2P76A

Crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
267
structure length
267
Chain Sequence
QWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTTNGHGKVEDYTLDELKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKHHLLNNNKLKNGHVMIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDLGFIVHPYTVNEKADMLRLNKYGVDGVFTNFADKYKEVIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Glycerophosphodiester Phosphodiesterase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Glycerophosphoryl diester phosphodiesterase
total genus 110
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2p76A00
3L12A 1DJIA 1O1ZA 2O55A 1VD6A 2OOGA 4I9JA 1YDYA 2F9RA 3EA3A 3EA2A 3PTDA 4OECA 4PTDA 4Q6XA 2ISDA 2P76A 4QJ4B 6PTDA 1DJXA 3RLHA 4QJ3B 3H4WA 1T8QA 3KS5A 4S3GA 5T91A 5T9CE 5T9BG 4F2TA 4I8YA 4RV3A 2PLCA 3RLGA 1DJYA 1QASA 1DJGA 2FJUB 3QR0A 1DJZA 3KS6A 4I9MA 1GYMA 1XX1A 3NO3A 5PTDA 1PTDA 1AODA 1DJHA 3QR1A 4I90A 1ZCCA 4RW5A 3V18A 2PTDA 4GNKB 1QATA 3OHMB 3I10A 3EA1A 4F2UA 7PTDA 3CH0A 3MZ2A 3QVQA 3V16A 3H4XA 1V8EA 1T6MA 4QJ5B 1PTGA 2OTDA 2OR2A 1DJWA 2ZKMX 3V1HA 2PZ0A 4RW3A 4R7OA 4F2BA 4I9TA
chains in the Genus database with same CATH superfamily
4LFYA 4QQUA 3LLXA 3CB3A 3T2QA 4IIFA 4JTJA 1FWIC 4DWDA 1JF5A 1KBKA 3IJ9A 2AKZA 2PDQA 4PUMA 4MJZA 4IUOA 4E4FA 3GM8A 3AU2A 1W5QA 1N2VA 4HU4A 1WZKA 1XDLA 1PV8A 2QS8A 2E0PA 1ZNNA 2VDGA 3BJFA 4ADSA 2FGZA 3M5VA 3O0KA 3CMGA 4QX4A 3UZZA 1SJCA 4ZO6A 1M3UA 1TPDA 1QOXA 2OODA 1ZY9A 1I1WA 3QLDA 3ZSTA 5CCZA 2TPSA 2YB4A 3VKAA 4Q8TA 2EO7A 3GVGA 1BWLA 4F79A 8XIAA 2QCHA 3TZNA 3LHZA 1DIEA 3ZVIA 1LOSA 4O1AA 1DJNA 4PRRA 3CUFA 1HF6A 2E8YA 3VIOA 3IJ7A 4UFIA 3MCNA 2PBGA 4O57A 3SJNA 1QW8A 5FEZA 4EIVA 4QG8A 4ZB2A 3MYOA 2C6QA 2OB3A 2JEPA 1WKFA 3M9YA 1AJZA 1A0DA 1HUVA 1WDPA 2VZUA 3GIYA 4QEEA 5D09A 2J7CA 3LCLA 4BK9A 2ZXBA 4ATWA 3WQWA 4KGJA 4HK7A 3PNZA 3NO1A 1RPXA 4D8ZA 2PD9A 1TRDA 1J79A 3RU6A 1F3XA 3C3NA 1OD8A 4ZENA 4FI4A 4R9XA 2EAWA 3CZLA 4LW7A 1H63A 1XSKA 2JE8A 4XO7A 1EUAA 3QKZA 2E4TA 4JN7A 1GW9A 5CC3A 3H2OA 3VDBA 4LNYA 3O7UA 4JY8A 5LNWA 5M3WA 3CUIA 1MFUA 1RY0A 1YKWA 1O12A 4JTSA 3GXTA 3UJRA 3W7NA 1KRBC 2Z7GA 4IX2A 5B7ZA 2YLAA 3KDNA 1F73A 4HIBA 3GS6A 3M0KA 4AD1A 1DHPA 3AROA 3B0UX 4FP1A 3K8KA 3U2EA 3TJIA 3UQNA 4ZXOA 3OODA 4N9DA 6A3HA 5FF0A 1X6LA 1ENUA 1TELA 2WVVB 2NX1A 5A8OA 2PE4A 3EB2A 3EKLA 5DEZA 2ACSA 3W88A 3W29A 4HU0A 3GVWA 1TG7A 1QWGA 2WCGA 3BLDA 3B0YA 1OY0A 4HA1A 1BG4A 3I65A 3DG3A 1UMYA 4M1BA 1E0TA 1AW5A 2PZNA 3NSXA 2W9MA 3WUGA 3VNJA 1R6WA 2FLIA 2PDCA 4DJED 1GPFA 1BYAA 3LBOA 2VFHA 1I0BA 1UUMA 5AFDA 1L2QA 1PO9A 4PTNA 1OIFA 4TUFA 2DT1A 1TZ9A 2VRKA 2ZFAA 1US0A 5A6TC 5E0FA 5DRCA 2P3ZA 3C3UA 4GJ1A 4UBPC 2FGLA 1A0CA 2FZMA 3WNMA 4ZO8A 3FVMA 4CKQA 5FJOA 1GVQA 5I7GA 2X30A 3UZ5A 1MUCA 4OE7A 2V3EA 4WGHA 4XSLA 1YPXA 3MMTA 3S9IA 3NPUA 4W87A 2PPGA 3NDZA 4GINA 2HSAA 2X05A 1XG4A 3B9AA 2WPGA 1RA0A 5MKGB 1XD1A 3VX1A 1ZP3A 3N1AA 2RDXA 1W1IE 4WRHA 5FCZA 4L4PA 4KRUA 4YVPA 1I2PA 4GUGA 1TTIA 3AS1A 5LGXA 3LXBA 1PWMA 1QASA 1GQJA 2WLZA 3WX7A 3GIQA 3B9DA 1QATA 4OVXA 4CEUC 1A5BA 3FN9A 4A8NA 3TTQA 3UZXA 3IRSA 5HMSA 1IT8A 3VX0A 1JGMA 2YJQA 4WZHA 3SCOA 4PUNA 3C0SA 5FD0A 4HB7A 4WVXA 3SFKA 2ZE0A 4FNQA 5J5DA 3CIVA 5CJMA 3EKZA 2RDTA 4PH6A 1FWGC 2HDJA 3FEMA 3PG8A 1ZBCA 1OABA 4XSMA 4D8AA 4JIRA 5L6UA 4U4MA 1RK5A 2ZZ4A 1JYXA 3V3WA 1JXKA 3EDJA 1FX6A 3CL8A 4QGCA 1M1BA 3MUIA 4NRSA 4OUEA 4JAWA 1XLFA 5M17A 4LRTA 4X9SA 5BOEA 3QV8A 4YLWA 1K8YA 2EG7A 1OB0A 5FF3A 2P0IA 1HJVA 3KVLA 3TZFA 3UR5A 3H24A 2Q01A 1TRIA 3TTSA 3VIMA 2DZBA 3VGGA 4FALA 4V33A 2YL6A 1DWIM 4Q4PA 1IIGA 1GWJA 1GQKA 1CGYA 2E6FA 3QSRA 3V35A 2AMXA 3LERA 4AY1A 3EPOA 3OJGA 1FDJA 2OFJA 2NLIA 3W70A 2A79A 4AB4A 3CQIA 3ECQA 4PRWA 4GYFA 5CBBA 3BGGA 5BRQA 4Y9PA 1XIJA 3HMJG 1FFQA 2DIEA 2ON3A 2J7BA 2NQZA 4KETA 4RE4A 3LENA 3GU9A 4I6KA 5H1WA 3JS3A 2A85A 4B3ZA 1NP2A 1UZDA 4U3AA 2OZ8A 4MYXA 5EMYA 2Z1SA 3MSGA 3ZYZA 3GDLA 1NDWA 3MSDA 1WDWA 2ZDRA 4JFTA 2UZ9A 3M41A 1PKLA 5BROA 5F2IA 1FWFC 4FO4A 4AC1X 2KZHA 4HTBA 4NI3A 4F3HA 3UERA 5LYRA 1SFLA 4AWTA 3R7MA 3A3XA 3VIFA 3MWAA 2D0FA 4W84A 3PS7A 4YYCA 3NQVA 3NOEA 2X41A 3IJDA 3H2CA 1B5TA 4KT2A 4GH3A 4WCJA 3EOOA 5E1QA 1DL3A 5HAOA 3WBXA 3WCZA 5I02A 4BQ3A 3BMWA 3WEOA 1E9LA 3QPYA 2YR1A 1SFJA 1GZGA 2QUUA 1EXPA 1K8XA 3BH4A 3BSMA 3PAJA 1IR2A 3E0VA 2F38A 5JH1A 4PYSA 5IFPA 3T0DA 2A0NA 1DIKA 4UZUA 2RHGA 5BNKA 4G7EB 4PBEA 1QNSA 4XZHA 2WKLA 3QMTA 4LCQA 1GJPA 1R38A 4H00A 3L65A 3AS2A 2WHLA 3GG8A 2D0GA 4D71A 1XBVA 1T6MA 1BRLB 2ZRVA 3PC0A 1NQKA 4NNCA 2J62A 2VGFA 3GR4A 1YADA 2I5QA 1MW1A 2PGWA 4Z2HA 4ECLA 1PWLA 2G4FA 2TRSA 3TYUA 1DWHM 3FK4A 1MW3A 3TYCA 3NQGA 4DB7A 3U2ZA 3G1YA 4UTTA 1TYGA 3USBA 4PULA 3L12A 3GFYA 3D3FA 5A8GA 2NUYA 5DMLA 3PTKA 4N9BA 3ZJ8A 3L68A 1CXEA 1G4PA 1JG9A 4LGXA 1UMLA 2XVPA 5A8QA 5CJ5A 1F07A 1FDZA 2XU2A 3LCWA 2DZAA 4BF5A 3AS3A 2XH2A 4M5PA 1IEVA 3PBGA 3FX4A 1GZJA 3T9PA 3SCSA 1OT2A 1E70M 3KOXA 4KGLA 1UKQA 1XRVA 4TVUA 1UQYA 7ODCA 1E6XM 1IZCA 1V0LA 2YW4A 2FTPA 5HNUA 1VD6A 3QFWA 4G6CA 1FWJC 4DJDD 4DEFA 3OLGA 2XGIA 1JYWA 4J7RA 1E4MM 1RZMA 3GH4A 4DLMA 2Y89A 4F66A 1M41A 4PMOA 4A3RA 5ECUA 3VZXA 4JTHA 