  2NG1 A;  3MYF A;  4O6M A;  4JC7 A;  2HSQ A;  1A41 A;  2JPU A;  1JAF A;  4P9T A;  2NSG A;  2YWA A;  3NRH A;  3TJ5 A;  3K7D A;  2LCH A;  3VF0 A;  2XL4 A;  3GEI A;  1WGW A;  2V26 A;  5COM A;  5KYU A;  4XLP F;  1JOG A;  5BUO A;  3MLG A;  3O39 A;  4JIO A;  4YN0 B;  3TOM A;  2TMV P;  2OQM A;  3DJN B;  4CDY A;  1NBB A;  1FAP B;  2L81 A;  1FTS A;  4MVO A;  2QNL A;  2KYH A;  3RYL A;  5F5F A;  2J45 A;  1LPE A;  2R7O A;  3LS0 A;  4ULW A;  4U5G A;  3LLI A;  4XPW A;  4W8K A;  3GM2 A;  2IXN A;  1T6I A;  4JVS A;  2R03 A;  1Z7Q c;  4CS8 C;  1QSP A;  1KNY A;  2GA0 A;  1EA8 A;  4C7O B;  1XZQ A;  3TK0 A;  3O10 A;  1PCX A;  2CW0 F;  1N1C A;  4LER A;  4K7B A;  3ECS A;  4CS9 C;  2YL3 A;  4OIR F;  1ZZP A;  4JUR I;  4AL1 A;  4EBK A;  2LQG A;  2XLW A;  4H54 A;  2G3K A;  1RCP A;  3FOO A;  4NY3 A;  5JUA A;  2R02 A;  4BJ6 C;  5E3C A;  2HJ3 A;  3KPH A;  4A4A A;  2X51 A;  2C03 A;  1CGN A;  1VLS A;  1VTM P;  2PX3 A;  1C03 A;  3RH3 A;  1E84 A;  1T6U A;  4O6N A;  2IM8 A;  2XM0 A;  2X0C A;  3QZC A;  2IXP A;  2V3C C;  4OIP F;  3UMI A;  5L3Q A;  3B0V C;  1QVX A;  4NQF A;  5CI9 A;  5B3I A;  4IAO A;  5A69 A;  2D5R B;  5L0C A;  2OEX A;  3L1M A;  3AG3 C;  5L0I A;  4W8P A;  2WZL A;  3KL4 A;  3FOP A;  4M63 A;  3S0X A;  1OXB A;  1I4Y A;  2D4U A;  3AGT A;  4O6Y A;  2Q9C A;  4BJ1 A;  3O6X A;  2RD9 A;  3KYI A;  4RDA A;  3NDB B;  2NUT B;  3CQZ A;  1BR4 A;  4CJO A;  2FAP B;  3WAQ A;  4P9F A;  4NTF A;  3EH1 A;  1KU2 A;  2Q00 A;  4JTC B;  2XLO A;  3FAJ A;  4XTK A;  2AWC A;  1GS9 A;  4FWV A;  2YVK A;  4PR9 A;  2B0J A;  3S90 A;  3SXM A;  1ZU4 A;  3ASN C;  2YKZ A;  3HTK C;  2DYS C;  2YEV A;  3EZI A;  4JKV A;  2WB7 A;  3B29 A;  1RJ9 B;  2J0W A;  3M4B A;  2Y3D A;  1D1A A;  1J8Y F;  2Y3B A;  4Q7C A;  1BZ4 A;  3TQO A;  1L3P A;  2BE5 F;  3L0I A;  3NYL A;  5COF A;  3Q6M A;  1SZI A;  4EBB A;  3IQ6 A;  5TJ5 E;  4I1O B;  2J7P D;  1A7V A;  1O3U A;  3DXJ F;  1WN0 A;  2Y3H A;  4HFK B;  4Z9J A;  4E18 A;  1FR0 A;  3W8I A;  3OEO A;  2QTV A;  4Q4Z F;  2YRF A;  4DBQ A;  3RVY A;  2Q9A A;  3K33 A;  1H9G A;  1AEP A;  3Q6N A;  2GWW A;  4I3M A;  4ONS A;  3N24 A;  2ASR A;  2QUP A;  1YYJ A;  1LIH A;  5D92 A;  1AVO B;  1C02 A;  1M2O A;  2HKV A;  4GEH A;  1OR3 A;  3AGU A;  5IY5 C;  1EQ1 A;  5A6B D;  3M4C A;  3SYN A;  4BJT A;  4N6H A;  2R25 A;  3LJB A;  1V4A A;  2KK1 