2P6VA

Structure of tafh domain of the human taf4 subunit of tfiid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
89
Chain Sequence
SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSPQPYLVPFLRSLPALRQLTPDSAAFIQQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 4
total genus 26
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2p6vA00
2P6VA 2H7BA 2KNHA 2PP4A
chains in the Genus database with same CATH superfamily
4PJMA 3SXMA 4DXWA 2G62A 256BA 3OA1A 1CGME 1HW1A 2M4EA 2AWCA 2VCAA 1RCPA 2A6EF 3GWNA 3O55A 1LPEA 5JSLA 3R2PA 3R7CA 4WJ0A 5BQGA 3JRMO 3C18A 3KPHA 1Q0FA 2XLWA 4O6NA 5B3SC 1Z3IX 4CSAA 2DI3A 2HJMA 3DM5A 5CI8A 1TQGA 5BUOA 3Q6MA 2WVNA 5BQIA 2R02A 1JMWA 2QNLA 4XPXA 3S0XA 4DBQA 4D4XA 3KYJA 4JW1A 3DE8A 5B3IA 2J8WA 2R7VA 1OCCC 3NKEA 2Y3BA 1TWGA 2D5RB 2XL8A 4IJJA 3B0VC 1AEPA 1TWAA 1NU9C 4BEJA 2HFIA 1A7DA 1UG7A 3T6BA 1JOGA 3EGXA 1R4TA 4EWCA 3VAYA 3ZWIA 2KGOA 3TQOA 3U5SA 4FX5A 3FHDA 5EGYA 5JS5A 2VB6A 1GS9A 3X2QC 4XLPF 3AG1C 1VYKA 2L6HA 4U9EA 1BZ4A 2AVKA 2PP4A 5L0IA 1GM5A 3N24A 4AE4B 1C17M 4CJOA 3G4XA 3ECSA 3EG9B 3CQZA 4MVOA 3RQGA 4ZLCA 4IARA 1OW7A 2C04A 4KNVA 2YRFA 4AL0A 4IAQA 2Y39A 3ZQVA 4C3DA 4CDYA 1YZCA 4LDKA 4JJGA 2OJQA 1JPNA 3PMRA 3QZCA 2ASRA 2NUPB 4JCZA 4YT2A 4OIPF 5F28E 1S05A 4FWVA 4NTAA 3U8VA 2LSEA 1VYIA 4CDVA 1FR0A 3GODA 1TR2A 2WB7A 5AC4A 3IQ6A 2O9XA 3IQ5A 2GWWA 5COMA 3SXKA 3UMIA 3L34A 1TKNA 1T5OA 2KSFA 2VCBA 4MTOA 3TJ5A 4MTGA 2QUPA 3V5XA 1M2OA 1TWHA 5TJ5E 5COFA 5DS6A 4WGYA 1FFTC 1L7CA 1JR8A 2I15A 4Q7CA 1MMDA 5L3VA 4G7ZF 3W2VA 2FFHA 4BJ6C 1ZYRF 4I3MA 2XLMA 4Q4ZF 2YL3A 2A6HF 3GEIA 1LI7A 3EGDA 2Q9AA 3FOOA 3L8IA 1RXQA 5KYUB 4CS9A 5JP7A 4CS7A 3NYJA 2WZFA 4KC9A 4JE9A 4L6RA 5KYXA 3POVA 3SP1A 2YLGA 2NUTA 3RFYA 1ZHYA 4CS9C 5JLIA 5L3QA 2HSQA 4W8PA 3UGPA 2LD6A 2Y69C 4RBNA 1OR2A 1WWPA 3RQFA 3EQLF 5L0HA 1V74B 2NSFA 4RDAA 5F5HA 1VMAA 4K1OA 4Z9IA 1LS1A 5T1DB 3IQTA 2E87A 5CI9A 2AU5A 2CNWD 3Q7LA 4H4KC 3I4UA 3UGOA 3X1OA 3MX3A 2GFHA 5JT4A 1SR2A 3BEHA 3TOMA 1D1AA 3W2WA 3DMDA 1V4AA 4NCQA 1ZVZA 5E2QA 1FMVA 4HFKB 4A4AA 4DRJB 3HJCA 4EIYA 1WASA 4EBBA 1ZU4A 3HLZA 3CAXA 4IWBA 4PFOA 2CDQA 4CIHA 4OIQF 3ABKC 5B1BC 5DQZA 2B0JA 3H2VA 3JZ0A 5DLJA 4M63A 4U5FE 2IXMA 3W4YA 3C8GB 2H7VC 5JUAA 3U2LA 4F4BA 1WATA 3U3BA 2EINC 1HMDA 1QKRA 1ORSC 1QLEC 2YEVA 3DWWA 2VH3A 2ZXPA 3O10A 3RIPA 5HV9A 3C7JA 3FMSA 3F46A 2H7BA 1OCRC 3AGTA 3GANA 5A6JA 3KKBA 3CSKA 2Q4FA 3E9VA 4ANJA 2H7OA 2A69F 4CJGA 1UFBA 5DS5A 2YVKA 5K0IA 4DJ9A 2KNHA 3V5ZA 1RJ9A 5AGFA 3SNHA 3S90A 1EKYA 1C02A 2EPKX 1QPUA 1T6IA 2Q3TA 3O6XA 2IBFA 1N1CA 3EJNA 3PCVA 4J30B 5DVWA 4WGZA 2XSEA 5DS4A 2ZPAA 1XZQA 5EHHA 2XM0A 4JZAA 2WVOA 4PR9A 1V55C 2ZXOA 4FESA 4U5GA 2ETSA 2P0NA 3M4BA 1NLXA 2XS1A 1QVXA 5HSWA 4PJNA 3DAFA 2EILC 3DXJF 1E85A 4XTKA 2XM4A 3LAYA 2CNWA 4OINF 3G4ZA 2P6VA 2OOCA 2YLIA 3DI5A 1C03A 2Y3GA 4ONSA 4P6IC 5FCLA 1D1BA 5JVEA 1M6TA 3C8ZA 1OW8A 1T6UA 2X0CA 1PCXA 3SXZA 3RH3A 1B68A 2L7AA 2M64A 2XXAA 3MYFA 4QI0A 1GQAA 1YZAA 2J45A 2YWAA 3QVYA 3W8IA 4PK4A 3ZIBA 1E83A 3K1IA 3V7OA 4ZLDA 3DZAA 2R03A 2R7QA 1I4YA 3IQCA 3Q7GA 2Y3HA 4IAOA 2A0BA 4MW3A 3U9MA 2XXAB 3B0UX 3U0CA 2IOQA 2PX0A 5IY5C 1FNTc 4U5EE 4D4NA 2J9UA 1OW6A 1V54C 1G4WR 2HMQA 4N4WA 4OD4A 3VYWA 3GM2A 2BC5A 1ORYA 1ZW2A 2W4BA 2XL6A 3B71A 1O3UA 3GM3A 4E0HA 1YA9A 3DAGA 1LE2A 3NKDA 1RKCA 2NPUA 1Y6DA 2Y3DA 4JC7A 1OKKD 1SF8A 4BJ5A 4AK9A 3C63A 2HKVA 1YA7O 1OCZC 2XLVA 4NTBA 3HTKC 2IYLD 4YJWA 2HSBA 3JYYA 3U3FA 1LS4A 1NFOA 1G8XA 4DVZA 1JRAA 1PD1A 1H7IA 