2P77A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
171
Chain Sequence
b'MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAEMAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 60
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p77A00
1EBBA 3KKKA 1DKLA 5CU7A 2P79A 4D4MA 4E3WA 1V7QA 2A6PA 3NTLA 2OWDA 3K4QA 4TSRA 1CVIA 3E9CA 1DKQA 2EKBA 2OWEA 3FDZB 2H0QA 2P9FA 1C81A 2EKZA 2H4XA 3D6AA 2P6OA 2HHJA 4JOCA 1RIIA 4ARSA 2WU0A 1TIPA 4GPZA 1UJCA 2ENUA 2AXNA 1SK9A 2P30A 1QWOA 4D4JA 2H4ZA 4HBZA 3K4PA 3NFYA 5HTKA 2QNIA 3MXOA 2DWPA 3FJYA 1FBTA 3EOZA 4IJ6A 1YFKA 2YN2A 3GW8A 1ND6A 2F90A 4D4LA 4MA4A 1DKOA 1C7ZA 2P78A 3LG2A 1K6MA 3F3KA 1SK8A 4FDTA 2WNIA 3DCYA 3DB1A 2HPAA 1RPTA 3E9DA 2WNHA 4ARVA 1QFXA 1E58A 2HIAA 2H52A 3C7TA 3QPWA 1DKNA 3F2IA 3GP3A 3IT0A 5CX4A 1QHFA 5AJVB 3ZHCA 2P9YA 3IT2A 4EMBA 3BIFA 3FDZA 3E9EA 1BIFA 1RPAA 2BIFA 2PA0A 4EO9A 3OI7A 2P9ZA 5PGMA 1H2FA 2A9JA 4D4KA 2P75A 1H2EA 1C80A 1ND5A 4IJ5A 1FZTA 1IHPA 4PGMA 2P77A 3IT1A 4GPIB 1BQ3A 2IKQA 1BQ4A 4QIHA 1UJBA 5HR5A 1E59A 2P2YA 1YJXA 2GFIA 3LL4A 5CDHA 2I1VB 3GP5A 5AJZA 4ODIA 5AJYA 4JOBA 4AROA 5AJWA 2P2ZA 1SKBA 1NT4A 1SKAA 3QPUA 4FDUA 3QPVA 3EZNA 1DKMA 4PZ9A 3PGMA 4JODA 2DWOA 2P6MA 1V37A 3D4IA 3D8HA 1T8PA 2RFLA 1XQ9A 2ENWA 5AJXA 3IT3A 2YN0A 3O0TA 5AK0A 3MBKA 3R7AA 4PZAA 4ARUA 2EOAA 3HJGA 3LNTA 1DKPA
chains in the Genus database with same CATH superfamily
1HSZA 3CX4A 3OTGA 4Q34A 3UMRA 5HRCA 3P2KA 2IYEA 5L6MB 1N5OX 3ZWKA 2B3TA 2NSLA 5TJ9A 3OCVA 2O0KA 2ZPAA 3JQ9A 4ISCA 1Z0KA 2VDQB 1VZ2A 5E9AA 3S2YA 4GIBA 2HXGA 1WCIB 4I14A 2AMLA 3ZY2A 2ZBVA 3SMQA 5GZ1A 1YS2X 2A1IA 3FOWA 2W00A 1I2MA 1M75A 1IAQA 1YCHA 4H6PA 4JQZA 5B7PA 1TTHA 3KLPX 3LT1A 1LNZA 5E8JA 4DT1B 2RARA 1D4FA 1TECE 2QYOA 2X5NA 4MDYA 5CH8A 2O0LA 4DUGD 2ARKA 1CE8A 1UBCA 4MQUA 1W44A 4HLNA 4IQFA 4Q4JB 3RTGA 2BI7A 5KMGB 3KSZO 3VR4H 1V9CA 2A9QA 4QGAA 4KZKA 1WUHS 3ZWNA 2I4LA 2VHUA 1EXDA 2XT6A 1V7PC 2C7VA 1IAVA 4ZYYA 1AQUA 4DLRA 4ZHQA 3RARA 4D3SA 5C46F 4G0WA 1S2OA 2YWXA 1TM7E 1SOUA 4FTWA 4HNAA 5KQPA 3QOYA 1JQAA 1M1ZA 1OE0A 4G5RA 4M1WA 5BOVA 1WXQA 2VYVA 2YYSA 2GBCA 1SIOA 4FC6A 1N6IA 2Z4RA 3QU9A 2XOKD 4D9GA 4IH1A 721PA 2AR7A 3KAJA 2H11A 5I01A 4UNSA 3ESCA 1RR6A 2H2WA 2R0QC 3GDHA 3PDIB 4JJEA 4IS2A 3N2KA 3ZJVA 4ZOAA 1P1JA 2OBYA 5DSXA 1Q7CA 2G5PA 3AVTA 2HXYA 5A6SA 3HA5A 4Z4HA 2BGIA 5EC8A 3KZXA 3B1FA 3HO1A 3AHJA 4RHYA 4ZI3A 2IH4A 4CUKA 1ZXXA 2F4NA 2I7CA 3NASA 3TXXA 4C0AC 3JSAA 4AY3A 4ESEA 5A4IS 4LHYA 2C04A 2HMTA 2JHAA 2PZKA 3DDCA 3B2EA 3MWDA 4Q39A 2E4YA 4R1LA 3R76A 4BNGA 3JQAD 1JTEA 1GSHA 4J4HA 1E20A 5DM4A 4YRQA 3FSJX 1OH6A 4EGSA 5HJEA 4JJAA 3K2IA 4LYFA 2CK3D 2DFVA 2YW2A 4G2NA 4P34A 4FZ5A 4WKOA 2ZI6A 2QMEA 5E1MA 3GJYA 3U17A 1J07A 1CYEA 1T35A 5F98A 1P1HA 2GTIA 4CMKA 5TPZA 1F51E 3H3JA 3HCWA 4IO1A 4WOJA 3HKCB 4KXYA 3PTAA 2AYXA 2VNAA 3OG9A 4UHCA 2YCLA 4I8IA 4MR7A 1M2JA 4MA0A 2BYTA 4Q03A 5C2JB 3O3MB 3RFUA 2GAFA 4HX9A 1XZKA 2HU2A 4LJLA 4FYPA 1NN1A 2CFIA 3ZNQA 2W4QA 5JFTA 1QE3A 2XVYA 2XUZA 4ZCQA 1O5OA 2UUAB 5F76A 1GNQA 1PX0A 4ZI2A 5BURA 2B7CA 2EFGA 4TMFA 2WJYA 3LCVB 4MCHA 1PKXA 4R2KA 2NUTA 2OC9A 4RV9A 5AKEA 3Q9LA 