A;  1M2V B;  1OXK A;  3EHM A;  1PD0 A;  2ZXW C;  4DVZ A;  4MTO A;  2KQ9 A;  1VYK A;  3B71 A;  3OWT A;  4PAC A;  3X2Q C;  4PK4 A;  3L8I A;  1OKK A;  1RXQ A;  4MW3 A;  4BJ5 A;  1A0B A;  1YVI A;  5JRA A;  1EKY A;  1HW2 A;  3LEV A;  3NMK A;  3UMH A;  1EI7 A;  3EFO A;  4O79 A;  1RKC A;  4N6C A;  3JT1 A;  3JZ0 A;  3ZQV A;  1G4U S;  3EZH A;  3S27 A;  2A68 F;  3TOL A;  5B3S C;  3GM1 A;  4OIO F;  2VB6 A;  3FAP B;  2VAS A;  1Q0D A;  1YA7 O;  4J7T A;  4JCH A;  4XEK A;  3S28 A;  4JTA B;  4BPM A;  2Q3T A;  1YDI A;  4BEJ A;  1LVK A;  5K0I A;  4DBR A;  4U9D A;  3S84 A;  1Q0F A;  2IBF A;  1MNE A;  4U5B E;  2PFD A;  1SYQ A;  2EIM C;  3IHU A;  2P6V A;  4G0H A;  4IAQ A;  5AGF A;  4PJL A;  3ZQY A;  2VCA A;  2KW3 C;  1OCC C;  5EHH A;  3DI5 A;  2CCY A;  2YZS A;  3ABM C;  1W2W A;  4LAC B;  2A0B A;  3GEE A;  1TWC A;  5CI8 A;  4C3E A;  3G4Z A;  1O87 A;  4H4K C;  3SXZ A;  1Z3I X;  1E85 A;  2CDQ A;  2ICW G;  3X1O A;  5DVW A;  1TFO B;  1OW8 A;  3LAY A;  1O5H A;  1WWP A;  4CIP A;  4WGY A;  3RFY A;  2ETS A;  5FZT A;  2XXA B;  5KYY A;  1Q0K A;  2ZXO A;  5DQZ A;  3WHN A;  3CZ6 A;  1ST6 A;  3NMI A;  3W2V A;  1WTY A;  2A1D D;  2MWQ A;  3V5Z A;  1IZM A;  4HEA J;  2HV7 A;  2KNH A;  3AQB A;  3CSK A;  3EJN A;  3U3F A;  1R4T A;  1YAU O;  5DQT A;  1MND A;  1DOV A;  2I8B A;  4CS8 A;  4I44 A;  2DYR C;  1LM3 B;  2J9V A;  3W4Y A;  5BQG A;  2HMZ A;  2LFD A;  4MVM A;  3QW0 A;  2IOQ A;  3Q7G A;  1Q0G A;  3C18 A;  3SEO A;  3FVY A;  4B6I A;  3EGX A;  5JVE A;  4CS9 A;  4ZLC A;  1OCR C;  2CNW D;  2R9R B;  3NYJ A;  4LDR A;  1NU9 C;  4XWJ A;  1T5O A;  4OD5 A;  2J9U A;  1BR1 A;  1B68 A;  1CPR A;  2XL6 A;  4IJJ A;  3EH2 A;  4BJ6 A;  1ZHT A;  1PV3 A;  3EG9 A;  5JLI A;  1NFN A;  1M56 C;  4C3B A;  1RKE B;  3DE9 A;  4G7O F;  3GM3 A;  5AC5 A;  2MYS A;  4FES A;  3U2L A;  5KYW B;  2XLD A;  4NCQ A;  3GWN A;  3LES A;  5L0J A;  1RMV A;  4E0H A;  2XXA A;  1VYI A;  4IB4 A;  2GFH A;  2OU6 A;  2NPU A;  1HY5 A;  1T01 A;  2AVK A;  4J32 B;  4R32 A;  5JT4 A;  2XM4 A;  2KSF A;  1FNT c;  3KMI A;  3NKE A;  4MQ9 F;  1JPJ A;  3IPM O;  3M15 A;  4WGZ A;  256B A;  3HLZ A;  3LNM B;  3MYI A;  2ZXR A;  3K1H A;  2B0H A;  1ZW2 A;  3BEH A;  3VYW A;  4LDK A;  3DM9 B;  1S7Z A;  3GOR A;  4NC3 A;  4U5F E;  4YWQ A;  2R7X A;  1QZX A;  2CGE A;  1ZVZ A;  3WG7 C;  2OKU A;  1NZE A;  