2PF4E 2XRHA 1VK5A 3H2UA 2P1AA 2VC9A 2IM8A 3SZRA 3US6A 4MVQA 1RJ9B 1WGWA 3GORA 3N0TA 4YK5A 1AUEA 3TD7A 2I8BA 2R25A 4MVMA 4Q5SF 1LI5A 4BEMJ 3RW0A 2PNOA 4PJLA 3E70C 1Q0DA 1J8MF 3QW1A 1LKXA 4ULWA 1K04A 2OJED 4BJTA 4YT4A 2OEXA 5D92A 4MVUA 2CW0F 3QW0A 1IW7F 4CSAC 3C8GA 4LACB 4LDQA 4JKVA 5AC5A 3DD7A 1YLMA 2VASA 3TULA 2KC3A 4X0RA 1VB5A 4HE8D 1ZHWA 1OCOC 3RF3A 2DGJA 4GQHA 3LJBA 4E7ZA 5A6BD 3RVYA 2CCYA 3HNJA 1OXBA 4CDAA 3EZIA 2LK4A 5GPGB 1EA8A 4YT8A 4G7HF 4AX2A 2YLDA 3U8PA 2UUHA 1K40A 2PX3A 1Z7Qc 3ZSUA 3S27A 3MYIA 3M79A 5A6BA 2P61A 3JYHA 2G3VA 3MLGA 3WHNA 4J7YA 3J06A 1ZU5A 2KYHA 4WABA 2Z15A 3KMIA 2L6FA 4NC3A 4O6MA 1VTMP 3Q6NA 4HEAJ 2YKZA 3VF0A 2QY9A 1M57C 2NUTB 1PD0A 2R9RB 3T9OA 1Q0MA 4IB4A 2XLOA 4XEVA 5KYXB 4NQFA 3JSEO 1FFHA 1QSPA 1HMOA 1OXKA 4JEAA 2OKUA 5KYUA 3EGDB 3NMIA 2LFFA 3G50A 3EZHA 2HZ8A 3IEEA 2C03A 4MS2A 3ZTMA 2UUIA 2Q7RA 3TJ6A 3LNMB 4AL1A 3WAQA 2X51A 5KYNA 2L9JA 3MFNA 1EQ1A 2YL1A 4E18A 1NSGB 3CEXA 4DBRA 2DYRC 1KTMA 3LLIA 4JCHA 2KW3C 3S28A 3FVYA 2QLAA 3OWTA 2LIGA 3ASNC 4KNWA 5L0DA 2HS5A 2J46A 3ZVRA 4I44A 3NYMA 1DOVA 2EIKC 3OEOA 1WN0A 3RVZA 2G3KA 3L8JA 3V5YA 1PV3A 1JPJA 4CBEA 4LERA 4MNDA 3UMHA 2NUPA 3DJUB 3K66A 4J32B 2JX0A 3FAJA 3U9JA 1OR3A 1GGQA 1XWJA 1YJGA 1YYXA 3LEVA 3L1MA 3AG3C 3PHF2 1APCA 2FAPB 4LLEA 3EG9A 4YN0B 1MQVA 2JPUA 3CZ6A 3I5PA 3EPVA 3M15A 2QTVA 4AE4A 2MYSA 1A7EA 1QQ3A 2R7OA 4JIOA 2YL7A 4JTDB 2W45A 1D0ZA 3FDQA 1FMWA 1SZIA 3GEHA 3NMJA 3NYLA 2ICWG 1WOLA 5L0GA 2BE5F 3KH2A 4FAPB 3LUTB 3FOPA 1HE9A 4K0DA 2LCHA 4R32A 2LP4A 2XLHA 2R7XA 3EGXB 2PFDA 3AJMA 1O87A 1IZMA 3NG1A 3M4CA 4NY3A 2H8AA 3EH2A 5E3AA 2F22A 3O39A 2W9YA 4XQ1A 5L0CA 1Q0KA 2XL4A 1MNEA 3JRTA 2PBEA 3ATPA 1E2XA 1MMNA 4O6YA 4BJ1A 1XZPA 3L0IA 4ER9A 4JVSA 3RYLA 3UR3C 2HJ3A 2AP3A 2EPNA 2LQGA 1Z23A 5FZTA 4G78A 2ZXWC 1MMGA 1LIHA 3I5QA 1I4ZA 3FXHA 1NBBA 2VCCA 1CPRA 4P9FA 1CPQA 3B0PA 2R7SA 4MTFA 4P9TA 4KBLA 1FTSA 1VLTA 3HNLA 1Z6AA 2NSGA 1CGNA 3F47A 3ZC4A 4N06A 5DQTA 3VM6A 2A0UA 2A68F 2KQ9A 2QE9A 3JSZA 4N6CA 4MQ9F 4DVYP 3KYIA 3LS0A 3UMKA 4YWQA 1A7VA 1CGOA 1LM3B 2P7VA 2YL0A 4K7BA 4QDLA 1J8YF 4E17A 1LVKA 4U9DA 1NU7D 2GA0A 3ABMC 3S29A 2Q00A 2Q9BA 4PACA 3SYNA 1Z5ZA 3M1CB 2IXNA 1T6QA 2BL2A 4HFFB 1BR1A 4MVSA 4YL0A 4XLNF 4G7OF 4QI2A 3S9OA 4U5HA 2XLEA 3N2ZB 2HV7A 5KYWA 3QMKA 4EBJA 1OQCA 2AWYA 2J7PD 4GEHA 3KL4A 4BPMA 5KYYB 3SXYA 1D0XA 3ZG1A 3S84A 2YQYA 1ORJA 3LLKA 4GYTA 2LFDA 1Q0GA 1KU2A 4XPYA 3AQBA 2CGEA 2L81A 4E0IA 1A41A 4CX9A 4EHPA 4XPWA 3K1HA 2DYSC 3B29A 1ZHXA 1HY5A 3GWLA 2EIJC 5A69A 4U5CE 4E7SA 1ZHTA 4MW8A 1R5ID 1M2VB 2YHSA 4O7GA 4JURI 2HMZA 4CS8A 5JRAA 3DM9B 2WZGA 2YZSA 3A11A 4JJFA 1D0YA 4BJ6A 1K05A 3ITFA 1BBHA 1VOMA 3LEOA 3W8HA 4C3BA 2DB4A 2EPOA 2J0XA 1DOWA 2R05A 5E3CA 1HW2A 1M56C 3K6BA 4EKWA 4LDRA 4YT5A 3T6GB 3HNIA 2J9VA 4XWJA 1JAFA 1TWCA 3AGUA 2J9WA 2MWQA 3LNRA 4RD9A 2OCCC 4W8KA 4XEFA 3TK0A 3U2MA 5BQHA 4BG0A 1BR2A 2GDCA 1H9TA 3VRCA 1W2WA 4YL1A 1RKEB 3K7DA 3T6JA 3EFOA 4Z9HA 5T3WA 3HNKA 1EI7A 2RSEB 3FAPB 1U6HA 3WG7C 4CIPA 4KI2A 3AG4C 3JTLO 4IRUA 1E84A 1TFKB 1D1CA 1WTYA 1I5NA 3WODF 2W4MA 3AOUA 4JEBA 4C7OA 1Y4CA 4J7TA 4UDVA 1QZXA 4B6IA 2V26A 3IHUA 3JT1A 2OG2A 4I1MA 3TOLA 3EH1A 1Z63A 3DKAA 4U5DE 2HV6A 4JTAB 1BDJB 2WVQA 4LLCA 1LE4A 2ZXRA 2KJGA 1G5ZA 1YYJA 3NMKA 2R7TA 3LESA 5EK0A 2J0WA 3ZQYA 4C7OB 1KNYA 1ST6A 3K33A 3AQCA 3PDMP 2OEVA 4NTFA 4JTCB 3DE9A 3EHNA 4PJJA 4XEKA 1U0BB 1MMAA 4OIRF 2NG1A 3B9QA 4A2NB 1FAPB 1ZHZA 1H6GA 2EIMC 3EFOB 3AG2C 1RKEA 2WL8A 5L0FA 3GM1A 1T01A 5A6KA 