2P6XA

Crystal structure of human tyrosine phosphatase ptpn22
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
302
Chain Sequence
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDKHSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale structural analysis of the classical human protein tyrosine phosphatome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 22
total genus 108
structure length 302
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2p6xA00
2GWOA 1Q6TA 2G6ZA 3A5KA 3A5JA 2QBRA 2QBQA 2HVLA 4BJOA 1Q6NA 2PSZA 4DGXA 3QCLA 4GWFA 3QCCA 1Q1MA 3EAXA 2FJNA 1VHRA 2QEPA 2CJZA 1YPTA 2H02A 3QCEA 3ZM3A 4R0TA 1L8GA 5J8RA 2Q05A 5KAAA 2B49A 1A5YA 2NLKA 5BX1A 3I80A 2CM8A 4PVGA 2F6VA 3F81A 5M43A 4D3QA 2BV5A 3V0FA 2H4KA 2J16A 1PTUA 4IKCA 4ZRTA 4TVVA 2OUDA 1Q6SA 2F6TA 1C86A 3SR9A 2I1YA 1OESA 1X24A 4GE6A 2Y2FA 4GRYA 1RXDA 3QCGA 4HJPA 1MKPA 2I4HA 3O5XA 3BLUA 1PTTA 2PBNA 2F6ZA 2PI7A 4YAAA 2GP0A 2I75A 2HY3A 1T4JA 1C87A 2I3UA 2VEUA 5IBSA 2I6IA 1WAXA 5BZZA 5KA1A 3BRHA 2YDUA 2H03A 2CMCA 2ZMMA 3ZM0A 1OHCA 3B7OA 5AWXA 4QUNA 3BLTA 3S4OA 3M4UA 2B4PA 3CWEA 3AWFA 4NWGA 2IMGA 4Y14A 4B04A 4ERCA 3D44A 1XBOA 1ZCLA 2DXPA 2BGDA 2F6WA 3QCJA 5I6VA 3EU0A 1KAKA 1D5RA 3MOWA 1PYNA 1BZJA 2F6YA 3AWEA 4OHLA 2AHSA 3QCKA 3V0HA 5BZXA 2HC2A 4D3PA 1QXKA 1OEMX 1AAXA 1OEUA 1C84A 4J51A 1YGRA 2A3KA 1T48A 5KADA 2I4EA 4RH9A 1OEOX 2NT2A 4KYRA 3N0AA 2FJMA 2I4GA 1G1HA 4KYQA 3O4TA 3O4UA 1XM2A 1BZCA 3S4EA 2BIJA 4ZI4A 3S3EA 2QDCA 2F71A 2QCTA 4NYHA 1OETA 2J17A 3F9AA 2CM2A 5K23A 1G4WR 3GXHA 4QAHA 5KACA 2BZLA 4Y2EA 2C46A 5KABA 1R6HA 2PQ5A 1PA1A 1YFOA 1SUGA 2B4SA 2OZ5A 4OHDA 5K9WA 1ZC0A 3S3HA 3QCIA 3S3KA 2QDMA 1RPMA 2F6FA 4JMKA 5KA9A 3MMJA 3AWGA 2CNIA 1U26A 4RDDA 1PTVA 3I36A 5HDEA 3V0EA 5IBMA 4PYHA 4HRFA 4H34A 2I42A 3QCDA 4RI4A 1EENA 3QCNA 1OHEA 2CNEA 3I7ZA 1EEOA 2VEVA 2A8BA 1M3GA 3QCFA 3RGQA 1XXVA 3D1HA 3RZ2A 1LQFA 4WOHA 5KA7A 1J4XA 2B3OA 2J16B 5KA0A 2I5XA 2SHPA 2OOQA 1JLNA 2NT7A 1FPZA 2H4VA 3S3FA 1U24A 3OMHA 2CM7A 1NNYA 4R0SA 2F70A 2VEXA 4NWFA 4NNDA 2VEYA 2C7SA 1WCHA 2QBPA 4JNBA 1GWZA 4WTYA 4QBEA 1JF7A 3ZM2A 2CFVA 1OHDA 5MMZB 4GE2A 1ZCKA 1ECVA 3ZMPA 1I9SA 5EHRA 1U25A 1Q6JA 2B07A 4JBCA 1NWLA 3NMEA 4ICZA 4ZN5A 1NO6A 1LYVA 2CNGA 4WU2A 4GS0A 2G59A 4GRZA 4RKKA 1WRMA 2I6PA 2BGEA 3EMUA 1LARA 4OHEA 4H1OA 5LXQB 2I6JA 2P4DA 3U96A 1ONYA 1PXHA 3RO1A 3V0IA 3QCBA 2NZ6A 2HB1A 2M3VA 4GE5A 5K24A 4R30A 2HCMA 2E0TA 3D1QA 4MBBA 3EZZA 3QKQA 4OHHA 2VEWA 4QUMA 5GTJA 2B4UA 3OLRA 2PT0A 4QAPA 3D1OA 3O4SA 2ESBA 2RF6A 2B4OA 3D9CA 2NV5A 4I8NA 2NTAA 1G4US 4GFUA 1QZ0A 1XRIA 2F46A 3LJ8A 1BZHA 1OEVA 1I57A 2HNPA 3ZM1A 3BM8A 1PH0A 3O3LA 2P6XA 4QBWA 3SMEA 5KA2A 1FPRA 1YZ4A 2JJDA 4BPCA 2CNHA 4OHIA 1YN9A 4WU3A 3V0DA 4GFVA 4S0GA 1ONZA 5K22A 2WGPA 3ZMQA 4D3RA 3V0JA 5KA4A 4RI5A 2R0BA 2MBCA 5KA3A 2QDPA 1PA9A 2PA5A 1G1GA 1YTWA 3QCHA 1NL9A 2HNQA 3ZV2A 1I9TA 1NZ7A 1P15A 2QBSA 