2P76A

Crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
267
structure length
267
Chain Sequence
b'QWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTTNGHGKVEDYTLDELKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKHHLLNNNKLKNGHVMIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDLGFIVHPYTVNEKADMLRLNKYGVDGVFTNFADKYKEVIKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
molecule tags Hydrolase
source organism Staphylococcus aureus subsp. aureus
publication title Crystal structure of a Glycerophosphodiester Phosphodiesterase from Staphylococcus aureus
rcsb
total genus 110
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2p76A00
5PTDA 2PZ0A 2OTDA 3MZ2A 3QR1A 4I9JA 3H4WA 4Q6XA 3V1HA 3KS5A 1VD6A 1DJIA 1GYMA 1YDYA 2O55A 1DJGA 2PLCA 1QATA 2P76A 3EA3A 3EA1A 3PTDA 3QR0A 1DJXA 4PTDA 5T91A 4QJ4B 3CH0A 1PTDA 1DJYA 3L12A 2ISDA 4F2BA 3RLHA 4S3GA 3I10A 5T9CE 6PTDA 4RW3A 1DJZA 1O1ZA 1PTGA 3QVQA 3RLGA 3NO3A 4RV3A 3V18A 3V16A 4I90A 1DJWA 4R7OA 2F9RA 4F2TA 1ZCCA 3H4XA 2OR2A 4QJ3B 4RW5A 1AODA 4OECA 2ZKMX 4I8YA 2OOGA 1T8QA 4I9MA 3OHMB 7PTDA 4I9TA 2PTDA 3KS6A 1QASA 1V8EA 5T9BG 1DJHA 3EA2A 4F2UA 4GNKB 4QJ5B 1XX1A 1T6MA 2FJUB
chains in the Genus database with same CATH superfamily
2X41A 2E0PA 2ZWYA 1JGIA 4ATDA 4WX2A 3OZOA 1N7KA 1MQRA 1V3KA 4WY0B 3USZA 1XM3A 2DIKA 4DNMA 1RXOB 2NXHA 2AGKA 3IIVA 1EX5A 4UR8A 4QJ3B 2Z7KA 5KSWA 3U2ZA 4RNJA 3W1PA 1V08A 4O1BA 4H3DA 3URQA 3UYIA 3QOMA 4P5UA 3H2FA 1EWDA 2IPFA 3GVRA 3GXNA 4NZ4A 4NKCA 3KL5A 3WYZA 3FSUA 4RUBA 3RM9A 2OGJA 3U5UA 2YR1A 4ZEPA 1W8GA 5AKQA 5MKGB 3N18A 3WQWA 1D3CA 1AH4A 3AHZA 1OSEA 3TEVA 2JF6A 4E6MA 1Z8AA 2E1WA 3MB9A 3WK0A 2DT3A 3F7JA 4KRTA 2GGHA 3LZ5A 4UFIA 1REQB 3VNMA 1N8IA 1GOIA 1GJUA 4HA4A 2PZNA 1YDOA 1JYXA 2WYSA 5HPCA 1GZ1A 4MJ2A 4MAZA 1JG9A 5C9RA 5HNRA 4YTQA 3L4VA 3LEPA 3QR3A 5HQEA 1MDLA 1OD0A 2VOTA 3VIMA 3LB0A 5HJLA 4KEVA 3RM8A 1A5BA 2QQ6A 3C8NA 5AVHA 3RDKA 1POJA 4S39A 3RX4A 1VFHA 2CPUA 4KBXA 4FNRA 4HQVA 2A1YA 1XWYA 3ZVHB 4DWDA 2VYOA 4FNUA 4ROPA 5FEWA 3HG3A 3W7KA 2ZZ1A 3G1RA 3K5XA 1YE6A 3NQ6A 3E0IA 3PWAA 4P8UA 2GSJA 2X1TA 4JL1A 2WHMA 4ECLA 4NAFB 2L5HA 1UR8A 3WD2A 2VZTA 4I9TA 3ZMRA 5H2ZA 1BWVA 3W7RA 4ZTXA 4PCFA 1QU4A 1UWAA 4CN4A 3WL1A 3WLTA 2BVWA 3E2VA 2RJHA 4RW3A 3TQ0A 2NX3A 4Q4MA 1JNDA 4HU8A 4ZGYA 1V7AA 5AHNA 5AHFA 3RUBL 2X0HA 4IISA 3L4WA 4O28A 1KBBA 3S5SA 3LBOA 2E6DA 1TCMA 3NO1A 5FF0A 1GONA 2DZBA 2ZUNA 1MVYA 2E5BA 2ZTJA 3FYPA 3FEQA 4IXHA 2D24A 3TWBA 4RPPA 3EKGA 4IP4A 2EG8A 4AIEA 1X6NA 1JYWA 4WJ8A 2ZVRA 3JZUA 4KKXA 2VD9A 1N55A 2HE5A 3GY1A 1U30A 4QQ3A 1OIMA 3R58A 4IIBA 5ABFB 5GJNA 1W37A 4IJBA 1ME8A 3ES8A 4AX7A 1C93A 1QK0A 4Y9PA 4XD3A 2PDXA 4M81A 1UR9A 3DGRA 1JCXA 3BLLA 2DZPA 4C6PA 1G9HA 5CLWA 3VUPA 3FGCB 2B31A 4Q8TA 4ZO7A 4C6OA 4J5NA 1WDDA 5FL1A 5LA0A 1KQYA 1W31A 1DJNA 1NEYA 1O4UA 1DYSA 2NX9A 4ZFCA 4GXMA 4JIIX 2OWCA 4D8AA 3W2KA 2OO6A 3VKJA 5IDIA 4FNPA 3OU8A 5DLCA 2A85A 1FWNA 3RIKA 1EP2A 4NZ3A 2R1MA 3PWGA 2Q01A 1BWKA 2CETA 3LCXA 1ZBWA 3KDOA 3F4DA 3WCZA 5ABFA 4CQ9A 2VQUA 4GBUA 4U33A 2AAMA 3UCCA 1EEPA 1QBBA 4AVNA 2A7RA 2VEFA 3BV7A 2YXOA 2ISWA 2YCEA 3EEZA 2Y7GA 4O16A 4GC4A 2CFFA 5H8PA 1T7LA 4NY2A 4K7VA 5FL0A 5M2FX 3NO3A 1EBGA 2W79A 1BKSA 1WYIA 1PE1A 4TTGA 1PCWA 3POCA 3QV7A 2IPGA 5G4EA 1JCMP 4WKAA 3B0VC 2YDQA 4HB7A 1XFBA 4MLJA 4O10A 4S23A 1VJIA 3UVAA 2Y24A 4UOZA 3B8SA 1GYLA 5BOOA 3CJPA 1XRVA 4XZHA 1VFLA 2J7HA 4KFOA 4PTVA 5KINA 2DZAA 4NAFA 4NF7A 3CWHA 2Z28A 4DJDD 4HCLA 2O9OA 3H23A 3QQ1A 4LSBA 2HVMA 4LALA 3MBDA 1XDMA 3LXCA 4BF9A 2HRWA 2Q71A 3NEHA 2PCEA 4DF1A 1A5UA 4Q7BA 3E1F1 3TNBA 4KCUA 4C6DA 1F76A 1L8PA 2GUYA 5CXPA 2BXZA 5I5RA 3QKZA 8RUCA 4O18A 3BH4A 4HJWA 3ZT7A 3UT0A 3MKKA 4GGHA 3T9PA 2XN0A 1PTGA 1ZP4A 1W9VA 3I3EA 3EDDA 4FZIA 4OECA 1P48A 1GQJA 2HJPA 3TOYA 1MDRA 3S6DA 3GD6A 1W5MA 2C15A 1EJUC 1R9XA 1G7VA 3IV3A 3ES7A 3B40A 3ZJ7A 1E9YB 2R1PA 1XHGA 2FMNA 3T6CA 4DO5A 1VEPA 2GDVA 3GC5A 3LCFA 1JFXA 3CGTA 4LYKA 1TUFA 3SI9A 4GWEA 4Z2GA 1FXQA 1TPB1 1J10A 4TU1A 1G4PA 1WV2A 2GJRA 1Q45A 3F1QA 4XUGA 3E12A 3EEGA 1GK8A 1TV7A 4LB3A 4WXYA 2D2GA 2XN2A 2PGEA 4S38A 4QX4A 4AC7C 3OP2A 4JX6A 1P1MA 3VD3A 3P80A 4JN8A 2PU1A 3TMQA 3WQDA 3EDFA 4CVUA 3Q45A 1ITQA 3QHMA 1AH0A 1LQ2A 3A4XA 2YZRA 4F3HA 3UWEA 3FFSA 3W1NA 2XIBA 1THFD 2A4AA 2CWNA 4QE5A 2J62A 4GFIA 4L65A 2G37A 1IQ8A 5HANA 1BSLA 3V0SA 2VQTA 1PZ0A 3GHUA 1U1JA 3MV01 4UTUA 1QHZA 3SRFA 2VX4A 5GPRA 5DBUA 3LXAA 3WBAA 5I2UA 2PWUA 1HGWA 4M7TA 4B3LA 2ISVA 1HXJA 1EYWA 4RPQA 9XIAA 1PTAA 5IXEA 3BLEA 4WXZA 4ZE4A 2WC4A 4RZ4A 1UA7A 4MKSA 3KP0A 4UBPC 1JCNA 1NVMA 1XLDA 1R2TA 1RAKA 4AYSA 1JQXA 2WBGA 1NJJA 1QJWA 4TUFA 3BANA 4IGMA 1TMQA 3RGTA 1GVFA 1Y7VA 3U57A 2VUYA 1QNQA 3MV11 2IKHA 3Q58A 5CLTA 1VYPX 5K3VA 1ZENA 4W7VA 1LTDA 2PBGA 4JYFA 1HF6A 2XH0A 3LRLA 3G1FA 4Z2HA 5LNRA 5D2YA 2XH2A 2F84A 4ZB2A 1BEUA 3B9OA 3KEHA 2PE4A 4R27A 4P8XA 1Q6CA 4D6FA 4NJHA 3P0WA 2E6YA 4DWSB 3IK2A 1XJBA 2VL4A 1P0EA 3GHSA 3BO9A 3IJ7A 1EF2A 2PAJA 4I90A 4Y8EA 1DWJM 1YBQA 2EBNA 1LDCA 4QP0A 2YCLB 2GK1B 4U2ZA 4K1WA 5PTDA 1H41A 3VM7A 1ZQ5A 4B91A 1UB3A 1HQTA 4MY1A 1R3VA 1EX1A 3IV8A 1ELSA 4CNUA 2GWNA 3SCOA 1PTDA 5KZDA 