4HU8A 4X2RA 1XRFA 3NTYA 3CEUA 5AC4A 3KVKA 5CLTA 2CETA 1C7SA 3T8QA 3FA5A 2YB1A 1SO5A 2WSRA 4WOQA 3PJXA 2C91A 1GW1A 5B80A 3KP1A 1RA5A 5I07A 3PG9A 3PULA 4M8UA 3U48A 3TJXA 5IXEA 3SY5A 1LG2A 1XM3A 3AXIA 2FPYA 1ZPTA 4IL0A 2CLHA 3BW4A 3EDFA 4HGXA 4D6FA 3PY2A 4J3ZA 1QO2A 2V5BA 3L0KA 4TX6A 2XISA 2PI6A 3LGEA 1HJXA 3APTA 4DYJA 3EX2A 3MZNA 5HMFA 5CSYA 3W7MA 4YVXA 3R11A 1E0XA 1JAKA 3IVUA 3GVVA 1JZ3A 1E1FA 1H0GA 4KH2A 2E5CA 4X63A 1UW9A 4AZ5A 1J0JA 3LGDA 4ZO9A 3CT2A 1QBBA 1HKKA 1M6JA 1IYXA 1YRRA 3BE7A 1FCBA 4WDUA 3WENA 3W1MA 3FEQA 1CXIA 2Y7FA 3ARYA 5C8BB 2XIOA 1G69A 3N4FA 4DUWA 1S39A 2GDUA 4AAJA 3PPFA 4IGMA 3LTYA 4JNYA 4L6DA 2WM1A 4CNPA 3UXIA 4I8DA 4LTSA 1K8CA 4ZO7A 3URQA 4CNUA 2VURA 2J6XA 1HO1A 3SDOA 2V3FA 4PR4A 1P0EA 1KFEA 2DZSA 4DXVA 1EF3A 1R3WA 3U5YA 3VIGA 1I2OA 5G2IA 4D6IA 4GGBA 3WEMA 2E67A 3S1GA 4ALDA 1JIBA 3W7JA 1U1UA 1VYRA 4YTQA 4BEQA 1EX1A 4U5KA 4AYGA 4IIHA 5HULA 3EYPA 2A2IA 4IQDA 2YDAA 1PCWA 4HOWA 4NNAA 4O1FA 3ARQA 3EOUA 3FW6A 2I14A 2XH0A 5I2UA 2GQ9A 3LN3A 2R1NA 1YXDA 3WD3A 5HQLA 2B7OA 3PF3A 1O66A 5XINA 3U2OA 4GGHA 3VUPA 4NI8A 5GNZA 4FA3A 1YXCA 1QO5A 1KO0A 1OK4A 3UCCA 4JR5A 1XD0A 3S6DA 5HNTA 3EBVA 1XWYA 3WDJA 4PTVA 3ZLHA 4US5A 4QLJA 3MANA 3TEVA 5U7SA 1D3CA 5C5YA 4FXJA 3VO0A 4M0XA 3WO8A 1KM6A 2GUUA 4AZCB 2RUSA 2OCZA 3L5MA 4A3YA 3DYPA 5E5CA 4N4PA 3H4XA 4GPNA 5DBUA 5C7HA 1H1NA 4GUFA 1J0KA 3ES7A 1WUFA 4XZBA 1J6OA 4X22A 3SRFA 2ZICA 6XIAA 3SQSA 3KRZA 3F4CA 3BAXA 4O0QA 3G1VA 2HK1A 5KMYA 3H2EA 1X38A 4GD0A 4UTIA 8RUCA 1MQPA 1EJUC 1NQ6A 4FX6M 3EWDA 3PB0A 2YCIX 1YPFA 4AHOA 2NSXA 2Z6IA 2PWHA 1PS9A 1W5MA 4U5IA 4FZIA 1J0IA 5H2ZA 3BSHA 1YE4A 4E5TA 3IRDA 4C65A 5MHBA 3QV7A 1JFHA 1BVNP 3RILA 2WLYA 3DENA 2J25A 4XKMA 2BY1A 3UGVA 1O5XA 3FJNA 3NNTA 4D9PA 1OX4A 3MS8A 4J4KA 2CZVA 5DCDA 3IIZA 1IZKA 3LV5A 4GABA 4KQNA 1JL8A 4YPJA 3QOMA 1B9ZA 3ZSSA 3KBVA 3VE9A 3TC3A 4RNJA 4CCDA 1P6WA 3NZQA 4LU0A 3MP5A 5EU9A 1RR2A 3GU1A 2FQIA 1EZ2A 5C9UA 4Y90A 1SO3A 3WK2A 4DUOA 1RQBA 3CHEA 4JICA 4JIPA 2QCGA 5C7VA 4Z2IA 5J8LA 2NX3A 3HGSA 4XB3A 4WDTA 2NT0A 3H2MA 4UTUA 4PMZA 1LROA 3CZGA 1SW3A 2VDIA 2YDRA 3TQVA 1WB0A 1JCJA 3L2IA 3OQEA 1D7FA 1CT5A 2WSQA 4OIFA 1Q66A 3RGTA 1HJWA 4TMBA 2A7NA 3AMKA 2P76A 1ME8A 1T8QA 4ZQOA 3VKDA 1Q3NA 2TMDA 4P7QA 1BTCA 2ZRUA 4ZODA 5I3HA 5D30A 3G5EA 4C5ZA 4FLRA 3ABOA 2W63A 1Q8JA 4BF9A 1T8XA 4LEFA 3E74A 3HZ3A 5C9WA 2HE5A 4GKTA 4ZVJA 3LHTA 3W73A 1ZP4A 1BEUA 3IUHA 2LLEA 3M44A 1W9DM 5AYXA 2IPJA 2G3NA 3AYTA 2XN0A 3ARTA 2V5CA 1KKOA 1PYMA 4DJFA 2E6DA 4GBDA 1VJSA 3VNIA 1PL9A 3QC3A 3FAXA 4DI8A 2VFDA 2ZA1A 1U2YA 2DJXA 1V0MA 3ZJ6A 2Y8VA 3T0TA 1NELA 2DH2A 5C2XA 5JMUA 2R8WA 3KBWA 4ZBCA 2PF0A 3DFHA 1QUMA 3LM3A 4EAMA 1XQKA 4RW3A 4GCXA 3NZ1A 2NUWA 1W1YA 1LP6A 3W6YA 1V3KA 2SFPA 3GG7A 2ESCA 3HQOA 2P88A 4HK5A 4P8WA 1L6GA 5HA7A 1UOZA 1GYMA 5CZTA 4Z2JA 3ITTA 5HANA 1DV7A 1FWTA 3VA8A 3U7BA 2NXGA 4IT1A 2O4QA 2POZA 2EF9A 3DXIA 4PCSA 4MB1A 4RLIA 4C5YA 1PHWA 1S5VA 2WO5A 3WYZA 2DQWA 1XQLA 3KVMA 2C1GA 1TO3A 4IL2A 3DC8A 1VCVA 1GPWA 3DIPA 1W9VA 3AZSA 1UHVA 3AYSA 1F4HA 2D24A 3GTXA 4YHEA 2ZDSA 2VTFA 4GUHA 2J9YA 1V6WA 3UXDA 3MJYA 4UFHA 4JBRA 2YIHA 3KCJA 3MDUA 3S2MA 1O1HA 2VFGA 2OWXA 1GKPA 2X7VA 3WK1A 4CQ9A 1GT8A 1RP9A 2EG8A 4YWSA 1J0ZA 2R82A 1X97A 1FHUA 4CQDA 2XINA 2FH8A 3W3OA 3AMDA 3O3RA 1AL7A 3AOFA 3E9AA 5DFAA 2I9UA 1LL6A 1K6AA 4DWSB 3P80A 3N15A 4LWWA 3LQGA 1E73M 3FGCA 1C3FA 2PP3A 3VCNA 3DYMA 3E0IA 3MI2A 2GGEA 4IWWA 3RRAA 3VC6A 1G4SA 1JDEA 3C5QA 2G3JA 3WQFA 2A6LA 1CB2A 4NXSA 4WIWA 2V30A 5KETA 1A5KC 4DNHA 4QLLA 1UKOA 3WD4A 5FSDC 4F2UA 1UASA 2D2OA 4YTRA 4YTTA 4LYKA 2OJPA 3JVAA 5A2CA 1EO7A 3URBA 4EPKA 3KTXA 5GJPA 2W0UA 3EZ4A 2VGIA 4LYQA 3WQOA 4P7OA 2VX6A 2KAUC 3UG8A 4ZL1A 1KXHA 2UY2A 1VBJA 3CBWA 2VYOA 5GJMA 1F6KA 5CPNA 2GJXB 5CPOA 2FHCA 4FLQA 4PMQA 2XSAA 2PLMA 1B3YA 3RLHA 1W9UA 2G97A 4GVFA 2AGKA 3Q67A 1BKSA 2ZBTA 2PTZA 1E3XA 1SFTA 3ZJKA 4D6DA 3STGA 1BXCA 3BW3A 2BOGX 4A29A 1LORA 3V0TA 2IQDA 3R0UA 3SUTA 4BI6A 4N9EA 4UCFA 2YLLA 1P0BA 2E09A 4LBRA 1UZHA 2D2GA 5DLCA 1TR9A 5HUOA 3NL3A 1JF6A 4X3ZA 4ILSA 1PZ1A 1Q85A 1QHOA 2GWNA 5U4NA 2QUTA 5CBJA 3AXXA 4JTUA 2F6KA 1F76A 4IMCA 2VX4A 3GB6A 2CPUA 4WSHA 3W6MA 4RE2A 1X98A 4K8HA 1HJUA 1Q4NX 3GR8A 4KIEA 3SW6A 3TMLA 2OSXA 4LYPA 4RE0A 3OLDA 3CZEA 3TKFA 1ADSA 3W7IA 1H2JA 3ES8A 3K1DA 4GC3A 5EA9A 3IUDA 2GSEA 4I5RA 1J2WA 1P6BA 1TE6A 1CDGA 1U83A 1HL9A 4HNNA 3AHTA 2H6RA 4DJFC 4QHRA 4YMZA 4KRTA 1IQ8A 4N9CA 1DHKA 2XWDA 2AL2A 3NQ7A 1FWAC 1YBQA 3SCVA 1E6PA 1GOWA 1H61A 2QULA 4HA4A 4PEEA 4D6JA 2VEFA 3B9OA 1SGJA 5HOSA 3U8GA 2IKGA 1ZBVA 3L4WA 1XIDA 2VJXA 5ABTA 2HROA 1GOXA 2YXGA 4ADUA 3UJFA 3TTYA 4P7NA 1OK6A 1FCQA 1P1XA 3S2LA 1AQFA 1EGMA 3MUY1 2DW7A 1GVOA 1XLDA 1MEWA 4ORMA 2J7GA 4UMBA 3GYCA 3UYCA 1UR1A 1XF0A 5JU6A 1PVNA 3WQ6A 1MSSA 1CENA 1QI5A 4QIUA 4IJCA 4MLRA 5EYWA 1GVIA 3QOKA 4GXPA 4JZ5A 3UY8A 3M6DA 2FVMA 1D3GA 4HYRA 2I1OA 5H6HA 4IJRA 1FHVA 1ZL1A 3VDHA 3U5UA 5AHNA 4XUYA 3WDHA 1KCKA 2PTWA 2ZUMA 2DORA 4PL1A 2R14A 2W79A 1CXKA 2I56A 4AZ6A 1TV5A 3CL6A 3CAWA 4EPEC 2CLEA 1B90A 2BSLA 3RLUA 3WD1A 1I45A 3BXWA 2YA2A 3NXFA 2CZ5A 3PPCA 1T99A 2PDPA 1A49A 3UNTA 3IPWA 4BEUA 1GVFA 3PBWA 4J1OA 