1OKKA 4DOZA 3QVZA 1U89A 3H65A 3UNGC 1YAUO 1L3PA 3C62A 4BJ5C 1ZZPA 1E86A 2OQMA 4JRZA 2EPLX 1BR4A 1H9GA 1O5HA 2IXOA 3T4RA 2D4UA 5D91A 2TMVP 1HE1A 1VLSA 2FGYA 2WZLA 1F1MA 4IGGA 5T3TA 3NRHA 3ZDLA 5CIVA 1ZW3A 5L0JA 1YARO 3HKKA 1TFOB 1YVIA 3ZTZA 1A0BA 3EHMA 2Q9CA 2MHRA 5COGA 5A6AA 1M2VA 4N6HA 4Z9JA 3NDBB 2ZD9A 2R7UA 3RKOF 4PFPA 3K1IC 3C8GD 3DJNB 3RQEA 4ULVA 2XS8A 4CS8C 2J9BA 4U5BE 4DRIB 1NFNA 4MVZA 1MNDA 1YDIA 2CYDA 3LS1A 1T9KA 2L6GA 2OU6A 4YL3A 2XLDA 2IXPA 3SEOA 4C3EA 4EBKA 2A1DD 4MVRA 4OD5A 5KYYA 2KK1A 3A9CA 2JD3A 2HUJA 1SYQA 3IPMO 3MBGA 5KYWB 2J7PA 2RD9A 2EPMX 1RMVA 4EUKB 1SMYF 2R7WA 5F5FA 1G4US 2GAQA 3QTHA 4G0HA 4OIOF 4O79A 3BRJA 1AVOB 1NG1A 1NZEA 3GEEA 3JCUQ 5B1AC 2R7RA 4H54A 5E33A 2V3CC 4DRHB 3ABLC 4I1OB 2B0HA 3ASOC 1S7ZA
chains in the Genus database with same CATH topology
4PJMA 2G62A 3OA1A 2M4EA 2A6EF 4WJ0A 5B3SC 4O6NA 4CSAA 1Z3IX 3DM5A 5CI8A 5BUOA 3Q6MA 2WVNA 3S0XA 4DBQA 4JW1A 2R7VA 1OCCC 3NKEA 2Y3BA 1TWGA 2D5RB 4IJJA 3B0VC 1TWAA 1NU9C 4BEJA 3T6BA 3EGXA 4EWCA 3VAYA 2KGOA 4FX5A 3FHDA 5EGYA 2VB6A 3X2QC 4XLPF 3AG1C 1VYKA 2PP4A 3N24A 4AE4B 3ECSA 3EG9B 3CQZA 4ZLCA 2C04A 4KNVA 4C3DA 2Y39A 4JJGA 1JPNA 3PMRA 3QZCA 2NUPB 4YT2A 4OIPF 4FWVA 2LSEA 1VYIA 3GODA 1TR2A 2WB7A 2O9XA 3UMIA 3L34A 1TKNA 1M2OA 1TWHA 5DS6A 5L3VA 1FFTC 4Q7CA 1MMDA 4G7ZF 3W2VA 2FFHA 4BJ6C 1ZYRF 4I3MA 4Q4ZF 2A6HF 3EGDA 2Q9AA 5KYUB 4CS9A 4CS7A 3NYJA 2WZFA 4KC9A 5KYXA 3POVA 3SP1A 2NUTA 3RFYA 1ZHYA 4CS9C 5L3QA 3UGPA 2Y69C 4RBNA 3EQLF 4RDAA 5F5HA 1VMAA 1LS1A 5T1DB 2E87A 5CI9A 3Q7LA 2CNWD 4H4KC 3I4UA 3UGOA 3X1OA 3MX3A 2GFHA 3W2WA 1D1AA 3DMDA 5E2QA 1FMVA 4HFKB 3HJCA 4EBBA 1ZU4A 3HLZA 4PFOA 4IWBA 4CIHA 2CDQA 4OIQF 3ABKC 5B1BC 5DQZA 2B0JA 5DLJA 4M63A 4U5FE 2IXMA 2H7VC 4F4BA 2EINC 2YEVA 1QLEC 2VH3A 2ZXPA 3RIPA 3F46A 2H7BA 1OCRC 3GANA 3KKBA 3CSKA 3E9VA 4ANJA 2H7OA 2A69F 5DS5A 2KNHA 1RJ9A 3SNHA 2Q3TA 3O6XA 1N1CA 3EJNA 4J30B 5DVWA 2XSEA 5DS4A 2ZPAA 5EHHA 4JZAA 2WVOA 4U5GA 1V55C 2ZXOA 4FESA 5HSWA 4PJNA 3DAFA 2EILC 3DXJF 4XTKA 3LAYA 2CNWA 4OINF 2P6VA 4P6IC 5FCLA 2Y3GA 1D1BA 1PCXA 3RH3A 2XXAA 4QI0A 2J45A 3W8IA 4PK4A 3ZIBA 4ZLDA 3V7OA 3DZAA 2R7QA 3Q7GA 2Y3HA 4IAOA 2XXAB 3B0UX 2IOQA 2PX0A 5IY5C 4U5EE 2J9UA 1V54C 4OD4A 3VYWA 2W4BA 3DAGA 3NKDA 2Y3DA 1OKKD 1SF8A 4BJ5A 4AK9A 1OCZC 3HTKC 2IYLD 4YJWA 1G8XA 4DVZA 1PD1A 2PF4E 2XRHA 1VK5A 3SZRA 1RJ9B 1WGWA 3N0TA 3TD7A 2I8BA 4Q5SF 4PJLA 3E70C 1J8MF 1LKXA 4ULWA 4BJTA 4YT4A 5D92A 2CW0F 1IW7F 4CSAC 4LACB 3DD7A 2VASA 4X0RA 4HE8D 1ZHWA 1OCOC 2DGJA 3LJBA 4E7ZA 3EZIA 4YT8A 4G7HF 4AX2A 2PX3A 3ZSUA 3S27A 3MLGA 3JYHA 2G3VA 1ZU5A 2Z15A 3KMIA 4O6MA 3Q6NA 4HEAJ 2QY9A 1M57C 2NUTB 1PD0A 5KYXB 1FFHA 5KYUA 3EGDB 3EZHA 3IEEA 2C03A 2X51A 5KYNA 2L9JA 4DBRA 2DYRC 3LLIA 4JCHA 2KW3C 3S28A 3FVYA 3OWTA 3ASNC 4KNWA 2J46A 3ZVRA 4I44A 3NYMA 2EIKC 3OEOA 2G3KA 4CBEA 1JPJA 4LERA 4MNDA 3UMHA 2NUPA 3DJUB 3K66A 4J32B 3FAJA 3LEVA 3AG3C 3PHF2 4LLEA 3EG9A 4YN0B 4AE4A 3CZ6A 3I5PA 3EPVA 2QTVA 2MYSA 2R7OA 2W45A 1D0ZA 3FDQA 1FMWA 1SZIA 3NYLA 2BE5F 3KH2A 4K0DA 2R7XA 3EGXB 2PFDA 1O87A 1IZMA 3NG1A 4NY3A 5E3AA 3EH2A 3O39A 2W9YA 2XL4A 1MNEA 3JRTA 1MMNA 4O6YA 4BJ1A 3L0IA 4JVSA 3RYLA 3UR3C 1Z23A 2ZXWC 1MMGA 3I5QA 2R7SA 3B0PA 4KBLA 1FTSA 1Z6AA 3ZC4A 3F47A 4N06A 5DQTA 2A68F 2KQ9A 3JSZA 4MQ9F 4DVYP 3LS0A 3UMKA 4YWQA 2P7VA 4K7BA 4QDLA 1J8YF 1LVKA 1NU7D 3ABMC 3S29A 2Q9BA 3SYNA 1Z5ZA 3M1CB 2IXNA 4HFFB 4G7OF 1BR1A 4QI2A 4XLNF 4U5HA 3N2ZB 2HV7A 5KYWA 3QMKA 2J7PD 4GEHA 3KL4A 5KYYB 1D0XA 3ZG1A 3LLKA 