1D0Y A;  2KC3 A;  4JE9 A;  3UGP A;  1ORY A;  4MS2 A;  3C8Z A;  3MX3 A;  1OW6 A;  4XEF A;  4ULV A;  4YT4 A;  1Z23 A;  3C8G B;  3EPV A;  4PJM A;  4ZLD A;  1LI5 A;  4IWB A;  1HE9 A;  1OR2 A;  3QTH A;  3TUL A;  1KTM A;  2VCC A;  1H7I A;  1BR2 A;  4MVS A;  1H6G A;  4AX2 A;  4C7O A;  1HE1 A;  3RQE A;  4KNV A;  3DM5 A;  3ABK C;  2M64 A;  1YLM A;  4AE4 B;  1TKN A;  3N0T A;  4CBE A;  1I4Z A;  3DAF A;  3UNG C;  2R7T A;  4G7Z F;  2W9Y A;  2YL1 A;  2ZXP A;  1NG1 A;  4EIY A;  2EIJ C;  3UGO A;  1MMA A;  1VOM A;  5DS5 A;  4ANJ A;  3I5P A;  2WVN A;  3NYM A;  4EBJ A;  2EPN A;  3ITF A;  2DI3 A;  2UUI A;  1PD1 A;  2H8A A;  1J8M F;  1LS1 A;  3ASO C;  3ZWI A;  1ZU5 A;  1TQG A;  3ABL C;  3C7J A;  2DGJ A;  1ZHX A;  1YZC A;  3RVZ A;  2NUP B;  4XEV A;  4MVU A;  4QDL A;  1QPU A;  2IYL D;  5A6J A;  3VAY A;  2OEV A;  2L7A A;  1JR8 A;  3G50 A;  3LEO A;  4MVR A;  3EGD B;  4Z9H A;  3R7C A;  1Y6D A;  3LUT B;  2YL7 A;  4YL3 A;  4MTG A;  3DKA A;  3SP1 A;  2GAQ A;  3C8G A;  4DRI B;  1APC A;  1ZHW A;  2NUT A;  1HMO A;  1E83 A;  2UUH A;  3ATP A;  1ZHZ A;  2HSB A;  3LLK A;  3L34 A;  2F22 A;  5E2Q A;  2HS5 A;  5T3W A;  1VK5 A;  4BEM J;  5DS6 A;  4AE4 A;  2QLA A;  1Z6A A;  2WZG A;  2I15 A;  1HW1 A;  2R7R A;  1TWA A;  4YL0 A;  4MVZ A;  4IRU A;  1RJ9 A;  3TD7 A;  1WOL A;  1WAT A;  3KH2 A;  2R7V A;  4JJF A;  1OCO C;  2PX0 A;  3UMK A;  2PP4 A;  3I4U A;  1GQA A;  2NSF A;  3NMJ A;  1YZA A;  1OW7 A;  2P61 A;  3EHN A;  2G62 A;  1D0X A;  1LKX A;  4K1O A;  5COG A;  2QY9 A;  3K66 A;  4AL0 A;  4QI0 A;  2CNW A;  1CGM E;  1CPQ A;  1UG7 A;  3IQC A;  4OIN F;  4E0I A;  5F5H A; 
#chains in the Genus database with same CATH homology
 3PMR A;  2G3V A;  3AG4 C;  3RIP A;  5HSW A;  2R7S A;  1Z5Z A;  4KNW A;  4KI2 A;  2A6E F;  2L9J A;  3H65 A;  4PJJ A;  2LSE A;  1M2V A;  2Y3G A;  2J9W A;  2Y39 A;  4J30 B;  2HV6 A;  1FFT C;  2A6H F;  4GYT A;  5KYU B;  3S29 A;  1TWG A;  3K1I C;  3B0U X;  5KYX B;  3HJC A;  3PHF 2;  3B9Q A;  3SNH A;  4A2N B;  5FCL A;  3I5Q A;  4OD4 A;  2JD3 A;  4F4B A;  4CSA C;  3DMD A;  2FFH A;  3ZSU A;  3LNR A;  5DS4 A;  2W4M A;  4JJG A;  4YT2 A;  3AG2 C;  4KC9 A;  1JPN A;  2IXM A;  2Q9B A;  3W8H A;  3GOD A;  4Q5S F;  1OKK D;  3JCU Q;  1D1B A;  4U5D E;  2R7W A;  2XSE A;  3LS1 A;  1MMG A;  4E7S A;  2H7V C;  1IW7 F;  2J7P A;  4LLE A;  2EIK