4WQ6A 3HG3A 5H91A 4ZSTA 3IANA 2Y8UA 5EKYA 2Y24A 4HNCA 2XIBA 1VRDA 5K9XA 4HPHA 1OYCA 4KFOA 1IV8A 2FH6A 1HX0A 3WJSA 4O53A 2RKXA 5CPLA 2ZC8A 1BFNA 1ZU8A 4I9AA 1AW1A 4L9YA 7REQA 3RPTA 4EX4A 1UD6A 1XPYA 3NSNA 4WGXA 1W3NA 2GL5A 2PGEA 2Y4SA 4S3GA 1TMHA 3CEPA 4E4UA 2EPKX 2EEXA 4Q7IA 2X1TA 1AODA 3PSVA 3TN4A 3F4VA 4NQ1A 1NDZA 1V93A 3WF1A 4E2DA 1J4EA 1ALDA 1VYSX 3NYZA 4B5UA 7CGTA 1GJWA 4MJ2A 3G8EA 1CI1A 3RJXA 2G95A 1NFPA 1K9EA 1YLVA 2YA0A 4GVIA 4A8RA 1P7TB 3GUWA 1OYAA 1ESWA 1F4AA 2DT3A 3KZPA 4UB9A 3W7OA 4JIHA 4PZVA 4ZEPA 4ORIA 2ZZ5A 4ERIA 2GVYA 3P8JA 3VINA 1KKRA 4I90A 3GLCA 1E6QM 1H1YA 3MO7A 3BW2A 4M19A 4LUTA 4F2BA 5LNUA 3RR1A 1EO5A 3KAOA 4RZBA 2VUNA 3Q37A 4YIWA 1A0EA 4ZQCA 1LTDA 5A6BD 1Z7AA 2CZDA 1D3HA 2XVKA 3NCOA 8XIMA 3RJYA 3UWWA 1IXQA 5I06A 1QOQA 4H7CA 4RE3A 3ITVA 3EDDA 3LI0A 3A6OA 5AVNA 4XAFA 2Z1WA 3W00A 1EB3A 2QAFA 4IPLA 3R89A 3C2EA 2VEKA 3JU2A 1XLHA 3RO6A 4CQAA 1UD2A 4UOQA 1HNYA 3KFTA 2X0SA 4JIQA 4PCTA 3VGBA 2V3GA 1FXPA 1MQQA 1KFJA 1HL2A 4KEUA 3SGGA 2ZRZA 5FJJA 4MB5A 1CTNA 1M53A 5CKSA 1LWJA 4QJ5B 1P0KA 4HK6A 4MM1A 3TYEA 1JI2A 4GE8A 4H8VA 1VR6A 3OIXA 1OFPA 2WHKA 2VELA 2G3MA 2NQ9A 3O15A 1W1TA 4ATLA 4WDXA 1ISZA 1X1ZA 2UY4A 1PCKA 1QK0A 2VUYA 3JZEA 3PK7A 4EE9A 3GD6A 3WBYA 3WELA 3CQHA 2ZZ1A 1GYLA 4W88A 3WMBA 5AYYA 4L65A 3QH2A 3VIHA 3N12A 3QV9A 2BOFX 2J77A 1W3TA 5C6MA 5AYBA 4QG9A 1R5YA 1RD6A 1PTAA 1CCWB 1U30A 1PJ9A 4LC6A 1MRQA 1HN1A 1XC6A 4RXGA 1MDLA 3OGVA 4RUBA 3MA8A 4HZ7A 1PKNA 1HQTA 1REQA 1TCMA 4UTTC 3PFRA 4AU0A 3NAVA 4GCAA 3RYSA 1DE6A 2Y85A 3SUSA 3VKBA 3W81A 4FNRA 5E09A 4G1KA 5A6BA 3EGJA 5DF0A 1VLIA 3V1PA 4Y6GA 2DZXA 3NM3A 4RR4A 3T42A 3S1VA 1JCLA 5HDRA 2AOSA 3KRSA 1UD4A 3WLMA 2BS9A 1PTGA 3S5YA 3SRHA 4BCEA 2Y5JA 2IQ0A 3LYEA 3ITGA 4NZFA 1E9ZB 3VK5A 4AYSA 1US3A 2ZWZA 1PX4A 2GJXA 4K39A 1GOKA 1V02A 1YW1A 1OSEA 2CHOA 1JRCA 2XFRA 4HOZA 3ID7A 2A3CA 1KA9F 3QC0A 4PE8A 4WDWA 2VD9A 5BU6A 3CAVA 5LIWX 5AYIA 2AAAA 5C2GA 5D2YA 3N9SA 2A4AA 4J3VA 1J10A 4F0KA 1JD7A 1LZOA 1RY8A 2E9LA 4QCFA 2CCRA 4UTKA 3HF3A 1W3KA 3BDKA 3SSZA 5J5RA 2Z26A 4MUZA 1KFBA 1JDFA 3QQ0A 2I16A 4RNHA 1XISA 2JKPA 4PUUA 1IT7A 3WLNA 1PUDA 3V5CA 3LD5A 1O68A 4CGTA 1AUSL 3C86A 1ZAHA 5GNYA 3MY9A 1O5RA 3LX9A 2AKMA 3WQ8A 1V7YA 4WJEA 1SZNA 4TXEA 2Z0IA 3MUXA 4WLCA 3TNOA 4PTMA 3WNOA 4F0LA 1W17A 1Y5VA 3ATYA 1AA1B 1H1ZA 3PVFA 4OTKA 3FA3A 3HGRA 3IK2A 7A3HA 3KHJA 4O1DA 2XZ7A 4K8EA 1FY6A 1I60A 3ONCA 2FVKA 1IEIA 1N55A 3HJEA 2XIIA 1O1ZA 1C29A 1W3HA 4QDWA 4X0NA 3SBFA 1LCOA 3HO8A 3BCJA 1JFXA 3C2VA 3GTFA 1C93A 1KM5A 4TX9A 4P2VA 3G22A 5D8ZA 1BYCA 4HQVA 1J93A 3QBUA 3W7QA 1S3TC 1HT6A 4PUKA 1EHNA 4CVUA 3OBKA 3GXMA 2Z1XA 1NDYA 1M03A 3TR2A 3ITXA 3STPA 1E6SM 4IPPA 1TVNA 1XC4A 2CERA 4M56A 4PTWA 1GQIA 1EP3A 2BXVA 3GWQA 3GO2A 4JTCA 4XX6A 1KCLA 3W86A 2I5IA 3UXLA 4H7ZA 4FIRA 5G2HA 3GNPA 3T4WA 1BVWA 2DIJA 3PJTA 3E02A 4W86A 1YX1A 4AG0A 4GVHA 3IK4A 1GQNA 5LKYA 4R27A 1KBBA 1ZZMA 4O8RA 2GDVA 1LQAA 3KBMA 4IP5A 5AHFA 3KZSA 2VC9A 4LRSA 4CEXC 2WYSA 3GDMA 3C56A 5F4XA 2XZ9A 2OOFA 3OZYA 3FLUA 1DQWA 1R8LA 5K9CA 3VTRA 4F48A 1JZ7A 2CXEA 4HBKA 4Q8WA 3WLHA 2PGFA 2AQVA 3DHUA 2CLMA 4GG9A 1VYPX 5FEXA 1QPOA 2R94A 2QF8A 4DVOA 4US5D 1RCQA 2FKPA 1NFBA 3PWAA 1QNPA 3GX9A 1ZJBA 2BGSA 1GNXA 2J88A 4LS1A 4IQJA 3WBWA 2HXUA 3SM0A 1OJXA 4AF0A 1OX6A 3N4AA 5FF4A 4AWUA 4F8XA 1L6FA 3SIZA 5CC6A 3AXKA 1X7IA 4DZIA 1HIZA 2ISDA 2OEKA 4ROPA 2VEGA 1E72M 3MCMA 2EXOA 2HISA 4O14A 2JFEX 1AJ2A 1A5AA 4BWLA 3MBDA 1EPVA 2D1ZA 4FX7A 3W37A 2PLKA 5M1TA 1V8EA 5CC5A 1DYSA 3DKLA 2ZC1A 1OVDA 5A3HA 2ZYFA 1D7KA 4OFCA 2CLIA 4LAZA 5DRIA 1JCNA 4ZQRA 3LCGA 4DJEC 1GG0A 2HZGA 3SZ8A 1FP8A 1XLCA 1LBFA 3FHQA 3DFPA 4C1LA 1MXGA 2QW5A 5HMEA 1H7OA 3GXPA 4B4FA 3KL5A 4AZBA 1B1YA 2ATSA 4GH1A 4GYPC 4OZOA 5LIKX 3TQPA 1AJ0A 1R3TA 4CU8A 6CGTA 1BGGA 4Z2GA 2QKFA 2YPIA 1TV7A 3AAMA 3C4UA 3WQ4A 1XGEA 3DZ1A 2GVLA 1J0HA 1E0WA 1EJXC 4B9ZA 1S2TA 4LAOA 3OA3A 4ERAA 2DSKA 3WDRA 1QI2A 3IV8A 1K3UA 3W82A 4XVDA 3TP4A 3TXVA 1J2BA 3LMYA 3R6IA 2DZVA 3EA1A 1XIGA 3E0WA 3P3BA 1V79A 3OZOA 1JUKA 4JYFA 2Y1HA 1BRLA 1XIFA 4LY4A 1FA2A 1WDRA 3LXCA 4FR6A 4IPNB 1XDJA 4F2TA 4XISA 3LM7A 3M07A 2R1MA 3UETA 2WBGA 3P61A 4B5XA 4LT9A 3AICA 1IEWA 3U3HA 3B9EA 1KR1A 2F9RA 3S9ZA 1EOMA 4E2BA 1CIUA 1OCJA 2PBOA 3PP7A 3M46A 2XUCA 3EDEA 2HRWA 5AECA 1Q2SA 1VRXA 5CG7A 4JEQA 1WKDA 4DO4A 2CKSA 5CBIA 3E2RA 1J96A 4G1NA 5D05A 1W31A 3DHDA 1CX9A 3OG2A 4AY8A 1UYQA 2INFA 1VHNA 3I7RA 4O54A 5HMDA 5A95A 3MKKA 2YA1A 4NAFB 5KTLA 1I75A 3OBEA 1QXLA 2AL1A 3BLKA 2J13A 1T41A 4YYFA 3EA3A 3G2GA 2INZA 2J75A 5HATA 1UJPA 4AIOA 1Q6CA 3ARSA 4AXNA 3P7YA 1RBOB 2V9DA 3VD9A 2FHFA 1KFCA 4NIRA 1TA3A 1SMDA 1EBGA 2BY2A 5CZKA 3ELFA 3W76A 2QJJA 2UY5A 3CUJA 3D3AA 2GUYA 2BHUA 4ACYA 2WMGA 3ALGA 3LCFA 3LRLA 3HV9A 4IFKA 2EHHA 4HMCA 3UWQA 1R3YA 3MKCA 3RM4A 1TZZA 4IMAA 4LPCA 3VKJA 5EMMA 3TK7A 5BXSA 2QF7A 3VKKA 5D04C 4LALA 3S6TA 4ZR8A 3IEBA 3BICA 2PCEA 1S1RA 3ITLA 2ZIDA 4HPJA 3OPSA 4QP0A 1XLAA 2W4XA 3C2OA 3CXOA 3AJ7A 4BQ5A 1OD0A 3IS4A 4F0RA 3VZZA 1WZAA 4HMEA 3UPBA 1HP5A 3RPDA 2QCDA 4B2DD 2EPHA 5AKQA 1PXGA 1TQJA 4CCZA 1WAUA 3WIJA 3F4DA 4L1WA 3C6CA 2E5BA 1UR2A 3BAIA 1YBQB 1S1PA 4GI8A 1UKTA 1V6VA 5I3KA 