4GYTA 1KU2A 3AQBA 2CGEA 2L81A 3K1HA 2DYSC 1ZHXA 2EIJC 4U5CE 4E7SA 1ZHTA 1M2VB 2YHSA 4O7GA 4JURI 4CS8A 3DM9B 2WZGA 2YZSA 4JJFA 1D0YA 4BJ6A 3ITFA 1VOMA 3W8HA 4C3BA 2J0XA 5E3CA 1M56C 3K6BA 4YT5A 4XWJA 2J9VA 1TWCA 2J9WA 2MWQA 3LNRA 4RD9A 2OCCC 4W8KA 4BG0A 1BR2A 1W2WA 3K7DA 3T6JA 3EFOA 5T3WA 3WG7C 4KI2A 3AG4C 4IRUA 1D1CA 3WODF 2W4MA 4C7OA 1QZXA 4B6IA 2V26A 3JT1A 2OG2A 4I1MA 3EH1A 1Z63A 4U5DE 2HV6A 2WVQA 4LLCA 2ZXRA 2KJGA 2R7TA 3LESA 2J0WA 4C7OB 3K33A 1ST6A 3AQCA 3EHNA 4PJJA 1MMAA 4OIRF 2NG1A 3B9QA 4A2NB 1ZHZA 2EIMC 3EFOB 3AG2C 2WL8A 1OKKA 4DOZA 3H65A 3UNGC 4BJ5C 1BR4A 1O5HA 2IXOA 3T4RA 5D91A 2FGYA 2WZLA 5T3TA 3NRHA 3EHMA 2Q9CA 1M2VA 3NDBB 2R7UA 3RKOF 4PFPA 3K1IC 3DJNB 4CS8C 4U5BE 1MNDA 3LS1A 2IXPA 3SEOA 4C3EA 2A1DD 4OD5A 5KYYA 2JD3A 5KYWB 2J7PA 1SMYF 2R7WA 5F5FA 4G0HA 4OIOF 4O79A 3JCUQ 1NG1A 1NZEA 5B1AC 2R7RA 5E33A 2V3CC 3ABLC 4I1OB 3ASOC 1S7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2H7B A;  2KNH A;  2PP4 A; 
#chains in the Genus database with same CATH topology
 4PJM A;  3SXM A;  4DXW A;  2G62 A;  256B A;  3OA1 A;  1CGM E;  1HW1 A;  2M4E A;  2AWC A;  2VCA A;  1RCP A;  2A6E F;  3GWN A;  3O55 A;  1LPE A;  5JSL A;  3R2P A;  3R7C A;  4WJ0 A;  5BQG A;  3JRM O;  3C18 A;  3KPH A;  1Q0F A;  2XLW A;  4O6N A;  5B3S C;  1Z3I X;  4CSA A;  2DI3 A;  2HJM A;  3DM5 A;  5CI8 A;  1TQG A;  5BUO A;  3Q6M A;  2WVN A;  5BQI A;  2R02 A;  1JMW A;  2QNL A;  4XPX A;  3S0X A;  4DBQ A;  4D4X A;  3KYJ A;  4JW1 A;  3DE8 A;  5B3I A;  2J8W A;  2R7V A;  1OCC C;  3NKE A;  2Y3B A;  1TWG A;  2D5R B;  2XL8 A;  4IJJ A;  3B0V C;  1AEP A;  1TWA A;  1NU9 C;  4BEJ A;  2HFI A;  1A7D A;  1UG7 A;  3T6B A;  1JOG A;  3EGX A;  1R4T A;  4EWC A;  3VAY A;  3ZWI A;  2KGO A;  3TQO A;  3U5S A;  4FX5 A;  3FHD A;  5EGY A;  5JS5 A;  2VB6 A;  1GS9 A;  3X2Q C;  4XLP F;  3AG1 C;  1VYK A;  2L6H A;  4U9E A;  1BZ4 A;  2AVK A;  2PP4 A;  5L0I A;  1GM5 A;  3N24 A;  4AE4 B;  1C17 M;  4CJO A;  3G4X A;  3ECS A;  3EG9 B;  3CQZ A;  4MVO A;  3RQG A;  4ZLC A;  4IAR A;  1OW7 A;  2C04 A;  4KNV A;  2YRF A;  4AL0 A;  4IAQ A;  2Y39 A;  3ZQV A;  4C3D A;  4CDY A;  1YZC A;  4LDK A;  4JJG A;  2OJQ A;  1JPN A;  3PMR A;  3QZC A;  2ASR A;  2NUP B;  4JCZ A;  4YT2 A;  4OIP F;  5F28 E;  1S05 A;  4FWV A;  4NTA A;  3U8V A;  2LSE A;  1VYI A;  4CDV A;  1FR0 A;  3GOD A;  1TR2 A;  2WB7 A;  5AC4 A;  3IQ6 A;  2O9X A;  3IQ5 A;  2GWW A;  5COM A;  3SXK A;  3UMI A;  3L34 A;  1TKN A;  1T5O A;  2KSF A;  2VCB A;  4MTO A;  3TJ5 A;  4MTG A;  2QUP A;  3V5X A;  1M2O A;  1TWH A;  5TJ5 E;  5COF A;  5DS6 A;  4WGY A;  1FFT C;  1L7C A;  1JR8 A;  2I15 A;  4Q7C A;  1MMD A;  5L3V A;  4G7Z F;  3W2V A;  2FFH A;  4BJ6 C;  1ZYR F;  4I3M A;  2XLM A;  4Q4Z F;  2YL3 A;  2A6H F;  3GEI A;  1LI7 A;  3EGD A;  2Q9A A;  3FOO A;  3L8I A;  1RXQ A;  5KYU B;  4CS9 A;  5JP7 A;  4CS7 A;  3NYJ A;  2WZF A;  4KC9 A;  4JE9 A;  4L6R A;  5KYX A;  3POV A;  3SP1 A;  2YLG A;  2NUT A;  3RFY A;  1ZHY A;  4CS9 C;  5JLI A;  5L3Q A;  2HSQ A;  4W8P A;  3UGP A;  2LD6 A;  2Y69 C;  4RBN A;  1OR2 A;  1WWP A;  3RQF A;  3EQL F;  5L0H A;  1V74 B;  2NSF A;  4RDA A;  5F5H A;  1VMA A;  4K1O A;  4Z9I A;  1LS1 A;  5T1D B;  3IQT A;  2E87 A;  5CI9 A;  2AU5 A;  2CNW D;  3Q7L A;  4H4K C;  3I4U A;  3UGO A;  3X1O A;  3MX3 A;  2GFH A;  5JT4 A;  1SR2 A;  3BEH A;  3TOM A;  1D1A A;  3W2W A;  3DMD A;  1V4A A;  4NCQ A;  1ZVZ A;  5E2Q A;  1FMV A;  4HFK B;  4A4A A;  4DRJ B;  3HJC A;  4EIY