4KI9A 2ZN7A 1T49A 1PTYA 4AZ1A 1G1FA 1XXPA 3D42A 2Y96A 4HJQA 5K25A 4YR8B 1YGUA 2I3RA 1NWEA 4Z6BA 5BUGA 1L8KA 2Q47A 4JMJA 1C88A 3PS5A 1C85A 1V3AA 3F9BA 2CM3A 3V0GA 1Q6PA 4RHGA 3EB1A 4DGPA 1G7FA 3MOZA 3CM3A 1YTSA 2CNFA 5KA8A 3QKPA 2HXPA 2AZRA 5K9VA 2HC1A 3F41A 2CMBA 1C83A 1KAVA 2CMAA 1YWFA 4RH5A 2FH7A 3RGOA 1FQ1A 2H4GA 3QCMA 2GJTA 3GXGA 2I6MA 2I6OA 1YTNA 1ZZWA 3F99A 4NX8A 1G7GA 5EHPA 2QCJA 2H04A 1GFYA 2OC3A 1Q6MA 3H2XA
chains in the Genus database with same CATH superfamily
2GWOA 1E8CA 1Q6TA 2G6ZA 3A5KA 3A5JA 2QBRA 2QBQA 2HVLA 4BJOA 1Q6NA 2PSZA 4DGXA 3QCLA 4GWFA 2UAGA 3QCCA 1O5ZA 1Q1MA 3EAXA 2GCBA 2FJNA 2Y1OA 1VHRA 2QEPA 2CJZA 2WJPA 1YPTA 1EEHA 2H02A 3QCEA 3ZM3A 4R0TA 4CVMA 1L8GA 5J8RA 2Q05A 5KAAA 2B49A 1A5YA 2NLKA 5BX1A 3I80A 2CM8A 4PVGA 2VOSA 2F6VA 3F81A 5M43A 4D3QA 2BV5A 3V0FA 2H4KA 2J16A 1PTUA 4IKCA 4ZRTA 4TVVA 2OUDA 1Q6SA 1JBWA 2F6TA 4QDIA 1C86A 3SR9A 2I1YA 1OESA 1X24A 4C12A 4GE6A 2Y2FA 4GRYA 1RXDA 3QCGA 4HJPA 1MKPA 2I4HA 3O5XA 3ZL8A 2F00A 1GG4A 3BLUA 1PTTA 2PBNA 2F6ZA 2PI7A 4YAAA 2GP0A 2I75A 2HY3A 1T4JA 1C87A 2I3UA 2VEUA 5IBSA 2I6IA 1WAXA 5BZZA 5KA1A 3BRHA 2YDUA 2H03A 2CMCA 2AM1A 2ZMMA 3ZM0A 1OHCA 3B7OA 5AWXA 5A5EA 1JBVA 4QUNA 3BLTA 3S4OA 3M4UA 2B4PA 3CWEA 3AWFA 4NWGA 2IMGA 4Y14A 4B04A 4ERCA 3D44A 1XBOA 1ZCLA 2DXPA 2JFGA 2BGDA 2F6WA 3QCJA 4QF5A 5I6VA 3EU0A 1KAKA 1D5RA 3MOWA 1PYNA 1UAGA 1BZJA 2F6YA 3AWEA 4OHLA 2AHSA 3QCKA 3V0HA 4BUBA 5BZXA 1W7KA 2HC2A 4D3PA 1QXKA 1OEMX 1AAXA 1OEUA 1C84A 4J51A 1YGRA 2A3KA 1T48A 5KADA 2I4EA 4RH9A 1OEOX 2NT2A 4KYRA 3N0AA 1P3DA 2FJMA 2I4GA 3HN7A 1W78A 1G1HA 4KYQA 3O4TA 3O4UA 3NRSA 1XM2A 1BZCA 3S4EA 2BIJA 4ZI4A 2GC5A 2QDCA 3S3EA 2F71A 2QCTA 4NYHA 1GQQA 2XPCA 1OETA 2J17A 3F9AA 2CM2A 5K23A 1G4WR 3GXHA 4QAHA 5KACA 3QCZA 2BZLA 2UUOA 4Y2EA 2C46A 5KABA 1R6HA 2PQ5A 1PA1A 1YFOA 1SUGA 2B4SA 2OZ5A 4OHDA 5K9WA 1ZC0A 3S3HA 3QCIA 3S3KA 2QDMA 1RPMA 2F6FA 4JMKA 5KA9A 3MMJA 3AWGA 2CNIA 2Y66A 1U26A 4RDDA 1PTVA 3I36A 1E0DA 5HDEA 3V0EA 5IBMA 4PYHA 4HRFA 4H34A 2I42A 3QCDA 4RI4A 1EENA 3QCNA 1OHEA 2CNEA 3I7ZA 4CVLA 1EEOA 2VEVA 3UAGA 2A8BA 1M3GA 3QCFA 3RGQA 1XXVA 3N2AA 3D1HA 3RZ2A 1LQFA 4WOHA 4BUCA 5KA7A 1J4XA 2B3OA 2J16B 5KA0A 2I5XA 2SHPA 2OOQA 1JLNA 2NT7A 1FPZA 2H4VA 4CVKA 2GCAA 3S3FA 2AM2A 1U24A 3OMHA 2CM7A 1NNYA 4R0SA 2F70A 2VEXA 4NWFA 4NNDA 2VEYA 2C7SA 1P31A 1WCHA 2QBPA 4JNBA 2VTEA 1GWZA 4WTYA 4QBEA 1JF7A 3ZM2A 2CFVA 4UAGA 1OHDA 5MMZB 4GE2A 1ZCKA 1ECVA 4ZIYA 3ZMPA 1I9SA 2JFHA 5EHRA 1U25A 1Q6JA 2B07A 4JBCA 1NWLA 3NMEA 4ICZA 4ZN5A 1NO6A 1LYVA 2CNGA 4WU2A 4GS0A 2G59A 4GRZA 1J6UA 4RKKA 1WRMA 2I6PA 2BGEA 3EMUA 1LARA 4OHEA 4H1OA 5LXQB 2I6JA 2P4DA 2UUPA 3U96A 1ONYA 1PXHA 3RO1A 3V0IA 3QCBA 3PYZA 2NZ6A 2HB1A 2M3VA 4GE5A 5K24A 3LK7A 4R30A 2HCMA 2E0TA 3D1QA 4MBBA 3EZZA 3QKQA 2GC6A 2VEWA 4OHHA 4QUMA 5GTJA 3ZM5A 2B4UA 3OLRA 2PT0A 4QAPA 3D1OA 3O4SA 2ESBA 2RF6A 2B4OA 3D9CA 2Y67A 2NV5A 4I8NA 2NTAA 