2P76A

Crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
267
structure length
267
Chain Sequence
QWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTTNGHGKVEDYTLDELKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKHHLLNNNKLKNGHVMIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDLGFIVHPYTVNEKADMLRLNKYGVDGVFTNFADKYKEVIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Glycerophosphodiester Phosphodiesterase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Glycerophosphoryl diester phosphodiesterase
total genus 110
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.4.46: Glycerophosphodiester phosphodiesterase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2p76A00
3QR0A 4F2BA 1XX1A 3EA1A 3L12A 4I9MA 2FJUB 2PTDA 4F2TA 3V16A 3H4XA 1QASA 4OECA 2ZKMX 1O1ZA 3KS5A 1YDYA 1V8EA 1GYMA 4I9JA 4R7OA 4I9TA 1DJIA 4QJ4B 1DJGA 2PZ0A 5T91A 3EA2A 3H4WA 6PTDA 3CH0A 3KS6A 3MZ2A 4I8YA 3NO3A 3OHMB 5T9CE 1T6MA 1T8QA 2O55A 2PLCA 5T9BG 4PTDA 3V18A 1DJYA 1DJHA 3I10A 4F2UA 1ZCCA 3RLHA 4GNKB 2OTDA 7PTDA 1DJXA 2F9RA 4Q6XA 1VD6A 2ISDA 3RLGA 3V1HA 1DJWA 5PTDA 3EA3A 3QVQA 1QATA 4I90A 1PTGA 2OR2A 3QR1A 4QJ5B 4QJ3B 4RW3A 4RV3A 1DJZA 3PTDA 1AODA 2P76A 4RW5A 2OOGA 4S3GA 1PTDA
chains in the Genus database with same CATH superfamily
2J8GA 3H7UA 2HE8A 4JY9A 1RBAA 2EKGA 4WKFA 4HMCA 3VIPA 1K9EA 4A3HA 3CS2A 1XLBA 4QLLA 4AH7A 3BLKA 3M6YA 1PS9A 5IXEA 1CXIA 1YHTA 4RW3A 4GVIA 6XIAA 4HSHA 4RZBA 4IXXA 4GYJA 3QHNA 1S3HA 4REQA 3W38A 4OV4A 3CQJA 1IEQA 2HXUA 4XISA 4M1RA 4DJEC 4W84A 2DORA 3WQWA 3ZYZA 3GHTA 5D2WA 4J35A 3WF4A 3ALGA 3HGSA 2QCCA 1P48A 4K2SA 3LZ3A 5MHBA 1AVAA 2D23A 4LEFA 2ZQ0A 1TB3A 3GYEA 3U48A 3M47A 4H1ZA 1IV8A 4R27A 2NVAA 2V63A 3GZAA 2GSEA 1HFBA 4L64A 2PDGA 2PDMA 3SY1A 3G18A 3C2OA 3WK0A 2V81A 2NXGA 4XBSA 1TE6A 1DPMA 1V3JA 3DFNA 3T05A 5CBJA 2V5KA 4BQ2A 4QSHA 2FMOA 4XUGA 4FIRA 4ZXLA 3CWHA 1K8CA 2Z27A 1JPIA 4NXSA 5LIXX 3C0SA 5AYXA 3B0PA 2Q6ZA 3BH4A 4JX4A 3P93A 1EBGA 3HO8A 5JXQA 2OSYA 3M44A 2WCSA 3OZOA 3T6CA 1K8ZA 2VX4A 3ZFHA 3TDFA 3W86A 4LGXA 5XIAA 2V8ZA 5A5WA 2QCEA 1JD9A 3FXYA 2FPTA 4B5NA 1ZJAA 3B0UX 4Q8TA 3SCVA 1A0CA 1N82A 1VFTA 2X30A 5EY5A 4HU3A 3SSZA 1J4EA 4LVGA 1DQWA 3E2SA 2YL5A 3ZM8A 2YDAA 3QQ0A 1UZDA 2CZFA 4GBUA 4TIMA 2WMHA 4LYPA 4HA3A 4GX9A 1BTMA 4G7EB 4V15A 1H7OA 1YXCA 3LHTA 1AFSA 3TK7A 5CBIA 3M46A 5D02A 3UYCA 3K13A 4ZOEA 3GO2A 1TPEA 1U1JA 3T09A 2DP3A 3VIGA 1JPHA 2HRWA 1PYMA 4OWGA 3M0HA 1KBLA 4RDVA 4Q7BA 3CAKA 1XCFA 3OIHA 1XSJA 1K02A 1R38A 1US2A 3W1AA 3AU2A 3MT1A 3OQ8A 3NQ2A 1S1RA 1A5AA 1QTWA 1F9CA 3UYIA 4W85A 3W7RA 4JKKA 1KGXA 1E6NA 3N6HA 1U5JA 3NXFA 2D0FA 3FEMA 3TZNA 1JYWA 4N2YA 1F2JA 2WBGA 2JF7A 1KWGA 2DVXA 1US0A 3N6QA 1VCVA 1H0GA 2ZZ6A 3HQOA 3RX4A 2V2HA 2OZTA 4PRRA 4GD0A 4HK7A 3BTNA 4UTFA 2BY1A 4MWAE 3W7DA 2V6AA 2J7EA 3S5YA 4E0CA 1WDQA 4MZYA 4FOJA 2BOFX 1B3YA 1VKFA 3R12A 5LYRA 1UA7A 2VEMA 3GXDA 3LBMA 3PB0A 1KBBA 1CW2A 3RITA 1PZ0A 4AX6A 3SADA 3SY5A 4IQEA 5C71A 2WVTA 1MZHA 2DUZA 4NJHA 5CPSA 4K38A 4LF1A 1YKWA 3EGJA 2PZNA 2Y5EA 1M3UA 4OVXA 6A3HA 4ROQA 1KBIA 4WQ6A 1OG6A 4ZO9A 5HULA 4JQAA 2FH8A 1CDGA 1N2VA 4JTUA 5FJIA 3ITYA 3BMVA 4Y8FA 4PA8A 3KCLA 3SCOA 5A95A 4A29A 3TCEA 2HTMA 4GXWA 4FNTA 3OHIA 5LXEA 1EJVC 4FI4A 4NI8A 2ZRZA 2DZAA 2XM2A 3T08A 3KBJA 3EMQA 4U2ZA 4GZIA 3G3DA 3LY0A 4C1LA 1NQKA 4H83A 4GISA 1UR8A 1IXNA 1ICPA 2QF7A 3MS8A 4HHPA 1UR2A 3L65A 3PVFA 4JTRA 4MTVA 3XIMA 1O7AA 3EYPA 3OGSA 3W27A 2VGBA 1FKWA 1YNPA 2CZ5A 3MQTA 3UXKA 3CB3A 4Z2JA 1S38A 4GC4A 1PYFA 4PSPA 4PUMA 1W17A 5L6UA 4EK7A 4K7YA 4RNFA 3GH5A 4LYQA 4KCUA 3WLNA 3A9IA 1ME8A 3M5ZA 4GI6A 3OB8A 4U31A 4UFMA 1UR1A 1J0HA 3GZ3A 4IHCA 3FDGA 3RK8A 4QDMA 1EP2A 5EFDA 3IRSA 1JI2A 4M56A 2NW0A 3A64A 2WNZA 3DIPA 2DZVA 1KKOA 3IIOA 4JKMA 1UQYA 4XSLA 2WC7A 4QQUA 4ERGA 2BNJA 4REQB 2WSQA 4F0HA 5I23A 1H7PA 1QBBA 2J7BA 1VHCA 4QAWA 2XISA 1BQGA 1JDCA 4F3HA 1VFOA 4QCEA 1RAKA 3CNYA 5CGTA 4J4KA 3FJNA 4ZQMA 1MZRA 5A8GA 2YW3A 3V7PA 4H4IA 1CIUA 1WOAA 3N9SA 4B5VA 4NQ1A 1XYBA 3C2VA 3HG4A 1LROA 3RU6A 4A35A 3U2EA 2FZ8A 1FHVA 3GNOA 5BXTA 3WDRA 2J7GA 4G8TA 4A6GA 4PC8A 3W76A 2OCZA 3CMJA 3PAOA 3ARYA 1Y65A 1TWIA 2EXOA 3DFHA 3NZGA 4JN6A 2G50A 2EJAA 3TR2A 2PDCA 4O28A 2XIOA 4FSAA 4AZIA 3VNDA 5HJYA 2FYMA 2Z24A 4C7DA 3UPMA 2J7FA 3CU2A 2YL6A 1E0WA 9CGTA 1OG0A 3WNKA 2ZYFA 1TRDA 1R2RA 4ZQRA 1I8JA 3OU8A 3WQCA 2OPJA 5AHEA 4QTGA 2W9MA 4V2XA 7ODCA 4L61A 4M6UA 1U83A 1EYEA 4Q33A 4PTWA 5E0FA 3L4WA 3OYZA 4DN1A 1P6CA 3B9OA 1FP8A 1WDPA 4PZVA 4DXXA 1WYIA 2OT0A 4GMEA 5XINA 4S2CA 1LUCB 4E38A 3RM8A 4B2DA 3PR2A 4FXJA 3UD6A 2HS6A 4PB4A 3S1UA 2C71A 3SRKA 3W2MA 4CUCA 4MUZA 2DIKA 4GKLA 1T8XA 5C2CA 3LV5A 4H19A 2FLIA 4P8VA 1TX0A 3IPWA 4NYUA 3GDMA 4NU7A 1A5CA 3S1WA 3GYCA 3AIEA 3GK0A 2V2DA 5H1WA 4Q7IA 4CN1A 2XVGA 5HMSA 1QXLA 1U5HA 4FO4A 3M9YA 2P0OA 2HEJA 3RDKA 2FFCA 3POCA 4QP0A 2VURA 4HVXA 5BWAA 1NELA 2FPVA 1MEIA 4MWAD 3BURA 3BJSA 4JKLA 1RQEA 1J0IA 1TTJA 3L0KA 1JCLA 3AZSA 3FJ6A 3NQDA 1LLZA 4QJ1A 4EF8A 3KRUA 4L4LA 3V18A 4HNNA 3ERPA 1EO7A 3NYZA 5I07A 3RAOA 3LD5A 4AWSA 3H54A 1J8VA 1NDZA 4LVBA 5A6JA 2BLEA 1KM6A 2GVJA 3VC6A 4J40A 1DL3A 5E6YA 1A5BA 1Q2SA 1NFBA 3PY2A 