C;  2PF4 E;  2E87 A;  3ZG1 A;  5KYX A;  1TR2 A;  4LLC A;  2WVO A;  4DOZ A;  1G8X A;  5DLJ A;  5D91 A;  2WL8 A;  1D1C A;  3FDQ A;  1Z63 A;  1V55 C;  2W45 A;  2H7B A;  5B1A C;  4E7Z A;  3DZA A;  3WOD F;  3M1C B;  3GAN A;  2Z15 A;  3T4R A;  2H7O A;  1NU7 D;  3JRT A;  2J46 A;  1FMV A;  3DD7 A;  4X0R A;  5KYW A;  4QI2 A;  1VMA A;  4O7G A;  2ZPA A;  4MND A;  3T6B A;  2VH3 A;  3F46 A;  1OCZ C;  2C04 A;  4AK9 A;  1TWH A;  3FHD A;  4U5H A;  5B1B C;  3Q7L A;  4YT5 A;  3EQL F;  3V7O A;  2M4E A;  3T6J A;  3E70 C;  1SF8 A;  3OA1 A;  1FMW A;  5E33 A;  2KJG A;  2W4B A;  1ZHY A;  3NKD A;  4OIQ F;  3NG1 A;  2EIL C;  5T3T A;  4CS7 A;  2EIN C;  3E9V A;  3N2Z B;  4P6I C;  3QMK A;  3B0P A;  5EGY A;  4HFF B;  2XRH A;  3EFO B;  1V54 C;  1MMD A;  2A69 F;  4YT8 A;  3POV A;  1QLE C;  3ZIB A;  1ZYR F;  2KGO A;  1FFH A;  2OG2 A;  2NUP A;  3K6B A;  2OCC C;  3DAG A;  3F47 A;  4K0D A;  5E3A A;  3UR3 C;  3EGD A;  1SMY F;  3RKO F;  4U5C E;  4WJ0 A;  4G7H F;  4JZA A;  4N06 A;  5KYY B;  2Y69 C;  4KBL A;  4RBN A;  3W2W A;  2J0X A;  2R7Q A;  3AQC A;  4CIH A;  2FGY A;  4BG0 A;  3KKB A;  5KYN A;  4CSA A;  5T1D B;  2YHS A;  4BJ5 C;  4C3D A;  3EGX B;  4EWC A;  3JSZ A;  4HE8 D;  2IXO A;  4PFP A;  1D0Z A;  2R7U A;  4PFO A;  3EG9 B;  4U5E E;  4RD9 A;  4JW1 A;  3ZC4 A;  2O9X A;  3DJU B;  1MMN A;  2WZF A;  4I1M A;  3JYH A;  3AG1 C;  3ZVR A;  1M57 C;  4DVY P;  5L3V A;  2WVQ A;  4PJN A;  2P7V A;  4YJW A;  4FX5 A;  4XLN F;  3IEE A;  3SZR A;  2NG1 A;  4O6M A;  3NRH A;  3K7D A;  2XL4 A;  1WGW A;  2V26 A;  5KYU A;  4XLP F;  2R7T A;  5BUO A;  3MLG A;  3O39 A;  4YN0 B;  3DJN B;  2L81 A;  1FTS A;  3RYL A;  5F5F A;  2J45 A;  2R7O A;  3LS0 A;  4ULW A;  4U5G A;  3LLI A;  4W8K A;  2IXN A;  4JVS A;  4CS8 C;  4C7O B;  1PCX A;  2CW0 F;  1N1C A;  4LER A;  4K7B A;  3ECS A;  4CS9 C;  4OIR F;  4JUR I;  2G3K A;  4NY3 A;  4BJ6 C;  5E3C A;  2X51 A;  2C03 A;  2PX3 A;  3RH3 A;  4O6N A;  3QZC A;  2IXP A;  2V3C C;  4OIP F;  3UMI A;  5L3Q A;  3B0V C;  5CI9 A;  4IAO A;  2D5R B;  3AG3 C;  2WZL A;  3KL4 A;  4M63 A;  3S0X A;  4BJ1 A;  4O6Y A;  2Q9C A;  3O6X A;  4RDA A;  3NDB B;  2NUT B;  3CQZ A;  1BR4 A;  3EH1 A;  1KU2 A;  3FAJ A;  4XTK A;  4FWV A;  2B0J A;  1ZU4 A;  3ASN C;  3HTK C;  2DYS C;  2YEV A;  3EZI A;  2WB7 A;  1RJ9 B;  2J0W A;  2Y3D A;  1D1A A;  1J8Y F;  