1G4US 4GFUA 1QZ0A 2X5OA 1XRIA 2F46A 3LJ8A 1BZHA 1OEVA 2JFFA 1I57A 2HNPA 3ZM1A 3BM8A 1PH0A 3O3LA 2P6XA 4QBWA 3SMEA 3MVNA 5KA2A 1FPRA 1YZ4A 2JJDA 4BPCA 2CNHA 4OHIA 1YN9A 4WU3A 3ZM6A 3V0DA 4GFVA 4S0GA 2VTDA 1ONZA 5K22A 2WGPA 3ZMQA 4D3RA 3V0JA 5KA4A 4RI5A 2R0BA 2MBCA 5KA3A 2QDPA 1PA9A 2PA5A 1G1GA 1YTWA 3QCHA 4HV4A 1NL9A 2HNQA 3ZV2A 1I9TA 1NZ7A 1P15A 2QBSA 4KI9A 2ZN7A 1T49A 2WTZA 1PTYA 4AZ1A 1G1FA 4C13A 1XXPA 1GQYA 2Y96A 3D42A 4HJQA 5K25A 2Y68A 4YR8B 1YGUA 2I3RA 1NWEA 4Z6BA 5BUGA 1L8KA 2Q47A 4JMJA 5A5FA 1C88A 3PS5A 1C85A 1V3AA 3F9BA 2CM3A 3V0GA 1Q6PA 4RHGA 3EB1A 4DGPA 1G7FA 3MOZA 3CM3A 1YTSA 2CNFA 5KA8A 2HXPA 3QKPA 2AZRA 5K9VA 2HC1A 3F41A 2VORA 2CMBA 1C83A 1KAVA 2CMAA 1YWFA 4RH5A 2FH7A 2XJAA 1FQ1A 2H4GA 3RGOA 3QCMA 2GJTA 3GXGA 2I6MA 2I6OA 1YTNA 1ZZWA 3F99A 1FGSA 4NX8A 1G7GA 5EHPA 2QCJA 2H04A 1GFYA 2OC3A 1Q6MA 3H2XA
chains in the Genus database with same CATH topology
2GWOA 1Q6TA 2G6ZA 3A5KA 3A5JA 2QBRA 2QBQA 2HVLA 4BJOA 1Q6NA 2PSZA 4DGXA 3QCLA 4GWFA 3QCCA 1Q1MA 3EAXA 2FJNA 1VHRA 2QEPA 2CJZA 1YPTA 2H02A 3QCEA 3ZM3A 4R0TA 1L8GA 5J8RA 2Q05A 5KAAA 2B49A 1A5YA 2NLKA 5BX1A 3I80A 2CM8A 4PVGA 2F6VA 3F81A 5M43A 4D3QA 2BV5A 3V0FA 2H4KA 2J16A 1PTUA 4IKCA 4ZRTA 4TVVA 2OUDA 1Q6SA 2F6TA 1C86A 3SR9A 2I1YA 1OESA 1X24A 4GE6A 2Y2FA 4GRYA 1RXDA 3QCGA 4HJPA 1MKPA 2I4HA 3O5XA 3BLUA 1PTTA 2PBNA 2F6ZA 2PI7A 4YAAA 2GP0A 2I75A 2HY3A 1T4JA 1C87A 2I3UA 2VEUA 5IBSA 2I6IA 1WAXA 5BZZA 5KA1A 3BRHA 2YDUA 2H03A 2CMCA 2ZMMA 3ZM0A 1OHCA 3B7OA 5AWXA 4QUNA 3BLTA 3S4OA 3M4UA 2B4PA 3CWEA 3AWFA 4NWGA 2IMGA 4Y14A 4B04A 4ERCA 3D44A 1XBOA 1ZCLA 2DXPA 2BGDA 2F6WA 3QCJA 5I6VA 3EU0A 1KAKA 1D5RA 3MOWA 1PYNA 1BZJA 2F6YA 3AWEA 4OHLA 2AHSA 3QCKA 3V0HA 5BZXA 2HC2A 4D3PA 1QXKA 1OEMX 1AAXA 1OEUA 1C84A 4J51A 1YGRA 2A3KA 1T48A 5KADA 2I4EA 4RH9A 1OEOX 2NT2A 4KYRA 3N0AA 2FJMA 2I4GA 1G1HA 4KYQA 3O4TA 3O4UA 1XM2A 1BZCA 3S4EA 2BIJA 4ZI4A 3S3EA 2QDCA 2F71A 2QCTA 4NYHA 1OETA 2J17A 3F9AA 2CM2A 5K23A 1G4WR 3GXHA 4QAHA 5KACA 2BZLA 4Y2EA 2C46A 5KABA 1R6HA 2PQ5A 1PA1A 1YFOA 1SUGA 2B4SA 2OZ5A 4OHDA 5K9WA 1ZC0A 3S3HA 3QCIA 3S3KA 2QDMA 1RPMA 2F6FA 4JMKA 5KA9A 3MMJA 3AWGA 2CNIA 1U26A 4RDDA 1PTVA 3I36A 5HDEA 3V0EA 5IBMA 4PYHA 4HRFA 4H34A 2I42A 3QCDA 4RI4A 1EENA 3QCNA 1OHEA 2CNEA 3I7ZA 1EEOA 2VEVA 2A8BA 1M3GA 3QCFA 3RGQA 1XXVA 3D1HA 3RZ2A 1LQFA 4WOHA 5KA7A 1J4XA 2B3OA 2J16B 5KA0A 2I5XA 2SHPA 2OOQA 1JLNA 2NT7A 1FPZA 2H4VA 3S3FA 1U24A 3OMHA 2CM7A 1NNYA 4R0SA 2F70A 2VEXA 4NWFA 4NNDA 2VEYA 2C7SA 1WCHA 2QBPA 4JNBA 1GWZA 4WTYA 4QBEA 1JF7A 3ZM2A 2CFVA 1OHDA 5MMZB 4GE2A 1ZCKA 1ECVA 3ZMPA 1I9SA 5EHRA 1U25A 1Q6JA 2B07A 4JBCA 1NWLA 3NMEA 4ICZA 4ZN5A 1NO6A 1LYVA 2CNGA 4WU2A 4GS0A 2G59A 4GRZA 4RKKA 1WRMA 2I6PA 2BGEA 3EMUA 1LARA 4OHEA 4H1OA 5LXQB 2I6JA 2P4DA 3U96A 1ONYA 1PXHA 3RO1A 3V0IA 3QCBA 2NZ6A 2HB1A 2M3VA 4GE5A 5K24A 4R30A 2HCMA 2E0TA 3D1QA 4MBBA 3EZZA 3QKQA 4OHHA 2VEWA 4QUMA 5GTJA 