5FD0A 1JFXA 3SY8A 1E3ZA 3ARPA 1R3WA 1HGYA 3W1UA 1LL6A 3NM3A 1RJRA 3NG3A 3AUJA 1F61A 3PPFA 3GXTA 2RUSA 4CCDA 5J5DA 2JEQA 1A53A 4GIYA 3EKLA 2TPSA 3M5XA 1R86A 4GUJA 1KFJA 1UC5A 4PTNA 1PZ1A 1KRAC 2FTYA 3M0YA 3VUSA 3ZMRA 4Z1YA 1A3XA 4ML9A 3UWYA 4JYEA 1XGDA 3OGVA 3TE9A 1X8FA 4MAZA 1TPH1 5D9NA 1JZ3A 4XVDA 1TREA 4LXFA 2QJMA 4W93A 4GVFA 2OGJA 4L9XA 1RV8A 4FXSA 3AAMA 1UPMB 1PO9A 4HN8A 3QC0A 1V8EA 5LIUX 1MEWA 1HW6A 2E9BA 1PL9A 3CQ0A 4F40A 3CLMA 5AVHA 5C9ZA 1ESWA 2FGLA 5T9CE 3UR5A 4AYSA 2QCGA 5HMDA 1DJXA 5EBAA 3DFTA 3V0TA 3NQ6A 1S1PA 3UG8A 2W62A 4P8WA 3URAA 1A80A 4O19A 2VKZG 2O4MA 4X0NA 1NU5A 3AS0A 4H8VA 3AS1A 3CO8A 4WY0F 3UERA 2VDHA 2FHBA 3BSHA 1CYGA 2ZE0A 2QCMA 3LCXA 2OSWA 2E6FA 3PBUA 2HWGA 3UR8A 1MUCA 2CLFA 1SW7A 1B5TA 4G7EA 4LRSA 5A6MA 4GY1A 1SMDA 2OGYA 3VM5A 2VC7A 2ZBTA 5H6HA 4PGLA 3GX9A 3OA3A 1J5TA 2PDUA 5C70A 1XIGA 4R7JA 6TIMA 4YU1A 5E6ZA 3WBEA 3CZEA 3KP1A 1Y5XA 3SCSA 3WF0A 3DFOA 2PDBA 4FOUA 3EWYA 4IIDA 1EP1A 4H9ZA 4NZJA 5JUVA 3KOFA 2VX6A 4HOXA 5A8MA 1XLDA 5E9XA 3WBAA 5TBOA 1TIMA 4WSHA 4XIAA 3AJ7A 1T6MA 4HYRA 3RO6A 5DBTA 1TA3A 2Q01A 1ZPTA 2V2CA 1J01A 2QPSA 5A6BA 4GVHA 1CNVA 5IBXC 1LBFA 4N42A 3I6RA 2ESCA 4J3UA 4AD5A 4HGXA 2FJKA 2BB0A 1FCQA 3PG9A 1Z9AA 3NQBA 4JTSA 2P5NA 1OINA 1V02A 1PIIA 4GH1A 2V5JA 4IX2A 2VFGA 2VC9A 2Y6ZA 4URIA 1UD3A 3IK2A 2CETA 1BD0A 1V3KA 3MCOA 3FKKA 1GZJA 2I57A 2VM8A 3PJXA 2ZUSA 1DQUA 2B31A 3FA5A 4XKYB 1KW1A 3WO8A 2PWFA 1ONEA 3WNMA 5HK4A 5I6SA 2YR1A 2J4GA 4QNEA 1OT2A 3LCGA 5EFFA 4NVTA 1XFBA 2VJXA 1IQ8A 3PK7A 1OT1A 2DU2A 2GK1A 3KHDA 2C0AA 2WV8A 4CQCA 4DWSA 3NNTA 5AOUA 4LV4A 2GUUA 1U22A 1GNXA 3U7BA 4A8RA 1RBOB 5DANA 2W63A 2WJZA 4BJHA 4FLQA 3NUKA 4B2DD 2EKCA 3ZVHB 4NT0A 1WZMA 1OFQA 3J7HA 1XWYA 5DY3A 3ZVIA 3M07A 2PDWA 3GDRA 4TX9A 1B3OA 4IX0A 5HR7A 1C8YA 5AFDA 5F2IA 1Z32X 3VABA 3QVQA 4GUFA 2I17A 1YADA 2A0NA 1W3JA 1UD8A 2RH9A 3DESA 4I9TA 1C8VA 4GZJA 3AIRA 4I7VA 1FWAC 1E72M 2GOUA 4L1GA 4ZENA 3Q58A 4AISA 5K9XA 1SQ7A 2W3ZA 3SUTA 5FJTA 3KWSA 3S4TA 5C2XA 1XYLA 3LTSA 4L56A 1JAEA 4JZ5A 1A5MC 3PNZA 4TX6A 1GYMA 2REQA 3SRFA 2VUYA 4MB4A 3V36A 4UFLA 3HQ1A 2EG7A 3CPUA 5FEWA 5EBUA 4HOZA 1DIDA 4IGSA 2GLKA 3TVAA 3VUPA 4H9TA 2VZSA 1MRAA 1E71M 1R47A 3UG4A 4Z1BA 2OLHA 2NX3A 1H11A 3VZZA 4CCZA 2DH3A 1XRTA 2P88A 1D8CA 1R7OA 2Z28A 1M7PA 1PUDA 4UB9A 4MY8A 3W7GA 2I16A 3ANYA 3MC5A 3RPDA 1GVOA 1XINA 1GUVA 3QFWA 1EXBA 1GZGA 4RPQA 2F6UA 3NM1A 3V16A 4HN4A 1VFFA 2QCDB 4JICA 3REQA 1RCQA 5F2GA 1VLWA 3QLLA 5J8LA 4KGLA 1K4GA 1BRLA 2P53A 2PD9A 3B9NA 4GWEA 3UFYA 1XW8A 2VUNA 4N4PA 4R3UA 1V93A 1V08A 2QYGA 3QEZA 5HPCA 1L6GA 1TFVA 5D09A 3W7KA 4DWSC 3LV6A 1HJQA 4CCEA 1TWWA 2JQXA 1S2UA 3QKEA 2PMQA 4HNUA 2B7PA 1PB0A 2V9DA 5LXXA 2VT0A 4LPCA 3GUWA 5HANA 1EFZA 1MW1A 2FZBA 3K2GA 4GJIA 2NT0A 3T07A 4E8DA 4A2SA 3IVSA 3L5MA 4LV9A 1TR9A 4ORIA 4Z2KA 4K8GA 5F1UA 3HN3A 3EDKA 2CKRA 3PSVA 1E1CA 3CZKA 3GFXA 3VNYA 3NPUA 1DKWA 4C6MA 4YL2A 1H2JA 2FGZA 4CD4A 3LG3A 1IIGA 3OG3A 3LZ5A 1I2RA 3RX2A 4P7OA 1HIZA 2PDXA 1O4UA 3CQKA 3LXCA 3NO3A 3TJ4A 1B3ZA 5EMYA 3CUXA 3S8HA 1EPXA 1PIFA 1F4HA 3MUY1 3TCSA 1PDYA 2OXNA 2R1MA 4JYDA 1AQFA 1LF1A 4US5D 2QUVA 4UNIA 4EAYA 3W29A 2C1GA 4PMQA 2G4FA 1W5NA 4CU7A 5HXMA 2OFJA 1ML1A 3BAYA 4PTDA 2A79A 3UCCA 1SGJA 3O15A 2AAAA 3TQKA 4UOJA 1TCMA 5DQPA 2DT0A 3TLQA 3KRSA 1QK2A 1WAWA 1AD1A 1KBJA 3VDCA 1E6ZA 3UZZA 1K8YA 2IPJA 4YVPA 4CD8A 3O7UA 1XIDA 3VZYA 1GVEA 5BYWA 2EPOA 3WK3A 3A4JA 9XIAA 4FAMA 4Y9AA 3F7JA 3NGFA 1AH3A 3A47A 4EOUA 4KEZA 3WMBA 1JUEA 3LHUA 3L68A 1PTDA 5I3DA 2XM1A 3WQDA 2IQ0A 1TSIA 1I4NA 1W56A 5DF0A 3KRBA 3BE7A 4XD5A 3VIHA 3VOHA 4B3LA 4UTUA 3QYSA 4RV8A 3TNOA 3ZS4A 4QE5A 1EUNA 1HG3A 5HMFA 1W1IE 1ZSXA 3APGA 3R58A 2OZ3A 4GZEA 2FHFA 1FXQA 1W8GA 1CB7B 3W37A 4Q4OA 4DO6A 3CZLA 4MB5A 1YDVA 3WQ4A 1H4PA 4TMCA 2W27A 4NAFA 4F2UA 1B30A 3RPMA 3P0WA 4PE8A 2IQDA 3QY6A 2YSWA 3TMQA 1IWPA 1SFTA 4E2OA 4R9OA 4WOZA 5FI8A 1I0DA 2VGFA 3E49A 1OC7A 1TVLA 3GDBA 3L4VA 5LA2A 1WUFA 3CLWA 2OT1A 3LNMA 1MNSA 1YQ2A 5JBEA 2POTA 1NEYA 5LIYX 4O14A 2ZZ5A 1P0BA 3VC5A 1V5XA 6CGTA 1FA2A 5CAKA 4GHRA 2X16A 3RXZA 1BVWA 1EWEA 3GWQA 2UY2A 5SWUA 3BAJA 1K9DA 5C0QA 1SPQA 2ZADA 3AUOA 2QAPA 1PDZA 3R10A 3L9CA 1LQ0A 2A7RA 3LHWA 4FLRA 4I9MA 4HMDA 1ITCA 3VMOA 1NDYA 3O16A 3THUA 3S46A 4JR5A 4MFEA 4GE8A 2DH2A 4OJYA 1FP9A 3WH8A 2OOFA 1R30A 3TA9A 2EPMX 2PGEA 1UWRA 4MYXA 4G6CA 5HINA 2PTXA 3HIJA 3M0ZA 3RLUA 1XBVA 4A05A 3MUXA 3C6CA 3QYQA 1V7YA 5KINA 3IIZA 1M7XA 1Q5MA 3ABOA 3A23A 3ID7A 4I8DA 4AZ7A 3N25A 4DIAA 1E6RA 4I90A 4LT9A 1FWGC 1POKA 5AHLA 4NZCA 1HKIA 1KR1A 5GJPA 1DORA 2JGQA 3RR1A 3CBWA 2NT1A 3AIUA 5KTLA 2FFIA 4IISA 1O94A 4ZO8A 1SU5A 2GJXA 3AMGA 1JDAA 1LCOA 1W1YA 3URBA 3CHDA 3F2CA 3PUDA 1TJ1A 1UB3A 4ZO6A 5EA9A 4GCAA 4Z1AA 1EKOA 1ZTVA 5HDRA 3BAXA 4ENLA 2V30A 3VIFA 2GJLA 1EYWA 4XV0A 3XISA 3FDKA 2A21A 2YX0A 3MWAA 3T40A 4LUTB 1DBTA 1XIBA 3KVLA 3WLKX 3EPOA 3A13A 3THQA 3OHMB 3W28A 2R1LA 2OO6A 2Z1XA 3W7OA 2YA1A 4GI4A 3PN8A 4H9UA 1XXXA 2WWCA 1HP4A 4Y6GA 5H8MA 4JTDA 3KS5A 3ZSSA 1W37A 1L6YA 3KCOA 4A8NA 2EEXA 2DVUA 1CPUA 3VYLA 2D3LA 3LXAA 4HU4A 3QOKA 2WJEA 3W88A 4X22A 4HQVA 1AZ1A 5KZMA 1V79A 3M4HA 3LCIA 4I7UA 3Q4DA 3WDJA 4IG2A 4H01A 5DMYA 