1OBVA 4Q02A 1ZD1A 1LF0A 4QQNA 1DXQA 2LIPA 1IDN1 1KGDA 2ZB7A 2CZGA 4FLFA 3S6JA 4B3XA 2RKBA 3OZXA 4F8YA 4E13A 2RBGA 1ZCFA 3PHJA 3U37A 5L3SB 5ALZA 5C31A 4Z1OA 3HDQA 1RLMA 1H2XA 1EXWA 1UBRS 1XL1A 3AF5A 2R9VA 4JJKA 5JD4A 4M8SA 2WM8A 3ORSA 2IU0A 1JIKA 1YOBA 2F43B 3KNZA 1FFHA 4HI0E 3ZWAA 3TAHA 3W2GA 4YUZA 4DJAA 2VK4A 2OV8A 4QKQA 4S3MA 1T6NA 2C4MA 4P81A 2UZ1A 3NVDA 5F64A 4BKQA 1AZTA 3DHYA 4BP8A 1K8ZB 5CB4A 4RNCA 4A0HA 4HDAA 2XCIA 1C2TA 1V11A 1WTCA 3P4XA 3ROPA 3EDOA 3W3AD 3ANNA 2XA2A 3W1WA 3R7BA 3GAMA 4XFDA 1EGMB 2CBZA 1V43A 4PVDA 1GA1A 4ZVPA 5G53C 2K2WA 3RQIA 3WYGA 4EGQA 1Z4IA 1Z6GA 3RRFA 1GYPA 3QLVC 3IIIA 2PIDA 3KZNA 3SFVA 5LN1A 3DLHA 1VPEA 1XO1A 3TQCA 3IR6A 4XARA 2HU8A 4ZQFA 3K8ZA 2BP7B 4MUNA 3TX6A 2QRUA 2AQKA 1PR2A 3TZQA 3V80A 4UASA 4MQBA 2Y2UA 4E2YA 2A57A 3T1VA 4QSHA 3T35A 1AN9A 4DG5A 2Y6VA 3F5SA 1YZTA 2VI5A 4ND8A 3VR2A 4BMPB 4EW1A 4YUXA 4ZOQI 1Q83A 5AQ1A 1I24A 3ANMA 3CVYA 3AONB 4ZTUB 1OTYA 1UM8A 3T3PB 4KI0A 4I9UA 3HJNA 4CE6A 5K3EA 1KJQA 3QENA 1L1EA 5CA0B 3K9CA 2EHDA 2O8FB 5D01A 4DHWA 1Q74A 2UZ4A 4Q9HA 2ZBPA 3TEMA 2O3JA 4O4JF 2W43A 4MARA 1OAAA 1RYNA 1C4KA 2UZAA 4JJFA 3F0TA 2XB8A 3C7TA 2C00A 4TUYA 5SYMA 3TFOA 1IY0A 3OLQA 5DRTA 5K6RA 1NVXQ 1O5TA 1TZCA 1X7ZB 3QU5A 2MYUA 1E6KA 521PA 1FP4A 5BN4B 3DEZA 4QJBA 4A8TA 1BWSA 2B1JA 3AERA 4ED9A 2FDRA 2HMVA 2O2SA 2RIPA 3GRAA 4LYYA 4WI1A 3K0EA 3TQFA 2FU5C 3U3RA 2IYZA 3SZMA 5B7GA 4NBRA 1U3FA 1VECA 4IKEA 2BGUA 4XX0B 4D1YA 3LPCA 4HGYA 1JIJA 4UHEA 4EW3A 3VU0A 2PBFA 1UKEA 3A9UA 1Q7RA 3AQIA 1M1NB 4KUEA 4UATA 4RIEA 4NNOA 1RWKA 5J43A 5LZ2A 5J1SB 3PXXA 2ATIA 1TUIA 4N6GA 3DVQX 3M5WA 3WWZA 1KMCA 1FLAA 2XMPA 2DBVO 4GC9A 3TZKA 1YB1A 4KO2S 4N8SA 3AV0B 3QXXA 2YASA 1A9YA 5ALLA 4LGMA 1R12A 1FFWA 4LJYA 4OO3A 1OYOA 2H1FA 2QM7A 4R7GA 3D59A 4CMGA 2W0SA 1G4UR 1NW4A 3BFJA 5TARA 2J30A 3USZA 2VZEA 1RXWA 5FKJA 4K9KA 3E18A 3HB1A 4MICA 5SZIA 3UICA 4EQ6B 1QDLB 3R7NA 4F7WA 5BYKA 4LHXA 4RELA 5AVYA 3O93A 1DJPA 4XCXA 5DMHA 1S5PA 5JS8A 1KI3A 4C0WA 3H2KA 5BV0A 2YXLA 3DFUA 3BREA 3CRQA 1CZOA 2VTBB 5L40A 3GMDA 1SCDA 3NH6A 3Q1KA 2YNMA 3GRVA 4WA7A 5DEIA 1PTJC 3FPLA 4M1EA 1U0TA 3N0RA 5E6RB 3V4PB 1X8KA 4R8RA 2EHJA 1XLUA 4HDKB 2HH9A 1X1EA 3N8KA 2X1VA 2D1TA 1SKUA 4QU9A 4UEJA 5JZMA 3TTVA 3AUXA 4XPIA 2QPTA 1JDNA 3NYRA 5LNK1 2VRCA 3B5EA 1XFDA 4K5QA 3W05A 4BFZA 1XTQA 4BP3A 1XNQB 4JH0A 3WJ1A 2HI0A 5JU6A 4GKJB 4D80A 4H0FA 4CTJA 3TM4A 1WBDA 2XEDA 2XXBA 1ZMRA 3R5JA 2XBLA 4FQ5A 4DBZA 4GMHA 1Y5LA 1XBTA 4LYAA 3MF4A 1OXKB 2YRWA 3GUUA 1M74A 3UK0A 2FPGB 1KJZA 3WA7A 4H1TA 7MHTA 4KLAA 2FZVA 4TWZA 3VYSB 3S3TA 1BU5A 1WWKA 3ROTA 3DKPA 1XQ1A 4XJSA 1MTOA 4QL3A 2JK0A 4JA0A 3TMAA 3HGQA 2YV4A 5B6JA 4DYHA 3CNBA 4NMHA 5C5EA 5ADHA 2E7ZA 3BH7A 4BUJA 4MHOA 4LI0A 4XD7A 3S1AA 4B3TB 4ER0A 1PT9A 3OFNA 3DAOA 2IV2X 1OLUA 1H9BA 3RTBA 2H06A 4COOA 4K46A 5DFAA 1OW3B 3M9WA 1ND6A 1LPMA 1O03A 4HGOA 1ZJWA 1M8FA 1R9MA 2GZ1A 1UWKA 3DVRX 4K6GA 1OSNA 4M87A 4MV6A 4HWOA 3N6XA 3WGOA 4LMBA 2YHSA 3I73A 5IYZA 1FQJA 2VYNA 1HZJA 2PJUA 1U2QA 3FHJA 5LZ4A 1YFZA 5ALYA 3UV3A 3GLGA 3E9DA 4KV7A 4ZQBA 3EIOA 1E1CB 3C7CB 5BNFA 2LIVA 4MS3B 1O0SA 3GRKA 3RUFA 2W98A 3VNRA 3D9QX 3RSHA 