A;  1WAS A;  4EBB A;  1ZU4 A;  3HLZ A;  3CAX A;  4IWB A;  4PFO A;  2CDQ A;  4CIH A;  4OIQ F;  3ABK C;  5B1B C;  5DQZ A;  2B0J A;  3H2V A;  3JZ0 A;  5DLJ A;  4M63 A;  4U5F E;  2IXM A;  3W4Y A;  3C8G B;  2H7V C;  5JUA A;  3U2L A;  4F4B A;  1WAT A;  3U3B A;  2EIN C;  1HMD A;  1QKR A;  1ORS C;  1QLE C;  2YEV A;  3DWW A;  2VH3 A;  2ZXP A;  3O10 A;  3RIP A;  5HV9 A;  3C7J A;  3FMS A;  3F46 A;  2H7B A;  1OCR C;  3AGT A;  3GAN A;  5A6J A;  3KKB A;  3CSK A;  2Q4F A;  3E9V A;  4ANJ A;  2H7O A;  2A69 F;  4CJG A;  1UFB A;  5DS5 A;  2YVK A;  5K0I A;  4DJ9 A;  2KNH A;  3V5Z A;  1RJ9 A;  5AGF A;  3SNH A;  3S90 A;  1EKY A;  1C02 A;  2EPK X;  1QPU A;  1T6I A;  2Q3T A;  3O6X A;  2IBF A;  1N1C A;  3EJN A;  3PCV A;  4J30 B;  5DVW A;  4WGZ A;  2XSE A;  5DS4 A;  2ZPA A;  1XZQ A;  5EHH A;  2XM0 A;  4JZA A;  2WVO A;  4PR9 A;  1V55 C;  2ZXO A;  4FES A;  4U5G A;  2ETS A;  2P0N A;  3M4B A;  1NLX A;  2XS1 A;  1QVX A;  5HSW A;  4PJN A;  3DAF A;  2EIL C;  3DXJ F;  1E85 A;  4XTK A;  2XM4 A;  3LAY A;  2CNW A;  4OIN F;  3G4Z A;  2P6V A;  2OOC A;  2YLI A;  3DI5 A;  1C03 A;  2Y3G A;  4ONS A;  4P6I C;  5FCL A;  1D1B A;  5JVE A;  1M6T A;  3C8Z A;  1OW8 A;  1T6U A;  2X0C A;  1PCX A;  3SXZ A;  3RH3 A;  1B68 A;  2L7A A;  2M64 A;  2XXA A;  3MYF A;  4QI0 A;  1GQA A;  1YZA A;  2J45 A;  2YWA A;  3QVY A;  3W8I A;  4PK4 A;  3ZIB A;  1E83 A;  3K1I A;  3V7O A;  4ZLD A;  3DZA A;  2R03 A;  2R7Q A;  1I4Y A;  3IQC A;  3Q7G A;  2Y3H A;  4IAO A;  2A0B A;  4MW3 A;  3U9M A;  2XXA B;  3B0U X;  3U0C A;  2IOQ A;  2PX0 A;  5IY5 C;  1FNT c;  4U5E E;  4D4N A;  2J9U A;  1OW6 A;  1V54 C;  1G4W R;  2HMQ A;  4N4W A;  4OD4 A;  3VYW A;  3GM2 A;  2BC5 A;  1ORY A;  1ZW2 A;  2W4B A;  2XL6 A;  3B71 A;  1O3U A;  3GM3 A;  4E0H A;  1YA9 A;  3DAG A;  1LE2 A;  3NKD A;  1RKC A;  2NPU A;  1Y6D A;  2Y3D A;  4JC7 A;  1OKK D;  1SF8 A;  4BJ5 A;  4AK9 A;  3C63 A;  2HKV A;  1YA7 O;  1OCZ C;  2XLV A;  4NTB A;  3HTK C;  2IYL D;  4YJW A;  2HSB A;  3JYY A;  3U3F A;  1LS4 A;  1NFO A;  1G8X A;  4DVZ A;  1JRA A;  1PD1 A;  1H7I A;  2PF4 E;  2XRH A;  1VK5 A;  3H2U A;  2P1A A;  2VC9 A;  2IM8 A;  3SZR A;  3US6 A;  4MVQ A;  1RJ9 B;  1WGW A;  3GOR A;  3N0T A;  4YK5 A;  1AUE A;  3TD7 A;  2I8B A;  2R25 A;  4MVM A;  4Q5S F;  1LI5 A;  4BEM J;  3RW0 A;  2PNO A;  4PJL A;  3E70 C;  1Q0D A;  1J8M F;  3QW1 A;  1LKX A;  4ULW A;  1K04 A;  2OJE D;  4BJT A;  4YT4 A;  2OEX A;  5D92 A;  4MVU A;  2CW0 F;  3QW0 A;  1IW7 F;  4CSA C;  3C8G A;  4LAC B;  4LDQ A;  4JKV A;  5AC5 A;  3DD7 A;  1YLM A;  2VAS A;  3TUL A;  2KC3 A;  4X0R A;  1VB5 A;  4HE8 D;  1ZHW A;  1OCO C;  3RF3 A;  2DGJ A;  4GQH A;  3LJB A;  4E7Z A;  5A6B D;  3RVY A;  2CCY A;  3HNJ A;  1OXB A;  4CDA A;  3EZI A;  2LK4 A;  5GPG B;  1EA8 A;  4YT8 A;  4G7H F;  4AX2 A;  2YLD A;  3U8P A;  2UUH A;  1K40 A;  2PX3 A;  1Z7Q c;  3ZSU A;  3S27 A;  3MYI A;  3M79 A;  5A6B A;  2P61 A;  3JYH A;  2G3V A;  3MLG A;  3WHN A;  4J7Y A;  3J06 A;  1ZU5 A;  2KYH A;  4WAB A;  2Z15 A;  3KMI A;  2L6F A;  4NC3 A;  4O6M A;  1VTM P;  3Q6N A;  4HEA J;  2YKZ A;  3VF0 A;  2QY9 A;  1M57 C;  2NUT B;  1PD0 A;  2R9R B;  3T9O A;  1Q0M A;  4IB4 A;  2XLO A;  4XEV A;  5KYX B;  4NQF A;  3JSE O;  1FFH A;  1QSP A;  1HMO A;  1OXK A;  4JEA A;  2OKU A;  5KYU A;  3EGD B;  3NMI A;  2LFF A;  3G50 A;  3EZH A;  2HZ8 A;  3IEE A;  2C03 A;  4MS2 A;  3ZTM A;  2UUI A;  2Q7R A;  3TJ6 A;  3LNM B;  4AL1 A;  3WAQ A;  2X51 A;  5KYN A;  