3VPLA 5BNKA 1FWNA 3AMLA 3KBWA 2UY3A 3AZRA 4DF1A 1Q63A 4JTTA 5DY2A 2YCKX 4PCSA 3RR4A 3WH5A 2GGIA 1N8WA 4R9XA 3M7SA 2E6AA 3G22A 3HQNA 4RL3A 4D6CA 3W7EA 3S47A 1U30A 3W00A 1MNZA 3P82A 3W83A 1SZNA 3DFYA 1N7KA 5EMUA 4M6PA 1YNYA 2OKTA 4CNTA 3WK1A 2QJHA 3NXLA 2BS9A 3BW3A 2XFRA 5CC5A 1K1DA 5AYYA 1UJPA 1A0EA 2WJFA 5FACA 3CWNA 4BWLA 2GK1B 3MPGA 1TV2A 4AF0A 3SCQA 4Y96A 1OHLA 4DF2A 3W7MA 3H2FA 2ZE3A 3F1QA 3KOYA 7CGTA 3GVWA 2CITA 3NSXA 4X2RA 3BW4A 4EACA 5T91A 3IAQA 1QMLA 3N1AA 1FFRA 4KFNA 2ISSA 4M0XA 5ABFB 4EKJA 2PUZA 3KTXA 2HPMA 1AJ2A 3ZT6A 1MUWA 2XWEA 4ZA0A 3SDOA 3NA8A 4POCA 3KL0A 4GQQA 3CWOX 4JFVA 2P8CA 4WJEA 5F7UA 2W0UA 3B0VC 4AVNA 3BQ5A 2PA6A 1FUYA 2VEGA 3WDIA 3G1RA 5REQA 3QBUA 5KEZA 1CGXA 2Q8ZA 1EDQA 2DSUA 4AD4A 4MM1A 3SUWA 2H8XA 4FNUA 2PE4A 3LMZA 3PSWA 4W7WA 1RSCA 3AIVA 3NZPA 4HA1A 1OYAA 2WKJA 2D1ZA 3KP0A 4XO6A 4WX2A 1BG4A 2QKFA 3CL7A 5CGMA 4N9DA 5TQLA 1QOXA 1H5VA 2PWVA 2ABBA 3HB9A 2EF9A 1AQ0A 4H6QA 3BO9A 3QN3A 1OIFA 1SMAA 4PL2A 1KB3A 3A6OA 3QV7A 1SYTA 2QF8A 1MQRA 5DCDA 4L4PA 3VZXA 1GEQA 1OFDA 3WLLA 5DT7A 4PRWA 4A2RA 3MWCA 4JTAA 3WJWA 4HBKA 2BDQA 2I1OA 2PF8A 1AD4A 3BCJA 1TPVA 1EPVA 3LI0A 1KA9F 1X96A 5CSRA 3O6YX 1XYFA 4RNHA 3GW0A 1DWAM 2VCCA 1CLVA 1ADOA 1GT8A 1X7IA 3G1DA 4G1KA 3N4AA 4C6QA 1VBRA 5LIKX 4WKHA 1FH9A 1VJZA 1XKYA 4AD2A 5BXSA 4I7WA 1UBSA 3S9IA 1JZ7A 4LH8A 2XH2A 3CAVA 4WVXA 4B3ZA 3AZTA 2QUNA 1K7XA 3NVTA 1W1PA 1B9ZA 2AL2A 4ES4A 2IKJA 3UNTA 5M5DA 5KZ6A 5KZDA 2CHOA 1TTPA 4FK9A 2GWNA 3W2NA 4MNMA 3AIBA 4UMBA 3N14A 3CMFA 3MP4A 5LGXA 4WUIA 4MLRA 1R87A 4R33A 4AZHA 4UOZA 4IIFA 3UNDA 3BXWA 1Q6GA 1UMYA 5JIPA 2BHYA 4F4RA 4MLJA 2ZOXA 3W7PA 3ZR4A 4XAFA 1HJVA 2GGGA 3L2MA 4ZQCA 3N3TA 1OF8A 4IMGA 1K6AA 1OFAA 4PMUA 4O0KA 3THDA 3PJWA 1BTCA 3LI1A 4IICA 4DQWA 3G1HA 3UWZA 4HP5A 2B81A 4NRSA 1WCGA 3B97A 3AOFA 3RUBL 2PRHA 3CMGA 1OZQA 1OJXA 3S0CA 5LZLA 5CZKA 4JEQA 4U3AA 4UXDA 3KOXA 1GQKA 1WPCA 3W0KA 3G2GA 2NX1A 2H90A 4C6DA 2PWUA 4DYEA 3NTYA 3DBNA 5BROA 3WUFA 3RN6A 5HNNA 1V3MA 4V28A 3LRKA 1SW3A 4IIHA 3OQEA 3NDZA 1I6NA 4O53A 3UW6A 1Q65A 1A0DA 4JHMA 1NOWA 4E4FA 4OIFA 3V0SA 1N55A 3RRXA 2YZRA 1D8WA 3BMXA 5CCZA 2CLMA 1JULA 3VGFA 5C9XA 3C2FA 4JN8A 1AL7A 4D1IA 3W87A 1BYCA 1O95A 1C92A 1ZP3A 2IKGA 2C79A 3PZNA 4PN2A 3QHMA 1WDDA 4QJ5B 3PWAA 4NG3A 3VOCA 3GR7A 1W9VA 1V0MA 1OC5A 4DBSA 2JALA 4XD4A 2A3LA 4DUXA 2BOGX 4HJWA 3O1NA 3DX5A 1W91A 4UMCA 1A3WA 2IW0A 5HWNA 5DCBA 1TO3A 2BFGA 3BDKA 1QHOA 3B4UA 4DUVA 1PV8A 4WGXA 5A6BD 4LAMA 3P67A 5C5YA 4ALDA 1UR0A 3KXQA 4AB4A 5PTDA 4B90A 5BRPA 4Q4MA 3WFLA 3VX0A 4UR9A 1Q8JA 4IMEA 4FNQA 4QM1A 3LQGA 1Q6CA 2WQPA 1KNWA 3MZNA 3H12A 2DIEA 2O7QA 3LBOA 2CLIA 4M6VA 2TSYA 2Y24A 2WMIB 1V6YA 3W07A 4V33A 1W9BM 4H7CA 2OWXA 1MWOA 4N9CA 1K7EA 3LUTA 4DZIA 1CCWB 1GYNA 3UXAA 1JQVA 4H9YA 1EGVA 4WRHA 1BXNA 2NX9A 2GJPA 1DIEA 2D3NA 3D0CA 2INFA 1OEPA 4UCGA 2X7VA 3R0DA 2ZA3A 1W5QA 3QV8A 1A5SA 3TFCA 3LERA 4LY8A 1E43A 1IT7A 5JMUA 1EQPA 2ZUMA 2VFDA 2DVTA 2FGBA 4FR6A 4Q32A 4N6EA 1HO4A 5CPOA 3UXLA 4QCFA 3PZMA 4FZIA 1FH7A 2BVDA 4ERIA 5L9FA 4UOQA 4UR7A 2R8WA 4JTQA 4AXKA 2ISVA 1AQMA 4GYPC 4O12A 4UNLA 1P6WA 2ZX7A 2WOQA 3PWGA 3ARVA 2X2YA 3DI0A 3U8GA 3UWQA 4O1CA 3PUGA 1E56A 5G4EA 1DWGM 4PMZA 2E1WA 3R8RA 1A5UA 3OBKA 3SCPA 5FKYA 3TUUA 3N4FA 4N4QA 3QJAA 2QVHA 3FAXA 2MUCA 3QSTA 4L6DA 3AC0A 4L7ZA 4MF4A 3H21A 5HNRA 1NWTA 1IEIA 1XLAA 3O07A 1I2OA 1ICQA 3QGKC 2PPGA 5DELA 3QMSA 1H50A 4IH3A 2PWEA 1SJCA 1YTEA 3QMRA 3DZ1A 3G77A 1XI3A 1ITUA 5I06A 3S5SA 5TIMA 4J3WA 3TZFA 1XBXA 3KLLA 3F5LA 3G6LA 1FCUA 3HJZA 1UOKA 2E40A 1G5AA 2YL8A 1C3FA 4LRTA 4MWAB 4P8UA 3QKZA 1UIPA 3F4VA 1QW7A 4MIMA 2OQLA 1VIWA 4L4MA 1V7AA 2DQWA 2WK2A 3WKZA 1NOFA 2CWXA 3P8JA 3BG3A 4XBKA 4BZYA 2YBTA 4QS6A 2JEPA 4X2PA 2GL5A 4CQDA 2CZDA 2YFOA 1AODA 5TF0A 1Y8BA 2ALDA 5G2HA 4DI8A 2V3GA 1M9HA 3RF9A 2WKLA 3TTQA 4C6KA 4PBEA 3NQ7A 1PWLA 1IWAA 2V5LA 1F3XA 2VEKA 3BANA 3QPZA 1BGGA 1K3UA 1K9FA 4Q6XA 3ARQA 2UY4A 5CLWA 1GW9A 2ATMA 1JI1A 1Q8AA 4QXIA 2F7FA 3F4WA 4S3GA 3ME3A 3LTYA 2YXOA 2BHUA 4NRRA 1WKDA 3WIJA 2EQDA 2I9UA 4WHBA 3E2VA 4AAJA 2XH0A 1JUBA 3PNUA 4P2VA 2O9PA 3W22A 5LA1A 4E3VA 4JTLA 3GBEA 2WMJA 2JKEA 2R14A 2EAWA 2A3HA 4IPIA 2VCBA 3W01A 3VDHA 3FSUA 3F2BA 3IWPA 3WENA 2CXEA 3CC1A 1Q7ZA 1V03A 4B5XA 3EA3A 5B7YA 3S9YA 4DJEA 5DRIA 1BF2A 2VR4A 1LOLA 3SSJA 3USZA 1WA3A 4RE0A 2PBGA 1ZGDA 4LC8A 1EJRC 1TQXA 4GX8A 1WNOA 2VOMA 3W7QA 3ZQ9A 3TW7A 3HURA 1GPFA 4Q4RA 4B5UA 1DXIA 4LS1A 2ASHA 5FIPA 1SSGA 3NEHA 2A3EA 4OUIA 1POJA 1TMHA 4IFKB 1D3HA 4UFIA 1EWDA 2EG8A 5CBBA 4XZLX 3AXMA 3OG2A 2IQTA 3GH7A 1QATA 5RUBA 1F3EA 1IXPA 1HL2A 4CN4A 4S23A 5HWJA 4F0RA 3WD2A 2ZA1A 2IS7A 1RK5A 1C8XA 2QPUA 1W3NA 1NOUA 3QLDA 1YXYA 5A6LA 1EP3A 1E70M 3NL3A 2HE5A 3VKDA 1ZZMA 4C6PA 4K3ZA 1KC7A 4PBFA 4HSNA 4IPLA 5I09A 3MP3A 3C2YA 5JQ9A 1MVYA 2QV4A 3M43A 3M0JA 2W61A 4L1XA 1K77A 4R85A 3VX1A 2AQOA 2Z2BA 1LTDA 1ISZA 4QISA 5EMMA 1B31A 1FVPA 4PUKA 4HCLA 3PWIA 1J0YA 1RA5A 2CW6A 4IJCA 4B5TA 3JRKA 3ARSA 3ABZA 1XICA 1UJQA 1XPYA 1E51A 4DWDA 4AEFA 4G2DA 1HJSA 3M6DA 3WF2A 4DY1A 7TIMA 2PFHA 4IIEA 2RKXA 2CFFA 2NQZA 1FWJC 1W5MA 1SR0A 4EXBA 4JIQA 1HKVA 5D32A 1V0NA 5E93A 3B9DA 1R2SA 3VTRA 2YGYA 3C0JA 2PDYA 