2B4UA 3OLRA 2PT0A 4QAPA 3D1OA 3O4SA 2ESBA 2RF6A 2B4OA 3D9CA 2NV5A 4I8NA 2NTAA 1G4US 4GFUA 1QZ0A 1XRIA 2F46A 3LJ8A 1BZHA 1OEVA 1I57A 2HNPA 3ZM1A 3BM8A 1PH0A 3O3LA 2P6XA 4QBWA 3SMEA 5KA2A 1FPRA 1YZ4A 2JJDA 4BPCA 2CNHA 4OHIA 1YN9A 4WU3A 3V0DA 4GFVA 4S0GA 1ONZA 5K22A 2WGPA 3ZMQA 4D3RA 3V0JA 5KA4A 4RI5A 2R0BA 2MBCA 5KA3A 2QDPA 1PA9A 2PA5A 1G1GA 1YTWA 3QCHA 1NL9A 2HNQA 3ZV2A 1I9TA 1NZ7A 1P15A 2QBSA 4KI9A 2ZN7A 1T49A 1PTYA 4AZ1A 1G1FA 1XXPA 3D42A 2Y96A 4HJQA 5K25A 4YR8B 1YGUA 2I3RA 1NWEA 4Z6BA 5BUGA 1L8KA 2Q47A 4JMJA 1C88A 3PS5A 1C85A 1V3AA 3F9BA 2CM3A 3V0GA 1Q6PA 4RHGA 3EB1A 4DGPA 1G7FA 3MOZA 3CM3A 1YTSA 2CNFA 5KA8A 3QKPA 2HXPA 2AZRA 5K9VA 2HC1A 3F41A 2CMBA 1C83A 1KAVA 2CMAA 1YWFA 4RH5A 2FH7A 3RGOA 1FQ1A 2H4GA 3QCMA 2GJTA 3GXGA 2I6MA 2I6OA 1YTNA 1ZZWA 3F99A 4NX8A 1G7GA 5EHPA 2QCJA 2H04A 1GFYA 2OC3A 1Q6MA 3H2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWO A;  1Q6T A;  2G6Z A;  3A5K A;  3A5J A;  2QBR A;  2QBQ A;  2HVL A;  4BJO A;  1Q6N A;  2PSZ A;  4DGX A;  3QCL A;  4GWF A;  3QCC A;  1Q1M A;  3EAX A;  2FJN A;  1VHR A;  2QEP A;  2CJZ A;  1YPT A;  2H02 A;  3QCE A;  3ZM3 A;  4R0T A;  1L8G A;  5J8R A;  2Q05 A;  5KAA A;  2B49 A;  1A5Y A;  2NLK A;  5BX1 A;  3I80 A;  2CM8 A;  4PVG A;  2F6V A;  3F81 A;  5M43 A;  4D3Q A;  2BV5 A;  3V0F A;  2H4K A;  2J16 A;  1PTU A;  4IKC A;  4ZRT A;  4TVV A;  2OUD A;  1Q6S A;  2F6T A;  1C86 A;  3SR9 A;  2I1Y A;  1OES A;  1X24 A;  4GE6 A;  2Y2F A;  4GRY A;  1RXD A;  3QCG A;  4HJP A;  1MKP A;  2I4H A;  3O5X A;  3BLU A;  1PTT A;  2PBN A;  2F6Z A;  2PI7 A;  4YAA A;  2GP0 A;  2I75 A;  2HY3 A;  1T4J A;  1C87 A;  2I3U A;  2VEU A;  5IBS A;  2I6I A;  1WAX A;  5BZZ A;  5KA1 A;  3BRH A;  2YDU A;  2H03 A;  2CMC A;  2ZMM A;  3ZM0 A;  1OHC A;  3B7O A;  5AWX A;  4QUN A;  3BLT A;  3S4O A;  3M4U A;  2B4P A;  3CWE A;  3AWF A;  4NWG A;  2IMG A;  4Y14 A;  4B04 A;  4ERC A;  3D44 A;  1XBO A;  1ZCL A;  2DXP A;  2BGD A;  2F6W A;  3QCJ A;  5I6V A;  3EU0 A;  1KAK A;  1D5R A;  3MOW A;  1PYN A;  1BZJ A;  2F6Y A;  3AWE A;  4OHL A;  2AHS A;  3QCK A;  3V0H A;  5BZX A;  2HC2 A;  4D3P A;  1QXK A;  1OEM X;  1AAX A;  1OEU A;  1C84 A;  4J51 A;  1YGR A;  2A3K A;  1T48 A;  5KAD A;  2I4E A;  4RH9 A;  1OEO X;  2NT2 A;  4KYR A;  3N0A A;  2FJM A;  2I4G A;  1G1H A;  4KYQ A;  3O4T A;  3O4U A;  1XM2 A;  1BZC A;  3S4E A;  2BIJ A;  4ZI4 A;  3S3E A;  2QDC A;  2F71 A;  2QCT A;  4NYH A;  1OET A;  2J17 A;  3F9A A;  2CM2 A;  5K23 A;  1G4W R;  3GXH A;  4QAH A;  5KAC A;  2BZL A;  4Y2E A;  2C46 A;  5KAB A;  1R6H A;  2PQ5 A;  1PA1 A;  1YFO A;  1SUG A;  2B4S A;  2OZ5 A;  4OHD A;  5K9W A;  1ZC0 A;  3S3H A;  3QCI A;  3S3K A;  2QDM A;  1RPM A;  2F6F A;  4JMK A;  5KA9 A;  3MMJ A;  3AWG A;  2CNI A;  1U26 A;  4RDD A;  1PTV A;  3I36 A;  5HDE A;  3V0E A;  5IBM A;  4PYH A;  4HRF A;  4H34 A;  2I42 A;  3QCD A;  4RI4 A;  1EEN A;  3QCN A;  