2BY3A 2DIEA 3FW6A 1P6WA 4WKFA 3AIBA 1ONRA 3HGRA 3KLKA 1SO5A 2Q6ZA 4DRSA 2X0YA 4C6LA 3MVTA 4ICMA 2E25A 1FH8A 3A24A 3SSJA 4ICCX 1DVJA 3GNXA 1AQFA 4WF7A 1KBKA 2E67A 4RNFA 2ZXDA 1KFBA 4G1KA 3NPUA 3T55A 2XDFA 3WK1A 2O7QA 3SY5A 3ZYZA 4UNKA 3H2NA 3T8QA 1ITXA 1O1ZA 1BF6A 1A4MA 5BOFA 4GABA 1DXEA 3NQEA 1VFTA 4Y9MA 2QS8A 1WBJA 1SU5A 2VM8A 4PB3A 2E09A 3AWNA 3U5YA 4IP7A 3H7VA 1WKDA 2XYLA 2H8XA 3UA3A 4O15A 4JCMA 4O11A 1ZAIA 3GDRA 3R10A 1UWUA 3CU2A 5DN1A 1W1ZA 2QV5A 3W38A 4GACA 3CUHA 3QFEA 1DORA 3P8JA 4XAGA 2O0TA 1W6TA 2PDJA 3AHTA 3MZNA 4I6KA 2AL2A 1V6YA 4O1CA 3WFZA 1HO4A 4GOAA 3SURA 3OG3A 3EB2A 4AAJA 4MB4A 3PZTA 1BXNA 1XH0A 2J7CA 3VIJA 1K02A 4MMWA 1EYEA 5CQ1A 1XH2A 1HX0A 3CPGA 4FSAA 3KOFA 2NQLA 1W0MA 1GVSA 3CIVA 2VEGA 2XVLA 4GYPA 1R7OA 3CV7A 1JYVA 1E43A 4Q8VA 1BQGA 1XCWA 2DVUA 3GFYA 4DWSC 3PAOA 2WMFA 1F4HA 3OLEA 1AVAA 2A3HA 3W1AA 2DSUA 4WEVX 1OX5A 1B9ZA 4K36A 3O0FA 3QR0A 3DFQA 1UG6A 4JTSA 1OBAA 4S2BA 3LI1A 4IGHA 4AUBA 1V3JA 3HG2A 1YQ2A 1ZHAA 2Y88A 2WPGA 2J9XA 1V6TA 2W27A 4X63A 1V93A 1AZ2A 1WXJA 5JIPA 2Z24A 3PZUA 1YMYA 3TOPA 1R47A 2YDAA 5CC5A 3CHFA 2ACSA 2RHGA 2PGFA 1Z89A 3G6MA 5JBFA 3RITA 3W7LA 4DI9A 3RF9A 1YPFA 4B5NA 3KCOA 3MCOA 2ALRA 2V0TA 3RX2A 3WDQA 4I3GA 2Z2UA 5FF2A 1F05A 3WQVA 2GWGA 3IGUA 2W63A 3WSUA 4QDPA 2E68A 4S3AA 1V7YA 3SFWA 2YW4A 3WNKA 3GG7A 5G2HA 3UJSA 4ERGA 3DG3A 1EOKA 4W4QA 2CLEA 3H4XA 2VC9A 2WJDA 4GY0A 4PCTA 3WDPP 5XINA 4CVWA 2OPJA 1K7XA 2PMQA 1I8JA 1KCLA 3SJ3A 4H19A 3VIOA 1EDTA 4AMCA 1J0JA 1XIMA 1B2YA 8XIAA 1W8SA 4BZYA 1S5MA 2QULA 2WPBA 3ANUA 1UMYA 3FKRA 1S2UA 1VAHA 4RXGA 4XD5A 4FX6M 1XICA 1FWWA 1TVLA 2J6VA 1OCQA 3TNOA 4Q6XA 3W00A 3U4FA 3WLKX 3NL2A 2RDXA 2C0HA 3M1ZA 1GTHA 3NUKA 5LXEA 3VGFA 3Q67A 2OX1A 3REQB 3NXLA 1ENUA 3KOWA 3THAA 2E1DA 3F4VA 3W74A 4AZ6A 4Q8MA 2DSWA 3PK7A 1MO0A 4LV9A 3G3MA 3PZOA 3HPFA 4PSPA 2YIHA 3TC6A 3UR8A 1VR6A 4U4MA 2HCVA 4UQDA 1EL3A 1XLMA 4XKMA 4DUXA 4MZ1A 4GLEA 1YX1A 3ITLA 1FWDC 4XQ6A 3UZXA 3W1TA 4XO7A 3WELA 4M6QA 1BTCA 2ZUMA 3WNNA 1V79A 3R25A 4M19A 4LCSA 4XAFA 4XZBA 3LG3A 4JX4A 1K9EA 4DWSA 3STEA 3BSGA 4MIMA 2F38A 3M0HA 2F6UA 1OY0A 3U9IA 4PTMA 1O95A 1TPWA 5C9ZA 5A6BA 3A4JA 4IIEA 2W6RA 4C1NB 1H7PA 3CQIA 4PEEA 2R14A 5FEXA 2BXYA 1HL9A 3LHTA 3ARVA 3P84A 1E4LA 3WBWA 3FKKA 4PMDA 4LUYA 3HN3A 3OB8A 1LWHA 4WZHA 1XKYA 3F2BA 1PDZA 3NYZA 2I57A 2OVLA 3FDGA 4LVDA 1TWWA 4DJEC 2V82A 4DZAA 5LKYA 2WJEA 1XYLA 3G22A 3A23A 5LNVA 4EX4A 4LFYA 5AYZA 4PMUA 2A3EA 2NXGA 1DBTA 1DKWA 1V8EA 3PTKA 4CU6A 1M68A 4M82A 1PHWA 1T8XA 3GC2A 2POTA 3HV9A 4NJIA 3ERPA 1PIGA 5I78A 4KWOA 2QXWA 4LS2A 1S5WA 3RX3A 1FRBA 4OBTA 2X1SA 4Z2JA 1LL7A 3PS7A 4BI6A 1OF6A 1RK6A 2FGBA 3TU9A 1VQTA 3NTYA 3CV2A 4TX9A 3IUDA 1E1EA 3TQKA 2PTWA 1EC9A 3JUGA 3TN6A 4IICA 3AHVA 5CZJA 1WXZA 2V9DA 2YBTA 3ZQ9A 2PDYA 3BXWA 4C6BA 1C7TA 2OWWA 3LBMA 3QQ0A 4LOCA 3POHA 3FS2A 3D6NA 1XLJA 4WCJA 5HWMA 3EXTA 2NLYA 2EGZA 4PMXA 3ZSSA 1V02E 1LJYA 4JR5A 5TF0A 4H7ZA 5BW6A 1HL8A 1IWBA 4UFKA 1S38A 4D8ZA 4C7DA 4YTSA 2WZTA 2QCDB 3QFWA 3OVRA 2YLAA 2EPNA 4O13A 1TR9A 1WUEA 4UB9A 4JTEA 6REQB 4G56A 2OTDA 1P0KA 1U33A 1Z6KA 5CAKA 4W5UA 4F2BA 1Q2SA 2CWXA 3UG8A 1DIKA 1CLKA 2O4MA 1O5RA 4XK2A 4BI7A 1AA1B 1RVKA 1ISYA 4QR6A 3GKAA 3H2EA 4O53A 1GWJA 2OZTA 1CNVA 1UIPA 4UTIA 2J24A 4Z0JA 2CNCA 1YIXA 3OIXA 5I3DA 7REQB 4AZ7A 1DWAM 3DX5A 2QJNA 5FAGA 1UD5A 2VR5A 3UR7A 3UERA 3T78A 2KX9A 4ZQMA 2XFYA 2Z4GA 2X30A 5FEZA 1JL8A 4ONVA 1RVGA 3P67A 4DBWA 2HS8A 3THCA 3UEQA 2ISFA 1JDDA 4H9YA 2EPOA 3PR2A 3BAKA 4FOJA 3N9SA 1UH3A 4JTIA 1FDZA 2AL2B 3WLRA 1VBGA 1V0LA 2YXXA 3GTFA 1TJRA 3E2RA 1QFEA 2OSWA 4H9VA 4TTUA 4YMZA 2PZ0A 2XSXA 2DJXA 3NPXA 4JD4A 1XBYA 1C92A 1OB0A 4QG9A 1FWBC 3AIWA 5A6LA 2JBMA 4IXXA 4CCDA 1JFHA 4E2OA 3SM0A 4IMFA 5LIXX 2ZRXA 1UUMA 1TTPA 2VRKA 3EA2A 3W27A 3LCWA 1BVZA 1JUBA 2ZA2A 2Z1XA 1R30A 4UTKA 3ARZA 4JDBA 3MMTA 5F1VA 4AWSA 2FLIA 1XRSA 4A3RA 3GW3A 2BXVA 1KXQA 5BROA 3N6HA 3GVGA 4M7SA 3O3RA 5GJMA 5I3IA 4RE4A 1KKRA 3R0DA 4DEFA 4AD4A 4E8CA 3MS8A 3M0VA 3V35A 1BF2A 3EKZA 1XIFA 2XFFA 1GTEA 3O8AA 1OJXA 1LYXA 2WKGA 4QBXA 1JUKA 3ARPA 2HVNA 5BXRA 3ZLFA 1LRQA 1XINA 1B1YA 1QPRA 1H1ZA 4Z1YA 1VBRA 2VX6A 4J2PA 2AQWA 4LAUA 2WKLA 4GUGA 3BMVA 4KIRA 1B54A 1E9ZB 3UW6A 1UD2A 2VC7A 2DSZA 4WGHA 3AJXA 3T2OA 1TWDA 4JYDA 2PDNA 4DAFA 1JPHA 4N4PA 2R1NA 2QUMA 1E6ZA 1V02A 4ASTA 3AMCA 2OLHA 3QSRA 4AEEA 3QF0A 2ASHA 5FF4A 5F1UA 1E0XA 4LY8A 1GQIA 1NQKA 1S2CA 3ITOA 3MBFA 3LD5A 3VX0A 5JH1A 4UIOA 2FYMA 3EGJA 1J6OA 3A3WA 4H6QA 3R8RA 5CBJA 3HQPA 2BVYA 1JULA 2J74A 2V5JA 3MDWA 1Q6OA 1XDLA 4B15A 3S1GA 4B5VA 4MGGA 4M6VA 1KXVA 1FWSA 4NJJA 1X1NA 3GU9A 1T8QA 3WQCA 4TIMA 5CG0A 1VJZA 5BWAA 2HPMA 1QOQA 3T0DA 5DRCA 3NZQA 1MXSA 4AIUA 2VCCA 1FKXA 3FHQA 1YDNA 3GH4A 5D05A 2NSXA 3FA4A 4OT7A 1XQKA 3NZGA 4IFKA 2ZZ3A 4AZCB 4AZ5A 1K03A 1TV8A 3WDHA 2F8QA 1E3ZA 4XZMX 1EC8A 5BMWA 4ERIA 1NWTA 5MHBA 3QPYA 3VKDA 3KBVA 1JI2A 3VMPA 5FJPA 4W85A 1XUZA 3KVJA 1S3TC 2PURA 2PSNA 1FWRA 3WFAA 3F4CA 4YU1A 3BLFA 3BLKA 4X3ZA 4LS1A 1DWHM 5C0QA 5I00A 4OOUA 3ZXWA 5D8WA 1VP5A 4IP5A 1EA0A 4UTFA 3B8WA 4H9MA 2E4TA 1CYGA 3O6DA 3IGSA 2QCEA 3QC3A 4CU8A 1GZJA 3GB6A 5HOSA 4LVAA 2EAWA 5CEWA 3OLGA 1A5OC 4B4FA 4F79A 