4QJ1A 5FESA 4KFPA 4MAVA 3CHCA 2J7FA 2PWGA 5BZAA 3W2JA 3MUAA 3OGSA 1Q45A 3PJWA 4A2SA 3BOLA 2P50A 3V4BA 3HA1A 3CTTA 3SIMA 1PZ0A 1TPB1 1L6WA 5A8NA 3ZR6A 2OLHA 3NGJA 2G3FA 1O5KA 4YCOA 3RPMA 5D2XA 4HZ6A 4QITA 3L4YA 2PDHA 2TAAA 1XYBA 3UJSA 1PX8A 3WMCA 4WF7A 3WQVA 1OFEA 4OOZA 1NAL1 1SR9A 3BZGA 4QROA 1W5NA 2V38A 2WHJA 3AU6A 2V63A 2YYTA 2P3EA 4H9TA 4NL1A 3W71A 4OBTA 3CH0A 1W5PA 3TSDA 5AY7A 4AZIA 2XSXA 4HKPA 3A4WA 2FZNA 1Q13A 2J7DA 2B0MA 1RVGA 3T1GA 3AHZA 2Y6ZA 3RM9A 3ME3A 4NRRA 1UROA 1Q7ZA 4BS0A 3ARZA 5E93A 3R4IA 1HW6A 2PTDA 4A8LA 1XIMA 3QGVA 3WK3A 1IR1A 4ZOCA 3GHRA 5FACA 3FSUA 4UFJA 2INEA 2D0HA 4Z1BA 3VNDA 1XV8A 2ZUSA 3GIPA 1CW2A 4Z2KA 4ACZA 4IMDA 1KC7A 1XUUA 5I0DA 1G94A 3CB8A 2ALRA 1MQRA 2OQHA 1E55A 4S3BA 1HKIA 2XIQA 1TVLA 2QHAA 1UKPA 4HPGA 5SWUA 1CWYA 2WSYA 2WWDA 5T9CE 2OLAA 3VOHA 1XX1A 3CQ0A 2EKGA 3URAA 2WNNA 3F5KA 4GQBA 2QLYA 1L8NA 5EBAA 2WMIA 4JQAA 3GVQA 1J5SA 4ENLA 3NGFA 1WZMA 5T91A 4XD6A 4GQQA 4GJJA 4FNPA 1BTMA 4JN6A 5AHEA 1OINA 5BXRA 3NR0A 3S2CA 2I7GA 4O16A 2XM2A 2GYIA 4IIGA 1KFWA 2P5NA 4IP7A 4IIBA 1K03A 2WZEA 2BXYA 1LLWA 2IUZA 1R3VA 1FH7A 1IT0A 3QZEA 4A3QA 2D69A 1N8WA 3EMZA 3AJXA 3ZQ9A 2CLLA 3GVRA 5CPSA 3TAOA 4A3UA 3EDKA 4E38A 2A7PA 3GH7A 1FOBA 1UQZA 3ABRA 1KV8A 3QMRA 1ZJAA 3GW3A 2CBUA 3N17A 3NFUA 1A5UA 4JCMA 2OZ3A 3CO4A 2FDSA 2X2YA 3BWWA 3QJAA 3NPWA 4TVCA 1FKXA 2NW0A 3W85A 1LOLA 3ZVHA 3ABSA 3IWPA 1VHCA 4NVTA 1CXLA 1W0MA 3LV6A 2FFCA 2OPJA 4S23A 2Z4GA 2BZNA 3LDVA 3IVTA 3W01A 3WDPP 4WSKA 1TJRA 3AYVA 2FZDA 1H49A 4CNSA 9CGTA 1Z41A 3STCA 4Z0SA 2FJUB 3Q94A 4J3SA 4HP5A 4D8LA 2GJNA 4PCPA 2JF6A 2F61A 1JZ6A 2JGYA 2PWDA 2V82A 2WCSA 3W7CA 1L2UA 4ZSUA 4R3UA 5GPRA 4J2MA 1JVNA 1V6TA 2VEIA 3XISA 5AVHA 3SUVA 1D8WA 4QFUA 4AZHA 4KCUA 3SCTA 4K2SA 4NP7A 5KZ6A 1UIOA 1P4CA 2H3DA 2R9RA 2AL2B 1ELSA 5IDZA 3NDOA 4C6NA 3UPWA 3PSWA 1TWWA 3NQCA 4YCPA 2QJHA 3TMQA 1S3HA 2J24A 3LLDA 3FS2A 3GY1A 4HCHA 3VMPA 4JFWA 2P0OA 4MZYA 4IGSA 1KWKA 3ZWTA 4DBSA 4FF7A 4EACA 3QZAA 1LRTA 1R47A 3ZFHA 1EHAA 4OV9A 4Q4MA 4B92A 3TCEA 1DIDA 5AC7A 3T09A 5G5IA 1Q7MA 4ZOBA 3GNDA 4MG4A 4N6FA 1K1DA 4QLKA 2QCFA 3ABZA 4PB4A 1RPKA 1GHSA 2PC4A 3THDA 4P5UA 1A5OC 5LNVA 3U0HA 4PMUA 2Q8XA 4C7DA 3QLLA 1MXDA 4LX4A 5DANA 2QEZA 3FJ6A 1IHIA 2W5FA 4IMEA 2WQDA 3CPUA 1EJTC 4JHZA 3UVIA 1T40A 1U1HA 3W74A 3W23A 5FJUA 4L1GA 1EA0A 4Y9MA 5MKGA 1DTNA 4WY0B 4L4LA 5EFFA 4C6FA 1JJKA 3Q2DA 3VILA 4Q22A 2QGHA 1RD5A 3VOJA 1VBUA 4W5ZA 3GNOA 3QTPA 2JIWA 5GQBA 4DNMA 1MDRA 2V2DA 3E5PA 4AIUA 3C0QA 3VVGA 1Y65A 2ADAA 3GG1A 3REQA 4GI4A 3GAKA 4DPPA 3GC2A 3WG6A 1LL7A 4C91A 3O6CA 5H8PA 2GGGA 2HQAA 1BKHA 3CJPA 1SYTA 3BTNA 3GKFA 5CLWA 1K9DA 5FJPA 4PMJA 4S2BA 3M47A 4MWAE 1EL3A 3WQ5A 5JQ9A 3TC7A 3WNLA 3IJIA 3N2MA 1E1CB 4EF8A 1R2TA 1QPQA 3QV6A 4Q3MA 3B9NA 2V5JA 1VPYA 2C8NA 2YCEA 3SAZA 3I4KA 2OKTA 1XCXA 2WV8A 3APGA 1W37A 2GJLA 1XSIA 3BZJA 1F3TA 1I2QA 3NVTA 2QDHA 3NZRA 3UZWA 3ARXA 2PDJA 2HMCA 3AISA 3IJ6A 3M0JA 3TN3A 2VGGA 6PTDA 3THQA 2PDUA 2E40A 2HPIA 1KBLA 2JIEA 4LV4A 4W85A 3U6WA 1Q63A 4AIEA 3GNRA 4JHMA 1RQHA 1US2A 4ZFCA 3BGAA 3QHNA 1EDGA 1Z3NA 3WMLA 4C7FA 1TR1A 4LAKA 2PGRA 4P7RA 1RQEA 4WEVX 1KLZA 2V5KA 1ONWA 1ONRA 1DJYA 3OBAA 1HGYA 5GNXA 1NP0A 4QEHA 2BY0A 2WZHA 4GZEA 4YTUA 4J2PA 2Y7DA 4KEVA 4O1EA 5EMUA 3N3MA 4JQ4A 1FDYA 1TTJA 4R7OA 5H8MA 3BG5A 5A2AA 3BLEA 4C6OA 1JDCA 4I7UA 3DGBA 4Y9OA 3PAOA 1UWUA 3HPFA 1ME9A 4TR9A 5EMKA 4MY1A 3LU2A 1F9CA 4CUCA 1WUEA 2Z1KA 2ZUNA 1H5VA 2VC5A 1OQFA 3QHMA 4ZQPA 3PANA 1ITQA 4S3KA 4QSHA 2BOEX 1M68A 2MNRA 1A47A 3E6EA 1KXTA 3B8IA 4FOKA 4IFOA 5IDIA 3G1DA 2CITA 4TQTA 4MOZA 3W1NA 4Z17A 3LHWA 4O1BA 6REQA 3LK6A 4IIEA 4NF7A 1S2CA 5JIWA 4ZTYA 1FTXA 2V2CA 2GOUA 3E49A 3ALFA 2VZVA 3WJXA 1EDTA 1TIMA 4JYDA 3BPWA 3PZVA 3M64A 3H54A 2Y70A 2WC3A 1Z44A 4DO6A 2BDQA 3PWIA 3EOSA 1TV4A 4U28A 5BMWA 3C2RA 3NQ6A 4R7JA 3GG0A 1WDDA 3MP4A 2QYGA 3LZ5A 2EJAA 4UQDA 5C9ZA 4FLSA 4OU1A 3UW6A 1ZENA 2WJEA 3LA4A 4K37A 4Q32A 1JUEA 1B2YA 3VD5A 3S1UA 1VFTA 1SZGA 2DZUA 4FNUA 3VGHA 4XD5A 3SUWA 1W8GA 3R79A 4M3PA 4XZ9A 4DUXA 4MWAC 3S6OA 1IWAA 1S5TA 4MZ8A 5FAGA 4D2JA 1XH1A 1B3XA 1BXNA 2RGMA 5C9RA 1XGZA 3AQUA 2G3IA 4JNMA 5FJTA 2YW3A 4XZWA 1LYXA 1OFDA 1ODZA 4ADTA 4MJMA 1ZUAX 4W89A 2HCVA 4DAFA 5LXEA 3G0SA 4UR9A 5I3DA 5E6YA 5LNSA 3U9IA 1L6SA 1YTDA 3H12A 2QUMA 1F8MA 1UD8A 3E3HA 4Z1YA 4UQBA 2ZZ2A 2DVXA 4KBXA 3A24A 2Q6ZA 3WD0A 2VX7A 4OGZA 5ABFA 3NL6A 4H8UA 3BLOA 4M81A 4UTJA 5REQA 1S2UA 4Q8UA 2OO6A 3DESA 3UF9A 1IIHA 4Y8EA 4NJKA 3AALA 4L6HA 3GNXA 1FWDC 1H7NA 4M6UA 2Z29A 1EWDA 3CASA 1KLYA 1JQVA 1VCFA 4FK9A 2H8XA 3AHVA 3CV6A 3W2UA 5BRPA 3TH6A 2WCAA 4R53A 3KBJA 4KW2A 4KKXA 1H0IA 2BGNE 4PTXA 1JCMP 4MWAB 3PUOA 3R43A 4FIQA 5E9AA 3NA8A 1RK6A 3R13A 4AZGA 1Q2RA 1VB9A 5D2TA 2ZZ3A 3PZTA 2X8RA 3WK0A 4PUJA 1P48A 2J27A 3GC5A 4PBFA 2ALDA 1E51A 4DM1A 4QDPA 4HSOA 2XVNA 5KSWA 4Z0JA 1UH2A 3AIWA 4NAEB 3WH5A 3W07A 2Z27A 2FZ9A 2IPFA 3S5ZA 1HFBA 4PMYA 4KEMA 4C1KA 4W4QA 2DV0A 1W3JA 2GWGA 4GY7A 3UXKA 1AQ0A 1WBJA 1KCXA 3LBCA 1K7XA 5XIMA 3WLSA 4DO5A 3MKVA 2WMKA 1KFLA 3PUDA 2GGJA 2PDBA 4JS3A 2QVNA 3VOIA 4X9YA 4ROQA 1POKA 3GDKA 3F2CA 4TIMA 1G4EA 4JIIX 4U33A 4KWSA 2NV9A 1UWAA 3BQ5A 4FSAA 1JPIA 