1OHE A;  2CNE A;  3I7Z A;  1EEO A;  2VEV A;  2A8B A;  1M3G A;  3QCF A;  3RGQ A;  1XXV A;  3D1H A;  3RZ2 A;  1LQF A;  4WOH A;  5KA7 A;  1J4X A;  2B3O A;  2J16 B;  5KA0 A;  2I5X A;  2SHP A;  2OOQ A;  1JLN A;  2NT7 A;  1FPZ A;  2H4V A;  3S3F A;  1U24 A;  3OMH A;  2CM7 A;  1NNY A;  4R0S A;  2F70 A;  2VEX A;  4NWF A;  4NND A;  2VEY A;  2C7S A;  1WCH A;  2QBP A;  4JNB A;  1GWZ A;  4WTY A;  4QBE A;  1JF7 A;  3ZM2 A;  2CFV A;  1OHD A;  5MMZ B;  4GE2 A;  1ZCK A;  1ECV A;  3ZMP A;  1I9S A;  5EHR A;  1U25 A;  1Q6J A;  2B07 A;  4JBC A;  1NWL A;  3NME A;  4ICZ A;  4ZN5 A;  1NO6 A;  1LYV A;  2CNG A;  4WU2 A;  4GS0 A;  2G59 A;  4GRZ A;  4RKK A;  1WRM A;  2I6P A;  2BGE A;  3EMU A;  1LAR A;  4OHE A;  4H1O A;  5LXQ B;  2I6J A;  2P4D A;  3U96 A;  1ONY A;  1PXH A;  3RO1 A;  3V0I A;  3QCB A;  2NZ6 A;  2HB1 A;  2M3V A;  4GE5 A;  5K24 A;  4R30 A;  2HCM A;  2E0T A;  3D1Q A;  4MBB A;  3EZZ A;  3QKQ A;  4OHH A;  2VEW A;  4QUM A;  5GTJ A;  2B4U A;  3OLR A;  2PT0 A;  4QAP A;  3D1O A;  3O4S A;  2ESB A;  2RF6 A;  2B4O A;  3D9C A;  2NV5 A;  4I8N A;  2NTA A;  1G4U S;  4GFU A;  1QZ0 A;  1XRI A;  2F46 A;  3LJ8 A;  1BZH A;  1OEV A;  1I57 A;  2HNP A;  3ZM1 A;  3BM8 A;  1PH0 A;  3O3L A;  2P6X A;  4QBW A;  3SME A;  5KA2 A;  1FPR A;  1YZ4 A;  2JJD A;  4BPC A;  2CNH A;  4OHI A;  1YN9 A;  4WU3 A;  3V0D A;  4GFV A;  4S0G A;  1ONZ A;  5K22 A;  2WGP A;  3ZMQ A;  4D3R A;  3V0J A;  5KA4 A;  4RI5 A;  2R0B A;  2MBC A;  5KA3 A;  2QDP A;  1PA9 A;  2PA5 A;  1G1G A;  1YTW A;  3QCH A;  1NL9 A;  2HNQ A;  3ZV2 A;  1I9T A;  1NZ7 A;  1P15 A;  2QBS A;  4KI9 A;  2ZN7 A;  1T49 A;  1PTY A;  4AZ1 A;  1G1F A;  1XXP A;  3D42 A;  2Y96 A;  4HJQ A;  5K25 A;  4YR8 B;  1YGU A;  2I3R A;  1NWE A;  4Z6B A;  5BUG A;  1L8K A;  2Q47 A;  4JMJ A;  1C88 A;  3PS5 A;  1C85 A;  1V3A A;  3F9B A;  2CM3 A;  3V0G A;  1Q6P A;  4RHG A;  3EB1 A;  4DGP A;  1G7F A;  3MOZ A;  3CM3 A;  1YTS A;  2CNF A;  5KA8 A;  3QKP A;  2HXP A;  2AZR A;  5K9V A;  2HC1 A;  3F41 A;  2CMB A;  1C83 A;  1KAV A;  2CMA A;  1YWF A;  4RH5 A;  2FH7 A;  3RGO A;  1FQ1 A;  2H4G A;  3QCM A;  2GJT A;  3GXG A;  2I6M A;  2I6O A;  1YTN A;  1ZZW A;  3F99 A;  4NX8 A;  1G7G A;  5EHP A;  2QCJ A;  2H04 A;  1GFY A;  2OC3 A;  1Q6M A;  3H2X A; 
#chains in the Genus database with same CATH topology
 2GWO A;  1E8C A;  1Q6T A;  2G6Z A;  3A5K A;  3A5J A;  2QBR A;  2QBQ A;  2HVL A;  4BJO A;  1Q6N A;  2PSZ A;  4DGX A;  3QCL A;  4GWF A;  2UAG A;  3QCC A;  1O5Z A;  1Q1M A;  3EAX A;  2GCB A;  2FJN A;  2Y1O A;  1VHR A;  2QEP A;  2CJZ A;  2WJP A;  1YPT A;  1EEH A;  2H02 A;  3QCE A;  3ZM3 A;  4R0T A;  4CVM A;  1L8G A;  5J8R A;  2Q05 A;  5KAA A;  2B49 A;  1A5Y A;  2NLK A;  5BX1 A;  3I80 A;  2CM8 A;  4PVG A;  2VOS A;  2F6V A;  3F81 A;  5M43 A;  4D3Q A;  2BV5 A;  3V0F A;  2H4K A;  2J16 A;  1PTU A;  4IKC A;  4ZRT A;  4TVV A;  2OUD A;  1Q6S A;  