5F2LA 1Z3NA 1E0UA 3G1VA 4HPXA 1E0VA 2HBXA 4ASTA 4YTSA 4FXRA 3TIMA 3W7NA 2F2HA 4IQDA 5D30A 4WEVX 1AJ0A 3LGGA 5HQMA 1Q6QA 4Z0SA 1BHGA 1UKQA 3DUGA 2OWCA 1F3TA 1ECEA 4CU6A 1J5SA 3KWXA 1PKYA 2XDFA 4UQBA 2V5BA 1HN1A 1K03A 4IFOA 1P0NA 3ICJA 5HATA 4E2VA 4YTRA 1XYCA 6TAAA 4FA3A 2DW6A 2CBJA 3TX9A 3LGEA 5I3KA 1P4CA 3O0FA 4PR4A 4RE4A 1UKSA 1OFPA 2O92A 4K68A 2J13A 3IVUA 3HA1A 4FHAA 2XIIA 2HZGA 1EEPA 1Q85A 4JIRA 3WK2A 2XVNA 3TV8A 5JBFA 4GY7A 4X3ZA 3O0KA 4LVAA 2NUWA 3WD0A 3O6DA 3CL8A 1H3GA 1KD0A 4H8UA 4HZ7A 1IEXA 4CNNA 4WXZA 5AHIA 4AD1A 1V3IA 4ZVJA 5XIMA 1HL9A 4JS3A 1K7FA 3VMPA 3N13A 1FWCC 2J7DA 3P60A 3RMEA 4B15A 1Q7QA 3M64A 2ZWZA 1UH4A 3STCA 3GIYA 3HJEA 1QHZA 3QW3A 1M6JA 3B3DA 4O17A 5ENLA 2C8NA 4HCHA 3AU6A 1UH3A 2QQ6A 1YTDA 3L12A 4MWAC 3IJ6A 4QROA 2ONEA 4LW7A 2FJUB 4NUWA 4ONVA 2WNQA 3KX6A 2VL4A 3CZGA 5BU6A 1K70A 3H2MA 3WEOA 1WZKA 4IPNB 1SJAA 4ILSA 3WQGA 2ZZ3A 4JTHA 2ODOA 4GVGA 1DJWA 4FEZA 1I2NA 2VVSA 3UZYA 4F66A 2QMJA 3D6NA 1JNEA 4K36A 3A4WA 1OWQA 3MI6A 4TMBA 1E1EA 4LUTA 2DJLA 4AEOA 2WZHA 1QNQA 2OX4A 4L65A 4C6IA 4JEJA 4RX0A 4PB3A 4CEXC 3BPWA 3AIQA 3CAQA 2WMIA 1H7NA 4GABA 3OODA 1J79A 1DE5A 1AJZA 3T8QA 3CM4A 4FF5A 1DIOA 4KEVA 4LAZA 4XVEA 1J18A 1UYQA 1RH9A 1IEVA 2BGSA 4NNBA 1KWKA 2A5HA 2AAMA 4GGHA 1UZHA 1KM4A 2JK2A 4FF7A 4UZSA 3PB2A 4KWVA 4PUJA 1GHRA 4ZMGA 4L1WA 1TV3A 2ISFA 1JCNA 4H8HA 3II1A 2F38A 3AICA 1FWFC 3A4XA 3AMDA 4C1NB 4DWSB 3MHUA 3TKFA 4RCXA 4D1JA 3GS6A 3DBPA 4QE4A 3B40A 1NDVA 2FKPA 2YOCA 3QZEA 4IJBA 4JPGA 3CQIA 3LM7A 2WB5A 3UEQA 4XZBA 1NM9A 2H9AB 4KBXA 2QPXA 3CPRA 2FDMA 3H55A 3B8DA 1JYVA 1YRRA 3BOXA 3NFUA 3U0HA 1R0MA 3PZGA 3VGGA 2BSLA 4NNAA 1NJJA 1BLIA 1M41A 3MP5A 3A21A 1IZKA 8XIAA 4GI9A 5FESA 1L6WA 1KFEA 3XINA 5BWFA 4EP8C 1HUVA 5D04C 1HTIA 4IP7A 4OBSA 3LM3A 4HB7A 4XAGA 4UQDA 1OY0A 2WVVB 1T0OA 3DC0A 1KTCA 1DJZA 1P1XA 3TWAA 1LWHA 4UTJA 1Z7AA 3MB9A 3E38A 4UC5A 4E6MA 4LS0A 4ZOCA 3ARUA 4YYFA 3ARWA 1GVSA 1E73M 1E9ZB 4Z2HA 4HNTA 3OLGA 3V5OA 4HNLA 3T8LA 5I3FA 3R0KA 2Z1VA 3DCPA 3L5AA 3L4ZA 2YXGA 2YDQA 2PWDA 1D9EA 3MHFA 4K39A 2OG9A 1X1OA 2UBPC 4XK2A 2C13A 1SO5A 1MUMA 2XGBA 1QW9A 2E5CA 1DQXA 3LMYA 1I2QA 3QF0A 5GVJA 1OCBA 3LLFA 4O18A 4AMAA 1NWSA 3R79A 3W6LA 4IF2A 1BKSA 3JS3A 2J24A 4OE7A 3NPXA 1DHKA 1GGOA 2VFFA 4JFTA 1JZ5A 1EJXC 4F8XA 4RDYA 2Y8KA 3BZJA 3UP8A 5CLTA 4XZWA 2XSBA 1CGWA 3SQSA 3DG7A 2CLHA 5FF3A 4K8HA 2INEA 2EG6A 5LGZA 4L9YA 2OX1A 1TPC1 3G8EA 1Q6LA 4TU1A 1AW5A 3B9AA 1YMYA 1GWJA 1J12A 1DJGA 4MDOA 1RUSA 3AMKA 2WVUA 1ZLPA 2D73A 2AL2B 4QHRA 3I3BA 5AC5A 2DZBA 2RJHA 1WOBA 3PP7A 5B7ZA 1V6UA 4MJZA 2RDXA 1QK0A 4GOAA 1M1BA 4ZE4A 1KFBA 3H23A 1OC6A 1RPXA 3HZ3A 4UTWA 2VX5A 5C9UA 4XZNX 2B7OA 4X60A 2GWGA 1GG1A 1H1ZA 1RALA 2BOEX 3QZAA 3WBYA 4NJIA 3FVDA 3LPPA 2P0IA 1RHCA 4JGDA 1WBHA 3H7VA 3VI2A 3CUFA 8XIMA 4JXCA 2I5QA 3PUEA 3ZT7A 1UPPA 4MJ4A 2X41A 2E8ZA 2P8BA 3W2JA 1YXDA 1L8PA 3OZMA 4A3YA 2VZOA 1S3TC 2PSNA 5IRPA 1X8CA 1JPKA 4GUHA 3TOPA 5BW6A 1I1WA 3U5YA 1FWBC 1XC6A 3EWCA 4BI5A 4AC1X 3DGRA 1MI3A 4DRSA 3O05A 1S5MA 4BQ4A 3TYAA 3HGOA 2HV5A 1M53A 3TC6A 4JFUA 4BKNA 3WD1A 3R8HA 3R8GA 4O15A 5DRCA 4KH2A 1O1HA 2E9LA 4UIOA 3MBFA 5CPLA 3H70A 3TROA 5CPQA 5I3IA 4N9EA 4CQ8A 3ZJ7A 1S5NA 1FWSA 6ENLA 4AG0A 1H62A 3N2TA 1F73A 2OWWA 2QJNA 5FJOA 3N17A 4Q4QA 2XSAA 1QI0A 4HA0A 3TA6A 3R2GA 3LHVA 3VVGA 3LOTA 3OGRA 1DWJM 2EPKX 5GJNA 1GK8A 1TPFA 3FYYA 4MVAA 9XIMA 4C91A 1HVQA 4JX6A 2RDUA 4M7SA 1T8QA 5DT5A 4FX7A 1TG7A 1QPOA 3H2OA 3VCRA 2VDGA 1DHPA 5AVNA 4GLEA 1FWIC 2QIIA 1W3IA 3KTCA 1Q4NX 5FF4A 3CQHA 3GHRA 2CERA 2EO7A 1PEZA 2VEFA 3HMJG 4JTGA 3TMLA 2WZEA 5CPMA 4ZBCA 3NQFA 3IJ7A 4CU8A 2E68A 3RX3A 2D2HA 2W91A 3OVGA 5IDIA 1BWLA 1KQYA 3FX4A 4IUOA 4H6KA 4KQNA 2W6RA 4E4PA 1JZ4A 3LN3A 4IP4A 3HOJA 3QM3A 3MMWA 4D6IA 1QI3A 3RJXA 1VBGA 1O12A 2YFNA 1P6BA 1V0KA 1PZ3A 3QY7A 2ZX9A 1QO5A 2DZPA 3LX9A 1HT6A 5C9RA 6REQB 2YYUA 2ACSA 3V1PA 2ZTJA 3EDEA 4HJFA 5FAJA 1KLZA 1NF0A 3NJ3A 4CD5A 4PBGA 3RRAA 1LT7A 1VFMA 1QWKA 2VZTA 3FGCB 2XFWA 1G0CA 4UMAA 1IXQA 1WB0A 3SBFA 3STEA 2W67A 4Q8OA 4DHGA 4UTMA 4CD6A 1XBYA 5CZJA 1NARA 1W9DM 2VD9A 2E7FA 1FCVA 1K8XA 1R3YA 5HWMA 3PANA 1XIHA 4K7VA 3T2QA 3HFTA 3E2RA 2ZRXA 2ZUUA 3UXIA 4MPKA 1ZJIA 2Z1BA 3GIQA 1RCXB 3AHXA 2PLMA 3IACA 1WP6A 3GU1A 1XYAA 5A6SA 1XISA 5HOSA 1JAKA 3AWOA 2QCHA 2YCIX 5D33A 3SN0A 4HNCA 1AMKA 1UIOA 1FQ0A 1RP9A 4AHPA 4M82A 1E6XM 4RUBA 4Y9MA 4TTGA 2PBOA 5FF0A 1ZRQA 4AX7A 3UT0A 2NLYA 5KZEA 3VA8A 4GI8A 4QBXA 3THAA 3FY1A 1BWVA 3GC4A 4MGGA 3RILA 1EX5A 1GORA 2ZUVA 4D6EA 3R6IA 3TTYA 4UWMA 2PDHA 1Q6RA 3VCNA 4WXYA 1N8FA 1S5TA 1MMFA 5LHEA 2PTZA 1TR1A 2XSXA 4MPQA 1GW1A 4G9PA 4H04A 4KT2A 5A2AA 3W1QA 2WC3A 1LBMA 4S3CA 1JYNA 1FWWA 2HVNA 1VYRA 3QPEA 3ABXA 3TU9A 4PMOA 2YKKA 3L23A 1EOKA 4M24A 3F4DA 2LLEA 3JUGA 7ENLA 1SO3A 2Y7EA 4MZ8A 3B8TA 3FHAA 1B3VA 4DEFA 4WLCA 2CC0A 1AG1O 2ZXQA 4M51A 3ZLHA 1ITXA 4Z2IA 2J8TA 1E4LA 4C6BA 2OEJA 1CWYA 4NZ4A 4FR1A 3A9BA 1KRCC 3LLDA 3B0XA 1XHGA 1F6YA 4D8LA 3EMCA 4MHBA 3PJTA 3W2LA 3GVGA 3OVRA 5ABEA 2PDPA 3IIXA 5AB3A 2DT3A 5HUPA 4Q7NA 3N29A 4Y9OA 1XLMA 3BCFA 4MYAA 1VRDA 1SO6A 3AALA 3S1VA 4XZHA 3DKLA 2PZ0A 2DQXA 1JEZA 2EPNA 1RXOB 1B90A 1TELA 4DX3A 4RDWA 1LBLA 3OO2A 4TTUA 