4IZOA 2Q1YA 2Q7OE 5B1YA 4N8DA 3RI3A 4YCLA 3IJPA 1XSEA 2FMTA 1F2VA 1M10A 2QP3A 4HLCA 2WU4A 2VLIA 4I1SA 2CLEB 4TMYA 3FNRA 2X0KA 2VPWA 3HCFA 4E31A 3M6XA 3Q9SA 4BKUA 3Q11A 3LO5A 4HVLA 5K4GA 2Z08A 3A6JA 3ETGA 5AHKA 4NL4H 3PNQA 3NR2A 5KI6A 3UANA 1VRWA 1A7AA 3STHA 4OXQA 1E2FA 2DWUA 3EC2A 1EWKA 1YCFA 3PQ3A 5C8VA 1MW8X 3NYQA 4PGHA 2QTVB 3WV4A 4KIFA 2CKMA 3WRXA 3B1YA 3CLTD 4WFQA 4PZYA 1P44A 4C4SA 2WWIA 4YDSA 2ODAA 4CL0A 1AK2A 2BRUA 2JJ2D 3GA7A 3VQTA 5HQ3A 2EX1A 3BFXA 3K0CC 4KOAA 1PGNA 4GDMA 4N0QA 3DV0A 3I8XA 3VVBA 1RZUA 2OECA 1OTHA 4YJGB 3UJPA 2L42A 2F8SA 3CTMA 1SG0A 4R68A 4UCWA 3G1WA 4ZYVA 1ZM3A 2C61A 1B16A 1RPZA 3VHLB 3FCYA 2CL6X 4MCJA 2XCQA 4E22A 1S1CA 3N2GA 4EPTA 3PBKA 4K81B 3G89A 3GRYA 1U0FA 4CFYA 2J1LA 3ZBQA 3EZ6A 4DQXA 4L5IA 2PSEA 1P7ZA 3H87A 1AB6A 2ZIXA 1PR3A 4YWJA 4C3UA 4XM0A 2FSUA 4PAOA 5JNVA 4GKKB 3L8YA 4JB0A 3A31A 1NRJB 2WG0A 3MM4A 5E0KB 4Y9DA 5J2TA 1ABFA 5DGTA 3C70A 3EY9A 1CEYA 3EARA 1WP9A 1KETA 2G7ZA 4TQUS 5ENVA 2PT5A 2XMGA 3COSA 3QTTA 4D44A 1AKRA 1EVEA 4OP1A 4IP0A 2C20A 2FSVC 1FA9A 4MUAA 1U2GA 1ZMOA 4DVGA 5HM8A 1ZG3A 2NSDA 1VG8A 1IXYA 3F3YA 2AK3A 1FNCA 5IEBA 2ZM5A 1CNFA 4GVXA 4EBBA 1ZGAA 1JEOA 2AZDA 5E2IA 5A4JA 5LQJA 3VTFA 1M66A 1OV6A 2XUAA 3DM9B 3M1IA 4RAQA 5FULA 1NAIA 5G4KA 2HSDA 5DLEA 2HA4A 4JOCA 4KCGA 4W5HA 4HEA1 2FWMX 3OF2A 3OEED 4GOOD 3DKRA 3GLGE 3BIJA 3VR6H 4J90A 2MSCB 1QCZA 2DHCA 4CQNA 2X4IA 4ES6A 1WETA 1YK0A 1QPGA 4D8XA 3CR8A 5J4LA 5KYYB 5LD2C 3NBKA 5JXHA 5HIJA 2OQ2A 1FF9A 4BLSA 3DEHA 3BRWA 1UK8A 3O8CA 3OE7A 1QV7A 3DBHB 3RQSA 4A1OA 2BTQA 3HLYA 4PQRA 4XQCA 2IW1A 2HK9A 3T3MB 1T26A 4HH3C 4B8WA 1YQGA 2WPDD 3EG5A 1VSBA 3VTZA 1W4CA 1ZH8A 1G8AA 1V3UA 2RHTA 1GCAA 4L1KA 3G8BA 1H5UA 1OGIA 2DHQA 4TYQA 5AHRA 1Z0JA 5IT4A 3ZU3A 4RU1A 3Q7EA 4DB2A 4RF5A 3ET4A 3IIMA 5DM2A 3WGMA 1U3VA 2DTEA 5DTRA 2C3OA 3A58B 5BV8A 1ULHA 1RLOA 4H7HA 3WK5A 4H16A 3EXHA 1H0HA 3RGGA 4Y18A 2NYAA 4ZOLA 1INLA 3JQGA 3A4NA 4F4JA 1QFXA 4TGLA 2GJ4A 2GN2A 1B15A 3HSSA 1G59A 3ORHA 2E4XA 3W2IA 4MGYR 3W9UA 3WLJA 1W25A 3CKMA 5CW1A 4X1OA 5AKXA 5B53A 1OROA 5KHOC 2IXTA 2VTEA 4KH0A 5LXTB 3UA4A 3PEYA 4ZHSA 4PCUA 1RMYA 2HCBA 4U8HA 4X66B 4OYHA 4QFMA 5ETJA 3LUPA 3ADCA 5ES3A 1CB7A 2C98A 3D54D 5ILOA 2LXNA 2ZQ5A 2WWTA 1ZCJA 1FDVA 1RAGA 2FJUA 1VG0B 2ACVA 4KDCA 1LKZA 3PR2B 3RU7A 3HFJA 4QICA 2DSNA 4WBNB 4X63A 3H3XA 1CCWA 4KDFA 2P1ZA 5I4CA 4HPXB 6GPBA 4P3OA 2QRJA 1FYVA 3NAGA 3DE4X 4EHLA 1VE1A 2IX3A 2ZUBA 5A3VA 5CVTA 1EGHA 2JGDA 4MPRA 4KR7A 2IFTA 2ZKLA 4HX2A 4URYR 4F12A 2H2GA 4TTJA 4E09A 3EWIA 3T34A 4DADA 2WAYA 3JQRA 3RYFA 4RJTA 2ZWAA 4DJEC 5G0VA 2WMDA 3WS7A 4HNGA 4X00A 5AIBA 1KVQA 4UTRA 5IFKA 3HYTA 3PXCX 1BH6A 3JX9A 1J8QA 2B5WA 2YVKA 3LKZA 4LCEA 1QFJA 1GA6A 1EX1A 3P9NA 3DF7A 1CWUA 5T4FA 4DIUA 1JTVA 1SC9A 1NYRA 4HMOA 4EARA 2FB9A 5IDWA 2J8ZA 6CHYA 3ZHSA 1VPVA 2R00A 1PGOA 3AEZA 2FEOA 2R68A 5KWEA 2DCUA 1I30A 3F7NA 2X41A 3GJ7A 4YRFA 4U7HA 2ZIEA 3WJ2A 3FOCA 4TKMA 5IAKA 4PC6A 2QMOA 2IPMA 4BVBA 2GXSA 3QKSB 2AOUB 3M6LA 5T64A 1A72A 1VGRA 1Y80A 4OSEA 3WLTA 4X71A 4LXGA 1VHTA 5BSFA 1TU4A 2OHIA 1CS4C 3U4CA 3WMWA 1RKUA 2YY7A 4XH9B 1L4GA 2I1WA 3AFGA 3MW8A 5BSGA 1QTQA 4TWAA 