5LGZA 3AHXA 3SCNA 2REQA 2J6VA 2VOTA 4U2ZA 3VIPA 4K8GA 3ISIX 3UG5A 5C55A 3ANVA 3DI1A 1NWSA 1FWEC 3P6LA 3TLQA 3I3DA 3KUMA 3N25A 1NARA 4OUIA 2QJIA 3IV3A 3GDRA 3BURA 3TV8A 1A5CA 2QMJA 3VFCA 4Y8FA 3KL3A 3BLIA 2AMGA 5LZLA 3I68A 1A80A 4IQLA 2OVLA 2Y5SA 1IE7C 4INFA 3VIIA 3S0CA 1GOMA 1Q6GA 4XD3A 4RZ4A 2BODX 1RJRA 4PMNA 5I3FA 4MZ1A 4U10A 3NL5A 3AMGA 1U5HA 3F5LA 1R3QA 3UP8A 2CIPA 1H62A 1QBAA 3R58A 3AXHA 4E8CA 1UR0A 1VFFA 4AISA 4L7ZA 3POCA 3OIHA 1QI4A 4G9PA 4C6LA 4XBJA 3PTQA 4DUVA 3VMOA 2YL8A 4PUWA 1ITXA 4OQVA 4P8VA 3JW7A 3ZS4A 3BSGA 3NEHA 4DJFD 1A5LC 1X1NA 5F1VA 1MNZA 3G1RA 2HNHA 1QNVA 4S1FA 3TROA 4F9JA 4HHMA 3UNDA 4BQ4A 1ZCOA 2X7WA 2EPMX 3CUHA 3IIOA 4JTDA 4KERA 2Z2UA 1IWBA 3B8UA 4QAIA 1UUOA 4LS0A 2J7HA 4CCCA 1A5NC 3BJSA 2H8ZA 2C15A 3UBPC 1XI3A 4DF1A 3QZ6A 4S3CA 4AD2A 1RAKA 3BK0A 3KDOA 1KM3A 3V36A 4Q4OA 2ODOA 2BASA 4U2YA 1NSJA 3DI0A 4CD8A 3C0LA 3RX4A 2JKAA 3SCWA 5LXXA 2WZIA 4GC4A 4RKAA 1VP5A 3M0ZA 4J3TA 3CIXA 1VH7A 3H2AA 4DYEA 4A05A 4I5XA 2IKJA 1HXJA 2VCBA 3APYA 1Q5MA 2NQ5A 3ITCA 4UFLA 3AWOA 1HKWA 3A12A 3FYPA 3GHSA 2ATMA 4UTFA 4WK9A 3MUZ1 4JTRA 2IW0A 4GYJA 1YEYA 4AD4A 3EMCA 3TUUA 6XIMA 2V2HA 3WF4A 2O92A 2EJ1A 3UA4A 3NPVA 3T6CA 4NJIA 3FJ4A 3NQEA 2E25A 4FMVA 1ZSXA 4H9XA 4YU1A 3BANA 4OBSA 3AMCA 3QF0A 4C1NA 1X6UA 3B0VC 2C1HA 4L5ZA 3W75A 5BU9A 3TTOA 4HD5A 4F0HA 4UZSA 3UZJA 3HU7A 3UG3A 1Q8AA 1Z89A 2PWUA 3ZJ7A 3NQMA 2WM0A 1P7TA 2VMFA 4TOQA 4DHGA 3CV7A 1NVMA 4XIMA 2CEQA 4UQAA 4DBEA 5F2LA 4Y9NA 3KVJA 4UFMA 1GCYA 2W92A 3GNNA 3P5ZA 1E5NA 2C13A 4IPIA 4B15A 1AH0A 1RHCA 4H6QA 3UWVA 2CLKA 2OYMA 1V51A 3L0NA 1EDQA 2WZTA 4PCFA 3HOJA 1QDSA 2X1SA 1NDVA 3B4YA 1JPDX 2OLSA 1KTBA 3EEZA 1FWCC 2VVNA 3SCQA 4YS1A 1MO0A 3W1PA 6REQB 3FAWA 4F0SA 3HPAA 1QHPA 3DHPA 1WZLA 3CYVA 3CYJA 4FNTA 5EMJA 2PRMA 1VEMA 4JFUA 4LUJA 4Q8PA 4FAMA 3UXAA 4M82A 3K4DA 1EP2A 4Q8NA 5ENLA 1JYVA 1UA3A 4JGDA 4B4HA 3AIUA 1PIGA 3A5VA 1U1JA 3PBYA 1OF8A 4JPGA 1CPUA 1F3WA 4LAMA 4G56A 1AZ2A 6ENLA 1IEXA 1RBLA 1TKKA 4U31A 5CGTA 4R88A 3D0CA 1QNQA 1Q6DA 4MNMA 5EMLA 1W91A 5F4WA 2C14A 2YYUA 4BHYA 4AHQA 3V16A 3OB8A 2YFOA 3DG6A 3P81A 3IJQA 3A21A 4UUIA 1EFZA 3LNMA 3TNBA 1YE6A 5DQPA 3TCSA 5D9NA 2Y7GA 2ZWYA 4H83A 1JULA 3I7SA 2Z25A 1PE1A 1P1MA 3W1UA 1W6TA 3WLKX 5K4ZA 3SSJA 5D38A 4AZCA 1H7WA 3DFNA 5H8UA 1A4MA 1OC5A 1CGXA 4NX0A 3TA9A 1XL9A 3WUEA 2XN2A 4O28A 1W32A 3MB9A 1TTQA 1YNPA 3N2BA 3R10A 2PU0A 1SFSA 2D73A 2VRQA 3OW1A 4GQRA 4HSNA 4NX5A 4G5DA 4CD6A 1UJQA 1E6ZA 1LQ0A 5AHIA 1YMYA 3VOFA 3E1F1 4I7VA 3LRKA 4QE1A 2V5LA 3O1NA 1O4UA 4BKNA 4PEKA 5HJLA 3NO3A 2XJ7A 4XKYA 1UR3M 3C2YA 4L4OA 2CWXA 4UTMA 3CWNA 4XTDA 4O8AA 5ABHA 5ABFB 4R9OA 4Y2WA 1GVRA 1GOIA 3LQLA 4NJGA 2CHNA 1A53A 2QQ6A 1RXOB 1KM0A 5FI8A 3T4CA 1K02A 4QBXA 1ZRQA 1SU5A 4GWEA 3PZ9A 4DQWA 4PODA 4AY7A 3A5FA 3B8DA 5HPOA 4HNVA 1GYNA 3G6MA 1VENA 5LIYX 1KV5A 1BWVA 1LF1A 3ORWA 3PBVA 3K30A 3NO5A 2NUXA 3TC6A 4Z1DA 3RCNA 1XS2A 5T8GA 4JEJA 1FBAA 4M51A 3PNUA 1QT1A 2E1DA 3R25A 3SEPA 3WKZA 4E4PA 1MMFA 1W2PA 1R3RA 3CUGA 4L56A 4FS9A 2ZADA 2DEPA 3WJYA 3RU8X 3G8RA 3U2CA 1DXEA 3PTDA 4HZMA 2EGZA 2PDGA 3TFXA 4UTLA 3NEVA 2A3HA 4BI5A 4GFSA 2QJGA 3OVRA 3O6YX 1JZ2A 4IXXA 3B8WA 4CCEA 4KCWA 3TONA 2XWEA 3WH8A 3M5ZA 1UIPA 3OGRA 5D33A 3ZOAA 1SW0A 3V75A 4CD4A 5EGRA 2PLCA 4RL3A 4ICNA 2ZQ0A 1DJHA 1JCXA 1CZ1A 3D47A 1YPIA 3DC0A 5FA5A 1EEXA 5CGMA 5A5WA 1CEOA 1EYEA 4XAYA 3TE9A 3VU2A 4WOZA 1T96A 3B4UA 4E8DA 3KS6A 3EXTA 4A8IA 2IQTA 4H41A 3S83A 3LEPA 3THCA 1C92A 4O0ZA 1LBLA 3VFLA 4IG2A 5DT5A 4K36A 4LCSA 4NZCA 2VOMA 1UA7A 3PN8A 4J3UA 1C9DA 1UWTA 4H4IA 5JBDA 1YQ2A 1UCWA 4B5WA 3WQGA 5CSUA 3OHIA 4GIAA 4JTQA 1A3HA 1RLCL 4IGHA 4GXMA 1QOPA 4A4AA 3T0BA 5A2BA 1SJAA 4GQGA 3RLGA 3KM8A 4NAFA 1VIZA 2YDSA 3QR3A 1W5OA 3SO7A 1VLWA 3TJLA 4O50A 2OYKA 5EPDA 3CIWA 1B3OA 4NNBA 1XLLA 3T7VA 3R1ZA 3NQFA 1G01A 3AIQA 1XYLA 7ENLA 5CZJA 3VD3A 4AC7C 4MWAD 3EX1A 1Q6OA 4URIA 1M7PA 1SM9A 3RK8A 1TFVA 1YTKA 5G4EA 1E4LA 1LT8A 4W7UA 5D32A 1EJ7L 3I6EA 2OG9A 1OFAA 1L6YA 1BD0A 3TJ4A 3O16A 1XBZA 3WNNA 2BVTA 2BP1A 4S2CA 5IOBA 1V3MA 1DJGA 1ZS2A 1KD0A 2ISVA 1PHQA 3A4AA 3KP0A 4J40A 2P8CA 2XH4A 1CGWA 1CBGA 2O9RA 1OM0A 3P67A 1W9BM 2QDGA 1VF8A 3T08A 2ASHA 4PMXA 4JTTA 2B7NA 3ANUA 1DXFA 2Y2WA 1VPQA 1ZTVA 2HVNA 3E2QA 4PC8A 3UVAA 2PODA 4QQ3A 5JUVA 3QMSA 1S2WA 4Q8QA 1QNOA 2OKOA 4KRZA 5I3JA 2VQTA 3A4JA 4G8TA 3H22A 3H7UA 1KWGA 2G50A 4QTGA 1OT1A 2WZMA 1N8IA 2OQYA 4MHBA 4UNKA 4B3KA 2NVAA 3NPXA 4ZXLA 1P5BA 3R8RA 1KBJA 1QW9A 1M7JA 4XBKA 4POCA 2A6NA 1VBHA 1ME7A 1XIIA 4JDYA 2EG6A 1JCTA 4MJ4A 4EOUA 4MVAA 3ATZA 3RHGA 4B16A 3RM8A 3QY7A 1C90A 4EPDC 3S9YA 1JPKA 2XFWA 2XGZA 2F8QA 4FB7A 1BWKA 2BMBA 3TX9A 1GOQA 4O52A 2OELA 4HNTA 2DGAA 2ISWA 2XIJA 4WD0A 3SY1A 4AF0B 1OCNA 5C9XA 3ITYA 1JYNA 2NSOA 1EIXA 3VNMA 4MMWA 3QGAC 2QR6A 3UJEA 4GYPA 3WFZA 4LUSA 3W2MA 2W67A 3DU0A 5G4HC 3OP2A 3KRBA 4X0VA 4C6CA 3NIYA 1O95A 2GUBA 1XW8A 4DJDA 2HBVA 1QTWA 2J9ZA 3LCHA 2G37A 2X09A 3CL7A 3FHAA 4DO7A 3W28A 4G7FA 4JL2A 2YZ5A 2IMRA 2POTA 1E0VA 1X96A 1R0MA 2XG9A 4MLJA 1PDZA 4DYKA 2WKGA 2YZRA 1MEIA 2E9MA 4FOJA 3S2NA 3DUGA 3UD6A 4LNCA 1SZFA 1DJIA 3LG3A 3SECA 4W9TA 3BCFA 1W3LA 3WF2A 1VPXA 4LAUA 3W2KA 5LHFA 