2Y3B A;  4Q7C A;  2BE5 F;  3L0I A;  3NYL A;  3Q6M A;  1SZI A;  4EBB A;  4I1O B;  2J7P D;  3DXJ F;  2Y3H A;  4HFK B;  3W8I A;  3OEO A;  2QTV A;  4Q4Z F;  4DBQ A;  2Q9A A;  3K33 A;  4I3M A;  3N24 A;  5D92 A;  1M2O A;  4GEH A;  5IY5 C;  3SYN A;  4BJT A;  3LJB A;  1M2V B;  3EHM A;  1PD0 A;  2ZXW C;  4DVZ A;  2KQ9 A;  1VYK A;  3OWT A;  3X2Q C;  4PK4 A;  1OKK A;  4BJ5 A;  3LEV A;  3UMH A;  3EFO A;  4O79 A;  3JT1 A;  3EZH A;  3S27 A;  2A68 F;  5B3S C;  4OIO F;  2VB6 A;  2VAS A;  3S28 A;  4JCH A;  2Q3T A;  4BEJ A;  1LVK A;  4DBR A;  1MNE A;  4U5B E;  2PFD A;  2EIM C;  4G0H A;  2P6V A;  5EHH A;  4PJL A;  2KW3 C;  1OCC C;  3ABM C;  2YZS A;  4LAC B;  1W2W A;  5CI8 A;  1TWC A;  4C3E A;  1O87 A;  4H4K C;  1Z3I X;  2CDQ A;  3X1O A;  5DVW A;  3LAY A;  1O5H A;  3RFY A;  2XXA B;  5KYY A;  5DQZ A;  2ZXO A;  3CZ6 A;  1ST6 A;  3W2V A;  2A1D D;  2MWQ A;  1IZM A;  4HEA J;  2HV7 A;  2KNH A;  3CSK A;  3EJN A;  3AQB A;  5DQT A;  1MND A;  2I8B A;  4CS8 A;  4I44 A;  2DYR C;  2J9V A;  2IOQ A;  3Q7G A;  4B6I A;  3SEO A;  3FVY A;  3EGX A;  4CS9 A;  4ZLC A;  1OCR C;  2CNW D;  4XWJ A;  3NYJ A;  1NU9 C;  4OD5 A;  2J9U A;  1BR1 A;  4IJJ A;  4BJ6 A;  3EH2 A;  1ZHT A;  3EG9 A;  1M56 C;  4C3B A;  4G7O F;  2MYS A;  4FES A;  5KYW B;  3LES A;  2XXA A;  1VYI A;  2GFH A;  4J32 B;  3KMI A;  3NKE A;  4MQ9 F;  1JPJ A;  3HLZ A;  2ZXR A;  3K1H A;  3VYW A;  3DM9 B;  1S7Z A;  4U5F E;  4YWQ A;  2R7X A;  1QZX A;  2CGE A;  3WG7 C;  1NZE A;  1D0Y A;  3UGP A;  3MX3 A;  4YT4 A;  1Z23 A;  3EPV A;  4PJM A;  4ZLD A;  4IWB A;  4C7O A;  1BR2 A;  4AX2 A;  4KNV A;  3DM5 A;  3ABK C;  4AE4 B;  1TKN A;  3N0T A;  4CBE A;  3UNG C;  3DAF A;  4G7Z F;  2W9Y A;  2ZXP A;  1NG1 A;  2EIJ C;  3UGO A;  1MMA A;  1VOM A;  5DS5 A;  4ANJ A;  3I5P A;  2WVN A;  3NYM A;  3ITF A;  1PD1 A;  1J8M F;  1LS1 A;  3ASO C;  1ZU5 A;  3ABL C;  2DGJ A;  1ZHX A;  2NUP B;  4QDL A;  2IYL D;  3VAY A;  3EGD B;  3SP1 A;  1ZHW A;  2NUT A;  1ZHZ A;  3LLK A;  3L34 A;  5T3W A;  5E2Q A;  1VK5 A;  5DS6 A;  4AE4 A;  2R7R A;  1Z6A A;  2WZG A;  1TWA A;  4IRU A;  1RJ9 A;  3TD7 A;  2R7V A;  3KH2 A;  4JJF A;  1OCO C;  2PX0 A;  3UMK A;  2PP4 A;  3I4U A;  3EHN A;  2G62 A;  1D0X A;  1LKX A;  2QY9 A;  3K66 A;  4QI0 A;  2CNW A;  3Q6N A;  4OIN F;  5F5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...