5E7MA 4KNWA 1N2EA 1V5FA 1ZBQA 2FEXA 3CLUD 3R3YA 2FX3A 1WHTA 1WY7A 2QXTA 4RHUA 4RY0A 5U1PA 3TD2A 1TJPB 3CR7A 5JWOA 4C05A 4L9AA 1KOGA 1ISIA 1CZRA 4YJDA 2O1WA 5KNCA 3OLCX 3VKWA 5L7YA 2ZBUA 4KPFC 5HBRA 3KWMA 4GXQA 2CWWA 2XYRA 4ALJA 1PK9A 1EQ2A 2JCGA 5FJIA 4JHLA 1QLJA 3LLVA 5FHQA 5H70A 2C4HA 1NNSA 2P67A 2E85A 1P4JA 4PWYA 2LBPA 1TW2A 3QZUA 1SB9A 1ISPA 4XIYA 2ZXUA 2DUMA 4JI4B 4Q47A 3EW7A 3ZCVA 1W19A 1BSVA 2QRKA 4OVKA 4RORA 4J75A 3GEDA 5ER6A 3TSZA 1R4NA 2JFBA 1Y1KE 3Q8KA 3ON5A 2QN8A 4ZWNA 2H1SA 3SBXA 1P2SA 1UH5A 3GW8A 4E32A 2AD5A 3EQ9A 4QPCA 4RD2A 4UNPA 1NJ6A 1PL0A 4QRDA 3UK6A 1QHIA 4F6CA 4B7UA 5ALVA 3KKNA 2VHTA 5EJ7A 2WG2A 3WWEA 1XJWA 4IJKA 4OMCA 1NASA 5KCMA 4EUNA 5LQRA 1Z6TA 3QLJA 2W6OA 1NFFA 3WNDA 3H7IA 4WCFC 5ERXA 4DNPA 4LHWA 4RHFA 4E5SA 4B3RB 3A6DA 2HY7A 1ZI9A 3O92A 4MDFA 3CZRA 3UCXA 4Z3OA 3LK6A 1EXNA 1ZA1A 3S1LA 9MHTA 1Z0SA 4QUBA 4NYMQ 1IOVA 3NXSA 4RQUA 5DLDA 1KFEB 3K31A 4B2IA 2PZJA 4BCDA 1U0LA 4IXTA 3GLSA 2YC4C 3DOJA 1OREA 4R3WA 1LLDA 2ZVQX 3ZYZA 2IVZA 2O3TA 3F3MA 2ODBA 4P0QB 3N1UA 1XVVA 5CLFA 2ZR9A 3K9HA 3CG0A 3DLCA 1MEEA 2QN2A 1Z63A 1D1TA 2VRBA 3SHTA 3MWYW 1DQYA 1KWKA 1U11A 3AUTA 4PNHA 2F4VB 1YRLA 4L22A 3MXTA 4URXR 2CBXA 1IFXA 5BSRA 5KYXB 3KB6A 1JDSA 3BGSA 3RS8A 2F17A 2XCSB 2I2AA 4B75A 3WZMA 2O1SA 2HOQA 1C3EA 3IUJA 5FOQA 1NKTA 3RSSA 2NSYA 4RCZA 4WESA 2C7BA 4DLSA 3DFMA 2XWQA 2PWYA 1ZJJA 4FDAA 5CDFE 2Q5CA 2NNLD 2XDAA 5F23A 4HAYA 1F5SA 3QVJA 4WUTA 5F1PA 5EQDA 3OOSA 1GIAA 1MO3A 1XPJA 4HXEB 1EQAA 4GI7A 1DAFA 1G17A 1BVRA 1T5LA 4IOJA 3B12A 4WQMA 2PKCA 5E1DA 3TGWA 4JC8A 3YASA 1KDPA 1YAJA 4B48A 1EFTA 3VDXA 2WTUA 3SHWA 3IESA 3FG9A 4JKIA 4P53A 1QONA 1X15A 4KVZA 4B47A 1LLCA 4QJ5A 3TTYA 1JMKC 2QAGA 3UK2A 1AQJA 4QEDA 1I51A 3EF3A 3S81A 2QMHA 5KTPA 4DR5B 3PK0A 5FP0A 1E77A 4W5JA 2VP4A 3GUVA 3NQ41 1GT6A 1MPXA 3L8MA 5AUQA 2CFOA 2B7BA 2NZUG 4RK6A 2XNHA 5DU2A 4D0GA 2Q2OA 3HVUA 4CG2A 2VT7A 3FNBA 3GT7A 5B55A 1GNVA 2Q4BA 1IPFA 1Q2XA 4ZVRA 1Z45A 1FFAA 1U3UA 4BLRA 3O82A 4MV1A 3UW1A 1DFIA 2ZS8A 5L95A 4HUQB 5G2OA 1IUNA 1EHYA 3IE2A 3RG8A 3B6JA 4X62B 4JVOA 1IWPB 3D7KA 1PJCA 4MCAA 3KE9A 4TXMA 3RAFC 4UHFA 4KIJA 3V97A 4BMDA 2H4JA 4UREA 3CEAA 3I2FA 5EGSA 4LY3A 2OENG 4PHHA 2XZPA 2Z3ZA 3B9BA 3HCRA 4F0JA 2ETVA 5CYOA 4BMXA 3ZVMA 3LKVA 2Q3BA 2QE7A 4ZYZA 2NU9B 3W5DA 1ISFA 2QM8A 2P2DA 3CYFA 1GSAA 4F85A 1V71A 1NA5A 1W5EA 1Z2DA 1I9CA 1ZJ5A 4MW7A 1D6SA 3ZWQA 1EIWA 1URPA 1TUGA 2CHFA 3IKJA 1XU9A 2CLMB 2NUBA 1PT5A 4MGZR 1MU0A 4LDZA 2O3SA 1JE1A 2R3SA 1PGJA 5KTSA 1YZUA 4DLUA 1IZ0A 4DILA 1NVGA 2AQ8A 4U2BA 4ROSA 1IPHA 2GK3A 2QD2A 2TECE 2YXEA 3AFNA 3EOBI 3U3OA 3U7FB 1VL5A 3ETDA 4QX6A 1I4TD 1KEUA 1AJEA 2ZBGA 2R6JA 3DL4A 3OZWA 2YIMA 1X14A 2N1MA 3T5CA 2QW1A 1ADCA 2VUIB 4U9IS 4WGGA 3L1HA 3UYLA 3NM4A 2PLNA 4D3DA 1VBNA 3N2LA 4EO9A 4IGIA 1U2RA 2ZR0A 3IEPA 1GFIA 3QX3A 1PVDA 2AK2A 2WG1A 3LQ2A 1L5OA 1U02A 2JAUA 4FC7A 4GR4A 1N3YA 5I48A 1QGYA 3ZDAA 2ZIAA 3DR3A 4F72A 4HNSA 3WWDA 3EZYA 3I23A 4WCFB 5MDHA 3K15A 1Q84A 4UBIA 2QN7A 5HKOA 4R84A 2DUNA 2OZLB 3UXYA 3CLKA 5HR5A 5J2UA 1Y3FE 2P2YA 4UM5A 1UJ2A 1G3MA 5G3ZA 7AT1A 3VR4D 3EZLA 1GGNA 3DBOB 1EJBA 3IFSA 4F46A 3UJNA 2ZM6B 