4HZ6A 3K1GA 4P2VA 1VPQA 3WL0A 1SZFA 3EMZA 3WDIA 1UD8A 1PUDA 2IXUA 3TN4A 4UQ9A 3H2MA 4LRTA 2GVGA 4MHBA 4WRHA 1FCQA 3PTQA 1ZJAA 5LA2A 1W3NA 2FPYA 3PTMA 4DF0A 4FXSA 4O8RA 4AY7A 4UOQA 2YX0A 3AYTA 4IPLA 4AU0A 2OT0A 3WBXA 3M07A 2WO5A 3SCVA 4RE3A 3RCMA 1JEZA 3NDOA 3L23A 1R2RA 2QYGA 4C5ZA 1XCFA 5HK4A 3OIHA 4FALA 4AD1A 1I0DA 6XIMA 1F8IA 2ZZ7A 3E96A 2FVLA 1UA3A 4LT9A 5K2ZA 1CXKA 2ZICA 3MP3A 2FZNA 4YCOA 1XBVA 4L4OA 1ZJHA 3BTNA 3MJYA 3WF4A 1OK4A 4P8WA 3VOHA 2ZADA 4Q8OA 4ZQNA 4LJ3A 4EXBA 3CQHA 3HF3A 2FPTA 3A12A 1NFGA 3ITTA 4RDYA 1VIWA 4FLQA 1KM5A 2BVDA 3G5EA 4YYCA 1SW3A 3HFYA 4G6CA 3E6EA 4ZOCA 1IT7A 4KGLA 1T96A 1YTKA 5I07A 4ZOEA 1DJYA 4JTRA 4BQ3A 3CL7A 4XZIA 4L56A 1YNYA 4NU7A 3L5AA 1GNXA 4FNQA 4FF7A 3U2OA 1XLKA 4FEZA 4L64A 4ZBCA 3W28A 2EEXA 1RV8A 1TJ2A 4M80A 4RDZA 4Y96A 2YB1A 4ATLA 4ALDA 3UWVA 2INEA 1YHTA 1WBHA 4REQB 4MNMA 1VC4A 4KWVA 3DHUA 4MWAA 4JQ1A 2GQ9A 5AYYA 2NUWA 1E6NA 1BGGA 2X0SA 2EQDA 4DUVA 3PB2A 1FH9A 1QXLA 5GNZA 5D8ZA 2NXIA 1V5XA 3ELFA 3TAKA 5DFAA 1MQPA 3QSTA 7CGTA 1KW1A 3KL3A 4FXFA 5CGTA 2A3BA 3GU2A 3C3UA 4IMEA 3MYOA 2PLCA 1UJPA 3N73A 1XI3A 3VNYA 5T8GA 2FQIA 2DORA 2OKTA 3UXAA 6TIMA 4JTFA 3TW6A 3M6YA 4MY8A 3D5HA 1V6UA 2D22A 3GH5A 3LENA 3RPTA 2C7FA 2DT2A 3NR0A 1TV3A 2DEPA 4V1XA 2PDFA 3QQWA 5EGRA 3VINA 2QJIA 3BAWA 4J3TA 4JL2A 1Q6DA 1XPGA 2W3ZA 2BY2A 1TFVA 3TK7A 4A3UA 3MI6A 2BSLA 1D8WA 4W5ZA 2YCJA 2QAPA 1L8NA 3OLDA 5DMYA 3XIMA 5H8UA 1J79A 4XIMA 5D33A 4C6IA 1SMDA 2WZMA 2RFGA 5FAJA 3S5NA 1KFCA 3CTTA 5HUOA 3GHTA 3UZJA 4MZ8A 1ITCA 4O54A 3WX7A 5DMLA 1CX9A 5IBXA 3QYSA 4JIRA 6ALDA 3OBAA 2FTYA 4ZODA 4G7FA 3UR2A 1BKHA 3VFLA 3G24A 4HMEA 4W7UA 3T05A 3B9EA 2Z1BA 4BA0A 3DC0A 3ALGA 3IACA 4HTBA 1W2PA 1XLCA 1KFLA 1M03A 3KUMA 1JCLA 5CC3A 2QVNA 1PZ3A 4IFOA 1VFUA 3QN3A 3FAXA 5HMFA 1BVNP 3T40A 5D09A 3C2RA 4G2DA 1LORA 3WIJA 4BEUA 3LS9A 1PKMA 2YFNA 5D2VA 4U31A 1M1BA 2PDPA 3SIMA 1LUCB 3BW4A 4JNYA 2UV8G 4S3FA 1R9YA 3TYCA 2WMHA 1UWIA 3KS5A 4AC1X 3K8LA 3DERA 3OZYA 3EX6A 4JIPA 3WQGA 4J1OA 5EFDA 4R33A 5DO8A 3E0LA 2WMIB 4N02A 3B0PA 3PNZA 5LIYX 2FH8A 2GQ8A 3W88A 3PJTA 1Z3NA 6REQA 1DXIA 3MMWA 3WEMA 2J6XA 1MSSA 1NM9A 1ONXA 1T6MA 4UQEA 1LM1A 3S2MA 3EOEA 1IEIA 3CZLA 3H54A 1AL8A 1PKNA 2B7QA 1R3TA 3KLLA 1DJGA 1MRAA 4CD5A 4W7WA 3LX9A 1CTNA 2IQTA 2XIMA 1M6JA 3TTEA 1KM4A 1X1OA 2GJLA 4MKVA 4GIAA 1HJQA 2QNEA 4HA3A 4LNCA 3KRSA 3VCRA 3NEVA 1VBUA 1NSJA 4NI3A 3TSMA 1L6FA 5FD0A 3DOPA 3IVUA 2BGSA 1KR0A 4H6EA 1NAL1 4HVXA 4YN5A 4TXEA 3NQCA 2NWSA 4MSSA 4GISA 2KAUC 1WKYA 1H7NA 4GI9A 4I8YA 1EF3A 1JF6A 3DYOA 1C9DA 1DTUA 1AD4A 1YPIA 1YE4A 2J75A 3OG2A 1HVXA 4DXKA 3UY7A 1FWFC 3G1YA 4PUKA 2XSBA 3W2LA 3KOZA 3NZPA 3S42A 1XYBA 3MSRA 3CWOX 2ZXQA 3W7QA 2ZA1A 1HJSA 2D2OA 1GVYA 3NOEA 3I3DA 4PTNA 3V5CA 2QW5A 1RY0A 1YDYA 4PN2A 3NPWA 1DQXA 3VUSA 3V0TA 1FHLA 2VI0A 3IJQA 1EJWC 3TXZA 5ABTA 1KXTA 2JIWA 1UR3M 3RJXA 1VFMA 1NY1A 4MB3A 2W5FA 2QCNA 3VGGA 3GZAA 3TQVA 3N2BA 4D6EA 3QHOA 1JGMA 2CXEA 2FDMA 5BXSA 3LM3A 4GYFA 2WW5A 3G1DA 3V75A 1WOBA 3N9KA 2WSRA 1PXGA 2ISDA 1BFNA 4G9PA 5DQPA 4W86A 1FFRA 3B0YA 2G3JA 4EPDC 1OQFA 2JIEA 2PF8A 4DAIA 2GZXA 1KFJA 1P1XA 1S5TA 4N42A 2DY3A 1QR7A 1M41A 4H8VA 4NZ1A 2PDWA 1C8XA 3RLGA 4KRZA 3EWWA 3N11A 3U6WA 2BB0A 1AUSL 3ZJKA 4IUGA 1OADA 3CK5A 3P82A 1VEOA 3W71A 3TJIA 2BZNA 4A8IA 1I1XA 2CLKA 4CQDA 3RLHA 3BAJA 2PWDA 3MUAA 5CPMA 1JZ7A 2A21A 4YTRA 4XAZA 2YOCA 2ZZ2A 2VGIA 1W32A 3UNDA 2WSPA 4DLFA 4D8LA 3G0SA 5A2AA 1EP3A 4HTYA 1JIBA 3MU7A 4HK7A 4C60A 4M6UA 1H62A 4WIWA 3UXKA 2XWEA 3AI0A 2F61A 3SBFA 1CLVA 4H83A 4JZ5A 3NQAA 1D3GA 1X7IA 4J3XA 3ZJ8A 1GOKA 1M3UA 4YL2A 1LRNA 4W84A 2ZCGA 1KNWA 4H01A 2ZUSA 4LX4A 4W88A 5TAOA 3WDRA 1UUOA 3ZIZA 3I10A 4S2CA 2E5CA 1BLIA 1W1PA 3SY1A 3VMNA 1VHCA 1OK6A 5HA7A 2GGEA 4AWUA 2BOEX 2Y0FA 3NAVA 1FDYA 1EXPA 3C2EA 4F2UA 2NLIA 1J18A 4UUIA 2Z29A 4HSOA 2VR4A 1SSGA 2EPKX 4H9TA 1SZGA 1S39A 5AN7A 4R9XA 3FJNA 2WVVA 3SIZA 4LVFA 3A3XA 1PDYA 1BVWA 2CZFA 2PWVA 1NTHA 1GPFA 3FNDA 1WCGA 3WH6A 3TQPA 3N19B 3LQLA 1C8QA 3R1ZA 2CZEA 5D38A 3H24A 4FOUA 4OWGA 3KVKA 4IPJA 2QUNA 2YYTA 3NQ7A 3DYPA 2OG9A 3W02A 2J4GA 1OYBA 1DIDA 2CIPA 4OUIA 2J78A 4JYEA 3GG1A 1UWTA 1LT8A 5FIPA 4NZFA 1QWGA 5F7UA 4J4KA 5E0KA 3MWCA 3L0GA 4D1IA 1JQVA 1PCKA 1W5NA 4HOWA 3I65A 3WNPA 4ADSA 1M5WA 5JUVA 2P53A 1P5BA 2PODA 3TX9A 4Q33A 2VFHA 3CUIA 4PE8A 1QI4A 4GHRA 3STCA 1W2VA 4AD5A 1I2OA 4CNOA 3NG3A 1TKKA 3UWYA 2ZUVA 4OV9A 3T8LA 1F3XA 1I0BA 5EFFA 1LUCA 5AECA 1E0UA 2PLKA 2XM1A 1EO5A 2AQOA 1F3WA 3NL3A 3DFPA 3S2CA 3ZZ1A 3TYUA 3MYPA 5HBFA 3KDNA 3G0XA 4P7LA 2Q02A 3D46A 1EP1A 2XZ9A 1KGWA 4AIOA 5BZAA 1M7JA 4QISA 4G7EA 5CPQA 4HU4A 5J04A 3U7VA 3EOSA 3B4YA 1B31A 5I77A 3W53A 1LP6A 2W66A 4C1KA 1YNPA 3B03A 3VGBA 2CEQA 4Y6GA 2D1ZA 3DU0A 3BV4A 1KM3A 1A0EA 2ACRA 4ADUA 2X09A 4WR3A 1MXDA 4MDOA 3DENA 4MFEA 1E1CA 5HPOA 3STFA 3PZQA 2QR6A 4AB4A 1TV5A 1KCXA 4C7FA 4GVHA 2CW6A 4A05A 4YYFA 3GC4A 4UWMA 4S3EA 5JVLA 3S5YA 3DYMA 4MOZA 1W5OA 4DX3A 6A3HA 3QV6A 5I3GA 3ZFHA 2VVNA 4V33A 3DFYA 4FR1A 5ABHA 2V68A 3N6QA 3OVQA 1XYAA 5LGZA 3G3DA 2TSYA 1MUCA 2PWEA 3QHNA 3W81A 4QCEA 3K4DA 1JRBA 1TREA 2QAFA 3BSMA 1H09A 4HA1A 1TV2A 4HHLA 5CC6A 4ORMA 2B7OA 1A3XA 3MUZ1 1NFPA 2P50A 