2L9J A;  3MFN A;  1EQ1 A;  2YL1 A;  4E18 A;  1NSG B;  3CEX A;  4DBR A;  2DYR C;  1KTM A;  3LLI A;  4JCH A;  2KW3 C;  3S28 A;  3FVY A;  2QLA A;  3OWT A;  2LIG A;  3ASN C;  4KNW A;  5L0D A;  2HS5 A;  2J46 A;  3ZVR A;  4I44 A;  3NYM A;  1DOV A;  2EIK C;  3OEO A;  1WN0 A;  3RVZ A;  2G3K A;  3L8J A;  3V5Y A;  1PV3 A;  1JPJ A;  4CBE A;  4LER A;  4MND A;  3UMH A;  2NUP A;  3DJU B;  3K66 A;  4J32 B;  2JX0 A;  3FAJ A;  3U9J A;  1OR3 A;  1GGQ A;  1XWJ A;  1YJG A;  1YYX A;  3LEV A;  3L1M A;  3AG3 C;  3PHF 2;  1APC A;  2FAP B;  4LLE A;  3EG9 A;  4YN0 B;  1MQV A;  2JPU A;  3CZ6 A;  3I5P A;  3EPV A;  3M15 A;  2QTV A;  4AE4 A;  2MYS A;  1A7E A;  1QQ3 A;  2R7O A;  4JIO A;  2YL7 A;  4JTD B;  2W45 A;  1D0Z A;  3FDQ A;  1FMW A;  1SZI A;  3GEH A;  3NMJ A;  3NYL A;  2ICW G;  1WOL A;  5L0G A;  2BE5 F;  3KH2 A;  4FAP B;  3LUT B;  3FOP A;  1HE9 A;  4K0D A;  2LCH A;  4R32 A;  2LP4 A;  2XLH A;  2R7X A;  3EGX B;  2PFD A;  3AJM A;  1O87 A;  1IZM A;  3NG1 A;  3M4C A;  4NY3 A;  2H8A A;  3EH2 A;  5E3A A;  2F22 A;  3O39 A;  2W9Y A;  4XQ1 A;  5L0C A;  1Q0K A;  2XL4 A;  1MNE A;  3JRT A;  2PBE A;  3ATP A;  1E2X A;  1MMN A;  4O6Y A;  4BJ1 A;  1XZP A;  3L0I A;  4ER9 A;  4JVS A;  3RYL A;  3UR3 C;  2HJ3 A;  2AP3 A;  2EPN A;  2LQG A;  1Z23 A;  5FZT A;  4G78 A;  2ZXW C;  1MMG A;  1LIH A;  3I5Q A;  1I4Z A;  3FXH A;  1NBB A;  2VCC A;  1CPR A;  4P9F A;  1CPQ A;  3B0P A;  2R7S A;  4MTF A;  4P9T A;  4KBL A;  1FTS A;  1VLT A;  3HNL A;  1Z6A A;  2NSG A;  1CGN A;  3F47 A;  3ZC4 A;  4N06 A;  5DQT A;  3VM6 A;  2A0U A;  2A68 F;  2KQ9 A;  2QE9 A;  3JSZ A;  4N6C A;  4MQ9 F;  4DVY P;  3KYI A;  3LS0 A;  3UMK A;  4YWQ A;  1A7V A;  1CGO A;  1LM3 B;  2P7V A;  2YL0 A;  4K7B A;  4QDL A;  1J8Y F;  4E17 A;  1LVK A;  4U9D A;  1NU7 D;  2GA0 A;  3ABM C;  3S29 A;  2Q00 A;  2Q9B A;  4PAC A;  3SYN A;  1Z5Z A;  3M1C B;  2IXN A;  1T6Q A;  2BL2 A;  4HFF B;  1BR1 A;  4MVS A;  4YL0 A;  4XLN F;  4G7O F;  4QI2 A;  3S9O A;  4U5H A;  2XLE A;  3N2Z B;  2HV7 A;  5KYW A;  3QMK A;  4EBJ A;  1OQC A;  2AWY A;  2J7P D;  4GEH A;  3KL4 A;  4BPM A;  5KYY B;  3SXY A;  1D0X A;  3ZG1 A;  3S84 A;  2YQY A;  1ORJ A;  3LLK A;  4GYT A;  2LFD A;  1Q0G A;  1KU2 A;  4XPY A;  3AQB A;  2CGE A;  2L81 A;  4E0I A;  1A41 A;  4CX9 A;  4EHP A;  4XPW A;  3K1H A;  2DYS C;  3B29 A;  1ZHX A;  1HY5 A;  3GWL A;  2EIJ C;  5A69 A;  4U5C E;  4E7S A;  1ZHT A;  4MW8 A;  1R5I D;  1M2V B;  2YHS A;  4O7G A;  4JUR I;  2HMZ A;  4CS8 A;  5JRA A;  3DM9 B;  2WZG A;  2YZS A;  3A11 A;  4JJF A;  1D0Y A;  4BJ6 A;  1K05 A;  3ITF A;  1BBH A;  1VOM A;  3LEO A;  3W8H A;  4C3B A;  2DB4 A;  2EPO A;  2J0X A;  1DOW A;  2R05 A;  5E3C A;  1HW2 A;  1M56 C;  3K6B A;  4EKW A;  4LDR A;  4YT5 A;  3T6G B;  3HNI A;  2J9V A;  4XWJ A;  1JAF A;  1TWC A;  3AGU A;  2J9W A;  2MWQ A;  3LNR A;  4RD9 A;  2OCC C;  4W8K A;  4XEF A;  3TK0 A;  3U2M A;  5BQH A;  4BG0 A;  1BR2 A;  2GDC A;  1H9T A;  3VRC A;  1W2W A;  4YL1 A;  1RKE B;  3K7D A;  3T6J A;  3EFO A;  4Z9H A;  5T3W A;  3HNK A;  1EI7 A;  2RSE B;  3FAP B;  1U6H A;  3WG7 C;  4CIP A;  4KI2 A;  3AG4 C;  3JTL O;  4IRU A;  1E84 A;  1TFK B;  1D1C A;  1WTY A;  1I5N A;  3WOD F;  2W4M A;  3AOU A;  4JEB A;  4C7O A;  1Y4C A;  4J7T A;  4UDV A;  1QZX A;  4B6I A;  2V26 A;  3IHU A;  3JT1 A;  2OG2 A;  4I1M A;  3TOL A;  3EH1 A;  1Z63 A;  3DKA A;  4U5D E;  2HV6 A;  4JTA B;  1BDJ B;  2WVQ A;  4LLC A;  1LE4 A;  2ZXR A;  2KJG A;  1G5Z A;  1YYJ A;  