3GEBA 4UBKA 5JALA 1VA5A 3M6WA 5F5NA 3C3DA 2AR0A 4LJ8A 1FRZA 2ZB4A 5DASA 5EKXA 1M1UA 1UT5A 2HJGA 4AROA 4HN9A 1NT4A 2JGRA 2B2NA 2CFTA 4OHVA 3DD5A 4K8RB 1FEZA 5FOSA 1ETUA 4HATA 1Y82A 5LMCA 1M3SA 5CDUA 2WSIA 1VYUA 4IEIA 1ZM4A 2IIVA 1ZLXA 2WICA 4C88A 3EULA 3UJ7A 4EENA 1G7CA 4C4RA 1F4PA 4RLFA 5JH7B 4J0QA 3KXKA 5JPCA 1BNCA 3BXEA 4R5MA 1P0CA 3PFKA 3OJFA 2H7VA 3THRA 3I1YA 3CB4A 2D0PB 2CJWB 3H86A 5EQTA 4RTKA 1L5WA 4B09A 2XMDA 3GX1A 3F6YA 3TTXA 4TLCA 1OQAA 3DDUA 1A8PA 4NBUA 4TVKA 5CBPA 3RYCA 4BWGA 3AZPA 4NPHA 1S2IA 4TUYF 2E87A 3WVNA 1T0JB 3ZC3A 4DUGA 2BKAA 5BVGB 1Y8QA 1YK1A 4MKIA 1RACA 1E7SA 1II8A 2QTZA 3IP9A 4FFVA 3FPEA 5EIWA 2WV9A 4C78A 3RJMA 3B7WA 1QUFA 3IEXA 3JWPA 1KP9A 1NLUA 1RWWA 2ZRHA 3P9YA 3SZRA 3FTCA 3D1VA 4FGLA 2XXAB 3ICQB 1NQTA 5F1YA 4D74A 1C8LA 2A33A 2ZRMA 3RC8A 1OC4A 4HKTA 4EYKA 1YH3A 4B4OA 1W85B 3FAZA 3EFOA 2C0QA 2BFCA 2DT8A 2K87A 2DVMA 2WVHA 3FWKA 4TWJA 4LF9B 4OKIA 4KP7A 1YFLA 1BAPA 4IKPA 2YHIB 1T5DX 1OX4B 2XOKA 4BNTA 1Z8DA 3A9TA 2Y0EA 3I6BA 1DCTA 3CX6A 4N3CA 1H6DA 4UOQA 3OMWA 3JASA 1X1DA 1JU4A 3BK7A 4BV3A 1KDVA 3LG2A 4O08A 4F38A 3ELWA 2ZIUB 4TLBA 2PUAA 5FEUA 2J3KA 3UAOA 3BDIA 3E6AA 5FL7A 3SWWA 1M5TA 4MQ6A 2FLKA 2PBLA 1YRYE 2Q0HA 4M89A 3SAJA 2WTMA 1EDZA 2V9CA 4FZ3A 3BAFA 1XMSA 4Y2SA 1KPIA 1UKAA 2VUHB 3HWRA 2VTKA 1KK0A 221PA 3ZQ4A 4INZA 3A6PC 4KQJA 1QIJA 2ZB3A 3A70A 3O1HB 3R5FA 3JQAA 5E2AA 3UM9A 4A26A 1PEAA 4D98A 3CVVA 3QY0A 2HJHA 2O2EA 3K92A 5A6VA 3UAVA 3G5TA 4W63A 5I8WA 5FTNA 5LPNA 4LMRA 4H08A 4UQOA 2C0PA 5ANRB 1W1IA 2P65A 2IDZA 1D2EA 2Z5VA 4B7XA 4S2UA 1P9LA 1ZK4A 1JAZA 1YDEA 2E82A 2UYYA 3A4LA 3QX7A 2P0EA 4NECA 4DWJA 1FMFA 2B8JA 3ESBA 4GOXA 2Q45A 5DK6A 3U3DA 1N9ZA 3NIBA 4B7AA 2ZWVA 1M0EA 4CLOA 3KKQA 2H2HA 2J9RA 5DHAA 5JCOC 1A1VA 1XTTA 1QYRA 1S9DA 1K8RA 2DLDA 3OU7A 4ZU6X 2JGAA 5CYFA 1NXXA 1V3VA 3H3FA 3QMPA 3VC7A 5KTYA 1U9JA 3OTHA 3PC8A 1O2DA 2DTXA 1YJXA 2C31A 3MFYA 3C3PA 1WVMA 2I1VB 1NVVQ 1NW7A 4TLMB 2J67A 2NO9A 3FCOA 5DBHX 5EIOA 3MTEA 5IASA 1DC3A 2UVDA 4KTTE 1IXZA 4LWZA 2ACKA 4YONB 4RDIA 2O23A 2ZI9A 3ZLUA 1KH1A 3BD6A 2BWJA 3MTAA 4ZO6A 3ICWA 4U63A 1FNMA 5CITA 4AUEA 4LRXA 1K7XB 1QB7A 3RGWS 4QYIB 1YS1X 4GW3A 5FJJA 5BQPA 3ICEA 1PO7A 3O73A 2ATVA 4Q4AA 5M29A 1E89A 4P3XA 4L8FA 4D4IA 3FPFA 1Y3HA 2V9ZA 1M83A 2F7SA 3INRA 1VB5A 2WOJA 3ZCXA 4YJ3A 5FFMA 3DCIA 2HJ9A 5EG5A 4AYTA 4R01A 5A9SB 1KEEA 1EG7A 3OJLA 2V55B 3V8NA 3KKKA 1ZN8A 4RCYA 4DZTA 2CMDA 3W3AA 5JWHA 2ZSKA 5DISB 3L0SA 4YYZA 5I9LA 1U9YA 2C88A 4ERNA 5CTAA 3LBHA 4OI0A 4NK5A 3G6WA 3K72B 3VNUA 4R1QA 1ZH4A 1U8YA 1NQUA 2BOVA 3QELA 5D87A 1KQGA 3FBWA 3QKRA 3QQ5A 5I7EA 5K3AA 3VPCA 1F1JA 1ZRMA 3PFCA 2N1BA 3M6AA 3B6ZA 4GPZA 4HDMB 4IZ6A 4QNRA 5HSGA 4B3GA 4B5LA 1JIQA 3V1TC 2A9OA 3G0OA 4YJHA 4M0CA 3HG7A 1XX6A 1BFUA 1CK4A 1TJ4A 1FSPA 1NF2A 4JQSA 1YIAA 2RCNA 1EDEA 5ALJA 1MG0A 4RPKA 1BRMA 4QUIA 2P40A 2IEIA 2V03A 3REQB 1QNFA 4QODA 4ZZ0A 1ZRNA 3L1JA 1CBUA 4GBGA 5BSKA 1JEYA 1G60A 2RGAA 4US1R 3J81A 2OV4A 4YY3B 4JVMA 3TR6A 1VL8A 2REQB 5EJ2A 2W9XA 2ACWA 3ND7A 1WZNA 4YH1A 2Q4OA 5E1OA 4IUCS 1D2HA 5BQ5A 5G0UA 4MA4A 1YQ9A 2HZ7A 3BF7A 3DE0X 3F2VA 2DCMA 4OOEA 3ZBPA 3O31A 3R3UA 3SBOA 3IYLW 