4HU0A 3CPUA 4L80A 1VCVA 3RG6A 1E6QM 3RR1A 1NP0A 3WJSA 1IEXA 5A6BD 1O7AA 1WDPA 4J3UA 5GVJA 4KETA 3RK8A 3TZNA 3DKJA 3FIGA 3S1XA 2QDDA 2YL8A 4V27A 2AMXA 4FR6A 5AZ0A 1LWIA 3MUIA 3HPAA 3IVTA 4LEFA 2VXNA 4HZ7A 4FXRA 2VEKA 1UD4A 4PODA 4REQA 3VOIA 1US2A 3AISA 4QS6A 1ZSXA 3U2CA 4NQ1A 2NV9A 4HJFA 3REQA 1KV8A 4HHPA 3B0UX 1KCKA 5LZLA 2PDBA 2NW0A 1LWJA 1LOSA 2WCAA 1TIWA 1H0IA 2ISSA 3MWAA 5JIWA 4J28A 2WCGA 4RV8A 1KKOA 1I45A 1LCOA 2DJLA 1GKQA 5H8MA 3T0BA 1EEXA 2UY5A 2WM0A 4CCZA 2WJFA 4HSHA 2QCHA 4AW7A 2BHUA 4GG9A 3HG4A 2QDEA 3LDVA 2FVMA 3QGKC 1BPLB 3HPSA 3BAYA 2Y5EA 1NOFA 3MC5A 2J66A 1XR2A 1IEQA 1F73A 3W3OA 3VD7A 4KEMA 1F07A 5KETA 2P8BA 3VU2A 3RO8A 9RUBA 3NCOA 4J35A 3C2VA 3UF9A 5BU6A 3EMQA 2J8GA 4GIEA 8A3HA 6TAAA 3AMDA 2NSOA 3W7PA 2AKZA 2ZDRA 4HK6A 4M0XA 5SWUA 3NL6A 4N4QA 1VPYA 2Y89A 3GU1A 4JTJA 2XZ7A 5CZTA 4DUWA 4GCAA 1EPVA 3SGUA 1HKMA 1R6WA 4OIFA 3OZPA 4QDMA 4MWAC 4HNLA 1TX0A 3GNNA 1RUSA 1ZS2A 4M51A 2FFCA 3AHXA 1V3LA 3A9IA 1UKTA 2Z7GA 2QZRA 2OZ8A 4X9YA 1OVDA 2YBVA 3HB9A 3QMSA 4WUIA 1FHUA 1UASA 4UXDA 2E28A 3A9BA 3N4AA 2PFHA 1VH7A 2NVCA 4DJFD 3S3GA 3U2EA 3NXFA 2IMRA 5A6JA 1ECQA 4BF5A 1E0WA 3EX1A 1DP0A 2WSKA 3C4UA 3K2GA 1X97A 4LF1A 5HNNA 3VNDA 2VD8A 2IPWA 1D3HA 3CAVA 3VNIA 3W29A 3KS6A 1VGAA 4K8HA 1EUAA 1JXJA 3L5LA 2J9YA 2Y7DA 5AYIA 1KLZA 4NG3A 3SN4A 1WZAA 2A7NA 3RFAA 1XDJA 4JOMA 3EXSA 3M6DA 2Q3OA 1FQ0A 3GG0A 2YXGA 1LG2A 1JXKA 3GWQA 1UP0A 1ODUA 1W9UA 4DNHA 4CD8A 4U10A 1LRTA 4AH7A 4RE2A 1DJWA 2F2HA 2P3ZA 5GJPA 5EMJA 3BGGA 3VA8A 3OEXA 3VZYA 1K77A 3FVDA 2HPIA 2GJNA 2GGIA 3Q65A 4R3UA 2YDRA 2NQJA 5HINA 4GVGA 3SQMA 3LGGA 3NWRA 1OCNA 4CEXC 1XYMA 3P3BA 2WNWA 2DUZA 2XVGA 3BW2A 2VRJA 1QW7A 3GVQA 2VWSA 5CH9A 4DJDC 3F4WA 5IHSA 4MADA 1MNZA 3N2OA 4GQQA 3WEOA 4GIYA 2BX7A 2QCDA 2W92A 1Q4NX 4IF2A 4L6OA 1ZBCA 1XG3A 1LL4A 4MAVA 3OW1A 4BQ4A 4ZMGA 4EP8C 5AC7A 3AS3A 1W3JA 2DGAA 3DHDA 5AC6A 3PPCA 1GQNA 3E9AA 4KQNA 1Q6LA 2QMJA 4WJEA 4IX2A 2DW6A 3T0TA 1O94A 4D6IA 4DPPA 4RNIA 3C2FA 4U28A 4HOZA 2C71A 4PMNA 5A5WA 3BC9A 4PUWA 5C9UA 1O68A 5E9AA 4GFSA 2FB2A 1G01A 2QPSA 3HIJA 1GOOA 5BWFA 3PPGA 1SVDA 2C1GA 4PUNA 1Q8JA 4HSNA 3PPHA 4QIUA 4EF8A 1KD0A 3WMLA 1IHIA 4XB3A 2QUTA 3DG6A 2GJPA 1Q7ZA 4XO6A 4IIDA 3H7UA 1PZ2A 3A22A 4BJHA 1W56A 3CYVA 2WK2A 3E38A 5I3KA 4O1FA 1ZAHA 2QPUA 2QMKA 3HGOA 1EO7A 4CLMA 1CGXA 2VWTA 3QEZA 4GE8A 9CGTA 1DOSA 3I7RA 1MEWA 2EPLX 2TAAA 2G3MA 3UFYA 3M43A 1AH3A 3LLDA 4W89A 3H55A 3QOKA 1CXIA 3OO2A 3CASA 1WDRA 4JPGA 2R91A 4O0KA 3NM3A 4LUSB 1UR1A 4AHQA 1GQKA 1NDVA 2B4GA 1OFQA 2PRMA 3SCRA 1Q6RA 3D3FA 4BQ2A 5A2CA 1B30A 3R8GA 2PBOA 3H2CA 4EKJA 2Y7FA 3UBPC 4ES4A 3WF1A 1FKWA 2GK1A 3HMCA 3VIHA 4MJ4A 1YBQB 3ABRA 5FJTA 3HA1A 1U1UA 3FJLA 3N15A 5TD4A 1KR1A 1XKJA 3PPFA 1GCYA 4IQLA 4FNTA 1KRMA 2I5QA 4MG4A 5FCZA 5K9XA 3NIYA 2H9AB 3ZM8A 1DTNA 1W9PA 4MDPA 4HYVA 1JZ5A 7TIMA 2IW0A 1BHGA 4JTKA 5BMXA 3MT1A 5CPNA 3WKZA 3WNLA 1G0CA 1IF2A 4DPQA 4NZCA 3PG8A 2HWGA 3UNTA 3KAOA 3UJFA 1OC7A 1P6CA 4C6FA 3NVTA 1V51A 4DF2A 3ZR5A 3EWBX 1RLDA 3KHDA 4F0MA 1TE6A 1HN1A 4ATWA 3VZZA 2NQ5A 4EXQA 2CHOA 4IPIA 1HP5A 2V5CA 4JEQA 4WQ6A 3F2CA 4UTTA 3F03K 3GX9A 4A6GA 1OABA 1TZZA 2Z6JA 1LF1A 3C0LA 3S9IA 3AIRA 3GVWA 3GM8A 3CO4A 4DZHA 3GG8A 5I6SA 1NWSA 3URBA 3FJ6A 4UQCA 2XTKA 4JTDA 3RCNA 3MW7A 1UC5A 1Q6FA 3GDKA 3H70A 2VGBA 4MJMA 1XGEA 3S6OA 2QVHA 4UR7A 4XBJA 3AC0A 3KBMA 2Y70A 2YPIA 4QS5A 4AQLA 4HZMA 1TJ1A 1QTWA 4FA3A 3VD4A 2GDUA 3APGA 4KGJA 4GX9A 4PBGA 4B2DD 1LZOA 3WQ8A 4RR4A 3NQDA 3TV8A 1EQPA 4RXFA 3NGFA 2BFGA 2D0HA 3W82A 5KMYA 1TX2A 2Y8KA 1ZY9A 3RYSA 4OVXA 2EPHA 5REQA 1WAUA 4CCEA 2NX1A 1U83A 3IUHA 3NQFA 1QNPA 1TTIA 5D2TA 3V18A 4DVOA 1Z48A 4JKLA 4LGXA 1TCDA 1UH2A 2J7BA 3GVVA 3SUVA 4EPBC 5D2WA 4PGLA 4C5YA 1FWTA 2X7WA 3KZPA 1ZL1A 4Q4PA 1XLIA 4RZBA 5K4XA 1E71M 3TTSA 4IPNB 3WLPA 1Q2RA 4ZL1A 2XG9A 3LCGA 2CC0A 1WNOA 4N0RA 3F4NA 5KZMA 1OFBA 4Q7IA 1SJCA 2TPSA 4Q32A 1J0IA 4CU7A 2FFIA 1JDCA 1PL9A 3UWUA 4WY0A 3THUA 1SFSA 1G67A 2ZRYA 1LQ0A 1XCXA 4B5WA 4JFTA 1JAKA 3IANA 2PGRA 4ZVJA 3AICA 1YEYA 3QMRA 2PUZA 5CSYA 3JZEA 4H1ZA 1UZDA 4NVTA 4PUUA 2VZUA 3GHRA 4AEOA 2A6LA 1JCTA 1VPXA 2X05A 2V3FA 4ZQCA 3S8HA 1KTBA 2FZ9A 3TC7A 4AZGA 1G5AA 4MPKA 4QJ4B 3QM3A 4JTHA 1PWMA 1F3EA 1ALDA 1K3UA 4A2SA 1MEHA 1XG4A 4U2YA 4UOJA 3W2MA 3UGRA 2I16A 5C55A 1R8LA 4WGXA 3QZAA 3GFXA 2OZ0A 4FIQA 2YYUA 2O7SA 4XZWA 1MNSA 4FS9A 1B4KA 4LH8A 3R4IA 4F2TA 1QW9A 2VJXA 2YSWA 4WOZA 1TJPA 2VFDA 2D2HA 4O50A 4BCEA 4LV4A 3J7HA 4B16A 1O12A 2VOMA 3C0SA 3UESA 1WE5A 2VURA 1CT5A 4ERAA 3NFUA 2CXGA 3NL5A 1XF0A 3NZ1A 1XS2A 4H9XA 4PMVA 8TIMA 1R87A 4HD5A 3F5JA 3KOYA 2VCBA 3CHEA 3V0UA 3SCUA 3JS3A 4HBKA 4Q22A 1L2QA 3M5VA 4LCQA 1HJXA 1C8YA 4LB4A 4TV6A 3A6OA 3DAQA 3R12A 4LU0A 4W8LA 2EHHA 1UC4A 3TW9A 3WJXA 4AHOA 1OX6A 5D9NA 3MVIA 3VOJA 1HKKA 3AZSA 4GUIA 4AEFA 5FJRA 2CKRA 3RU8X 1H0GA 4M3PA 2WXDM 1JJKA 4JGDA 3WF3A 4KERA 1J5SA 3OGVA 3VGHA 2OYKA 4PR4A 3V7PA 4RKAA 3W2JA 3MUXA 4IMCA 3V5FA 5AHMA 2IUZA 2I9UA 1UROA 4AY1A 2QKFA 3HO8A 4C91A 1TV4A 2VC6A 2JKPA 4Q7NA 3SGZA 4HMNA 5L9FA 4XBSA 4DELA 1XIBA 2GOKA 4M5PA 3LYEA 1G4EA 3BOXA 3N4FA 1TWZA 4JY8A 3S5ZA 4JNZA 3K30A 2PDUA 3TJ4A 3MUCA 3AXIA 3H7RA 4RDWA 3PP7A 