2ISDA 4AEEA 4GQRA 2VI0A 3SW6A 2QUTA 1U5VA 3WDHA 4Q8VA 3W70A 4D6HA 4GK8A 4AQLA 4TXEA 3N18A 1XH2A 3BLFA 3N04A 3QTPA 3AYSA 5D8WA 2YDRA 4UTWC 1SZRA 3CUGA 5A8NA 1N8IA 2X1RA 4QDWA 4FS9A 4A22A 4JTFA 2WCAA 1B3WA 1QNSA 5DCEA 1QVBA 3TSMA 3C52A 4LVDA 3LBCA 3QSRA 1CXHA 1FHLA 4GRSA 5K4XA 4PCPA 4LBRA 4P8XA 4F0KA 3DDMA 1WXJA 4PMVA 3ZJKA 3IUDA 3C3NA 3ZLGA 1R9YA 2PC4A 3IAPA 4Y8EA 4DAFA 4YHEA 1L0PA 2POZA 3DG6A 2GVLA 3IANA 1FX6A 3UJSA 2GQAA 2XVPA 3LS9A 3PHAA 3KBSA 1ONWA 2X05A 1GVRA 1MYRA 3G24A 5MKGA 2VMFA 2NSOA 2QMKA 4JHZA 3TP4A 4ZQNA 2PU1A 1O5RA 4CQAA 1VS1A 4QRNA 2WSRA 2Y0FA 4JNYA 2YZ5A 1GOOA 4LCSA 3EB4A 4NP7A 3H2EA 1VJSA 4WCJA 2BY2A 3R13A 1EA9C 3W81A 4PUUA 3AIWA 1E0TA 1UOZA 3WLIA 1F6KA 3FLUA 3T44A 3V5FA 3APTA 2IPFA 2ZXAA 2O9TA 3MSGA 2ATSA 1OBAA 3R43A 4YXGA 1NF7A 2WPBA 3E3HA 4H9MA 3FKRA 5E0CA 3CIVA 2CZVA 3OJGA 1ISVA 1VF8A 2GUYA 2G3IA 2FZ9A 4Z2LA 3PZTA 1IT0A 1W8SA 3OOQA 3VOJA 3AHVA 4Z1CA 3T2PA 4F0SA 1UW9A 1UASA 1U2YA 3BSGA 2OZ0A 4GKTA 2FMNA 4AZ6A 3WUBA 3V35A 4O4VA 1R85A 4YVXA 1X97A 2Z1WA 4X61A 3A3WA 1MW2A 5M2FX 1ZNNA 2XTKA 3NOEA 4DLMA 4AZ5A 4GUGA 3BVJA 3TYEA 1E1CB 4A8IA 1TIWA 1XLHA 3MMTA 3VU2A 3NR0A 3S5NA 2YA0A 3FA4A 4C6OA 4Q4KA 4C6CA 1FH8A 1T41A 2CXGA 2XIQA 4M5PA 2GOKA 2Q71A 1VPQA 1CGUA 1QNRA 1JNDA 1TWSA 2INZA 1IZJA 3SZ8A 2YA2A 2YLLA 5B80A 4O0QA 3RO8A 3WL1A 4HU8A 3EWUA 3UWWA 3UESA 2MANA 4E8CA 3DEQA 4FALA 1SSDA 1E5NA 4J28A 2FH6A 5D03A 4DXKA 4DAIA 3W1XA 4UTLA 5GQBA 4W5ZA 3BL3A 4Z42C 1HJXA 1E4MM 3B0YA 5EMKA 3MI2A 4FIQA 4KKXA 4GO8A 1RLDA 3BZGA 1OQFA 2YCLB 4KIEA 3GNPA 3DU0A 3UA4A 1MXGA 3CUIA 3BAWA 4FX8A 1H7RA 2PGWA 4EAMA 2CLEA 3NPWA 4LJ3A 5AC8A 1GVFA 1REQB 2OVLA 3U57A 2Z6JA 2IMRA 3E74A 2Y89A 1R8LA 5EPDA 4KRUA 4S3JA 3RLHA 1ONXA 1ZHAA 3WZ0E 1L8NA 1IF2A 1PCKA 3ITGA 2C0HA 1J96A 3ITLA 1US3A 4NIRA 2C14A 1ISYA 1M7JA 4LS2A 1W3LA 3CK5A 3VIJA 3C0LA 5BCAA 1NH6A 1RQBA 3L4XA 4XKYA 4E4UA 1W1B1 3WCZA 2VQUA 3NZRA 3P2VA 1SFJA 2OR2A 1EDGA 1TJRA 4WSKA 1KM3A 3IJLA 1OM0A 4ZOBA 1KM5A 3ARTA 1XC4A 4C6JA 1CXFA 3NPVA 3UVAA 4DXVA 2ZCGA 3GDKA 2NXHA 2PLCA 3L0NA 4O13A 1YX1A 1XLIA 1P0KA 4PTXA 5AZ1A 3S2JA 2I5IA 4NILA 1PTGA 4KCVA 2DZXA 4AD3A 2XIMA 4R34A 5FSEC 1CGTA 2L5HA 4HA4A 3MUIA 3KOWA 2XGZA 5A1AA 3W3OA 2PRMA 3BGGA 4LAOA 4O52A 5D2XA 4YVVA 1U33A 1KBKA 3SJNA 4J3SA 4GH3A 2O0TA 1G1YA 2WLYA 3SO7A 4AVFA 2A85A 2QDHA 5LNSA 1G69A 1PAMA 1TPB1 4Q8PA 3WQFA 5K9DA 5I78A 1ZENA 1E5JA 4KFPA 1DWHM 3W1LA 1GHSA 4RR4A 3VAVA 2QCFA 1IHIA 2YXXA 1I0BA 3NL6A 2J25A 4CKQA 4UFHA 1PJ9A 3OLEA 3BLPX 1VAHA 1EC7A 2J8FA 1Y5WA 1A5KC 3MO4A 3WLJA 3U5UA 5A2CA 1S2VA 2CHNA 1H41A 2P3ZA 4I5UA 4F2TA 3OA5A 3NL5A 2XINA 1PWMA 2ZRVA 3CIWA 4W7VA 5BXPA 3VNJA 4AWUA 3DECA 1Q6FA 1OFEA 4MSSA 4GNJA 1XLFA 1BVZA 4DYJA 4IMAA 3VDAA 1LL4A 3BWWA 3GY1A 1VPYA 4RDZA 2OKOA 4Q8NA 4UR8A 3UR7A 4BR1A 4I5RA 2PGRA 1JCMP 2ZXDA 5JBDA 3WL0A 3H4GA 3DERA 3QFEA 4GXMA 5D2TA 3CH9A 2VOTA 1ADDA 5CG7A 4EANA 2WSYA 2VRKA 4FOKA 3M5YA 3PPCA 2ADAA 1R3QA 1QAPA 4K37A 3AHYA 3BICA 2PRLA 3SCRA 1EHNA 4Z2GA 3C61A 3SIZA 4UTHA 5BU9A 3C56A 2SFPA 4I8YA 1OYBA 4V27A 3BOFA 5M3WA 3UZWA 4AZBA 3BCDA 2PDJA 4MMWA 4RXFA 1I2PA 3RLVA 4YTQA 5BOOA 1KTBA 2Y2WA 1W32A 1UUQA 3VD5A 2HPIA 1HVXA 3UF9A 1BEUA 3EKZA 3UY7A 3GXFA 4WIWA 3BLDA 2YYTA 1NFGA 4AZCA 1MDRA 2CLKA 1W31A 3I6TA 5A6TC 4DJFA 5T26A 5AC4A 8RUCA 3N4EA 1RLCL 4FNPA 4H7ZA 1TPDA 2R6OA 1PHWA 4ROPA 2GUBA 5H8PA 1O66A 3PG8A 5G1TA 1T7LA 3T9PA 2P3EA 2OLAA 4L5ZA 1S39A 5FF2A 1Z44A 1T96A 2HDJA 4JQ4A 2QR6A 3T0DA 5BMXA 4OBRA 3E12A 1TUFA 1S46A 3UG3A 3W73A 1F5ZA 3HPAA 3DAQA 3ZLFA 2VD8A 3GHUA 2OEKA 4S3FA 1HF6A 1HKJA 3KDNA 3CUHA 1RD6A 4HKPA 4V1XA 3KHJA 4DLFA 4XWUA 3O63A 1KM1A 4UCFA 3VGBA 3VDBA 2E25A 2E8YA 2OMAA 3WF1A 1GVYA 3EX3A 4JNZA 1PKMA 1OX4B 6ALDA 4M7TA 4JN7A 5CSYA 1WXYA 4NZFA 3TLLA 1VP5A 2R24A 3GQYA 1UROA 5I77A 3DHPA 3GVRA 1NP0A 4JQ2A 4RNJA 4QG6A 2CEQA 1EJ7L 3LEPA 2Y70A 2AL1A 2JGYA 2Y7DA 4LYKA 4LNYA 2AMXA 3GDLA 3NAVA 3TYUA 1H63A 2J7HA 1ZBVA 3ITTA 4ZL1A 1Y0EA 3VK5A 4X63A 1QPRA 1S2WA 1V6WA 3SFKA 3RFAA 1X1NA 4O8AA 2DSVA 4DZAA 5FF7A 4A3UA 3G6MA 4LU0A 5I02A 3M5VA 4DYKA 4KETA 3N19B 3M0XA 2ZIDA 1XLKA 1EHAA 2IXVA 1EJTC 4KCWA 3GTHA 3W23A 1EEXA 5HJXA 3ZSTA 1GPWA 2GDUA 3M16A 2TYSA 1Z41A 1XX1A 3QOMA 4XUYA 3SECA 2ZUNA 4BI6A 1E9YB 4AIUA 1QDSA 5KITA 1HO1A 3FS2A 2A3AA 1JQXA 4KS0A 2V67A 3S1XA 5JIWA 4EX4A 3LB0A 1F8IA 4BI7A 3FV9A 3NWRA 3EXSA 2PAJA 3Q37A 2RAGA 4ZTYA 4C6FA 3L0GA 3FYOA 5ABTA 3WLRA 3GRIA 4UUIA 3VOFA 1U1UA 3SCUA 2WAGA 3NQ8A 3KLKA 3UETA 1JXJA 1GCYA 1NIUA 4UQ9A 4I9JA 1ZU8A 4GG9A 3W9ZA 4MDPA 1QPQA 2V68A 1PKNA 1AK5A 3AYTA 2OTDA 3B4YA 3Q2DA 3E0LA 1ZJHA 4Q4PA 3EOEA 3DYMA 4W8AA 1DVJA 3P81A 3TAOA 3PULA 3OBAA 3GNXA 4OOZA 1DWFM 4HZ6A 3DHUA 3HGJA 3QW4B 3BGJA 1GEHA 1GQJA 2Y7FA 3W02A 4OOUA 3P84A 5H2ZA 3U3HA 1ZUAX 4I5XA 3CT7A 2WHMA 3ITXA 1SUXA 3LCHA 1UD5A 3VOGA 2OEMA 3MI3A 2ZA2A 1PPIA 3QY8A 2GSJA 3O9NA 4P7QA 1KTNA 1AW1A 3N34A 3N9KA 3AISA 4HPNA 3PBVA 4CNSA 1PXGA 1E9LA 3RM9A 3QQWA 2G37A 2PLKA 3Q94A 3VM7A 1XRSA 4LBUA 1XPGA 1Y7VA 3O8AA 4NZ1A 3A24A 4U10A 1UUMA 3LNPA 3OBEA 1RZMA 3M41A 4JY8A 4NAEA 4U2YA 4MY1A 2IPGA 1HGWA 2D2OA 1B4EA 2E77A 2QVNA 1ISWA 1WO2A 2BVYA 3H8AA 3HV8A 1I1XA 2GDVA 5T9BG 