4L74A 1BMTA 1KI2A 3C3EA 4Y67A 4BNUA 2D0DA 3DV2A 3ZVNA 2EF1A 2CMHA 5M7EA 1PTKA 2AG1A 3Q9NA 2YKGA 3VJLA 3TPCA 2PX4A 3GT4A 4AJPA 3X1JA 4DQKA 3LE8A 3C48A 4EPYA 3GUCA 3QF4A 4MW2A 1QFMA 5BWBA 1LPBB 2NZYA 1QRRA 4LX8A 2VN8A 3GCZA 4O4HB 4RTNA 3GLIB 2QP9X 4PZDA 4I4TB 1F3LA 1BU8A 3F2IA 1F60A 1XDZA 4UCXA 5CVUA 1M9NA 4UTVA 2R8OA 2JANA 3E48A 2IU6A 2M9MA 3UAXA 4A16A 1XALA 5KJ6A 1W36D 1IBKB 4ND7A 1UUFA 1DRKA 3FDZA 3B2NA 1X1BA 2FF5A 3HP7A 4BTLA 4EUEA 3G9QA 5AD1A 4J1SA 1JG1A 1ZZGA 3JZDA 2BEUB 2D5BA 3JZIA 4QXQA 5PGMA 1NBEA 2II6A 5IJWA 3S8EA 4I5IA 3OLXA 2XY4A 2H6EA 3ZN2A 2VJOA 4ZVOA 3B3QA 4EGCB 4GSLA 5K0ZA 1KJYA 3L7BA 3OH8A 5IRCD 2PY6A 1GN8A 5KO2A 3WKDA 5M34A 2G06A 3MERA 3Q6MA 1VI6A 3ASVA 1XAGA 3WYCA 1J5EB 1JR3A 3RUCA 5K45A 1F8GA 1R50A 1EVLA 4Q4DA 5C9ZA 4E1BA 4JITA 3AQ4A 5HDQA 2G77B 2EJWA 4HFRA 4RFSB 4D8YA 4C3OB 4AK9A 1R0BA 4FN4A 4GG1A 1C7JA 2G9QA 1FYEA 2Q5JA 3ASZA 3FGOA 4H15A 2KW5A 1Z5UA 4LNUA 1LK5A 2XHZA 4NEGA 4OQNA 2JS7A 4ENWA 1GTSA 2I6XA 5FOXA 1D2MA 2EERA 5KU7A 1P5FA 4K0KB 1NJ8A 1P33A 4BTEA 4MUGA 4W7IA 1KYQA 2A0XA 1YWGO 1X70A 2VPPA 5F35A 1L5LA 3BXZA 1F9AA 1G18A 4EX7A 4ZO9A 1RQPA 4EITA 3I2YX 3BL5A 1C14A 4ZVMA 3AJEA 3LM8A 3L82B 1TM2A 4GKVA 4I5EA 5PNTA 2NV0A 5AR1A 4LDQA 4PPNA 4NQRA 4W99A 5CT5A 2REBA 3PJRA 3OU2A 3NMUF 1D1QA 3KPYA 3VMMA 5E3HA 3TR0A 4P4NA 1SM4A 4AECA 3KR9A 3JQ8A 1J99A 3KM0A 4ZEXA 4DW8A 4OH7A 2WKSA 3DWGA 4AWAA 3JPWA 3QE9Y 4LF6B 2CHVA 3VPAA 3IIKA 1SVIA 1KVUA 3IR7A 4MCIA 1NNEA 1Z2AA 1NVFA 5GVRA 1WE2A 3HDYA 3WRYA 3HDGA 4H4CA 4X64B 1MR3F 1RYEA 1I94B 1T4CA 3FRHA 2QN1A 3DXXA 3DWEX 3FCAA 3ETJA 4FHCA 4RVHA 4RBNA 1U1DA 8ATCA 3K53A 3HYCA 2I2CA 1A3CA 3PNOA 4U2GA 3RKRA 1O9GA 1MA0A 1YBVA 4OKNA 3HH8A 1NE7A 3C3AA 3DMTA 3QVSA 2GEVA 5JADA 1G9XA 1K1EA 3DBRB 1I5OA 2DAPA 4BAUA 3HDJA 4EHFA 4YWHA 4IWNA 4F9FA 1N8TA 1XTVA 2P4QA 2PRZA 3INNA 1CTQA 4AO8A 4J0CA 3FNGA 1XXLA 3C7KA 4M0FA 3SHVA 5IPFA 1FTYA 4RZIA 4ZVNA 2Z6UA 3AHFA 2HRQA 4BQRA 3ACCA 4QXAA 1Z6AA 3BH0A 4C2AA 4PXAA 4GUDA 1GITA 3EZXA 1ISSA 4X93A 2A30A 3FFBA 1FFGA 2YOGA 2YWJA 3LKDA 1H1LA 2Q6TA 2AN1A 4W8GA 4YJ2B 3U4AA 1KIFA 2G5TA 1DQZA 3NVAA 4YR7A 1K3TA 2QDKA 3OZGA 1UM9A 4JJZA 3RIMA 1U90A 3NP9A 4XSGA 1CZKA 1G2IA 3IVMA 2Y6UA 3QU4A 5FQOA 3TPZA 3C6XA 3FOFC 1BIFA 2XRZA 5J4KA 2FQ1A 1U9CA 3MCUA 5J63A 4LIPD 2OCAA 2NU7B 2RSLA 1O97D 4J7XA 1JKFA 1VTKA 2ZATA 4RYDA 2XYQA 4C7OB 4MVJP 5KHLB 1B93A 4L4RA 4UBLA 3R8CA 4C4YA 4TYYA 1AS3A 1U0NA 2GZSA 4ESVA 3DYIA 4ND2A 8OHMA 1N2IA 2H59A 3WFJA 3SQDA 3VA7A 2M1ZA 3HM2A 3VR6D 1JXAA 2OCBA 4ZKEA 3THXA 3RFFA 1L4HA 3SQXA 5FB3A 1R37A 1HDIA 4IG4A 4B6FA 1B7GO 1V8DA 4DR3B 1NUUA 1Q0ZA 2VZ0A 3ZXYA 3G7NA 3W5BA 3LFUA 5AM0A 1YOVB 1EFLA 1XG5A 2ECKA 3PVSA 5CXSA 3UA3A 1RBYA 3AM1A 4RENA 5CXUA 3R6GA 5I5GA 1ETHA 1D2AA 3KUCA 1Y42X 2YW9A 5ELMA 3EJWA 4O4HF 1KRHA 1QGOA 3SY8A 1E2DA 1VIMA 2A1TR 1VBMA 3T9EA 1P7YA 4TT8A 4W9NC 1WXFA 4WLVA 2Q6KA 2IDMA 3KHSA 3TLXA 4FOTA 3WKAA 1IHUA 1T2CA 3H5VA 4KZPA 5BORA 1N6KA 3R20A 2HA3A 2SECE 1DS6A 2BJVA 1BJRE 2EGGA 2GM3A 2KWIA 2AFIA 3BHJA 3FCCA 3I9V1 3K5IA 2KLBA 4XDGA 2I3ZA 5TQ0A 3OD5A 1AQYA 1EFRD 3SYTA 2WSSA 3G2IA 1X3LA 2Q6LA 3UHJA 3I61A 1T1GA 2QW8A 