2DZUA 1NDWA 1ZALA 3EYPA 4UQAA 4TVDA 5CGMA 2Y61A 4UZUA 4XISA 3WO8A 1TUXA 3CH9A 2C1HA 2E8ZA 1HNYA 2VEPA 1IZKA 5E70A 2VDGA 3M0YA 1A5NC 2J27A 3CT2A 3W7GA 1H5VA 3CUZA 3WUBA 3BPWA 3O9NA 1W1IE 5C5YA 2WANA 1AJ2A 1EHAA 3M5YA 1E9IA 2FIQA 3L4XA 3DH7A 2PDQA 4P7NA 1FWEC 1U1HA 3CQKA 1CB2A 4XVEA 4DBUA 4TOQA 4ZCWA 1A3WA 3C86A 2ZOXA 3FXGA 1ZUAX 5BRBA 2XU2A 2W0UA 3M5ZA 1AW2A 4I7WA 3L0NA 4QDWA 4E0CA 2XVKA 4JIHA 3R5EA 4GBDA 1DJIA 4HGXA 4INFA 4QGCA 3BOLA 1UPMB 5D37A 4EWJA 3EXRA 3GNOA 3NZRA 3CUGA 2F6KA 1MW3A 2O92A 3VOGA 5E5CA 1E56A 3IIZA 3ITXA 4NXKA 2DV0A 3OGRA 4IG2A 3PJUA 1UHVA 4LAMA 1VLIA 3C2YA 1NDYA 5A6KA 1BYBA 1MYRA 1UOZA 3LTSA 4M1BA 1KWGA 1HKJA 3FA5A 3R13A 3PZVA 1UKSA 1TPDA 4R7OA 2GL5A 3VFCA 4GK8A 4H8NA 4QNWA 2ZZ6A 1BYDA 1MUWA 2GYIA 3TSBA 3LNPA 3OA3A 2FDSA 2J77A 4L1XA 2OYMA 3UGVA 4YWSA 4XSMA 3DZ1A 2FZDA 4X9SA 1PKYA 5DCDA 4AVOA 6PTDA 2PRLA 3S0CA 2ZKMX 3QKEA 3CL8A 1ME9A 2FZMA 3H53A 3KXQA 2XFWA 3LTPA 5M17A 4GZJA 1PIIA 1VYRA 1N2VA 2XGBA 5E93A 3D0CA 3O7UA 3F5KA 4QG6A 3IARA 3VNZA 3RM4A 4KFPA 3LM7A 3SCSA 1WDQA 3T0AA 2JE8A 5HR6A 4P8VA 1D2KA 1QDSA 1TWSA 1P7TB 2FKPA 1VHNA 3GXIA 3CEPA 2PWGA 4FPSA 1QATA 1W3LA 4YLWA 2V3GA 2VO5A 3EWXA 3NOYA 3WG6A 2PRHA 1DIEA 3A4AA 5G2IA 1QWKA 3U4AA 3APYA 5AHLA 3W76A 1IT0A 3RILA 2BV9A 3NJ3A 5LYRA 3SRDA 2I56A 3UYCA 1XQLA 4GUFA 1HVQA 4OGZA 3W1XA 4WSKA 4UTHA 3QY6A 4UTWC 4PMQA 3PY2A 4Y9AA 1QAPA 3RHGA 1B5TA 3CQ0A 1ZU8A 5CBIA 4GO8A 3BCFA 4L5ZA 4WDUA 3K8KA 2VFIA 3M7SA 2WBKA 2Y5SA 5A8MA 1E3XA 3CB3A 3UVIA 1B4EA 2EG7A 3AS2A 4NUWA 1GORA 3QW3A 4K7YA 4H7CA 3BAIA 2ZVIA 5XIAA 5LIKX 2EKCA 2D0FA 4GUHA 2BTMA 4ZO6A 1TQJA 1P4CA 1X6LA 5IFPA 1Q66A 4BF7A 2VDHA 3E02A 5HNUA 3RR4A 1K8ZA 2D20A 1BAGA 1CDGA 1EDGA 2CESA 1XSJA 5BU9A 3AUOA 3DGBA 4M24A 2HTMA 2DT0A 2PWHA 3PNUA 3FSTA 3G1HA 3P8IA 3CQJA 1I2NA 1JZ4A 3DESA 1K7FA 4GVFA 3E49A 1W17A 2R82A 1TJ0A 1W3IA 5D32A 2DVTA 4HNTA 1XGZA 2WV8A 5I03A 3BICA 3CS2A 4L4PA 1J0KA 2OFJA 3GR7A 2WZIA 2ZXAA 1QNOA 1CGYA 2ON3A 3BJTA 1PX8A 3P5ZA 2XH4A 1M7XA 2ACUA 4TVCA 2ZC1A 1W1A1 3G1AA 3SECA 3P62A 4A8RA 4MPQA 2PP1A 3ZT5A 5FI8A 3M64A 1WP6A 3VIKA 3LNMA 1NF0A 2FPVA 2WJZA 2LLEA 2Q3RA 4CQCA 1GYMA 2P76A 3LXBA 3FAWA 4O0QA 3TYAA 4EAYA 2OELA 3EAUA 2RDTA 4MF4A 1ZZMA 1ISZA 5TBOA 3B04A 1A5KC 2J88A 3E5PA 1WA3A 1YNQA 1A80A 2AKMA 3OHIA 2EF9A 2WMGA 4J40A 1E5JA 1GPWA 3EA1A 3AIQA 3ANYA 4MUZA 4XTIA 1XIEA 1TELA 4I7VA 5DY2A 3RU6A 3T08A 1UR2A 4AVFA 2A3CA 4ZB0A 3TC3A 4AD3A 2PTZA 4XUYA 4O8AA 5C7HA 4KCVA 4NIRA 5CZKA 1XLGA 4DLMA 2NWRA 2C3ZA 2O55A 3TR2A 5AZ1A 3AYSA 1OX4A 4H9UA 3QGAC 2HV5A 7A3HA 1C9WA 4M8UA 3LUTA 4O14A 3C3NA 3DFNA 3IJ9A 4BY3A 1RQEA 3PHAA 5EBUA 1RPXA 1FY6A 2BBFA 3DFSA 1WPCA 1Y5WA 5C2XA 5HDRA 1SFJA 1UR0A 1G4SA 4K8GA 2ANUA 1LG1A 1K9FA 2R9RA 1GEHA 5ECUA 3JRKA 3E5BA 7TAAA 2A0NA 4AD2A 2NV2A 3K13A 3LGEA 1NDZA 3WMCA 2WMIA 4Q4RA 2BP1A 2QLYA 3SR7A 2PDKA 5DXYA 1D8CA 4WJXA 4Y7EA 1EIBA 3ICJA 3L21A 1C91A 5FJJA 2ZUTA 3P6LA 2W62A 5KZ6A 4JKMA 1IWPA 1Q65A 3RRXA 3A21A 1TRDA 3WEZA 4GXWA 1TPFA 1WZKA 2WNNA 1H1NA 2Y5JA 1AODA 2HXTA 4HMCA 1OC5A 4IFKB 2Q09A 3CMFA 1TPEA 2JFEX 2WHJA 1FHVA 2WKJA 2E9BA 2C14A 2CLHA 2BODX 3SADA 4B2DA 3PZMA 1AW5A 5D30A 3C52A 1PYFA 2ZUWA 3BCJA 4BQ5A 4B9ZA 1BXBA 1E0VA 2ZRWA 3VKKA 1H4PA 3GNRA 4F0RA 4UCFA 5A8OA 1XLBA 3L0KA 3G0UA 2X16A 3EMCA 1WKEA 4B3KA 2QJJA 3ABQA 3VZXA 4Z42C 1OM0A 3HBLA 3TH6A 2CHRA 4KRUA 2ZC8A 3SCNA 1KWKA 3UWQA 1UZHA 3WJZA 5EL1A 3BVJA 3MPGA 2DZSA 3VC5A 5C2GA 4W8AA 5G4HC 1F61A 3BLPX 3ITCA 4DYJA 1VEMA 4JN6A 4CNTA 3GR8A 4P61A 4XD6A 4O4WA 2VRQA 3UXLA 3SSZA 1V77A 3CTLA 2G5WA 3ITYA 1MEIA 2B7PA 3W87A 3GTIA 1MZHA 3DIPA 1U5JA 1TA3B 1KCZA 2AAAA 3ATZA 4ZA0A 4DN1A 4E3TA 1UKPA 3CLWA 3CM4A 3W7NA 4QRNA 4FHAA 4IT1A 1OFAA 1Q63A 4GIRA 1L6WA 3IIPA 2X1RA 2EXOA 2A79A 3WDJA 1E73M 1GT8A 2WNQA 1KC7A 2RKXA 5K9CA 3TTOA 3L2IA 1MXGA 3MO4A 1UWSA 4PBEA 2YDSA 1C29A 3FJ4A 3QPZA 3MHUA 4OJYA 5HWNA 2WZEA 2X40A 3RJYA 1KRAC 3GE7A 1VBHA 1JD9A 3ARQA 1BWLA 2A6NA 1XLHA 1RBAA 5FACA 3VDHA 3PBVA 3OYZA 3PANA 3TYDA 3OODA 5RUBA 3OLIA 4Z1AA 7REQA 2TRSA 4JQ3A 1XP3A 2NQHA 1RH9A 3DXIA 2NT1A 2F9RA 3N34A 3N14A 2XIJA 1OT2A 5B7YA 4LVGA 5F4XA 2XWDA 4E2BA 2IKGA 2POZA 3R89A 4BI5A 5C7VA 1K4GA 1XYZA 3C2OA 3GBEA 3ORWA 1R2SA 1R3YA 3UZWA 3HU7A 2OYLA 1BSIA 4HYRA 2I17A 1YDVA 2PLMA 3G1VA 2PD5A 1J12A 7PTDA 3GAYA 4GNKB 4K39A 1QHPA 2H8ZA 3HQOA 3ABOA 4O17A 1XLAA 1PX4A 5LHFA 3AYRA 3UZYA 4Q4KA 3VAVA 4KMQA 3SUUA 1US0A 2CHNA 3LTYA 4H41A 5T26A 1A5MC 1RSCA 5DANA 5AY7A 1UQYA 1E4IA 3CZEA 1UYQA 4WDXA 3NM1A 3KM8A 3S46A 4WVXA 1JAEA 2UY4A 1UPPA 4DIAA 3MCNA 1L0PA 2J7GA 5JMUA 3OOQA 4F0LA 3SCWA 2A7PA 3HPXA 3LA4A 1LBLA 2J7DA 2J8FA 5C6MA 4QEEA 3ZLGA 3GSMA 5HNTA 4KESA 2XGZA 4UFLA 3XINA 3H22A 2Z00A 2DP3A 5DRIA 1OZMA 2YA0A 2DU2A 3M9YA 3R2GA 5IFTA 5AHEA 4HPHA 1QT1A 3S1VA 3BJFA 3LV5A 4E4PA 2G50A 2TYSA 1PAMA 4NAEB 4H9ZA 1I1WA 1MUMA 2NVAA 2QCMA 4ENLA 2BHZA 3OPSA 4JHOA 1XRFA 4KT2A 3PB0A 3T4WA 4EWND 3QH2A 1EKOA 3LMYA 3CAKA 3TA9A 2ZTKA 4DO6A 2MANA 1ZFJA 2CBVA 1Q4WA 2P3EA 1Q8AA 2V2DA 4EAMA 4RLIA 5G5IA 4CNNA 4MYAA 2ZYFA 2XIOA 4FO4A 5E6YA 1Z9AA 1EGVA 3VKAA 4NZJA 4F40A 1KM6A 4I5RA 4LC8A 1V0MA 1EGZA 3ZJ6A 1H2JA 4GXPA 4B92A 1J9YA 2WVVB 3IJLA 