3GXMA 1D7FA 1P7TA 2NQLA 2JIWA 1G9HA 4O1EA 3EDDA 3VKBA 3LSBA 1L9WA 4KF1A 3NOYA 2J9XA 3GVQA 1CXEA 1VBJA 4RPPA 3ZXWA 4DNHA 4TUFA 2BG5A 1YTKA 3MUAA 3MY9A 1VB9A 4MUPA 4OUEA 4S39A 1EJWC 1PHQA 2H8ZA 4O10A 2WMFA 1DJNA 1B4KA 3JW7A 2ZZ2A 1GJWA 1MW0A 4XG1A 3BW2A 1F76A 2CBVA 4Q8UA 1XDMA 3ARRA 3EX1A 4O50A 2J47A 1T99A 3K4WA 3A5FA 2A6NA 1W6TA 1ZJBA 1HKWA 2P10A 3VNIA 2R9RA 2ZRWA 3CV2A 2Z26A 3VINA 1Z48A 4AIBA 1RQHA 1OABA 3NQMA 2F2KA 3U4AA 3KL5A 2P76A 1F6PA 4Z08A 4QNWA 1CGYA 3EA1A 2ON3A 3FJ4A 2VZUA 1WDWA 2I5GA 2XPKA 3KVMA 5CKSA 1RP8A 1RR2A 3LYEA 6REQA 3CH0A 4MJMA 4Q8MA 2G41A 2FHCA 3GAYA 1HL8A 3AXHA 1WQ5A 4LVFA 4DM2A 3BV7A 3S9ZA 1TZ9A 4KMQA 5FSDC 4WZHA 3Q67A 2I9EA 3WBWA 2BY3A 4C6NA 3SGUA 1MQQA 1QR7A 4DBUA 4M8UA 3UPWA 1GG0A 2NV2A 4HPJA 2Y4SA 3EB2A 3WQ6A 2Z2UA 1CTNA 1VRXA 1J10A 3W53A 3VKAA 4WGHA 4EE9A 3PC0A 1XYMA 5D9MA 1MO0A 2HVOA 3S6DA 2YIHA 5H91A 3VGDA 1NY1A 4G5DA 2NQ9A 2Q09A 2OSXA 2P1FA 3Q45A 2BGNE 3P8IA 1O1ZA 3OLIA 4C7GA 4QLKA 1ODUA 2W66A 3MA8A 1AA1B 1I75A 1W3KA 2F9RA 2PI6A 2WSKA 1UWQA 3RG6A 4PSRA 2J88A 4F79A 3RJYA 3C86A 1YPIA 1P43A 5A8QA 4CD7A 3MBDA 2QZRA 1E3XA 1JDFA 3VOIA 3OVQA 1GOXA 1K6WA 1TA3B 4QR6A 1UR9A 3A3HA 1TQJA 1LQAA 5K2ZA 1D2KA 2GQ3A 5C7HA 4GQBA 4MKSA 3RU8X 1LG1A 1A4LA 4DUWA 4XD6A 2Q8XA 1GTEA 2OYLA 3WFZA 1J2BA 5HUOA 1DTUA 3B8IA 1MXDA 1OX6A 4PMRA 5CSSA 3CYJA 4OV9A 2VR5A 4HPHA 3E5PA 4DJDD 3BLLA 2HISA 1JZ8A 4LX4A 4JYFA 1OIMA 2VQTA 4HK5A 1EQCA 3E9AA 5ECUA 2ZZ7A 3MSDA 1BXBA 9RUBA 4EF9A 1UP0A 3MKCA 3W26A 2PDQA 1WE5A 1UG6A 1QRQA 1OF6A 3GU2A 1TTIA 3QR1A 3BG5A 3W6MA 3ONBA 5DEZA 2VENA 4GC3A 4WK9A 4FX6M 1IGSA 3O6CA 4O0ZA 3T0AA 2IXUA 5DBUA 4E3TA 1EA0A 3QPYA 5AC6A 2OLSA 4Q4SA 3B06A 3RCYA 3GU9A 4JCMA 3KEHA 3H24A 3VNLA 3TN6A 1MXSA 4F9JA 3FCPA 3RCMA 5EMJA 1V6VA 2VRJA 1UWAA 4M29A 3PPGA 3FK4A 2HXTA 3EA2A 3GG1A 2X0HA 3A3XA 2CU0A 1GTHA 1WDSA 3EX2A 4P7RA 3TTSA 4WF7A 5LNRA 3C5QA 4H2HA 4IIBA 4QSFA 1W54A 4U28A 4EPKA 1H61A 1XCXA 1OGGA 5H8UA 5GJMA 1HKMA 3I65A 4XAYA 3W7JA 4GINA 4AD0A 1DEDA 4JTIA 2DW7A 3DH7A 3W1NA 1A5LC 3I10A 3BMWA 1LUCA 2OYKA 3GFZA 3N73A 4INFA 8CGTA 3KBMA 4GJ1A 2FZNA 5AC7A 3I7RA 3C2RA 5AN7A 4A3RA 2VGGA 1Q6DA 3HG3A 1LRNA 3L5LA 4WSJA 1LDCA 1BGAA 1BPLB 3ZJ8A 2BGQA 4TVUA 2VR2A 2ZX5A 3VD3A 3GTNA 5IHRA 1ZFJA 3IS4A 2VC6A 3ORWA 4JTCA 1B1YA 1V4YA 1WBJA 3JZEA 2Y85A 3HTWA 3W75A 2ZTKA 5CPTA 3RNDA 1TPWA 1GQNA 2WVSA 4GO9A 4PYSA 5HR6A 4BS0A 1ZL1A 2QCNA 4RXGA 5ABGA 2QV5A 2JKAA 2DT1A 3UVIA 5DMNA 5DX7A 4AZGA 2Z1KA 3H2CA 3G5EA 3CUJA 2HNHA 2QUUA 2W5FA 2A2IA 3N11A 2E0PA 2Z0IA 1YBQA 4ADSA 1D7KA 3WUEA 4KW2A 5C9WA 2D20A 2DUXA 5DFAA 1UC4A 4WDTA 3FSTA 1W5OA 4ECLA 3BAIA 4JTJA 2QHAA 2X2GA 2JE8A 1FOBA 1TVNA 1VLIA 2Y1HA 4UNKA 3FN9A 1WV2A 5IHSA 3YPIA 2AQWA 3I3DA 5DLCA 1J9YA 4DUOA 3T0BA 2PTYA 4WY0B 1OYCA 1H09A 4MWAA 2FIQA 1BRLB 1LRTA 1ITQA 2X1IA 3UCQA 4LALA 3T0CA 3LQLA 3T7VA 4IGMA 4BF5A 2E67A 1RVKA 4D6GA 4ZTXA 3PTQA 4BHYA 3B8UA 2DGAA 5CGQA 3NIYA 4DJFC 3AJXA 4N7QA 2X0YA 1FHUA 4RE3A 5A6KA 1HXJA 1OD8A 5TAOA 2WM0A 1M01A 2BXYA 4FB7A 4GFSA 3V3WA 4LCQA 4HZMA 5AZ0A 3VD4A 4PMYA 2ZX8A 4AY1A 3ENLA 3DG3A 5FOOA 4HT3A 3SIMA 3UCDA 5EKYA 4NX0A 4NKCA 3QH2A 2GDQA 4YTTA 2VXNA 5CXPA 5CJMA 1GVIA 1QNPA 3DFPA 5FEZA 1JD7A 1EDTA 2MNRA 2NQ5A 3VXGA 4DJED 1G67A 3EWBX 1QPKA 2J74A 3WNPA 3EEGA 4DJDA 4IIGA 4JTEA 2R82A 1ZCCA 1SZFA 4M80A 2VP8A 3VO0A 4XAPA 1TV4A 3CV7A 1P7TB 5E1QA 3WQ5A 3PZVA 2E28A 3EOSA 2A7NA 4LNCA 2WYSA 2NVCA 4RLIA 3VDGA 1SFLA 4ACZA 4XD3A 4TO8A 4KPLA 3EOOA 4GUIA 2B0MA 3WF3A 1JF6A 2Y61A 3H53A 2DT2A 1RBLA 5DXYA 1GOMA 3SUVA 4CVUA 5AHMA 1VYPX 3DYOA 5CG0A 1EBHA 1MEHA 1JYXA 2D22A 1R5YA 5I00A 3ZT5A 4Z17A 3ITOA 2ZVRA 1VENA 4FLSA 2HK1A 1YE6A 3CTLA 3UZ5A 2TRSA 1QO2A 2HCVA 3M0MA 4JFSA 4MNJA 4ZOAA 1OCNA 4OU1A 3MMUA 4OZOA 1FDJA 4AYGA 1QFEA 1DJQA 3CTTA 5CH9A 4IFKA 2WZMA 2RGMA 3SI9A 4MFDA 1DXEA 3NZQA 1CXLA 3TTEA 4ZODA 3V75A 2O9RA 2VC5A 4O1FA 3M0KA 4AIEA 3BSMA 3KL3A 4C6EA 2XN2A 3BARA 3VIKA 1JZ6A 4W7UA 4IQJA 2XIJA 1UWIA 4JDYA 3DHFA 4LB4A 4XQ6A 3M1ZA 2HS8A 3NDYA 1AZ2A 1LM1A 3SGZA 3PBYA 3IJ9A 4FNRA 3R89A 2NV1A 1FFQA 2VEIA 2W4XA 5I79A 1TWZA 3LPGA 1F74A 3GUGA 7A3HA 2QS8A 3T0TA 2YCEA 4B5WA 3EZ4A 4I9AA 5F4WA 3S42A 1H51A 1PVNA 5JH1A 1B57A 4ICCX 5DN1A 1GKRA 3CIXA 1E6QM 5M1TA 2ACUA 4EVZA 3GHSA 5E09A 1X1ZA 1UP2A 4X9YA 3K1GA 4ZSTA 1VIZA 2CLOA 1VD6A 2EGZA 4Y7EA 1VCGA 2IUZA 2X09A 2UY5A 3UR2A 3GG0A 1XFCA 2I14A 5HNTA 1W1TA 3KE0A 1XLCA 1D3CA 1KRMA 3U6WA 3WYZA 3HPSA 2QJGA 1DV7A 4NASA 5FEXA 4QQ3A 3F5KA 2J62A 3MVTA 4IT1A 4KEUA 4JL2A 4IPPA 5FJJA 1BWKA 1VBHA 3HU7A 3TTOA 1Q45A 3MJYA 1V77A 1XLJA 1NTHA 2AMGA 4UTTC 4IMCA 3W1RA 4KRZA 3LCLA 5FL1A 2D69A 3VE7A 3GSMA 4QFUA 1AMYA 4WD0A 3STPA 1ENUA 3KM8A 2RGLA 3MYPA 1XKJA 2DY3A 5MKGB 5HPOA 1PE1A 3H7RA 4U5KA 4YNGA 4J2PA 4PUDA 1BYBA 4H2CA 2RHGA 3KZSA 1G4PA 3ES8A 1XD1A 3T78A 2OELA 4IOTA 2DSZA 2HROA 3VFLA 5I3GA 1AQHA 1W2PA 4NSBA 1J11A 1J0KA 4AXNA 2F61A 2ANUA 4AF0B 1ZQ5A 4EPDC 1VGAA 3FOKA 1OCQA 1TKKA 1E1FA 4BWLC 3E0FA 2DEPA 1LJYA 3SB0A 4IL2A 4C1NA 4JFWA 3RCNA 1QCWA 5AYBA 4C5YA 4IFRA 1G6CA 2YCJA 1VFSA 4AY8A 1QJWA 1OFRA 1JGIA 4GPNA 1LL7A 4M1BA 3ARZA 2WZTA 2PC8A 1JGMA 4X0VA 1SVDA 1PBGA 4WJ8A 2FZDA 1JPDX 2GVGA 2V5DA 