3NMK A;  2R7T A;  3LES A;  5EK0 A;  2J0W A;  3ZQY A;  4C7O B;  1KNY A;  1ST6 A;  3K33 A;  3AQC A;  3PDM P;  2OEV A;  4NTF A;  4JTC B;  3DE9 A;  3EHN A;  4PJJ A;  4XEK A;  1U0B B;  1MMA A;  4OIR F;  2NG1 A;  3B9Q A;  4A2N B;  1FAP B;  1ZHZ A;  1H6G A;  2EIM C;  3EFO B;  3AG2 C;  1RKE A;  2WL8 A;  5L0F A;  3GM1 A;  1T01 A;  5A6K A;  1OKK A;  4DOZ A;  3QVZ A;  1U89 A;  3H65 A;  3UNG C;  1YAU O;  1L3P A;  3C62 A;  4BJ5 C;  1ZZP A;  1E86 A;  2OQM A;  4JRZ A;  2EPL X;  1BR4 A;  1H9G A;  1O5H A;  2IXO A;  3T4R A;  2D4U A;  5D91 A;  2TMV P;  1HE1 A;  1VLS A;  2FGY A;  2WZL A;  1F1M A;  4IGG A;  5T3T A;  3NRH A;  3ZDL A;  5CIV A;  1ZW3 A;  5L0J A;  1YAR O;  3HKK A;  1TFO B;  1YVI A;  3ZTZ A;  1A0B A;  3EHM A;  2Q9C A;  2MHR A;  5COG A;  5A6A A;  1M2V A;  4N6H A;  4Z9J A;  3NDB B;  2ZD9 A;  2R7U A;  3RKO F;  4PFP A;  3K1I C;  3C8G D;  3DJN B;  3RQE A;  4ULV A;  2XS8 A;  4CS8 C;  2J9B A;  4U5B E;  4DRI B;  1NFN A;  4MVZ A;  1MND A;  1YDI A;  2CYD A;  3LS1 A;  1T9K A;  2L6G A;  2OU6 A;  4YL3 A;  2XLD A;  2IXP A;  3SEO A;  4C3E A;  4EBK A;  2A1D D;  4MVR A;  4OD5 A;  5KYY A;  2KK1 A;  3A9C A;  2JD3 A;  2HUJ A;  1SYQ A;  3IPM O;  3MBG A;  5KYW B;  2J7P A;  2RD9 A;  2EPM X;  1RMV A;  4EUK B;  1SMY F;  2R7W A;  5F5F A;  1G4U S;  2GAQ A;  3QTH A;  4G0H A;  4OIO F;  4O79 A;  3BRJ A;  1AVO B;  1NG1 A;  1NZE A;  3GEE A;  3JCU Q;  5B1A C;  2R7R A;  4H54 A;  5E33 A;  2V3C C;  4DRH B;  3ABL C;  4I1O B;  2B0H A;  3ASO C;  1S7Z A; 
#chains in the Genus database with same CATH homology
 4PJM A;  2G62 A;  3OA1 A;  2M4E A;  2A6E F;  4WJ0 A;  5B3S C;  4O6N A;  4CSA A;  1Z3I X;  3DM5 A;  5CI8 A;  5BUO A;  3Q6M A;  2WVN A;  3S0X A;  4DBQ A;  4JW1 A;  2R7V A;  1OCC C;  3NKE A;  2Y3B A;  1TWG A;  2D5R B;  4IJJ A;  3B0V C;  1TWA A;  1NU9 C;  4BEJ A;  3T6B A;  3EGX A;  4EWC A;  3VAY A;  2KGO A;  4FX5 A;  3FHD A;  5EGY A;  2VB6 A;  3X2Q C;  4XLP F;  3AG1 C;  1VYK A;  2PP4 A;  3N24 A;  4AE4 B;  3ECS A;  3EG9 B;  3CQZ A;  4ZLC A;  2C04 A;  4KNV A;  4C3D A;  2Y39 A;  4JJG A;  1JPN A;  3PMR A;  3QZC A;  2NUP B;  4YT2 A;  4OIP F;  4FWV A;  2LSE A;  1VYI A;  3GOD A;  1TR2 A;  2WB7 A;  2O9X A;  3UMI A;  3L34 A;  1TKN A;  1M2O A;  1TWH A;  5DS6 A;  5L3V A;  1FFT C;  4Q7C A;  1MMD A;  4G7Z F;  3W2V A;  2FFH A;  4BJ6 C;  1ZYR F;  4I3M A;  4Q4Z F;  2A6H F;  3EGD A;  2Q9A A;  5KYU B;  4CS9 A;  4CS7 A;  3NYJ A;  2WZF A;  4KC9 A;  5KYX A;  3POV A;  3SP1 A;  2NUT A;  3RFY A;  1ZHY A;  4CS9 C;  5L3Q A;  3UGP A;  2Y69 C;  4RBN A;  3EQL F;  4RDA A;  5F5H A;  1VMA A;  1LS1 A;  5T1D B;  2E87 A;  5CI9 A;  3Q7L A;  2CNW D;  4H4K C;  3I4U A;  3UGO A;  3X1O A;  3MX3 A;  2GFH A;  3W2W A;  1D1A A;  3DMD A;  5E2Q A;  1FMV A;  4HFK B;  3HJC A;  4EBB A;  1ZU4 A;  3HLZ A;  4PFO A;  4IWB A;  4CIH A;  2CDQ A;  4OIQ F;  3ABK C;  5B1B C;  5DQZ A;  2B0J A;  5DLJ A;  4M63 A;  4U5F E;  2IXM A;  2H7V C;  4F4B A;  2EIN C;  2YEV A;  1QLE C;  2VH3 A;  2ZXP A;  3RIP A;  3F46 A;  2H7B A;  1OCR C;  3GAN A;  3KKB A;  3CSK A;  3E9V A;  4ANJ A;  2H7O A;  2A69 F;  5DS5 A;  2KNH A;  1RJ9 A;  3SNH A;  2Q3T A;  3O6X A;  1N1C A;  3EJN A;  4J30 B;  5DVW A;  2XSE A;  5DS4 A;  2ZPA A;  5EHH A;  4JZA A;  2WVO A;  4U5G A;  1V55 C;  2ZXO A;  4FES A;  5HSW A;  4PJN A;  3DAF A;  2EIL C;  3DXJ F;  4XTK A;  3LAY A;  2CNW A;  4OIN F;  2P6V A;  4P6I C;  5FCL A;  2Y3G A;  1D1B A;  1PCX A;  3RH3 A;  2XXA A;  4QI0 A;  2J45 