3ZO9A 3H8AA 4HPGA 4UZSA 5DEZA 4R5EA 3TTYA 2VFGA 2W91A 3MUY1 1OD8A 1XSIA 4DJFC 2B7NA 2H6RA 1MRQA 1DE6A 2FJKA 5HJYA 2VFEA 3HQ1A 5DCBA 1IIGA 2GVEA 3TR9A 4ZQRA 3MDUA 3ABSA 3U0HA 1ADOA 2IS7A 5AC5A 3HPZA 2OQYA 3W07A 4S3BA 3BSHA 4RZ6A 4FK9A 4HPXA 4NRSA 5CZSA 1DQUA 3LOTA 5CAHA 4Q8PA 4X22A 3DI1A 5FJIA 3NDZA 4Q8NA 3GTNA 1J6PA 2WSQA 1DJZA 5H91A 3MY9A 2I1OA 1CLXA 1PSCA 1AK5A 5I09A 3QXBA 1C7SA 3M41A 1E72M 2PWFA 3QZ6A 4H2CA 3V4BA 1ISXA 4ZTYA 1FCVA 2Z0IA 1X98A 4LNYA 3CV6A 1T40A 3ITVA 4ICNA 1PV8A 1NU5A 4A8LA 3IUIA 2DH2A 1OIFA 4MWAB 3W9ZA 3AMKA 4W8BA 4CCCA 2R8WA 2JEQA 4QFUA 1XIJA 3M4HA 4US6A 1W9BM 3EWUA 2Y4SA 4DBEA 3SCPA 1EJRC 4JX5A 2VHLA 1PZ1A 4BR1A 3W01A 2XSAA 3LCIA 1IGWA 3W0KA 1AJ0A 1QK2A 4ZSTA 2V6AA 1XFCA 2Z6IA 2XIQA 3PF3A 4Q4OA 1XIIA 2W9MA 4GZIA 3L7RA 1TB3A 1OCBA 4UTTC 1V6VA 4OBSA 1A3HA 2X1IA 1SGJA 4JICA 1KBLA 3LERA 4N6FA 2YCLA 3INPA 1KLYA 1CCWB 3B05A 3CUJA 2ZXBA 1TPVA 3KE0A 2Z2AA 3LMZA 3AUJA 3EPMA 5FEPA 4N2YA 5IM51 3N25A 1L6GA 3A5FA 1IIHA 2WC7A 2QUVA 3I4EA 5DY3A 1K1DA 1AMYA 3RCYA 2DFAA 1MMFA 1J93A 3WD4A 2HBXA 4HU3A 3HG5A 3LCHA 2C18A 4IJCA 4KCTA 1DJQA 2GJXA 4B3ZA 3FYOA 3R0UA 4YXGA 1E40A 4D6HA 1J2WA 1G1YA 1KXHA 3W7EA 4PSRA 4KWUA 1SR9A 1K4HA 2E40A 2WAGA 2QCFA 4PULA 1YXYA 8CGTA 1KFEA 4LPCA 3T2QA 2P88A 2IXVA 3KTXA 1V0KA 4XZLX 3EWYA 3IAQA 4X0NA 2XUCA 3VNLA 4WK9A 2IQDA 7XIMA 1MI3A 2WVTA 4DBSA 4FP1A 4O1AA 1EA9C 4MVAA 3TFXA 3GNPA 3KWSA 2ZWZA 1FXPA 3CPRA 4PMZA 4QAWA 4C6CA 3S9YA 5J5DA 4Q8UA 3N3MA 1RCQA 4X2PA 1RLCL 3B0XA 2QF8A 1SZNA 3HFTA 1IXNA 2G0WA 1KM0A 4CEUC 4UC5A 1V03A 4JNMA 2ZA3A 1GQLA 2AQVA 4XAPA 1H60A 2OR2A 2O4QA 5LXXA 1NFBA 1B0IA 5LIWX 2WVSA 4GH3A 4C7GA 4OKDA 3NQ2A 4JY9A 1UD3A 1XV8A 4YIWA 3W2NA 4JN7A 1S2VA 4C1LA 3MP4A 1E15A 1DIOA 1SQ7A 3EKLA 1E6PA 1HKIA 2Z26A 3N29A 3NVDA 4IJRA 1GKRA 2W67A 1A5LC 2E7FA 1UWQA 1RD5A 1JDFA 4ZXOA 2X1UA 1N82A 1FP8A 1IR1A 3VD9A 1Y8BA 1Z42A 1JI1A 2XISA 4F9DA 2A3AA 4Z2KA 5I7GA 4DJED 3MP5A 3DHPA 3W6MA 1F7BA 3CZ8A 2WQDA 4QSFA 3ME3A 4UMAA 4JTUA 3GIQA 4M56A 1ML1A 3SO7A 3BCDA 1VJSA 4OQVA 2R1KA 3SN1A 3BG5A 2YA2A 4GNVA 2RGLA 2Z1SA 1TRIA 4C6NA 1EWEA 3FCPA 1QO5A 2ZFAA 4WSJA 4K6AA 4ACZB 3VDBA 3QZEA 5DMNA 2OSXA 1V6XA 4RCXA 3SUSA 2YJQA 3IK4A 5EU9A 5E1QA 2Z27A 2ZIDA 4GZEA 4AXKA 1WB0A 3VYLA 1GG0A 3QTPA 3BW3A 4IIFA 1HW6A 3AXMA 3WH9A 3DI0A 4S3DA 4HKPA 3WQEA 4PRTA 1KFKA 4JDYA 3PZ9A 5A69A 1E4NA 1R3QA 5C54A 2BGQA 3IRDA 1QI2A 5K9DA 3VCCA 5B80A 5KITA 1HTIA 3ONCA 3T09A 2WB5A 1W1VA 2PPGA 7ENLA 4UFJA 4F0SA 1ICSA 1NELA 1O5QA 4GI8A 3H4WA 3F5LA 1KBIA 2I14A 3WNOA 4IX0A 4KF1A 4XD4A 1DE5A 5A6SA 4HK5A 2DDXA 3VX1A 2OEKA 4ACZA 4E2VA 2PS2A 4IQJA 3QV8A 4JTAA 4W93A 3ZOAA 4JTCA 2QIIA 1GVRA 4V1YA 5F2MA 1FOBA 3I6EA 4A29A 4B5TA 2JGQA 4AF0A 2WOQA 3KRZA 3EX4A 3CLMA 4JQ2A 2G96A 1SFLA 2OOFA 1O5XA 5C9WA 2VR2A 5E09A 3LPPA 4ZSUA 2V5DA 4GJIA 3SEPA 4QE4A 4NHVA 2CBUA 2GSEA 1DWGM 3E2SA 1GW9A 2O9PA 4JQ4A 2PGWA 4AWEA 3F2DA 4GI6A 3WBYA 3N12A 5I06A 3VDCA 4YCPA 1W1YA 3XISA 3HMJG 1ZBVA 5D2XA 2RH9A 5JBEA 3I6RA 1UBPC 1OEPA 3MO7A 3IVSA 5JU6A 1AD1A 5M5DA 5EMUA 3B9AA 2QCLA 4JXCA 1XGDA 4GCXA 1WQ5A 5TQLA 3V1HA 3ARYA 1OC6A 2R94A 3VPLA 3AIEA 2CLIA 3W37A 2BY0A 3RAOA 1FBAA 1PYMA 3TCEA 2Q8LA 1QPNA 1ME7A 2WNZA 1EIXA 3LPFA 3A64A 2OSYA 3FGCA 4PYSA 4LUJA 4X2RA 2GVYA 3VDGA 1SJBA 2KZHA 1QNRA 3R79A 1XSKA 1ZTVA 1LOQA 3MTWA 3WLMA 1MFVA 3VC6A 4Z1DA 1MZRA 3AALA 3QC0A 2NUXA 2YLLA 3FYYA 4RNHA 2R24A 3ABXA 3CAQA 5CJNA 3E74A 5CPSA 4JFVA 4G7EB 2XH7A 2HZGA 4Y9NA 4GKLA 1Z41A 4A2RA 1ONEA 2CYGA 4UTWA 4V15A 5KEZA 4UTMA 2MUCA 2R6OA 4QHRA 3V5OA 5C70A 2P8CA 4NT0A 1AQMA 2WQPA 1WZMA 3CZJA 4LBRA 1JCJA 4HNUA 4JEJA 5CSSA 4MTVA 1RP9A 4DZ5A 4BHYA 3GR4A 3SQLA 4KW2A 5EB8A 4EVZA 1NOWA 3EBVA 2YZ5A 1H7XA 2QIWA 3CC1A 3RXZA 4OZOA 4B90A 2VUNA 4AHPA 2ESCA 3SFKA 4JS3A 3BJSA 4MKNA 4JIQA 3WD0A 1J4EA 2DSKA 5EA9A 1CENA 3KVMA 2DZTA 1VF8A 4IH3A 5GNXA 4CN6A 4J27A 3N6JA 4X60A 1US3A 2OCZA 2V5BA 1QW8A 2PDLA 4Z08A 1V3HA 4C6EA 3TKFA 1E5NA 2XVNA 2VMFA 3GXTA 4TMCA 5CJ5A 5FJUA 3O1NA 3L4ZA 3GZ3A 3B8IA 1B3YA 3GTHA 1KA9F 3ABZA 3WLOA 1KGUA 4HHHA 5BRPA 3WQ5A 2WLZA 5B7ZA 4K3ZA 4GPNA 4CQAA 3SRHA 3M0JA 3P61A 4JHZA 1XLLA 3UWZA 4GYKA 4L1WA 3TJXA 2RDWA 5HATA 1W1TA 2WMJA 2ABAA 3C5QA 1AZ1A 1OINA 3LPOA 3T2PA 2GPTA 2V3DA 4S3KA 1EOMA 3LLFA 2V30A 4D6JA 1G94A 4L1GA 3OJGA 1VCFA 4TO8A 3C56A 3M5XA 3V16A 4IOTA 1QBAA 4KCWA 2WWDA 1A0DA 4N9CA 3E0FA 3OGSA 4PL2A 1S2AA 3T07A 1UJQA 5D4YA 5FSDC 1VD6A 3PBGA 4JTQA 1QOXA 2TMDA 3W24A 1S2WA 3SUWA 4GUJA 1XIGA 3W1UA 3AFBA 3L66A 2Y1HA 4JFSA 4Q8QA 1SYTA 1GVIA 1DV7A 1IEWA 1I2QA 3W83A 7ODCA 2QV4A 3DHFA 3K8MA 4R7WA 1ODZA 2JK2A 1IZJA 3PBWA 5KTLA 4C6JA 1G69A 3MA8A 3SZ8A 2VFFA 4NAEA 2MNRA 3PM6A 4ADTA 3WQFA 3EX3A 5HMSA 2YB4A 1P6BA 3CWNA 4DYEA 3D47A 3AMGA 1G6CA 1OCJA 3IS4A 4HA0A 1A47A 4MUPA 1SMAA 1SW0A 3IRSA 3W1RA 2AL1A 4GD0A 4WOQA 4O19A 4XVDA 3W70A 3WUGA 4JTGA 3PVFA 3WH5A 3GXPA 1A53A 1B3OA 2QT3A 2VZSA 3PUDA 1P7TA 2H90A 3NSMA 4EANA 1JYNA 5J8LA 1EB3A 4YTUA 1WZLA 2HK1A 1XD1A 3GIPA 5EMKA 1CGWA 4XZ9A 2YCKX 1VRXA 2OB3A 3H4GA 3W6YA 3BE7A 4A35A 1LQAA 2EKGA 3W72A 2I9EA 5G4WA 2BOFX 2NT0A 3AYVA 3GAKA 1QI3A 3OYXA 5AOUA 1E6XM 2ONEA 4OTKA 4JAWA 3R43A 1LBMA 5LHEA 