4BEVA 5LYJF 3NOVA 4Z7JA 4A5SA 4TMXA 4LZPA 3OEEA 3QGMA 3E3MA 1ML3A 2HWYA 1MW9X 5KVQA 2E9SA 1NGSA 4X7RA 4E1AA 4J0KA 5FNZA 2CCJA 1CP2A 3BKXA 4TTQA 4B7CA 5B3KA 4DJTA 4CGZA 4YFYA 1PK8A 3ZVKA 3GA0A 4ODIA 5ECWA 1T6YA 2V9PA 2WSBA 2DULA 2VK8A 4CIBA 3SHQA 1T2EA 2OFWA 2PRSA 3MLBA 2GVNA 3IGFA 4NOJA 2REOA 4IGKA 1U5CA 2WPDA 4CYMA 1KPGA 3IBFA 4QTXA 3LXMA 3KALA 4A6PA 4MW4A 2NO4A 3CU5A 3OVMA 3LRTA 3M3PA 4M2LA 3SHFA 4I9GA 5TX7A 5ALGA 3AG6A 3HB9A 4URWR 1TA4A 4JX9A 4ZQGA 5FHRA 2H1CA 3CF6R 4AMGA 4PGGA 4GM1A 4DM4A 5LWQA 1FJXA 3SNHA 3VVLA 4DCPA 4DLYA 1XJCA 2EZUA 2DPHA 2FPKA 3Q8XB 1WHSA 3QVLA 3ZLTA 3I5AA 3U7QB 1VCMA 1T9AA 3EZFA 2WF5A 4GZMA 2PYIA 4PQFA 1MP0A 4UAJA 4H1WA 4IGEA 4O5AA 1RYZA 5DYWA 4DDHA 3K9QO 5ARCA 2DHRA 3L0DA 3IMGA 4YALA 2DKOA 4YAOA 4ZEWA 1SKQA 1IJEA 1QQAA 3K0FB 4AMUA 4D0NA 1ZCAA 2QJTA 1DG3A 5T67A 1KEPA 4K6CA 3TFQA 3O8OB 3F90A 4M49A 1H2HA 5EMHA 5LQDA 2NTYC 2YXBA 3PIDA 1UK9A 2QD4A 2XE4A 2ZJBA 4TTPA 1BFDA 5BW8A 2XGOA 3E03A 1NLYA 1YJ5A 4X24A 5CCBA 1CNEA 2WR8A 4BWYA 3C85A 2PMDA 1EFUA 2ZRKA 4N9WA 2EQBA 1MAAA 2JCBA 4CKWA 2VH1A 1BG6A 3ONNA 1W93A 2QMQA 3GBSA 3PQCA 4LDRA 3RAGA 3TRJA 3KOUA 4DS3A 4MWTA 3FI0A 1RKVA 4LXTA 1KOJA 1NX6A 4QBHA 3SJ7A 3MWEB 4ACBA 1FXWA 4LKRA 4YGYA 5EE1A 1G8FA 2RBKA 1Z5NA 3KQKA 4WN9A 5HIIA 2JLSA 2O0JA 3LQRA 5AIAA 2XD4A 5E4JA 3UH1A 4DNFA 2W22A 5A62A 3B51X 2WFLA 4R05A 1WZEA 2PUGA 2D5IA 4U2DA 4AKTA 4JOBA 4GLLA 1J7KA 4HGZA 4MIOA 2INGX 4NOMA 2HLHA 1POWA 1RCUA 2EZ8A 3C4JA 3L7CA 2EU8A 1E1RD 4GI1A 4YJ2F 3HP4A 4ZV4A 3GUYA 1NLFA 5SYNA 5BNTA 3WL3A 5EFZA 2CSXA 1M0SA 4FUTA 4JP1A 4Y1FA 2OG1A 1SUPA 3BB4A 1NBHA 2ZZMA 2C5GA 3BCHA 1ANKA 1ZUD1 3VHXA 3W4IA 2PH3A 1NP3A 5AUOB 1HE5A 5I8PA 5JYDA 2N75A 5C8YB 4PPYA 1XZQA 4ZI7B 3KOMA 1WPGA 3B52X 3HRKA 3E2IA 3Q3CA 3UB3A 2K7ZA 2Z9DA 1WBJB 3SZUA 1K4YA 2O6LA 3RROA 4Q4HB 2YRFA 2JJQA 4QDZA 2BUAA 1F1BA 1OT5A 1V3QE 3JYLA 4ZZ1A 1H4TA 5EMNA 4LVNA 2HX1A 2X0DA 5REQA 1B0ZA 3CPJB 3H11B 4MKRA 4QE3A 4BB6A 3NBMA 4I3GA 2HHJA 4C4XA 3ZH2A 3H7AA 2VNJA 2YUTA 3OKCA 1YVEI 5ITWA 4ZAGA 3GLHB 2AXNA 3GFTA 3F5DA 4W1PA 5K2MA 1MZVA 1VG9B 4Y2YA 5CLLA 4LSGA 1NSYA 5D5PA 3IA7A 3HBJA 3STYA 4FQ8A 1E1NA 5J9FA 1Y8RA 1TX4B 2FXIA 3LDHA 1XEXB 2PRJA 1YS7A 3AHHA 3NFYA 3QLUC 4PC3A 3EUAA 1UPAA 5BSEA 4YRLA 3KUUA 2X1MA 1RWXA 4R1NA 2NT3A 1N5MA 3WYDA 4NCNA 4ARCA 2XPCA 1GARA 3NI2A 3VH2A 1R8YA 1U4NA 1XNGA 3HUEA 1IEQA 2VDNB 4JGIA 4IWYA 5DN6D 2C2OA 1W76A 3BX1A 2B8WA 4AKIA 5K0BA 2P78A 1NW5A 4RETA 2PRKA 3KAQA 4UUOA 5EWMB 4JR1A 4AF7A 3GGSA 1ODSA 1SCBA 4Y98A 2I03A 1UOOA 5J2UF 2L0XA 3CINA 3M89A 4I5DA 1Y6ZA 3GG9A 1L5FA 1JSZA 1QYXA 1YR7A 3C5EA 3EGVA 1I01A 1JI3A 3TVTA 1E58A 4GVLA 2FR8A 3TLJA 3BEOA 2XT9A 2P2SA 5DCUA 1GXSB 1FW8A 3EXAA 1WDMA 3IP5A 1VE5A 2YQZA 3UWDA 4E5NA 4NZMA 1TT5A 3T6KA 1N8SA 4J7CA 1TD9A 3PUKA 1WXIA 3R5HA 2ISSD 4RK5A 4DEXA 5BNZA 3N28A 1SELA 3CNOA 4GRDA 1EWVA 1KSJA 3WTCA 1CUXA 4LJ4A 3X0DA 2QX6A 1DV1A 2OO5A 3MEQA 3K5HA 3ETCA 3LC0A 1NXSA 3O26A 3PPIA 3AUAA 1DRUA 3QVOA 1R0KA 1PJTA 3IP6A 4WUVA 1JJAA 2PEYA 5LBUA 1KVRA 3UWOA 4YYEA 2ZFUA 1VRVA 2IKQA 2OP1A 3RW9A 3P9QA 2HPHA 1Y6FA 4IHJF 3FNEA 2XQFA 4NJMA 2OE2A 3MJCA 3J81k 2MOKA 2YZ7A 