A;  3W8I A;  4PK4 A;  3ZIB A;  4ZLD A;  3V7O A;  3DZA A;  2R7Q A;  3Q7G A;  2Y3H A;  4IAO A;  2XXA B;  3B0U X;  2IOQ A;  2PX0 A;  5IY5 C;  4U5E E;  2J9U A;  1V54 C;  4OD4 A;  3VYW A;  2W4B A;  3DAG A;  3NKD A;  2Y3D A;  1OKK D;  1SF8 A;  4BJ5 A;  4AK9 A;  1OCZ C;  3HTK C;  2IYL D;  4YJW A;  1G8X A;  4DVZ A;  1PD1 A;  2PF4 E;  2XRH A;  1VK5 A;  3SZR A;  1RJ9 B;  1WGW A;  3N0T A;  3TD7 A;  2I8B A;  4Q5S F;  4PJL A;  3E70 C;  1J8M F;  1LKX A;  4ULW A;  4BJT A;  4YT4 A;  5D92 A;  2CW0 F;  1IW7 F;  4CSA C;  4LAC B;  3DD7 A;  2VAS A;  4X0R A;  4HE8 D;  1ZHW A;  1OCO C;  2DGJ A;  3LJB A;  4E7Z A;  3EZI A;  4YT8 A;  4G7H F;  4AX2 A;  2PX3 A;  3ZSU A;  3S27 A;  3MLG A;  3JYH A;  2G3V A;  1ZU5 A;  2Z15 A;  3KMI A;  4O6M A;  3Q6N A;  4HEA J;  2QY9 A;  1M57 C;  2NUT B;  1PD0 A;  5KYX B;  1FFH A;  5KYU A;  3EGD B;  3EZH A;  3IEE A;  2C03 A;  2X51 A;  5KYN A;  2L9J A;  4DBR A;  2DYR C;  3LLI A;  4JCH A;  2KW3 C;  3S28 A;  3FVY A;  3OWT A;  3ASN C;  4KNW A;  2J46 A;  3ZVR A;  4I44 A;  3NYM A;  2EIK C;  3OEO A;  2G3K A;  4CBE A;  1JPJ A;  4LER A;  4MND A;  3UMH A;  2NUP A;  3DJU B;  3K66 A;  4J32 B;  3FAJ A;  3LEV A;  3AG3 C;  3PHF 2;  4LLE A;  3EG9 A;  4YN0 B;  4AE4 A;  3CZ6 A;  3I5P A;  3EPV A;  2QTV A;  2MYS A;  2R7O A;  2W45 A;  1D0Z A;  3FDQ A;  1FMW A;  1SZI A;  3NYL A;  2BE5 F;  3KH2 A;  4K0D A;  2R7X A;  3EGX B;  2PFD A;  1O87 A;  1IZM A;  3NG1 A;  4NY3 A;  5E3A A;  3EH2 A;  3O39 A;  2W9Y A;  2XL4 A;  1MNE A;  3JRT A;  1MMN A;  4O6Y A;  4BJ1 A;  3L0I A;  4JVS A;  3RYL A;  3UR3 C;  1Z23 A;  2ZXW C;  1MMG A;  3I5Q A;  2R7S A;  3B0P A;  4KBL A;  1FTS A;  1Z6A A;  3ZC4 A;  3F47 A;  4N06 A;  5DQT A;  2A68 F;  2KQ9 A;  3JSZ A;  4MQ9 F;  4DVY P;  3LS0 A;  3UMK A;  4YWQ A;  2P7V A;  4K7B A;  4QDL A;  1J8Y F;  1LVK A;  1NU7 D;  3ABM C;  3S29 A;  2Q9B A;  3SYN A;  1Z5Z A;  3M1C B;  2IXN A;  4HFF B;  4G7O F;  1BR1 A;  4QI2 A;  4XLN F;  4U5H A;  3N2Z B;  2HV7 A;  5KYW A;  3QMK A;  2J7P D;  4GEH A;  3KL4 A;  5KYY B;  1D0X A;  3ZG1 A;  3LLK A;  4GYT A;  1KU2 A;  3AQB A;  2CGE A;  2L81 A;  3K1H A;  2DYS C;  1ZHX A;  2EIJ C;  4U5C E;  4E7S A;  1ZHT A;  1M2V B;  2YHS A;  4O7G A;  4JUR I;  4CS8 A;  3DM9 B;  2WZG A;  2YZS A;  4JJF A;  1D0Y A;  4BJ6 A;  3ITF A;  1VOM A;  3W8H A;  4C3B A;  2J0X A;  5E3C A;  1M56 C;  3K6B A;  4YT5 A;  4XWJ A;  2J9V A;  1TWC A;  2J9W A;  2MWQ A;  3LNR A;  4RD9 A;  2OCC C;  4W8K A;  4BG0 A;  1BR2 A;  1W2W A;  3K7D A;  3T6J A;  3EFO A;  5T3W A;  3WG7 C;  4KI2 A;  3AG4 C;  4IRU A;  1D1C A;  3WOD F;  2W4M A;  4C7O A;  1QZX A;  4B6I A;  2V26 A;  3JT1 A;  2OG2 A;  4I1M A;  3EH1 A;  1Z63 A;  4U5D E;  2HV6 A;  2WVQ A;  4LLC A;  2ZXR A;  2KJG A;  2R7T A;  3LES A;  2J0W A;  4C7O B;  3K33 A;  1ST6 A;  3AQC A;  3EHN A;  4PJJ A;  1MMA A;  4OIR F;  2NG1 A;  3B9Q A;  4A2N B;  1ZHZ A;  2EIM C;  3EFO B;  3AG2 C;  2WL8 A;  1OKK A;  4DOZ A;  3H65 A;  3UNG C;  4BJ5 C;  1BR4 A;  1O5H A;  2IXO A;  3T4R A;  5D91 A;  2FGY A;  2WZL A;  5T3T A;  3NRH A;  3EHM A;  2Q9C A;  1M2V A;  3NDB B;  2R7U A;  3RKO F;  4PFP A;  3K1I C;  3DJN B;  4CS8 C;  4U5B E;  1MND A;  3LS1 A;  2IXP A;  3SEO A;  4C3E A;  2A1D D;  4OD5 A;  5KYY A;  2JD3 A;  5KYW B;  2J7P A;  1SMY F;  2R7W A;  5F5F A;  4G0H A;  4OIO F;  4O79 A;  3JCU Q;  1NG1 A;  1NZE A;  5B1A C;  2R7R A;  5E33 A;  2V3C C;  3ABL C;  4I1O B;  3ASO C;  1S7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...