2HVOA 1SUXA 1TR1A 2V69A 3DCPA 2YL6A 3MKVA 1M53A 3KP1A 3M0IA 2G8ZA 4F8XA 1TE1A 1OGSA 4GI4A 3WH7A 3UQNA 2HMCA 3UJEA 1HL2A 5E6ZA 3BGJA 5I0DA 3W73A 5HMDA 1DJXA 3WH8A 1WXYA 1UKOA 3EB4A 3UCQA 3TCSA 1SO3A 4EACA 4CD6A 3PC0A 4DJFA 4HYWA 4JCLA 3ID7A 3AXHA 3WQ6A 3WENA 4BFAA 4UNLA 3U8GA 4IM4A 1B3XA 4GGBA 1H1YA 1OFRA 1QCWA 1Q85A 3VKBA 2XINA 5T9CE 4M29A 4DM2A 6ENLA 2GJXB 1T41A 4QQUA 3VE7A 3PUOA 2G4FA 2P5NA 3R0KA 2FJUB 3C0JA 4G8TA 3BK0A 1IXPA 1A4LA 3FLUA 3A13A 1ADDA 3W86A 4X61A 1ADSA 5J5RA 3L4TA 1A50A 3AMLA 4HNOA 1F6PA 2INZA 1A49A 3OBEA 3DN5A 3OZMA 3PZIA 5LA1A 1EQCA 3WQOA 5TNVA 4H2HA 2JF7A 5CPLA 2ALDA 1BG9A 4L7ZA 3W26A 1HGYA 1LBFA 3KRBA 2REQA 6XIAA 1CXEA 5K4ZA 1YW1A 3GDMA 5LNSA 1OZQA 1CGVA 4Z1CA 1UH4A 3GXMA 3UG3A 3BLDA 3Q37A 4I9MA 3EDEA 5H6HA 4GJ1A 4NSBA 1CXHA 1QHOA 4K1GA 1KTCA 1C8VA 3QJAA 4R88A 3AJ7A 3LGDA 1UUQA 3GBDA 1M7OA 3K4AA 3VOFA 3W22A 2C0AA 4LRSA 2VZOA 3R11A 4LYPA 2R1LA 4TX8A 3U7BA 4TQTA 1REQA 4LW7A 5T9BG 4E38A 1G4TA 1M04A 2W61A 3I7QA 4MY9A 3FX4A 3DFOA 1K6AA 2FGLA 3O05A 5CSUA 1SZRA 2UZ9A 3PULA 5LGXA 4H8HA 3VO0A 3WLNA 3VNKA 1NWUA 1XRTA 1HJUA 4EPEC 5AYBA 2HROA 3BURA 1UW9A 2FHBA 2PP3A 4IIGA 3TDFA 2F6XA 2Q8ZA 3A5VA 3ECQA 2X2YA 4Z17A 4LVBA 4RJEA 3DBPA 1R38A 3HTWA 1Z44A 4R34A 2UWFA 4GC3A 3CMJA 2PLJA 3KWXA 3ARUA 5IBXC 4D6GA 5DELA 3N2XA 3RPMA 4A3YA 2Y8VA 4DZIA 1U5VA 3P0XA 4C90A 2J9ZA 1S1RA 1I6NA 4EPKA 4PCNA 1QPKA 1VRDA 4ML4A 3UPWA 3JVAA 4JTTA 3ZS4A 3B9NA 1KO0A 3WZ0E 3ZR6A 4IQDA 2CZVA 2H3DA 3NQVA 4HMDA 2C79A 4LWWA 4LBUA 1WAWA 3OVPA 2PDGA 4QEHA 2HDJA 3KBNA 5FA5A 4ORIA 1P0DA 1I2PA 3TWAA 4HIBA 3NQ8A 1OGGA 2DT1A 3TUUA 4NJKA 5A8QA 1X6UA 3QGVA 1PBGA 3QBUA 1W91A 4NASA 4BWLA 1O1HA 4JTLA 2WZHA 3GDBA 2E9LA 1WO2A 2XPKA 4PL1A 3SGGA 1XD0A 1IYXA 1F6YA 1BYAA 4C1NA 5BXTA 1RALA 3LCLA 3QRHA 3CHCA 1ZAJA 5A3HA 3LHUA 4FIRA 4ROQA 1K9TA 4D1JA 1Q7MA 2EPMX 5JH2A 4OU1A 2BWGA 4H8UA 1IV8A 1JUEA 2OXNA 4GZ7A 1UIOA 4MNKA 2X42A 1QPOA 2VTFA 4QLKA 4Y2WA 5XIMA 3GW0A 1CI1A 2BHYA 3N17A 4GNJA 5F2IA 3UZZA 1J5TA 5HUPA 2BS9A 3VD5A 3UCDA 1Q7QA 4WDTA 3M0KA 1M7PA 5C9XA 3GYCA 2PF0A 1W3HA 1MFUA 3I7SA 3QPEA 5EKYA 3DECA 3V3WA 4ZB5A 3P60A 3N4EA 4XKYA 3W7DA 1RK5A 3AHYA 2Z1KA 3PFRA 1YKWA 3TN5A 1OFEA 1W1B1 4H4IA 1WDSA 3OQEA 2J47A 2ZX9A 2XFRA 3ZWTA 4LY4A 5CJMA 1YYAA 3T7VA 3TLLA 4U5IA 4AFYA 1BRLA 2ZZ4A 3O6YX 1OG0A 3BUVA 3THDA 2IKJA 2X2GA 3FN9A 3BGAA 1NWRA 1ONWA 3BQ6A 4MB5A 2X8RA 1R3SA 4UMBA 1QPQA 4A3QA 4PMYA 1AQHA 3C8FA 4HCHA 4MWAD 2GGGA 5MF5A 3A47A 5REQB 3KW3A 4WY0F 2WC3A 1SPQA 3SY8A 2GQ3A 3RLUA 2GUBA 3EOLA 3P5YA 1R3WA 2P10A 3SJNA 4US5A 1DWFM 5LNWA 4UTJA 3B06A 3SRKA 1OT1A 1V0NA 3GYEA 4HT3A 4XSLA 3THQA 3O16A 3Q94A 1E4MM 1YPXA 3M44A 4P7OA 2PP0A 1UZ1A 1EJXC 3MHGA 4E4FA 2A2IA 1NF7A 1FCBA 1O60A 2D23A 1JPMA 2XGIA 2YCIX 1BXCA 4QXIA 1EJTC 1ZNNA 4ML9A 3W2UA 4A4AA 3VGEA 1JPDX 3STPA 3KTCA 3O6CA 1SM9A 2OQHA 3L68A 3T42A 3P93A 5I3HA 3W7MA 2FVKA 1TMHA 1RHCA 3I6TA 4PB5A 5E0FA 3ZVHA 3HJEA 4QTGA 1GOWA 3IJIA 3MSYA 4MZYA 3IIXA 3UPMA 1FWCC 1O5KA 2DH3A 1LLWA 2CLLA 4N9DA 5ECVA 5HAOA 4XX6A 1K70A 1RY8A 4N7QA 4MB1A 1EJSC 1S5VA 4E2DA 1SFTA 1ICPA 4O0ZA 3AU2A 1GVEA 2ZQ0A 1KRCC 4AG0A 3OBKA 4URIA 2OMAA 1B3VA 2QCGA 1L2UA 2CKSA 3L4UA 3PBUA 1XC4A 1LL6A 4K37A 2E77A 4EOUA 4GRSA 4IQEA 4PMOA 4IGSA 1MWOA 3VM5A 3TVAA 4O52A 4J3SA 3L12A 1FWAC 1PX3A 4AF0B 3KTSA 1QNSA 3O07A 3VGDA 4JKKA 4UFHA 3W7HA 3TROA 2BGNE 5GNYA 3LHWA 5D02A 2B81A 3KFTA 1PB0A 3EB3A 3VIPA 4S1FA 3PBMA 1IWAA 4ZQOA 3GIYA 4BWLC 5C8BB 3UZ5A 4MJZA 1X8FA 3KRUA 3AAMA 1XLEA 4GJJA 5BYWA 1I60A 3PSVA 2J7FA 1VBJA 3CO8A 4PCPA 1B90A 2NUYA 2QJHA 5BCAA 3ATYA 1I4NA 4AWTA 2A5HA 5AVNA 1TPH1 4M6PA 1KV5A 3Q4DA 1Y0EA 2FHFA 3K46A 1U5HA 3S9ZA 3KVLA 2OODA 2RGMA 1TWIA 2J13A 3OTRA 1F9CA 3NSNA 3VILA 3H26A 4L9YA 3VKCA 1MW2A 4YJ5A 1XUUA 1GHRA 3N1AA 2CLMA 2ZUUA 4US5D 2VELA 4JBRA 2V67A 3KL0A 4D2JA 3VNJA 3ARTA 3G1SA 3A3HA 4UFMA 3WD1A 4N6EA 3I68A 4LUTA 3C6CA 2G3IA 3CEUA 1U2YA 4DY1A 3W23A 4IL2A 2BDQA 1RBOB 2BG5A 4QM1A 3MQTA 1R0MA 1G7UA 1Y65A 4PEKA 3MHFA 2WMKA 1ISVA 5A6MA 2O9RA 4PMRA 3TZFA 2ZDSA 3PSWA 2JKEA 2BOGX 9XIMA 3DKLA 1GVQA 3AU6A 1VB9A 3FK4A 2HBVA 3DC8A 4YTTA 1RJRA 1ZJBA 3WLQA 1GGOA 4MFDA 3QYQA 2XJ7A 4QSHA 4JHMA 5D9PA 4FXJA 3UD6A 4AD0A 5D9MA 4ZR8A 3LU2A 2OU4A 2I5GA 2C6QA 4PA8A 3OVGA 3B8UA 1WDWA 1FFQA 4B5XA 1PVNA 3UXIA 3WJYA 2E8YA 1D7KA 3B9DA 2OWXA 2FTPA 3GUGA 3TN3A 1RQHA 1ZJIA 4O1EA 3IWPA 1OX4B 3TLQA 1EH9A 2Q8XA 3UY8A 3WFLA 3IPWA 4IG2B 3KHJA 2WHLA 3NQMA 2CERA 3L4YA 3L2LA 2JQXA 1CWYA 4NNAA 5G1MA 4J3WA 4UTLA 1TSIA 4LAZA 3DG7A 4H6KA 4B5UA 4XIAA 5EYWA 1YADA 4CQBA 1HO1A 3NQBA 3QVQA 4DB7A 2J79A 4RV3A 3AO0A 1NP2A 4E8GA 2Z2BA 1R86A 1TMLA 1JDEA 2VDIA 1KQZA 4NP7A 1Q6GA 1UP2A 1PO9A 3QLLA 2ODOA 1DL3A 2YFOA 4LCRA 4WD0A 3BZGA 1FX6A 1K8CA 1TYGA 3GDTA 1XIDA 5D04C 3HV8A 4GINA 1IGSA 2OEJA 2D69A 4NNCA 1HUVA 1B57A 2DSVA 1TPUA 1CIUA 4H00A 5BXPA 1L9WA 1X8CA 3R7MA 1W3KA 2EO7A 2AMGA 1QMLA 2XN1A 4A3HA 4F9JA 1V4YA 2HEJA 1AL7A 3IGHX 4O57A 5LIUX 1HJWA 3RNDA 1H3GA 1ZBKA 4AX6A 3M7WA 3LV6A 4QE1A 3BAXA 4XKYB 2JKAA 3TMLA 3WUFA 1S5NA 1E6SM 2CLFA 1VS1A 4CNPA 1T5AA 4XZNX 4WDWA 4EE9A 5IOBA 3EWCA 1QOPA 4G5DA 2ZE3A 5CZ0A 3WF0A 3ENLA 4PUEA 4Z1BA 3CL6A 