3R8GA 4ASTA 5AC6A 1PX3A 3T8LA 4AVNA 3WY1A 3CPGA 1E6RA 4JTIA 2ZKMX 2YCLA 2E5DA 3MMDA 2WMFA 3R2GA 1H4PA 1XRTA 2X1UA 4WKHA 1I0DA 3FNDA 3NQ8A 5M03A 3ZWSA 3AZTA 4BR1A 4X60A 1VFSA 2O4MA 4GO8A 2F2KA 4GNKB 5FF2A 3QFEA 2H90A 1KQZA 4AW7A 3W1QA 5IHRA 4W7VA 2VFEA 3LBMA 4UCGA 4Q6XA 1J6PA 3A13A 6ALDA 1V3IA 3QKEA 1C91A 3LB0A 3AUOA 5ABGA 2J66A 3BQ6A 3V18A 3WJZA 4JCLA 2GK1B 1UOKA 3WNKA 1Y8BA 4HOXA 3CTLA 5I5RA 5HR7A 3KBSA 4F9DA 4GNVA 3EOLA 1B30A 1XLBA 1DJXA 2Z2AA 5BOOA 4PN2A 2E6AA 4KIRA 2O56A 2WMIB 4GXWA 4DZHA 3I10A 1V3LA 3DECA 3N2XA 3KTCA 2VX5A 4ZTXA 4CD7A 2FJKA 2VZTA 2ZRWA 4HYWA 1BHGA 4UMAA 3W7HA 3K46A 4DWSA 1W56A 2FHBA 1T0OA 3GAYA 1OGGA 4H9ZA 2XFYA 3QHOA 5A6MA 3B06A 2WXDM 1J01A 1OFOA 4MNJA 4KF1A 3CV1A 3GSMA 3L9CA 5LSMA 3SQLA 4HNUA 3B97A 3SGZA 1MWOA 2ANUA 3D6NA 2NT1A 2ABBA 4C6KA 3MMUA 4Z1AA 1DXIA 3ERPA 3C61A 2ZE3A 3E0FA 1A5MC 4ERGA 3KOYA 5TAOA 4ZB0A 1QNRA 4Q4QA 1VIWA 1OC7A 3MWCA 4BF7A 3F2DA 4AH7A 2CFFA 2OX1A 3GTIA 2YBTA 4ZFMA 2OQLA 2J78A 2ACUA 4CQBA 1LLZA 2E8ZA 3N18A 2PDKA 4QE4A 4GRSA 3S1XA 4JKMA 2BV9A 2V8ZA 1WDQA 3AI0A 4NU7A 1SVDA 1TV3A 4GX9A 3TYAA 3SQMA 3TYZA 1XUZA 2C0AA 3STFA 5JH2A 4LANA 1NWTA 2O55A 5A6AA 4OBRA 2DZPA 3GH5A 2A5HA 2JALA 3F5JA 3G1XA 2AGTA 4Q7NA 3H6OA 1JXJA 1VAHA 3WZ0E 1XIBA 3WD2A 2WJZA 1GTEA 3EPMA 5EBUA 4NHVA 1HO4A 4XVEA 1HJSA 4H1ZA 3ABXA 4PFMA 2PMQA 3NQAA 2V3DA 4UIOA 3ABQA 1SPQA 2FZBA 4PA8A 1XXXA 3W7EA 1EA9C 3VD4A 3A9IA 2PRLA 1TIWA 3M7WA 3EPNA 1Q6FA 3GXFA 3GXIA 3ZR5A 4B2DA 4DBUA 3SURA 2VR5A 4S39A 1JEZA 2E1WA 4O15A 3BOXA 3DBNA 3WQPA 2O7SA 4NKCA 5DMNA 3QN3A 2OT0A 3TFCA 1GKRA 3FYOA 1OYBA 4BI7A 1W9PA 3GFXA 5XIAA 2NXHA 4TU1A 1Z8AA 4GACA 7XIMA 4L9XA 1F3EA 2F6UA 3MCOA 5DMMA 2CBIA 3G24A 2YSWA 4HVXA 4HA0A 1F74A 1FHLA 2CZFA 5CPQA 2OZTA 3I3BA 4NZ5A 3M5XA 5E0KA 1TE1A 4DI9A 1ITUA 1P0DA 2WQPA 1KGWA 1THFD 1MFVA 1EC7A 2NWSA 1EQPA 4W7WA 2CU0A 1ZGDA 1C8VA 5B7YA 4UR7A 2H9AB 4ES4A 1U22A 3AIRA 3TW6A 2XVGA 1R46A 3OYXA 4KS0A 2YXXA 3VXGA 2Z00A 2D20A 4W8LA 2QDEA 4LVDA 3W25A 1TA3B 3CQKA 4B5TA 1V02E 3WUBA 3L4VA 2DVTA 1TJ0A 3B8SA 4J3XA 4WHBA 1FXQA 1XINA 3WF0A 4XTIA 3L7RA 2CESA 1XICA 4JL1A 2WKJA 4NYYA 5FL0A 2NV2A 4L4MA 1MZHA 3TXZA 5I77A 1JDDA 2WVSA 1DP0A 4QDMA 2PDLA 3OOQA 4LBUA 4O4VA 2XGBA 2GGHA 3IIVA 4NUWA 1R9XA 5AZ1A 3GZ3A 1RCXB 1OX4B 3KXQA 1BVZA 4J27A 1UZ4A 3MPGA 4FPSA 3L4UA 1EC9A 5L9FA 3F4NA 2FTYA 1TMQA 1UPMB 4IIDA 1L0PA 5C71A 1U5VA 3B03A 3T78A 5A6LA 1J0YA 3CMFA 2XH7A 1M01A 4JFVA 2BHZA 1YIXA 3M5YA 1Q6EA 3LPPA 3IGSA 1WQ5A 4GLEA 1J18A 1JD9A 4V2XA 1SMAA 3CNYA 1LWHA 1K9TA 2F2HA 4MKVA 2D2HA 4RPPA 2Z2BA 2QIWA 4JN8A 3MU7A 3LHVA 1UWIA 1ZJHA 2VEMA 1G0CA 4E6MA 2VM8A 2QT3A 3B8TA 5JIPA 2BB0A 3S4TA 3VZYA 1NOFA 3B8VA 4XZIA 3KOFA 3WN6A 4AUBA 2QCMA 3OVQA 1XIEA 2CZEA 1I2NA 1Z9AA 1P43A 5CAHA 3MC5A 1OADA 4S38A 1VEPA 3T40A 5BW6A 4Q4KA 2AAMA 5EY5A 1AMKA 4IGNA 1DORA 3WLJA 3G0UA 4LF2A 3TN6A 4REQA 3UT0A 1KM4A 3HFTA 2YOCA 2O9OA 4N7QA 1K4HA 1OG0A 4V27A 2VFFA 1YDNA 3H2NA 1ECEA 2YCKX 1GQLA 3QRHA 3K4WA 3USZA 1K77A 1VFOA 1CB7B 2AQOA 3II1A 2DT0A 2Z1VA 3MVTA 2FZ8A 1E56A 2PUZA 3KX6A 2Q3RA 2QDDA 3DOPA 1EP1A 2BTMA 3C0JA 2WSPA 4Q7BA 1E5JA 5E9XA 3W83A 3A47A 4DELA 4EXQA 3DFYA 4QNWA 3WLIA 2PS2A 4Y9AA 1H51A 3VDGA 3NM1A 3RG6A 3L5AA 4FEZA 4XO6A 1MI3A 4LS2A 4M7TA 2PDIA 4UR8A 5AYZA 4AVFA 4F4RA 3T2PA 4A6GA 3BO9A 3D5HA 4JTAA 3W7DA 1Z32X 3MTWA 2A3AA 1WOAA 3DCPA 1EH9A 1PEZA 3HB9A 5E70A 1XKYA 4FLOA 2GGIA 3OU8A 3ZR4A 3QR1A 4MGGA 2B31A 4KESA 4I6VA 4XBSA 2CLOA 3W7KA 4AIBA 4HZ8A 4GMEA 1ZFJA 3FCPA 2WK2A 1LQ2A 3UWZA 3EMQA 2WSKA 5FSEC 2ICSA 3WQCA 4IXHA 1FH9A 3VM5A 4O4WA 2YXOA 2ZX9A 4KWWA 3EX6A 2UV8G 2VZOA 4LBSA 4H2CA 4HSHA 3I7QA 3UFYA 1GHRA 4L1XA 2BGQA 1WKYA 5M5DA 3RIKA 3GXNA 3ZMRA 1CYGA 3WFAA 4HNLA 3H8AA 2ZXQA 2YX0A 4GHRA 2WHMA 3TTEA 3BAJA 3G0XA 3SN1A 4DWSC 3OZMA 3FVDA 4C6EA 1NM9A 5PTDA 4IP4A 5CJNA 1WYIA 3GE7A 1HL8A 1MUMA 5FL1A 2PF8A 1TV8A 3EWUA 3N9KA 4GVGA 4IFRA 3LSCA 3T0AA 2PU1A 4MNKA 2DVUA 4UNIA 4XV0A 8TIMA 1REQB 4HJWA 5HINA 4QNEA 2HBXA 4Y96A 1G4TA 3EXSA 1XSJA 4PRTA 2QCCA 4YL2A 1OC6A 3R8HA 3BL3A 4N0RA 3UY7A 4EVZA 3W7LA 4MPQA 3WL1A 1WDSA 5ABEA 1WPCA 4FXRA 2FMNA 5F2MA 1Y5WA 1TPFA 4N42A 4GX8A 2QV5A 2GPTA 1XDMA 3W1RA 5G1MA 4H8NA 1BG9A 2PWVA 3MSYA 4Z42C 3DFOA 3KCOA 4C6MA 4DF2A 2PP0A 1JQXA 1MEHA 3AUJA 1CNVA 4AVOA 4MADA 3H23A 1QI3A 2A3LA 4BWLC 2Q3OA 3UGRA 1NY1A 2VR4A 3WQDA 3K5XA 2WVVA 2PDWA 1I2RA 1TZ7A 2J8FA 3LMZA 1S2VA 3NQBA 5LHEA 3ARUA 5FJRA 3UG4A 1X8FA 1ISXA 1NWRA 1LT7A 3L5LA 3S3GA 1Z6KA 3P0WA 1VBRA 2DUXA 3PZNA 2FTWA 2WC7A 2DJLA 2HVMA 2ZXAA 1GVEA 3P14A 2ONEA 1CECA 5FOOA 4H9UA 1XG3A 3B04A 5BCAA 3NQ2A 2QUNA 1ZAJA 3J7HA 1MYRA 2CHRA 4WXZA 1BQCA 4LSBA 3N34A 2XDFA 3PZUA 1B3ZA 3WEZA 1WXJA 1IGSA 4RX0A 1E43A 1IXOA 3JZUA 5CG0A 3R0KA 3UZYA 4K7YA 5KZEA 3O0FA 3OZPA 3S8HA 1Q6LA 4NZJA 4XD4A 1ZLPA 4RW5A 2VGBA 2PTXA 5G1TA 2Q8LA 2NX9A 1TJ1A 1XYZA 4CU7A 2E77A 4HCLA 2V81A 3ARRA 1KNWA 3P8IA 4D6HA 1H09A 5I03A 3BG3A 2VT0A 3W1AA 5F7UA 2ZTJA 2PDYA 5F1UA 1FFRA 4H2HA 3M4HA 5TF0A 3WL0A 3TIMA 3GQYA 2CWNA 1Z69A 3MI6A 4S3JA 2HNEA 3FSTA 3W9ZA 3G3DA 3HIJA 4OT7A 4PL2A 4Y7EA 3V5FA 2HE8A 4ZCWA 2JGQA 2E28A 4NYUA 4PGLA 3HBLA 1FCUA 1B9BA 4H7VA 2HTMA 