1ZCOA 3G3MA 3GG7A 3WEZA 1QT1A 1ZBWA 4H7VA 4WR3A 1JJKA 2DZTA 1C9WA 1VZWA 2VFHA 3O06A 4WDXA 4P5UA 3M0IA 1DJIA 4IWWA 5AHFA 2J9YA 3W7HA 2ZWYA 1QI4A 3GDTA 4MY9A 3WN6A 1UKPA 4ML4A 1QU4A 5D8ZA 2W92A 3KZPA 4IG2B 1I45A 3T1GA 5U7SA 2Q3OA 5G1YA 3T55A 4TOQA 3P5ZA 2PDLA 3RGTA 1AUSL 1NWUA 3N2XA 2CPUA 4AU0A 2CLLA 4E2BA 3I7QA 5AECA 2AKMA 1P5BA 3L4YA 4CNPA 1CT5A 2I7GA 3PZOA 3WQEA 4ICNA 5CQ1A 2D2JA 3EKGA 3MHGA 1XLGA 2PWHA 3S2CA 3GAKA 4HCDA 1TTQA 3Q65A 4BCEA 5LA0A 3UA3A 4GQ0A 2DFAA 3PF3A 1KFLA 1TJPA 1H7WA 1OGBA 3CYVA 5TNVA 1O5XA 2AOSA 1KXVA 1XG3A 4UTIA 5CC7A 1EGZA 1UUOA 4HTYA 1EJUC 4J3VA 2V38A 4S3BA 3AO0A 4UQEA 3UWEA 3NO1A 1W1VA 5CEWA 3EDFA 1MFVA 3EPNA 3LHYA 3NGJA 4QEEA 4L4OA 1DTNA 3N6JA 3P61A 3W25A 1UHVA 2H9AA 4HHMA 3VIOA 1CENA 1XV8A 1CI1A 1DP0A 2DDXA 5EGRA 2CYGA 4YJ5A 3A22A 3EX4A 2C91A 2V3DA 2WHKA 5JU6A 4EWJA 4BY3A 1E15A 3KW3A 1Q4WA 2G97A 1XCWA 1L6FA 1PX3A 1E9IA 1UR3M 3MW7A 2WQDA 4LY4A 3V1HA 3FFSA 4MG4A 3TEVA 4HIBA 4LBSA 3HF3A 3B05A 3HMCA 1E0XA 3IGUA 1WKFA 2BVWA 1Z69A 3EAUA 4LOCA 4PCTA 1M68A 3BV4A 3UJ2A 3LRLA 4XZIA 4ZFCA 7TAAA 3TSBA 1HX0A 4PUNA 1L2UA 4QAIA 2H3BA 5AY7A 3AHZA 3P3BA 4HYWA 4B16A 3K30A 2WHLA 1VBUA 3BJTA 3HV9A 5IFPA 3G1XA 2HVMA 1KKRA 4RKAA 4LQ1A 2IPWA 1JCTA 4LWWA 2PWGA 1FWEC 4YS1A 2GFTA 2GGEA 1ONRA 4XB3A 3VNZA 2WNWA 4A8LA 5K9CA 3M7WA 3DOPA 2E3ZA 3W72A 2RFGA 1DYSA 4K1WA 4D8AA 4QGCA 1KRBC 3IGSA 1NWRA 1JCYA 2QULA 2F6XA 5J04A 1O68A 1DJHA 3I3EA 1CGVA 3VGHA 1XRFA 4I6KA 1UR4A 2UWFA 4BA0A 4ZQOA 5CSUA 1WKEA 2XFFA 3NCOA 4GJJA 1JZ2A 1PX4A 3ABQA 5FCZA 1BYAA 4JL1A 1GJPA 2H3DA 2QXWA 3JVAA 1VCFA 3EWZA 1JPMA 2IKIA 1DXFA 3VMNA 1QWGA 2NZLA 2PF0A 3SQLA 3PBMA 3A12A 1FHDA 1OZMA 4IPJA 2QGYA 4OT7A 3WG6A 3RPTA 1YDYA 4JQ1A 4MAVA 1RJPA 4RE2A 4AUBA 4YIWA 3WY1A 3AXIA 1XIMA 4RJEA 4BEQA 1F07A 1LG2A 1TVPA 2DIJA 3EOLA 4FLOA 2V5CA 3CHVA 4LUSB 4Z1DA 5G2IA 1KGWA 2PD5A 4RNIA 3NYDA 3DKJA 2A4AA 1F8MA 1HJWA 2NWSA 1LYXA 4AVOA 3NO5A 3UGVA 1PIGA 3ISIX 1HQTA 2CNCA 1CLXA 5IBXA 4NY2A 3TJXA 1LZOA 1IWBA 1W0MA 3ANUA 3M0VA 5K3VA 1H1NA 4MNLA 3CZ8A 2G5WA 3CASA 1VH7A 3S2NA 3AQUA 3ZR5A 3U2CA 1MDLA 3W4RA 5AKQA 3DYPA 2W79A 4KWWA 3KRZA 2A3CA 4HHLA 4BF9A 1MFUA 1ZBKA 2Z29A 4J9JA 2VHLA 1YW1A 2QNEA 4P7LA 1XIFA 3OTRA 1ZAHA 2VELA 4GCXA 2ZRUA 4Q6JA 4C6LA 3RHGA 3QMTA 4LAUA 4V1YA 4I6VA 5IOBA 1SFSA 2DUAA 3LCFA 3HBLA 8A3HA 3R5EA 1G4EA 1H49A 1F3WA 1DWIM 4KGJA 4MKVA 4ZB5A 3I68A 3R11A 1PX8A 2J7CA 1KR0A 1WZAA 3SN1A 3ES7A 1M7OA 1Z6KA 2NWRA 5E9AA 3S5ZA 3T42A 4ICMA 3CJPA 3GXPA 1ODZA 4KWUA 1DJYA 1TMLA 2PDFA 4LCRA 2X1UA 2DSWA 2WSPA 3LRMA 4D6DA 4MNKA 3INPA 3PBWA 1A5NC 4J2MA 3P6LA 2ICSA 2PP3A 2WZIA 1UMLA 3FIGA 3E1F1 4IP5A 2PODA 4MJ2A 5AHNA 2DZUA 3G8RA 2Y7GA 2B4GA 2JBMA 3WJXA 4HYVA 4PMJA 4IL0A 3VILA 1IR1A 3PM6A 3WLSA 4S3DA 3LENA 4O11A 1M03A 4MB3A 4YCOA 1C91A 1TV7A 3COTA 3KBNA 4NI3A 4PMDA 4DJDC 3CO4A 2CZEA 2XZ7A 5A6AA 2FB2A 1E6PA 4O1DA 3G0XA 5HAOA 1W1ZA 4OFCA 5CZSA 2PURA 1C29A 1W9UA 2V69A 3ABRA 3CEPA 2E5BA 1C93A 5BRBA 4JIHA 1KCLA 3UWVA 1AL8A 1J0JA 4N6FA 1WXZA 3TAKA 3DFSA 1XDLA 1KXTA 1VYSX 2BX7A 2F6KA 5MF5A 4M6QA 3HGRA 3IIPA 4D72A 4J3XA 4HSOA 3B8WA 1J2WA 2Y5SA 3K1DA 5I3HA 3C4UA 3L2LA 2Z7GA 1FDYA 3DHDA 3U2OA 4LF2A 4JQ3A 2ZC1A 4EPBC 1VFUA 2EBNA 2J79A 3CEUA 4JIPA 3STGA 4NF7A 1W9XA 3SJ3A 2QIWA 2CCRA 4YLWA 1VEOA 4ZXOA 3MCMA 4Q8WA 4OBTA 3C3UA 4N02A 3WQVA 1ECQA 4MB1A 2O7SA 4H6EA 3CL6A 4UFKA 3IK4A 3MVIA 2DZWA 3SQMA 1KM2A 2CLPA 4PFMA 4US5A 3P80A 3P0XA 2KZHA 1NVMA 4AZCB 2D0HA 3ZIZA 4LAKA 1RK6A 1W3TA 2Q02A 2OO0A 4BQ3A 3GH4A 3PTKA 2BMBA 2TAAA 3VCCA 4KIRA 1QOQA 3GTFA 3BG9A 2XJ7A 3AYVA 1NAL1 4YWIA 3N2CA 4LANA 1VHNA 3UZXA 1X6NA 2GVEA 1CEOA 3K8KA 1LP6A 3BK0A 2BP1A 1UZ1A 3ZWTA 1EH9A 3CHCA 2WKGA 4EXQA 1G01A 4CCCA 1TPUA 2NXIA 2G3MA 2GSHA 3MV01 4UTKA 4DB7A 4WOQA 2BBFA 4CNUA 5EB8A 3GLCA 4HU0A 2WJDA 4ZE5A 1CX9A 1SZEA 4DM1A 1UD6A 3VIIA 5ABFA 1H1YA 3LSCA 4GA8A 5CZTA 1C9DA 3NL2A 2FPYA 3PPHA 4PCNA 1UWTA 3F03K 3HM7A 1UCWA 5F2MA 2Q8LA 3VKCA 4PMXA 3P62A 4GIAA 1KFCA 4GIEA 4IUGA 3ARXA 3GR8A 2VX7A 3ZO9A 2QCDA 1V3LA 3IV8A 5GNZA 5D37A 3SUSA 3W84A 2ZXBA 2VWTA 1CECA 3TYDA 1TZ7A 1ELSA 2A3BA 3HG2A 4OHQA 2CBIA 3CHEA 4ZCWA 1F7BA 4QJ4B 2G0WA 1B9BA 4TR9A 3ITVA 1FXPA 3I4EA 1VC4A 2V3FA 2VFIA 3AFBA 3GG8A 4ZSUA 1HNYA 1G4SA 2FVLA 3DXIA 3TC7A 4DNMA 3TN4A 3WJYA 2YW4A 3PZUA 3F2DA 3W7CA 2FZMA 2REQB 2J75A 4MKNA 4ACYA 3WH6A 5U4NA 2QT3A 2JKPA 3AXXA 2Z4GA 3PZIA 3TJIA 3D46A 3PTDA 4BFAA 3PTMA 3EWWA 3G1AA 3UWUA 5CJ5A 5I24A 2WLZA 5K4ZA 4F9DA 1UA3A 5EMLA 3FXGA 3FJLA 4WJXA 4DPQA 1W9PA 3OZPA 4DVOA 1GVQA 2G8ZA 3USBA 4F48A 4W8LA 2VTFA 1ZS2A 1QI5A 4XAZA 4O57A 3AROA 4GXPA 1YPFA 4YHGA 3GE7A 3NZ1A 2XZ9A 1H60A 3NEVA 3H4WA 4KWOA 4PRTA 5D2YA 1EXPA 2OZ8A 4JNMA 3ZVHA 5HQLA 3ANVA 5BXRA 2G3JA 3OLDA 3EOUA 2VO5A 2HSAA 4B91A 4ZEPA 2ZC8A 5KETA 1XD0A 1MQPA 3WLOA 4W86A 5CC3A 1EGMA 1RCOB 1ZAIA 1VQTA 2A6LA 4GFIA 2Y5JA 1BSLA 3TXZA 4S3KA 4OKDA 3FW6A 1OFOA 2AQVA 1JCJA 1O60A 4U5IA 3MTWA 2Y88A 1KCZA 4Q3MA 3WLMA 3C2EA 3NURA 3V5CA 4C90A 1ICSA 5HNUA 1W5PA 2YDSA 1Z89A 2PTDA 3H4XA 2FVKA 3UBPC 5D9OA 4GGBA 4DO4A 2WANA 4TX8A 5FEPA 1RD5A 1YIXA 4ZB2A 3L21A 5D9PA 3SRHA 2DV0A 1I60A 1BKHA 1BAGA 1UD2A 3FA3A 4AHOA 3IGHX 3I6EA 4FXFA 2PB1A 