1JBW A;  2F6T A;  4QDI A;  1C86 A;  3SR9 A;  2I1Y A;  1OES A;  1X24 A;  4C12 A;  4GE6 A;  2Y2F A;  4GRY A;  1RXD A;  3QCG A;  4HJP A;  1MKP A;  2I4H A;  3O5X A;  3ZL8 A;  2F00 A;  1GG4 A;  3BLU A;  1PTT A;  2PBN A;  2F6Z A;  2PI7 A;  4YAA A;  2GP0 A;  2I75 A;  2HY3 A;  1T4J A;  1C87 A;  2I3U A;  2VEU A;  5IBS A;  2I6I A;  1WAX A;  5BZZ A;  5KA1 A;  3BRH A;  2YDU A;  2H03 A;  2CMC A;  2AM1 A;  2ZMM A;  3ZM0 A;  1OHC A;  3B7O A;  5AWX A;  5A5E A;  1JBV A;  4QUN A;  3BLT A;  3S4O A;  3M4U A;  2B4P A;  3CWE A;  3AWF A;  4NWG A;  2IMG A;  4Y14 A;  4B04 A;  4ERC A;  3D44 A;  1XBO A;  1ZCL A;  2DXP A;  2JFG A;  2BGD A;  2F6W A;  3QCJ A;  4QF5 A;  5I6V A;  3EU0 A;  1KAK A;  1D5R A;  3MOW A;  1PYN A;  1UAG A;  1BZJ A;  2F6Y A;  3AWE A;  4OHL A;  2AHS A;  3QCK A;  3V0H A;  4BUB A;  5BZX A;  1W7K A;  2HC2 A;  4D3P A;  1QXK A;  1OEM X;  1AAX A;  1OEU A;  1C84 A;  4J51 A;  1YGR A;  2A3K A;  1T48 A;  5KAD A;  2I4E A;  4RH9 A;  1OEO X;  2NT2 A;  4KYR A;  3N0A A;  1P3D A;  2FJM A;  2I4G A;  3HN7 A;  1W78 A;  1G1H A;  4KYQ A;  3O4T A;  3O4U A;  3NRS A;  1XM2 A;  1BZC A;  3S4E A;  2BIJ A;  4ZI4 A;  2GC5 A;  2QDC A;  3S3E A;  2F71 A;  2QCT A;  4NYH A;  1GQQ A;  2XPC A;  1OET A;  2J17 A;  3F9A A;  2CM2 A;  5K23 A;  1G4W R;  3GXH A;  4QAH A;  5KAC A;  3QCZ A;  2BZL A;  2UUO A;  4Y2E A;  2C46 A;  5KAB A;  1R6H A;  2PQ5 A;  1PA1 A;  1YFO A;  1SUG A;  2B4S A;  2OZ5 A;  4OHD A;  5K9W A;  1ZC0 A;  3S3H A;  3QCI A;  3S3K A;  2QDM A;  1RPM A;  2F6F A;  4JMK A;  5KA9 A;  3MMJ A;  3AWG A;  2CNI A;  2Y66 A;  1U26 A;  4RDD A;  1PTV A;  3I36 A;  1E0D A;  5HDE A;  3V0E A;  5IBM A;  4PYH A;  4HRF A;  4H34 A;  2I42 A;  3QCD A;  4RI4 A;  1EEN A;  3QCN A;  1OHE A;  2CNE A;  3I7Z A;  4CVL A;  1EEO A;  2VEV A;  3UAG A;  2A8B A;  1M3G A;  3QCF A;  3RGQ A;  1XXV A;  3N2A A;  3D1H A;  3RZ2 A;  1LQF A;  4WOH A;  4BUC A;  5KA7 A;  1J4X A;  2B3O A;  2J16 B;  5KA0 A;  2I5X A;  2SHP A;  2OOQ A;  1JLN A;  2NT7 A;  1FPZ A;  2H4V A;  4CVK A;  2GCA A;  3S3F A;  2AM2 A;  1U24 A;  3OMH A;  2CM7 A;  1NNY A;  4R0S A;  2F70 A;  2VEX A;  4NWF A;  4NND A;  2VEY A;  2C7S A;  1P31 A;  1WCH A;  2QBP A;  4JNB A;  2VTE A;  1GWZ A;  4WTY A;  4QBE A;  1JF7 A;  3ZM2 A;  2CFV A;  4UAG A;  1OHD A;  5MMZ B;  4GE2 A;  1ZCK A;  1ECV A;  4ZIY A;  3ZMP A;  1I9S A;  2JFH A;  5EHR A;  1U25 A;  1Q6J A;  2B07 A;  4JBC A;  1NWL A;  3NME A;  4ICZ A;  4ZN5 A;  1NO6 A;  1LYV A;  2CNG A;  4WU2 A;  4GS0 A;  2G59 A;  4GRZ A;  1J6U A;  4RKK A;  1WRM A;  2I6P A;  2BGE A;  3EMU A;  1LAR A;  4OHE A;  4H1O A;  5LXQ B;  2I6J A;  2P4D A;  2UUP A;  3U96 A;  1ONY A;  1PXH A;  3RO1 A;  3V0I A;  3QCB A;  3PYZ A;  2NZ6 A;  2HB1 A;  2M3V A;  4GE5 A;  5K24 A;  3LK7 A;  4R30 A;  2HCM A;  2E0T A;  3D1Q A;  4MBB A;  3EZZ A;  3QKQ A;  2GC6 A;  2VEW A;  4OHH A;  4QUM A;  5GTJ A;  3ZM5 A;  2B4U