5HJXA 1AL8A 1N7KA 2UWFA 1TWDA 1GORA 2CKRA 3P0XA 3B0XA 3MYPA 3UU0A 2VL4A 2QPUA 2CNCA 3TDFA 2YBVA 1K9FA 1A50A 2ZA3A 1OCBA 2XFFA 4IJBA 1UP0A 4EWJA 2DFAA 2QCLA 1OFQA 1LUCA 4MWAA 1W1A1 2L5HA 4QRNA 5C54A 3DGRA 2OR2A 1DWFM 4C6QA 4H04A 5CZSA 1F05A 1RV8A 3PUGA 4S3EA 3MI3A 2C19A 2VFIA 4GI6A 1ZBWA 3CUXA 1FRBA 2E3ZA 3I6RA 3T55A 1Y5XA 5FIPA 3EWXA 1WNOA 4JXCA 1EJRC 4TTGA 2X0YA 1OZMA 4MTVA 2ZX8A 1KW1A 4OOUA 3RX2A 1WXZA 3YPIA 2ZVRA 2JK2A 4L9ZA 1EJVC 1TPVA 3LPGA 1H7RA 1WAWA 1YDYA 2QCDB 5HWMA 1QR7A 4EXAA 3HQ1A 4YN5A 3TYDA 4LVFA 4J28A 3CLMA 1E9YB 1RCOB 1UH3A 1V7AA 1WCGA 3C8NA 2GFTA 1OGSA 3MVIA 3FDKA 4EWND 1F6PA 1W9XA 3MW7A 3SY8A 4JQ1A 3LLFA 4C6IA 2DSVA 1R9YA 2PDXA 1OBAA 3RXZA 3PTMA 3WQEA 2XPKA 3OLIA 1DE5A 3NZGA 4NSBA 4FHAA 3GFZA 1POJA 3U4FA 3TQKA 3UCQA 3OLEA 3GDTA 5FAJA 5A6KA 2XSBA 1LRQA 4GIEA 4KMQA 4RDZA 3W1TA 1AZ1A 1WA3A 1LWIA 1PZ3A 3V5OA 2DY3A 1GZ1A 5DN1A 4MIMA 4MF4A 1S2AA 3DAQA 1L9WA 5G2WA 3C52A 1GKQA 2QXWA 3QPZA 3ZM8A 2DIKA 1TCDA 1QMLA 3LNPA 3WDQA 3NXLA 1NJJA 4TX8A 2O7QA 2QAPA 3RRXA 2HK0A 3LHYA 5BRBA 8A3HA 2IPGA 4QE5A 1YXYA 3CQJA 2E68A 2VQUA 4HJFA 4EXBA 4MKNA 5M2FX 5CPTA 3CZKA 5K9DA 5IBXA 1W2VA 1TPH1 1N82A 3EWBX 2OU4A 5I23A 1FUYA 3L66A 2VC7A 3W1LA 1EIBA 2VP8A 3VGDA 4E0CA 2VEPA 1JDAA 2I17A 4U3CA 3PZMA 1RVKA 2WB5A 2XVLA 4CNOA 3LGGA 3N2TA 3RF9A 3KEHA 1TPEA 4RZ6A 5C0QA 4GK8A 1Q65A 2WNWA 2VHLA 3MV01 3KHDA 5LNRA 2YDQA 5LA2A 1EJWC 3AIEA 3T81A 4MB3A 4E2OA 3H7RA 1M65A 5KEZA 1PYFA 1QVBA 2J8GA 3O05A 4GI9A 4I7WA 4CN6A 3HG2A 1OG6A 3CWOX 3E2SA 3H7VA 3BOFA 1ONEA 2PLJA 4XAGA 4XAPA 4ZMGA 1H41A 1I4NA 5BYWA 1AD1A 2PRHA 4AEFA 3W27A 1VFUA 4JKLA 1LBMA 1TPUA 4KEZA 4A3HA 1C9WA 3UESA 1C8YA 3V0UA 4L64A 4I8YA 4RV3A 2P1FA 2FB2A 4HTYA 3KOWA 9XIAA 3FGCB 4DLFA 1AD4A 3E2VA 1HVQA 4HMNA 2RDUA 4H9MA 3FIGA 3VGFA 2Q09A 3QW4B 4J5NA 4UTWC 1RH9A 1QJWA 2NQLA 4D6GA 3D46A 3QEZA 1J12A 2DUZA 2GOKA 3PJUA 2O0TA 3W38A 4IOTA 1JPMA 3PR2A 2A1YA 2WC4A 3UR8A 4O18A 5EL1A 3WBEA 2PFHA 4YVVA 4DZAA 1HKVA 1ONXA 4NY2A 3ZT7A 3S47A 1XYMA 4N6EA 4K1WA 2F6XA 1H5YA 4QSFA 1QPNA 4QS6A 2MUCA 4C6BA 4GO9A 1M04A 2XTKA 1G1YA 3KBNA 1V6XA 1XH2A 3K4AA 4C6DA 2UY3A 1AVAA 1SO6A 1UD3A 1ICSA 1TMLA 4B5VA 3H53A 1S5MA 3SCPA 1RBAA 4O0KA 4M1RA 3DN5A 4DAIA 3CGTA 2DT2A 5A6JA 1GG1A 3SR7A 2QVHA 1M5WA 5G1YA 1JGIA 1XHGA 5DT7A 4HYVA 3FKRA 2IKHA 1FCVA 3TN5A 1E1CA 4ACZB 4W8BA 4EANA 3F1QA 1ZAIA 4GZIA 1YDVA 4HHPA 2ISSA 2J7EA 2PDNA 2CW6A 4LV9A 4CD5A 3A3WA 3BCDA 3F03K 3W02A 1EKOA 4V15A 3GU2A 2RDWA 3ONBA 3WDIA 1AQHA 4KCVA 4B5NA 2FVLA 1VQTA 3THAA 1XYAA 5CC7A 2MANA 1I8JA 1DVJA 3U4AA 4JY9A 1GTHA 3B3DA 1VJZA 1CLXA 1Q6QA 3SI9A 2OSWA 1EGVA 3RMJA 1W1ZA 3P5YA 4HMDA 1P6CA 2WW5A 3ZIZA 1R2RA 3TW9A 1VCGA 3UEQA 4IM4A 4CQCA 3O63A 3RITA 4Q4RA 4MAZA 3F7JA 4H3DA 1BPLB 3G1HA 3OO2A 4NZ3A 3OHMB 1XLEA 2EPOA 3WNPA 2B4GA 4RV8A 3OVGA 1C8QA 3WLRA 5EFDA 2J4GA 1WV2A 1U5JA 2QV4A 4AXKA 4HN8A 4JQ3A 4DXXA 5AC5A 4Z1CA 3PM6A 1T7LA 2J47A 4FXSA 3AZRA 2VDHA 2QGYA 1F61A 1UBPC 1OZQA 1DTUA 1ZQ5A 3BLFA 1D8CA 3WUFA 2BNJA 5FKYA 1XLIA 3WLOA 5I78A 3H4GA 2IXVA 4ZZ9A 2WMJA 2A21A 4IISA 3EWCA 3VE7A 3BC9A 3SN4A 5D2VA 6TAAA 3CPRA 1EWEA 1O6IA 1IXNA 4MB4A 3NWRA 3S5NA 1WKEA 1ISYA 1MXSA 2GVEA 3NYDA 3FYYA 3BV4A 3WSUA 3VNLA 1QK2A 1ADDA 4V1XA 2F84A 2QMKA 1ML1A 5JBFA 2OSYA 1AH4A 3GTHA 4RK8A 4UMCA 3FJLA 3GTNA 4FXFA 4NJHA 3TQ0A 2RJHA 3DFQA 2EPNA 1ZHAA 2ABAA 5IM51 1AH3A 1TWZA 4B91A 4A22A 3ZZ1A 4O11A 2OWWA 5A94A 1BSIA 3DG7A 4LUIA 1OF6A 3G6LA 1W1PA 1C8XA 1TREA 4Q33A 1TX0A 3L4ZA 3S5SA 5AZ0A 2KX9A 2PB1A 4MPKA 4RDVA 1NFGA 3WBAA 3ZVHB 5JBEA 4B3LA 1YNQA 1AG1O 1QHZA 2O9PA 4PSRA 3VNKA 1FWHC 1SZEA 2ZCGA 2RH9A 5K4XA 4LJ3A 2H3BA 2E7FA 3FV9A 1DWGM 5I79A 4CLMA 4RJEA 4S3FA 1YTEA 2Z7KA 1NWUA 4KFNA 4KWVA 3Q65A 1AW2A 3VMNA 3B0PA 2VCAA 3N3TA 1FWSA 1V0KA 2ZX7A 2D2JA 3AWNA 3PWGA 1EC8A 3TU9A 2X1IA 4MY8A 2WMHA 5HNNA 2C3ZA 1R86A 2WVTA 3CC1A 3GHUA 4L6OA 1G7UA 1RUSA 5DO8A 3TSBA 3BLLA 4XQ6A 4OWGA 2NVDA 1W54A 4UOJA 1DEDA 4OV4A 3WFLA 4ZA0A 3TYBA 3NQDA 5HXMA 1FVPA 4CN4A 1LOQA 4REQB 1R7OA 1QI0A 2CXGA 1E6NA 4LH8A 4M24A 2PP1A 3N11A 3QYSA 3PPHA 2WANA 3GBDA 5CSRA 1GJUA 3EX4A 1V08A 1EXBA 3UYIA 1F5ZA 2WPBA 1KRAC 3IJLA 5HPCA 4NZ4A 3FA4A 3V1HA 3GYEA 4RDWA 3K1GA 2Y0FA 1NH6A 2X1RA 1NF7A 3ANYA 1V4YA 1OEPA 2G0WA 4AEEA 2VO5A 3L2LA 3CWHA 3W7RA 4XG1A 3E96A 1B57A 1I6NA 4K1GA 1XCFA 4CN1A 4MDPA 5DY2A 3TOYA 3BAWA 3KWXA 1GEQA 1SJDA 1KTCA 4GNJA 4BFAA 4LF1A 3OVPA 4DY1A 3DBPA 4ZE4A 3BAYA 3BVJA 5A6SA 5EB8A 3DX5A 4GUIA 3SFWA 3CZJA 4C6JA 1TUFA 4O19A 2EQDA 2VENA 1QCWA 5FEPA 3MDWA 5A8PA 3KCLA 1XBYA 1XFCA 4YNGA 4GY1A 2VXNA 2OWCA 4DF0A 4RZ5A 1MVYA 1PZ2A 1V3HA 2YL9A 7PTDA 1JNDA 1KB3A 3M0IA 3O06A 4AWSA 4NZ1A 1JI1A 1DJWA 2ZZ6A 7TIMA 1HZYA 1XRSA 2GSHA 1R87A 3E5BA 3IACA 4R85A 4JNZA 3S5OA 2QJNA 5REQB 1E4NA 3QM3A 3L21A 2B7QA 3GZAA 6TIMA 3R94A 4GUJA 3VNYA 4A21A 2YCLB 1FP9A 2W66A 3BJTA 4J9JA 4WR3A 5FEWA 5AHMA 4LXFA 1S46A 4LVGA 3P60A 2PDFA 1JZ5A 2D23A 1WBHA 2X16A 3DFTA 3EOEA 3M0LA 3IIPA 1B0IA 3SJ3A 4YXGA 3SRKA 1NOWA 3QW3A 3QQ1A 3SB0A 4D6CA 2OTDA 2X2GA 2JBMA 3AC0A 3W87A 3C8FA 1M9HA 1KXVA 1KXQA 1ZBKA 5DMYA 3W6LA 3AIBA 1V6YA 5RUBA 1MNSA 1XYFA 2DSUA 3RN6A 4K68A 4QS5A 1LM1A 5FJIA 1LRNA 