2CIPA 3R7MA 4WKAA 4H41A 5A2BA 4D8ZA 2WXDM 2DJXA 1YDOA 3S6OA 2TODA 1VEMA 2QDDA 4PCFA 4XKMA 3E0VA 2NQHA 4OTKA 4RZ4A 2ISWA 4M3PA 2BZNA 3N15A 3WBXA 4D2JA 3S83A 4LUYA 1ZALA 3OYXA 4ATWA 1SR9A 3N9RA 2R91A 2YL9A 3S5OA 3GM8A 4GBDA 4G1NA 1JUKA 1XQLA 3SR7A 4U33A 1BF6A 5C8BB 3APYA 4JDBA 2G95A 1EC8A 3PJUA 4M19A 2V3EA 4ZFMA 4DELA 1X39A 2V0TA 1VFHA 2E4TA 3SAZA 2PP1A 1IXOA 1XG4A 3S2MA 3B8VA 4PL1A 2C7FA 1QPNA 2AGKA 4E8GA 4DZ5A 1OSEA 4YYCA 3GXNA 1BXCA 5FJPA 3HPZA 5HQEA 3U7VA 1T5AA 3TYZA 2R1NA 5LKYA 4ADTA 1YDNA 3AMCA 5CZ0A 5D2VA 4CNOA 1X38A 2X1SA 4QLJA 4ADUA 4KWSA 4MOZA 7PTDA 1GYLA 1LT8A 2P50A 1WAUA 7XIMA 5C6MA 2VNCA 4TVCA 4KFOA 1C7SA 1XRVA 4G56A 2R1KA 2J9ZA 3NQEA 4ZB0A 4P61A 3E0WA 3VIMA 4G7FA 4AW7A 3PFMA 3UU0A 1M65A 1O5QA 1TJ0A 3MZ2A 3B8SA 2PS2A 6XIMA 3L66A 1T40A 3EXRA 2DSKA 3R0UA 1M5WA 1UWUA 2DZSA 4RZ5A 3BLIA 1V51A 2X42A 4TV5A 2BTMA 2WC4A 1OB0A 1C7TA 5G1MA 1G7UA 5IM51 3NSMA 5M03A 4S3AA 2Q3RA 3O2LA 4FPSA 4QE1A 2O55A 2F84A 1HJUA 3LHZA 4AHQA 3T4WA 2PCEA 1VEPA 2QDEA 1IYXA 2EJ1A 4YTUA 2DPEA 4CEUC 4L80A 2ZDSA 2BODX 1KFWA 4QX4A 1OCJA 3THCA 4OECA 3FAWA 3PAJA 2D0GA 3WJSA 3GKFA 3H2NA 3VKJA 2C16A 1JDDA 2WBKA 5ABHA 4LUIA 4R5EA 4B3KA 3G1YA 1NQ6A 1QI2A 4O54A 3CGTA 4RW5A 4DWSD 2BASA 5HMEA 4DO7A 2WWDA 1BG9A 1PCWA 2I56A 1RJQA 1V0LA 1X6LA 1H0IA 2ZKMX 3E2QA 4W9TA 3IUHA 2YBVA 3B04A 1F4AA 1R9XA 1CXKA 1J93A 4D6FA 3ECQA 4ZQPA 4XTDA 1Q66A 1LORA 1OX5A 2OYMA 2HNEA 2QDGA 1JFHA 3IV3A 3TFXA 1R6WA 2OOGA 3MO7A 3K8MA 1GKPA 1TV5A 1UKTA 1Z8AA 5FJRA 2RDWA 5GNYA 3IRDA 3K8LA 2GVYA 3NQGA 3W82A 1BFNA 4PMNA 5FL0A 1YE4A 3D47A 3NVDA 2Y63A 3ABSA 3SCWA 4Y9NA 1OK4A 1QW8A 2PDNA 4KCTA 4DZHA 1TUXA 3S6TA 1RA0A 3B9EA 3BJFA 1FKXA 3F4NA 2YB4A 1CBGA 5LSMA 2OJPA 1WZLA 2D2GA 2XFYA 2PDIA 3CZJA 1UD4A 3QV9A 2X40A 3KCJA 3EMZA 2O4QA 2PDKA 4DO5A 5BOEA 1TJ2A 4GYFA 4KEMA 1B2YA 4O4WA 2VZVA 1C90A 4FP1A 4K6AA 3ELFA 2ZRYA 2QAFA 1TV8A 4HPGA 2ACRA 1QOPA 3EEZA 1R3SA 3JU2A 4ZO7A 1A49A 4LUSA 2WW5A 1RVGA 4UFJA 4YWSA 2B7NA 1HZYA 2QJIA 1XBZA 2HBVA 1YPXA 3KVKA 4KESA 4L6OA 2WNNA 3EXTA 1I9CB 3NDOA 5FA5A 4DBWA 4J5NA 1FBAA 1AH4A 4BK9A 1OFBA 3WLTA 1S5WA 1GOKA 1BSIA 2YCLA 1JDEA 1UZ4A 3UY8A 3WDPP 2UV8G 2XHYA 2PLJA 1WDRA 3G1FA 3TONA 1LWJA 1FWHC 4Z0JA 4ZR8A 2VVNA 2GQ9A 1TYGA 3NSNA 5CAHA 4H00A 3GD6A 3ZWSA 3UQNA 5LNUA 2CBUA 1E4NA 3UG5A 2E6DA 1LOQA 4F0LA 3CV6A 3LA4A 3B03A 3HQPA 4QEHA 3QGAC 2O56A 2RDTA 5GNXA 1JXKA 2C3ZA 1FWDC 4FNSA 2GGHA 3EWXA 4GNKB 1EO5A 1Q6EA 3CAWA 4S3EA 1GQIA 1EIXA 3U9IA 3SFWA 3BLEA 1LWIA 2FQIA 2Z6IA 4QIUA 1B3XA 4PH6A 4YPJA 2XVLA 3D3AA 4MADA 3U4FA 1R3RA 2CHRA 2CWNA 1UQZA 3H2AA 2PEVA 2C1IA 3L67A 5J5RA 4HNOA 1LOSA 4L6HA 1GOIA 5F4XA 3W1TA 4R7OA 3HG5A 3MSYA 1XIIA 2Z00A 4PULA 4O8RA 4HD5A 5E70A 5KSWA 3K46A 4DBDA 3I4KA 1WX0A 2CKSA 1EUAA 2GZXA 2JFEX 5IFTA 4AMCA 4LSBA 5EYWA 3BUVA 3POHA 4PB5A 4CN6A 4N0RA 2X1TA 3W6YA 2ABAA 2X8RA 3MKKA 4LC6A 1B54A 5I0DA 3VFCA 4F0MA 1U1HA 3AHTA 3WDQA 3R94A 2F8QA 7REQB 1Z42A 1GOWA 1EL3A 1GQLA 2Z25A 1REQA 2XH7A 1XIJA 3W2KA 3WNNA 3G1SA 5D4YA 3SUUA 3JZUA 3LDVA 1QHPA 3KS6A 1NDWA 2ZZ4A 3IVTA 4ERAA 4NHVA 2WMKA 3BAKA 4GNVA 1JL8A 1FWTA 1XUUA 3MDWA 4WDUA 1KCKA 3EPMA 4A21A 5KMYA 3WFAA 3UJEA 1XYZA 3SM0A 2TMDA 1G4TA 3JR2A 2PP0A 5T8GA 2KX9A 2GQ8A 4RZ6A 5D05A 3VNKA 3IGXA 3RMJA 5E5CA 3MYOA 3PZ9A 3N3MA 4MZ1A 2A1YA 1XJBA 1QNVA 1Q3NA 4LFYA 4YN5A 3WEMA 2A7PA 3V0UA 1G94A 1KLYA 1SJDA 3EWDA 3ZJ6A 4ZZ9A 2G4JA 3D3FA 1L6SA 3E96A 4AC7C 4D6JA 1OK6A 4JHOA 4XBJA 2KAUC 2ZX6A 3IJ8A 4PTVA 3W1PA 4HNVA 1A47A 4IZGA 3TOYA 4I3GA 1IIHA 1E6SM 1O6IA 3OW1A 5E0KA 1ME7A 3MANA 5F1VA 1GKQA 1QBAA 2G3FA 4B4HA 4P7NA 5G4HC 1SO4A 4NXKA 3FVMA 2XG9A 2X0SA 3EX6A 3KUMA 1KCXA 1KGUA 1XH1A 3H22A 4S38A 2XYLA 4PEKA 1MSSA 5I03A 2ZICA 5I3JA 1S2CA 4C60A 3FHQA 4O1AA 2WVVA 2VWSA 1D3GA 3URNA 5ECVA 4H8NA 2HJPA 4LYRA 1KFKA 4W87A 1CLKA 5G2WA 5BZAA 1E4IA 1PZ2A 4GQGA 4GIRA 4QG9A 3L4TA 3GBDA 4F2BA 2BVTA 5A3HA 3VD7A 1FWRA 2PGFA 2NUXA 1V02E 2E1DA 3VD9A 1UKOA 1XS2A 4AFYA 4C5ZA 1P0DA 4LB3A 2VGIA 2XU2A 2Z7KA 3TYBA 5GPRA 3BOLA 4R53A 4DF0A 1OVDA 1S2TA 5C55A 3RYSA 4IQLA 3QTGA 2WMGA 2QW5A 2YBUA 3BGAA 2BXVA 2XIBA 2PU0A 1OGSA 1GOQA 3KFTA 3GXIA 3AS2A 2ZZ1A 1XM3A 4UBPC 2FDSA 1IZCA 2GJNA 3HPXA 4CQ9A 3E02A 4AIOA 4EIVA 3IARA 2GPTA 4U4MA 3F5JA 3D5HA 3ITCA 4B4FA 1UP3A 1VFLA 4NX5A 3LTPA 5K7JA 3LK6A 1K4HA 3SCTA 3WLQA 1RPKA 3W7IA 3WUGA 4R7WA 4JOMA 1EJSC 4TVDA 3PUOA 1XSIA 3EBVA 2VYOA 2WM1A 5CPNA 3DFQA 1AH0A 2VEPA 1IR2A 4UQAA 2QGHA 3VKKA 3LCWA 4NL1A 2HQAA 1GONA 5DMLA 5G5IA 1KXQA 1ALDA 3TQ0A 2XUCA 4PFHA 4XSMA 5LNVA 1EC9A 3SURA 3TR9A 1JF5A 3CV1A 3ALFA 3FEQA 1VR6A 4QJ3B 4H9XA 5REQB 3STFA 3ZR6A 4JIIX 3QR0A 1S5VA 3S2LA 3FNDA 4GYKA 2E09A 1B0IA 2V82A 3H6OA 2VCAA 2AKZA 1EZ2A 3SEPA 4XTIA 1EZWA 3KAOA 4A3QA 4C7FA 5A8PA 1ZP4A 4RV3A 1LRQA 3H26A 3MJMA 3K4DA 2JIEA 4HMNA 1KO0A 4DBEA 4Q22A 4KERA 1OD0A 3FGCA 3A4AA 3UJFA 4NJKA 3EDJA 3T81A 3TSDA 4W89A 4NAEB 3BC9A 5CC6A 2YJQA 4Y9PA 2E5DA 1X6UA 4W88A 1J6PA 3RM4A 4XO7A 5LNWA 1EX1A 3TW9A 1TRIA 5FJUA 2XN1A 1NP2A 3VNMA 5EU9A 5HA7A 5FAGA 3W71A 4NZ5A 1FTXA 4CVWA 1IE7C 4YMZA 1V6TA 3WELA 4ATLA 2OODA 3W24A 1BVNP 3HPFA 1RY0A 2RJGA 3P14A 4S1FA 1PSCA 7REQA 5I2UA 3TQPA 4TV6A 3N2BA 3R4IA