1CPUA 2ZRUA 1A5CA 4FLSA 4Q4QA 1H63A 3NSXA 3KZSA 3FY1A 3GLCA 2OOGA 1QI5A 4K8EA 4JFWA 4ZO8A 1DJHA 3PBYA 2VEMA 1FA2A 4PRWA 4E4UA 5EBAA 1FWGC 8XIMA 1Y5VA 2OLAA 4MM1A 3GUWA 4YS1A 2CLPA 2WHKA 3P81A 3DEQA 4PFHA 5G1YA 3NNTA 3EPOA 2EJAA 2IKIA 2GLKA 3OHMB 1K7EA 3SAZA 1F8MA 3IJ6A 4S3CA 4L6DA 4RK8A 3P74A 4U3AA 1BYCA 2GDQA 2A3LA 5H1WA 3UG4A 5ABEA 3APTA 3MJMA 1J0YA 4NNBA 2HSAA 1PWLA 3CNYA 4QNEA 1BTMA 5AYXA 1TA3A 3EA3A 3WLJA 4F48A 4OBRA 4TVUA 3VCNA 1X7FA 1RJPA 4QJ1A 4JQAA 1XBZA 1WOAA 4I7UA 2QDHA 4AXNA 2PU0A 1J11A 1XISA 2CCRA 2VGFA 2OGYA 3ONBA 1ZPTA 4PMJA 4F66A 4GQGA 1RP8A 2V5LA 4FNSA 2V2CA 3TW7A 2RDUA 1NQ6A 5C71A 2F7FA 2WWCA 3BG9A 4HPJA 4NX5A 3BL3A 3NO5A 2UY3A 5FKYA 4DJEA 4I9JA 4KFNA 4XTDA 4B9YA 1D7FA 2OKOA 4ZQPA 3QY8A 4FF5A 3SDOA 5A94A 1JNEA 3DBNA 4LXFA 1W9DM 1UCWA 3URAA 1TZ9A 1GJWA 2Y8UA 3VVGA 3BZJA 1W5PA 1DXFA 3AS0A 3PZNA 2W4XA 1W9XA 1S3HA 4QAIA 4DQWA 4D6DA 3PFMA 4HOXA 2HXUA 3PJXA 4XV0A 3ZVIA 1Z7AA 4ACYA 3ALFA 3COTA 4NXSA 4FLOA 3CB8A 5CPTA 3N2CA 1OFOA 1B3ZA 5G2WA 3W25A 4Q6JA 1KFWA 4N9EA 2VX7A 1EC7A 3LBCA 4AZBA 5AFDA 3UU0A 4Q4SA 1EFZA 2TODA 3S47A 2GQAA 3FEMA 1OHLA 3M0LA 4D6CA 3P2VA 4P7RA 5C2CA 1VFSA 4WKHA 2BY1A 3H2AA 4B4HA 3HGSA 3GS6A 1UQZA 4IHCA 1K8YA 1W3TA 2VT0A 3P7YA 1UOKA 3KCLA 5I24A 2GVLA 1JPIA 4DUOA 5JBDA 4CKQA 5AC4A 3GXFA 1ICQA 4LF2A 5I23A 1DHPA 1DEDA 5I79A 3BDKA 1A5SA 3UP8A 1PHQA 1QI0A 5EMLA 4HNCA 2DUXA 2HE8A 4K68A 3GO2A 1MQQA 1LLZA 3M0ZA 3ZR4A 1BRLB 1GOQA 3ARRA 3BOFA 4O1DA 2QHAA 1WKFA 3WLSA 3C61A 3FA3A 3O06A 1GW1A 4UCGA 2P1FA 4LEQA 3WBEA 1RR2A 3QY7A 2J7EA 3CZKA 1GVOA 4YVVA 3BLIA 5GQBA 2D0GA 3O0KA 4K38A 1FDJA 3ZLHA 4QJ5B 3N13A 1SJDA 4H7VA 1L6SA 1PEZA 1DPMA 3LQGA 4J3ZA 3VI2A 2BNJA 2IPJA 2G3FA 4YNGA 2PEVA 1RA0A 2C19A 2YL9A 3QMTA 4GMEA 4FAMA 2RJGA 3HGJA 4EF9A 3G1XA 4OV4A 4GY7A 4TV5A 2I7GA 4I5UA 1FWIC 3RO6A 1EJVC 4AMAA 3KCJA 3PUGA 2AOSA 1NARA 1GKPA 4D9PA 5F2LA 3SCQA 3M16A 4PZVA 4LUIA 2OX4A 2P0IA 1ITUA 3LLXA 4I5XA 3SB0A 2E6FA 1QNVA 2DZWA 4PUDA 4RZ5A 3QTGA 4ZENA 1P43A 4NL1A 4U5KA 4H04A 4GA8A 3B3DA 1ZLPA 2GUUA 1F2JA 1CXFA 3AOFA 4YVPA 2VP8A 1JZ3A 1AFSA 5CGQA 3BARA 1F4AA 1LOLA 3TJLA 1XIHA 1H7WA 2O56A 3EOOA 4L9XA 4XWUA 5HWJA 5EMMA 1MW1A 3BMWA 1TZ7A 4FB7A 4C6KA 4G1NA 2HISA 1PJ9A 1FHDA 5FOOA 4XAYA 3WQPA 4Y9OA 1JZ8A 1ZB5A 1Z69A 2FZ8A 1BGAA 2QPXA 1X96A 1VIZA 2DQXA 2E3ZA 3RPDA 5K7JA 3CBWA 4P7QA 4XG1A 4WHBA 2NV1A 1I75A 1QO2A 2HS6A 2O9TA 1ZCCA 2Y85A 1OWQA 1X39A 1EZ2A 1XL9A 3AIUA 3G2GA 2GOUA 1RZMA 3VIFA 1RA5A 2EJ1A 2Z1VA 1VCGA 2VCAA 1I9CB 3N3TA 3CH0A 5DT7A 1N8WA 4OHQA 4YHEA 1POKA 4RX0A 1SR0A 4UR9A 3LSCA 2PDCA 3Q2DA 5M3WA 1M65A 3W7OA 3E2QA 2WVUA 3KBSA 1DQWA 1A5AA 3B97A 3O15A 4B5SA 1F5ZA 2BASA 4Q8WA 5KZEA 4R7JA 1BD0A 4X0VA 2JGYA 3JW7A 3N04A 3LY0A 3RMEA 3QLDA 1EXBA 5HXMA 3WLHA 1AG1O 1HIZA 2Z1WA 5CSRA 1RPKA 2OT1A 3RLVA 3WMBA 1OFDA 3GXDA 1XYFA 5CC7A 3PN8A 4IMDA 3CZGA 2G97A 4V2XA 4LBSA 3VIGA 4H6RA 1GJPA 1UMLA 1YXCA 2FZBA 4L4MA 4BKNA 4Y8FA 1YLVA 3UJ2A 1KGXA 3IJDA 3RN6A 4HNNA 1BG4A 4L4LA 4DXVA 4ZXLA 3M0MA 1E0TA 3E0VA 1E1FA 1QASA 3GQYA 4N9BA 2QCCA 3VTRA 1U22A 3PUEA 3GK0A 3UJRA 2VEIA 3FOKA 5DX7A 3PG9A 1D9EA 3LSBA 1AW1A 5HMEA 1Q5MA 2REQB 1L6YA 3MMUA 1B3WA 4PCSA 1TTQA 1H50A 3NDYA 3YPIA 1EBHA 4ZOAA 3T81A 1IE7C 3HOJA 4PTWA 4AYGA 4KEZA 3I3BA 4LAOA 1N8FA 3L5MA 2DPEA 5U4NA 3TA6A 3ARXA 4DXXA 2QGHA 3TAOA 3GTXA 1VFFA 5HR7A 1YTEA 2DIJA 3FV9A 4DO4A 4OOZA 3U3HA 1F6KA 1IZCA 2Y6ZA 2CITA 1E51A 3R6IA 5EPDA 1ISWA 4UMCA 1FVPA 2OO0A 1XYCA 1HFBA 4HNVA 4CN1A 4QLLA 2WLYA 1H7RA 2ADAA 3VDAA 5CPOA 4JIEA 1SZEA 3PTDA 5ENLA 4HN4A 4UQBA 1S1PA 2Y2WA 3STGA 3NURA 4M1RA 4FX7A 4L61A 2PI6A 3R8HA 3S2NA 3WUEA 4W87A 1FCUA 3SCTA 3BLOA 1CXLA 3G8RA 1QRQA 2DZXA 3AS1A 5T91A 2UY2A 1EUNA 2H3BA 3VE9A 5I3FA 1CGUA 2ABBA 3FHAA 4CNSA 1ZCOA 1NOUA 4ILSA 3WF2A 3W85A 3TXVA 1GG1A 4GQRA 3JU2A 3S5OA 1WX0A 3TONA 5F4WA 4EIVA 3BWWA 2FH6A 1VYSX 1IXOA 1HJVA 1J8VA 1TVNA 4GQBA 1X1ZA 2C91A 2V8ZA 4K2SA 2AGTA 1OYCA 2ZZ5A 3PZGA 3W84A 4A22A 3OQ8A 1P0NA 1Q3NA 2V3EA 2DZVA 1GHSA 3ITGA 2Z25A 1XH1A 4PTXA 4IUOA 5D03A 5HULA 1LT7A 1SW7A 4MNLA 3VK5A 4Q3MA 3AZTA 1XC6A 1OG6A 4J9JA 3E3HA 3SN0A 5IDZA 1E70M 1H61A 3O2LA 3EDJA 4DJDA 4PB4A 1PIFA 4NRRA 2J8TA 3QV9A 3LN3A 3NPVA 2XIIA 3ANVA 1X38A 3IGXA 2G4JA 3WN6A 3MI3A 3O6AA 1O6IA 4DWSD 4IPPA 1LROA 3WMSA 3AIVA 3G6LA 1Q6QA 1YRRA 2B0MA 3CYJA 5AHIA 1OFPA 2NZLA 2V81A 4ZO9A 2D73A 4EK7A 2GSHA 1K9DA 3QW4B 2QDGA 1J2BA 2ZE0A 3CXOA 4RDVA 4PUJA 4YHGA 4FLRA 1CB7B 1J01A 2VGGA 2XVPA 2PCQA 3GFZA 1EJ7L 1A0CA 2Y7EA 4E5TA 3L65A 5LNUA 2PTXA 4NX0A 2PD9A 3IEBA 2F2KA 2V5KA 5A6AA 4FX8A 1SSDA 1VKFA 1FWHC 4FI4A 2GGJA 5JXQA 5CKSA 4GKTA 4BEQA 4Z2LA 3VXGA 4HPNA 3MSGA 4PC8A 1OGBA 3LHYA 1ESWA 1FUYA 3W4RA 3M47A 2DVXA 2D3LA 2FGZA 3CT7A 2WSYA 1E9LA 3JR2A 3SW6A 1HKVA 4AISA 4DO7A 3A4WA 4LYRA 1RJQA 4HCDA 1W54A 1ZGDA 3UA4A 3IIOA 4RL3A 4IZGA 3M46A 2ZRVA 5CCZA 1VFOA 3CHVA 3UETA 3VOCA 4EXAA 2BVTA 3N2TA 1SO6A 2G3NA 3LRMA 3P14A 1AMKA 4GX8A 4OFCA 3FVMA 1CW2A 3H6OA 2YW3A 3DFHA 5FSEC 2E9MA 4BS0A 2HNEA 1J96A 3RRAA 1UR4A 5L6UA 3ZT6A 4GO9A 2J25A 4O4VA 1TQXA 1E55A 1KTNA 2E6AA 3G18A 3G8EA 4GYJA 3U48A 2C1IA 2OZ3A 4J2MA 4LYQA 1FP9A 3CHDA 4TR9A 5A95A 3WQ4A 1XX1A 3W6LA