2NZLA 3FXYA 4CNTA 4H6KA 4IICA 4XKYB 2C1IA 3GBEA 3NSMA 3VD7A 3AFBA 2F7FA 1I9CB 4QG6A 4UNLA 1KGUA 3TAKA 1X1OA 3F4WA 4W5UA 3F2BA 1HGWA 3M43A 2E9BA 1SUXA 3H4WA 1VJIA 4N4QA 1WO2A 8CGTA 1H7XA 1R2SA 5IRPA 1QAPA 3CLWA 4JKKA 4HNOA 4ZOAA 5DBTA 2FYMA 3TA6A 1WP6A 5F4SA 3ZT5A 4UQ9A 5DCEA 2BVDA 2WJDA 4DX3A 4PSPA 4JQ2A 1UKSA 3A9BA 4J35A 1DWJM 3TOPA 4JFSA 4IMGA 1X7FA 2BWGA 4LOCA 1CLKA 4H8HA 4IFKB 3U7VA 3ZLFA 1PSCA 3W26A 4JTFA 3HQNA 5AOUA 3A23A 1LJYA 4P61A 3LRMA 2GVGA 5CH9A 3UA3A 1TQXA 1UR9A 4OECA 4EPBC 3BG9A 1LG1A 5HQMA 1PDYA 4Q8OA 1HTIA 1F8IA 1LUCB 1TPWA 1HKMA 4UWMA 4WXYA 3TLLA 4OJYA 5KITA 1EJSC 1EQCA 3PZQA 1AFSA 4EKJA 2IKIA 3HM7A 1W3IA 3LI1A 1G9HA 1GEHA 2DH3A 2C18A 4LVBA 3UWEA 3K2GA 4HPNA 4MFEA 2IXUA 4AMCA 5JXQA 1OWQA 5BMXA 1XGDA 1S5NA 3CMJA 4DJEA 2A3BA 1EYWA 4GZ7A 2ZVIA 4DJDC 2C7FA 2RAGA 2YKKA 4ML9A 4TMCA 3CT7A 1TWSA 1FKWA 2REQB 4HHLA 1VC4A 5I00A 1Y0EA 2JF7A 4JDBA 3AIVA 2VZSA 1TSIA 5CXPA 2R1LA 5HQEA 1SJBA 4JIEA 1K7FA 1RALA 4YWIA 3NOYA 1IF2A 1UWRA 5HR6A 3IIXA 3IAQA 1OX5A 3M1ZA 5D4YA 4ZB5A 2GVJA 3HG5A 4WJ8A 3MSRA 4LCRA 1EEPA 2Y62A 2ZRYA 1ADOA 2ISFA 1XR2A 3P93A 1TJPA 1EPXA 1PIIA 3H21A 1ZALA 5F2GA 2NLYA 3T44A 4IUGA 4X61A 5A69A 3GR7A 3N6JA 7REQB 3G18A 3W7PA 3QYQA 2GSJA 4EK7A 1BGAA 3S42A 2XIMA 5AN7A 1NEYA 2JQXA 5KZMA 2VR2A 3N73A 4MKSA 1H11A 3CAKA 3UWYA 3ITOA 3MP3A 2CC0A 3FFSA 3AXMA 4ZGYA 3N6QA 4BY3A 1UC5A 5CAKA 2PTYA 1KBIA 4I9TA 4D1JA 3LPFA 2GDQA 1DQUA 4TO8A 4C7GA 2DW6A 5AB3A 4G2DA 4RCXA 4JTEA 1UBSA 2V68A 3LCIA 3C2FA 1XLGA 2G8ZA 1QU4A 3CK5A 5BOFA 3A3HA 4IX0A 4IPJA 4NASA 5I09A 4ZE5A 1R85A 4GISA 1MZRA 2PDMA 2Q8ZA 3HGJA 2HPMA 2PAJA 3LSBA 2QCEA 3OA5A 4V28A 1WXYA 4GZJA 2ZX5A 3IJ8A 4YTSA 1Q7QA 4KWOA 2DPEA 3SCRA 3GHTA 3KL0A 4XWUA 3EX3A 4CQ8A 5I24A 1O60A 2ZX6A 2I57A 1FWBC 1XLMA 5DX7A 3KW3A 2DDXA 1NIUA 1FHDA 3WH9A 2CBJA 2PSNA 2PD5A 2BFGA 3QVQA 3CHDA 1UZ1A 2TYSA 3MHGA 1PPIA 1CGVA 1ICPA 5CSSA 1DWAM 1F7BA 5CGQA 3E0LA 1W1B1 2QIIA 4WY0F 1K8ZA 3O8AA 2BBFA 4HHHA 3LTPA 3VM7A 2CLPA 5D9OA 4WSJA 2CYGA 3BARA 3MBFA 1QRQA 4FOUA 4E3TA 4I9JA 1KM1A 3GXDA 1O7AA 3CZ8A 4FF5A 1CXHA 4BZYA 2ZUWA 3WH6A 1OGBA 2FIQA 3EAUA 4AWEA 4N2YA 5D03A 4GA8A 1X8CA 3KRUA 2J79A 3H70A 3KLLA 1BQGA 1E71M 1SZRA 3RLVA 1A5SA 3RR4A 1MUWA 1SQ7A 5TNVA 1F2JA 3TR9A 3K8MA 3PBUA 2QUVA 3O6DA 1B31A 2D3LA 2QPSA 4W93A 1UB3A 2D3NA 3VOGA 3JUGA 1XPGA 2WNQA 4N02A 4XIAA 4CVWA 4PMRA 2FMOA 1FQ0A 2O9TA 3W1XA 4HN4A 3U57A 1ZJIA 3O07A 4EF9A 4AMAA 4F40A 1BF2A 4NT0A 2EBNA 4P8UA 4JX6A 1DBTA 1TV2A 1SR0A 3VGEA 3L2MA 3HFYA 3FKKA 3LHUA 4K6AA 1QPRA 1BYBA 4ICMA 3RO8A 4KCTA 5DY3A 1ODUA 1UR4A 4FR1A 3VCRA 1XYCA 3W24A 3GKAA 2AQWA 3O6AA 2PZ0A 4JHOA 5C2CA 2GLKA 5GJNA 1PB0A 3AO0A 3I6TA 3W22A 3G3MA 1D9EA 3RMEA 1YYAA 1KRCC 5CEWA 4K3ZA 1FWNA 3VPLA 2A3EA 4R34A 3XIMA 5TIMA 1XKJA 3G1SA 3ARPA 4XZNX 3ARWA 1H50A 1FH8A 3IVSA 3T0CA 2YCJA 3JR2A 3S46A 3EXRA 5KZDA 5I3GA 3NG3A 3H2FA 4DPQA 4C6PA 4X2PA 3VIKA 4S3AA 3URNA 3MMWA 2OO0A 4XZMX 4TV6A 5TQLA 3INPA 3N2CA 5BXPA 1HG3A 1KRMA 2P10A 3G1FA 2RJGA 3NJ3A 3QQWA 3LPOA 4NG3A 2NV1A 3GRIA 4TV5A 1HVXA 5IBXC 1B4KA 1R7AA 1PTDA 1S5WA 4HT3A 3EWWA 4Q4SA 1JRBA 1E1EA 2G41A 3WF3A 1G5AA 3N29A 1PBGA 1GGOA 1YHTA 1ECQA 1ZB5A 2JKEA 5K2ZA 2VC6A 2A7RA 4LY8A 3QR0A 1AK5A 3VABA 1UWSA 3R0DA 2B81A 3BMVA 1NF0A 3M0MA 4UTHA 5IFTA 4B9YA 3SN0A 1S38A 1UPPA 3NDYA 2BY3A 1CGUA 1BSLA 5KINA 4DBDA 3W84A 3KS5A 1V0NA 3QSTA 3E38A 3PHAA 3W2LA 4LVAA 1TUXA 3MO4A 5HUPA 5J04A 3QY8A 4H01A 3W2NA 3SCUA 2ZXDA 4RPQA 1R30A 4P7LA 3H55A 3M6YA 4ZOEA 3G77A 3V7PA 1UUQA 4C60A 3P84A 4O10A 5HWJA 1PAMA 3WJWA 2R91A 2V6AA 4A35A 2QNEA 3N04A 1B3WA 2WWCA 3SRDA 4FNSA 3NZPA 4HU3A 1H7PA 1QPKA 4LYRA 3RUBL 4BJHA 3HG4A 3HURA 1AQMA 4ML4A 1JNEA 1D2KA 3R5EA 1PIFA 3UR7A 3LTSA 1BAGA 4B90A 5FF7A 1NU5A 4NILA 4AQLA 3CUZA 4EP8C 3P74A 2FB3A 4PBGA 4QR6A 3N4EA 3QXBA 4GFIA 2H9AA 1GVSA 3MQTA 2ACRA 4AD3A 2X0HA 2PURA 2ZUTA 1B4EA 5LA0A 1MRAA 2WNZA 2Y61A 1M7XA 4JTGA 4EAYA 4BA0A 3THUA 1HJQA 4H6RA 1ICQA 3SGUA 4H19A 5D8WA 1K4GA 3BUVA 1KGXA 3S1WA 4PB5A 3ICJA 3L67A 4H9YA 5K7JA 2GZXA 3RAOA 4IZGA 4TVDA 4I5UA 4WKFA 4WUIA 2HXTA 1XBXA 3CHFA 3DEQA 3EB3A 4S3DA 3CS2A 2PEVA 3VCCA 2C79A 1ISVA 1XCWA 3BLPX 5G4WA 5LIXX 4HA3A 2BX7A 3FXGA 5K3VA 5GVJA 1IEQA 1Y7VA 1XLJA 3MV11 4PFHA 3FY1A 1SSDA 1EZWA 4IMFA 2Y8KA 1RSCA 2OOGA 1GVYA 2BXZA 5DCBA 3JRKA 1RP8A 3Q58A 2GJPA 4GQ0A 3M16A 3A64A 3ENLA 3AMLA 1J9YA 3OEXA 3PFMA 4LC8A 3XINA 1DPMA 3GDBA 1EBHA 4MDOA 4JTKA 4YJ5A 1NTHA 2HWGA 2Z1BA 5BXTA 3I3EA 3OQ8A 3ARVA 1DJZA 4B5SA 3IGHX 3HQPA 4AD0A 5D37A 1E4IA 1C7TA 3RFAA 4Q8VA 4DZ5A 3PZGA 4Q8MA 1VGAA 4L61A 3NUKA 1I1XA 4ZQNA 2W62A 3B05A 3PB2A 3I4EA 3S2JA 3TSMA 2OYLA 1LDCA 3MJMA 5TBOA 5I3IA 5BWFA 1OFRA 2WAGA 3QTGA 1K6WA 3COTA 4M29A 3AHYA 2Z6JA 4R5EA 2Z28A 5E6ZA 3DH7A 4GIYA 1V6UA 1L8PA 1TX2A 2VVSA 1TVPA 4UQCA 1QW7A 1TPC1 3HPZA 5CPMA 4GKLA 4XAZA 5A1AA 3VNZA 1VS1A 2C16A 2HVOA 4DM2A 2P8BA 5DXXA 4Z2LA 2OEJA 4QCEA 4V1YA 1A4LA 2ZTKA 2UBPC 4DWSD 2QCNA 1J11A 2HJPA 1E40A 3HPXA 1W1VA 2YGYA 4O1CA 2VD8A 2ZUVA 5HWNA 1CXFA 2TODA 3EWYA 4LQ1A 3PPGA 2WOQA 2OGJA 3O2LA 2W91A 2NXIA 3PBMA 1H60A 4XK2A 4YHGA 3IAPA 1BXBA 4PUEA 2PCQA 4DRSA 4UQEA 4QXIA 1G7VA 4ICCX 2Y5EA