A;  3OLR A;  2PT0 A;  4QAP A;  3D1O A;  3O4S A;  2ESB A;  2RF6 A;  2B4O A;  3D9C A;  2Y67 A;  2NV5 A;  4I8N A;  2NTA A;  1G4U S;  4GFU A;  1QZ0 A;  2X5O A;  1XRI A;  2F46 A;  3LJ8 A;  1BZH A;  1OEV A;  2JFF A;  1I57 A;  2HNP A;  3ZM1 A;  3BM8 A;  1PH0 A;  3O3L A;  2P6X A;  4QBW A;  3SME A;  3MVN A;  5KA2 A;  1FPR A;  1YZ4 A;  2JJD A;  4BPC A;  2CNH A;  4OHI A;  1YN9 A;  4WU3 A;  3ZM6 A;  3V0D A;  4GFV A;  4S0G A;  2VTD A;  1ONZ A;  5K22 A;  2WGP A;  3ZMQ A;  4D3R A;  3V0J A;  5KA4 A;  4RI5 A;  2R0B A;  2MBC A;  5KA3 A;  2QDP A;  1PA9 A;  2PA5 A;  1G1G A;  1YTW A;  3QCH A;  4HV4 A;  1NL9 A;  2HNQ A;  3ZV2 A;  1I9T A;  1NZ7 A;  1P15 A;  2QBS A;  4KI9 A;  2ZN7 A;  1T49 A;  2WTZ A;  1PTY A;  4AZ1 A;  1G1F A;  4C13 A;  1XXP A;  1GQY A;  2Y96 A;  3D42 A;  4HJQ A;  5K25 A;  2Y68 A;  4YR8 B;  1YGU A;  2I3R A;  1NWE A;  4Z6B A;  5BUG A;  1L8K A;  2Q47 A;  4JMJ A;  5A5F A;  1C88 A;  3PS5 A;  1C85 A;  1V3A A;  3F9B A;  2CM3 A;  3V0G A;  1Q6P A;  4RHG A;  3EB1 A;  4DGP A;  1G7F A;  3MOZ A;  3CM3 A;  1YTS A;  2CNF A;  5KA8 A;  2HXP A;  3QKP A;  2AZR A;  5K9V A;  2HC1 A;  3F41 A;  2VOR A;  2CMB A;  1C83 A;  1KAV A;  2CMA A;  1YWF A;  4RH5 A;  2FH7 A;  2XJA A;  1FQ1 A;  2H4G A;  3RGO A;  3QCM A;  2GJT A;  3GXG A;  2I6M A;  2I6O A;  1YTN A;  1ZZW A;  3F99 A;  1FGS A;  4NX8 A;  1G7G A;  5EHP A;  2QCJ A;  2H04 A;  1GFY A;  2OC3 A;  1Q6M A;  3H2X A; 
#chains in the Genus database with same CATH homology
 2GWO A;  1Q6T A;  2G6Z A;  3A5K A;  3A5J A;  2QBR A;  2QBQ A;  2HVL A;  4BJO A;  1Q6N A;  2PSZ A;  4DGX A;  3QCL A;  4GWF A;  3QCC A;  1Q1M A;  3EAX A;  2FJN A;  1VHR A;  2QEP A;  2CJZ A;  1YPT A;  2H02 A;  3QCE A;  3ZM3 A;  4R0T A;  1L8G A;  5J8R A;  2Q05 A;  5KAA A;  2B49 A;  1A5Y A;  2NLK A;  5BX1 A;  3I80 A;  2CM8 A;  4PVG A;  2F6V A;  3F81 A;  5M43 A;  4D3Q A;  2BV5 A;  3V0F A;  2H4K A;  2J16 A;  1PTU A;  4IKC A;  4ZRT A;  4TVV A;  2OUD A;  1Q6S A;  2F6T A;  1C86 A;  3SR9 A;  2I1Y A;  1OES A;  1X24 A;  4GE6 A;  2Y2F A;  4GRY A;  1RXD A;  3QCG A;  4HJP A;  1MKP A;  2I4H A;  3O5X A;  3BLU A;  1PTT A;  2PBN A;  2F6Z A;  2PI7 A;  4YAA A;  2GP0 A;  2I75 A;  2HY3 A;  1T4J A;  1C87 A;  2I3U A;  2VEU A;  5IBS A;  2I6I A;  1WAX A;  5BZZ A;  5KA1 A;  3BRH A;  2YDU A;  2H03 A;  2CMC A;  2ZMM A;  3ZM0 A;  1OHC A;  3B7O A;  5AWX A;  4QUN A;  3BLT A;  3S4O A;  3M4U A;  2B4P A;  3CWE A;  3AWF A;  4NWG A;  2IMG A;  4Y14 A;  4B04 A;  4ERC A;  3D44 A;  1XBO A;  1ZCL A;  2DXP A;  2BGD A;  2F6W A;  3QCJ A;  5I6V A;  3EU0 A;  1KAK A;  1D5R A;  3MOW A;  1PYN A;  1BZJ A;  2F6Y A;  3AWE A;  4OHL A;  2AHS A;  3QCK A;  3V0H A;  5BZX A;  2HC2 A;  4D3P A;  1QXK A;  1OEM X;  1AAX A;  1OEU A;  1C84 A;  4J51 A;  1YGR A;  2A3K A;  1T48 A;  5KAD A;  2I4E A;  4RH9 A;  1OEO X;  2NT2 A;  4KYR A;  3N0A A;  2FJM A;  2I4G A;  1G1H A;  4KYQ A;  3O4T A;  3O4U A;  1XM2 A;  1BZC A;  3S4E A;  2BIJ A;  4ZI4 A;  3S3E A;  2QDC A;  2F71 A;  2QCT A;  4NYH A;  1OET A;  2J17 A;  3F9A A;  2CM2 A;  5K23 A;  1G4W R;  3GXH A;  4QAH A;  5KAC A;  2BZL A;  4Y2E A;  2C46 A;  5KAB A;  1R6H A;  2PQ5 A;  1PA1 A;  1YFO A;  1SUG A;  2B4S A;  2OZ5 A;  4OHD A;  5K9W A;  1ZC0 A;  3S3H A;  3QCI A;  3S3K A;  2QDM A;  1RPM A;  2F6F A;  4JMK A;  5KA9 A;  3MMJ A;  3AWG A;  2CNI A;  1U26 A;  4RDD A;  1PTV A;  3I36 A;  5HDE A;  3V0E A;  5IBM A;  4PYH A;  4HRF A;  4H34 A;  2I42 A;  3QCD A;  4RI4 A;  1EEN A;  3QCN A;  1OHE A;  2CNE A;  3I7Z A;  1EEO A;  2VEV A;  2A8B A;  1M3G A;  3QCF A;  3RGQ A;  1XXV A;  3D1H A;  3RZ2 A;  1LQF A;  4WOH A;  5KA7 A;  1J4X A;  2B3O A;  2J16 B;  5KA0 A;  2I5X A;  2SHP A;  2OOQ A;  1JLN A;  2NT7 A;  1FPZ A;  2H4V A;  3S3F A;  1U24 A;  3OMH A;  2CM7 A;  1NNY A;  4R0S A;  2F70 A;  2VEX A;  4NWF A;  4NND A;  2VEY A;  2C7S A;  1WCH A;  2QBP A;  4JNB A;  1GWZ A;  4WTY A;  4QBE A;  1JF7 A;  3ZM2 A;  2CFV A;  1OHD A;  5MMZ B;  4GE2 A;  1ZCK A;  1ECV A;  3ZMP A;  1I9S A;  5EHR A;  1U25 A;  1Q6J A;  2B07 A;  4JBC A;  1NWL A;  3NME A;  4ICZ A;  4ZN5 A;  1NO6 A;  1LYV A;  2CNG A;  4WU2 A;  4GS0 A;  2G59 A;  4GRZ A;  4RKK A;  1WRM A;  2I6P A;  2BGE A;  3EMU A;  1LAR A;  4OHE A;  4H1O A;  5LXQ B;  2I6J A;  2P4D A;  3U96 A;  1ONY A;  1PXH A;  3RO1 A;  3V0I A;  3QCB A;  2NZ6 A;  2HB1 A;  2M3V A;  4GE5 A;  5K24 A;  4R30 A;  2HCM A;  2E0T A;  3D1Q A;  4MBB A;  3EZZ A;  3QKQ A;  4OHH A;  2VEW A;  4QUM A;  5GTJ A;  2B4U A;  3OLR A;  2PT0 A;  4QAP A;  3D1O A;  3O4S A;  2ESB A;  2RF6 A;  2B4O A;  3D9C A;  2NV5 A;  4I8N A;  2NTA A;  1G4U S;  4GFU A;  1QZ0 A;  1XRI A;  2F46 A;  3LJ8 A;  1BZH A;  1OEV A;  1I57 A;  2HNP A;  3ZM1 A;  3BM8 A;  1PH0 A;  3O3L A;  2P6X A;  4QBW A;  3SME A;  5KA2 A;  1FPR A;  1YZ4 A;  2JJD A;  4BPC A;  2CNH A;  4OHI A;  1YN9 A;  4WU3 A;  3V0D A;  4GFV A;  4S0G A;  1ONZ A;  5K22 A;  2WGP A;  3ZMQ A;  4D3R A;  3V0J A;  5KA4 A;  4RI5 A;  2R0B A;  2MBC A;  5KA3 A;  2QDP A;  1PA9 A;  2PA5 A;  1G1G A;  1YTW A;  3QCH A;  1NL9 A;  2HNQ A;  3ZV2 A;  1I9T A;  1NZ7 A;  1P15 A;  2QBS A;  4KI9 A;  2ZN7 A;  1T49 A;  1PTY A;  4AZ1 A;  1G1F A;  1XXP A;  3D42 A;  2Y96 A;  4HJQ A;  5K25 A;  4YR8 B;  1YGU A;  2I3R A;  1NWE A;  4Z6B A;  5BUG A;  1L8K A;  2Q47 A;  4JMJ A;  1C88 A;  3PS5 A;  1C85 A;  1V3A A;  3F9B A;  2CM3 A;  3V0G A;  1Q6P A;  4RHG A;  3EB1 A;  4DGP A;  1G7F A;  3MOZ A;  3CM3 A;  1YTS A;  2CNF A;  5KA8 A;  3QKP A;  2HXP A;  2AZR A;  5K9V A;  2HC1 A;  3F41 A;  2CMB A;  1C83 A;  1KAV A;  2CMA A;  1YWF A;  4RH5 A;  2FH7 A;  3RGO A;  1FQ1 A;  2H4G A;  3QCM A;  2GJT A;  3GXG A;  2I6M A;  2I6O A;  1YTN A;  1ZZW A;  3F99 A;  4NX8 A;  1G7G A;  5EHP A;  2QCJ A;  2H04 A;  1GFY A;  2OC3 A;  1Q6M A;  3H2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...