1JILA 1VCIA 5CB0A 1E99A 4Z6KA 3GPLA 1OJLA 4BATA 1LD3A 3EJ6A 1WKVA 2EBWA 3ZU2A 5DJ5A 1NXWA 4HGNA 4KO4S 2C4WA 2VJBA 1B74A 3GEMA 1YZYA 5J58A 1DCKA 3UPTA 1KRXA 3B7GA 3QVGB 4MGEA 3I01A 1JECA 2UKDA 4FYJA 3TXAA 4YDRA 4AUKA 2VLBA 4Q1VA 1GZVA 1HFEL 3RVJA 4ER5A 1XZGA 5JNSA 1GOTA 1QXSA 1T9DA 2VOEA 4QU0A 1D03A 2OXFA 4WERA 4ARZA 3REOA 5IHPA 4D9BA 4YHHB 4XUEA 2XT0A 2WM3A 4E5KA 4ALKA 2R1VA 4WLUA 2OXCA 4GM4A 4H31A 3T7JA 1NG9A 4UTXA 3TK1A 5K8UA 2IHNA 1TQ8A 1SRQA 4FI3C 3UJ3X 4OJNA 1P39A 3F8TA 4KHZA 4QGHA 3OZ7A 4A8JC 2A5FA 4BJHB 2SICE 5KYVA 2B1GA 1WDKA 1V3TA 4LISA 4MVJM 2VZLA 2M98A 3LVRE 4KQ6A 1H05A 3CPSA 3PSAA 1D2NA 3FVTA 1MT3A 1N6HA 4NX2A 5CURA 1NJ1A 3OUUA 4K6MA 1EU1A 3PFGA 4WK0B 1WOMA 2YWEA 5EIBD 3VOTA 4OBXA 1BMDA 4M1ZA 1U2TA 4J1TC 5CDYA 2QB5A 5K8JB 4H4EA 4QAQA 4QA9A 3B60A 4AZTA 2JHPA 3FMFA 4GP9A 1MX9A 4LBYA 1J8YF 2K7FA 3ENVA 3OC0A 4UZFA 4YLEA 2O8EB 1OFHA 3DPIA 3IEKA 4DMGA 2CNLA 4ENSA 3U5ZB 1M8KA 3ZD6A 5BYBA 1XWWA 2GZDA 3OF5A 3PDCA 4YRZA 2QLFA 3AM4A 1B6RA 3LCJA 1EVZA 1HLDA 1T2NA 5ULLA 9LDBA 4JDPA 1DL5A 2C77A 2W11A 1F4VA 2GCNA 2FWPA 3E9YA 5BVHB 4LHVA 2FV8A 3MT7A 4BNHA 1PP4A 5H4HA 4WLNA 2R47A 1JR4A 1P7PA 1ZJ4A 2W58A 3NFRA 3RS0A 1C7ZA 1ZI8A 1GL6A 1JMYA 4ANFA 1U94A 4FDTA 1RRCA 4XWWA 4GH5A 2G09A 4X60A 1UMKA 2GPBA 4J6EA 2Q5FA 3L8DA 1N7JA 1XZCA 1EP1B 2B4AA 2IDKA 6REQB 3SICE 5JVDF 1V2HE 1YI8A 2F8LA 3KVVA 3Q40A 1IY8A 3FNIA 4FJ0A 1KDZA 4BS9A 4ZCMA 5AW8A 1E3QA 5GJBA 3UH0A 1NN0A 3VO2A 3N5CA 2YC2C 1U1FA 1ZZEA 2YJ3A 3EUWA 3ZQKA 2C9CA 3G85A 4D6XA 4CN8A 4D57A 1UJNA 1VRCA 4B3HA 4CWAA 1P18A 5A4DA 1CY8A 4MQFB 1YUNA 2AFHB 1RAFA 2Y92A 3L8FA 3E53A 3OT1B 3HKBB 3P0EA 4HF7A 2F1RA 2R65A 4EWLA 1BS2A 3RUDA 4EVRA 2QGFA 2JFQA 5BYAA 3ZNNA 2PVCA 3CZQA 2E55A 4D9JA 2XRFA 4MMZB 1AX9A 3HZZA 3W8FA 1P91A 4PRYA 4KSCA 2O8CB 4BQFA 1JG7A 4R4JA 1BKSB 1J42A 2Y68A 3OUZA 4C6HA 2LNDA 1EK0A 2YX1A 3UKJA 3VR4A 5IABA 1N9KA 3VU9B 3W5AA 4LZJA 2D0OB 4GQBA 1HE3A 5CCDA 2WT9A 5ECGC 4LOIA 2EKPA 3NJRA 3AXSA 2R4TA 3LYAA 4IGAA 4J8PA 2DH6A 5FWXA 3S2EA 4YR9A 3O94A 1RDFA 5CUQA 5AVKA 2ZDHA 4Q3NA 4NESA 5BWCA 4QFCA 5IC4A 5SYAA 2R11A 1IATA 2Z5LA 1SKBA 2PO7A 3LYHA 1LC3A 4AD8A 5DP1A 2YS7A 2Q1WA 3BBPA 4BYMA 3K6SB 4DARA 3U61B 2QRMA 4HK4A 4LMAA 2HDWA 3KB8A 1DEKA 2MIIA 2NUPB 1YKSA 2Q9UA 3GN2A 1RWOA 3QVXA 4FYXA 4A10A 3UT5A 4BB5A 5H1YA 2ZCJA 2GK7A 1XRNA 2AIRA 4XDZA 1QH8A 5DHQA 5HJ2A 2GHQA 4Q16A 4PZLA 2JC3A 2X0RA 3WLQA 1FXSA 1AIPA 1CD5A 5KIAA 2I9KA 2P9JA 5A4MS 2OQIA 4BLQA 1BDIA 2OCPA 2ZBRA 2A6PA 4DBVO 3NZEA 2AJLI 1TKAA 3I05A 4UD2A 5TQ2A 3ZXSA 2FN3A 1EVJA 3DQZA 1GL9B 5LB2A 4D5GA 2ZJ8A 3ONEA 3OQ1A 2QQEA 4EY3A 1QG2A 3E3OA 1ABBA 2GASA 1JF8A 3PU6A 2LCIA 3EHEA 4U4AA 5BXQC 2VJKA 3EWNA 3LWNA 3OIDA 7REQA 2VSFA 1BS9A 4FDLA 4ZAWA 1TU3A 1VFPA 1S8FA 1G63A 3D31A 1AKYA 1WXDA 3S2ZA 1H2ZA 3L04A 3X1XA 4CKBA 1OB2A 4C6TB 4MVYA 2JKVA 1BZYA 1NT2A 1ZUNB 2P2NA 4EB0A 3E9ZA 4AN0A 1MBZA 4B6RA 1V25A 4C0SA 2VQSA 3PX3A 2PTHA 5FV4A 5AW4A 1BX1A 4KYUA 4MDHA 2CDBA 2COKA 1VCHA 3CJTA 1D9ZA 4A8JB 4C7XA 1FNBA 3WQQA 4FYMA 5CXQA 5JZSA 4RTSA 2NXWA 1EP3B 1LDNA 2XZTA 5JFGA 5K09A 2C82A 4M3NA 4CXMA 1CB0A 1CRLA 1T9GR 3F78A 1O4VA 4EHBA 2FI1A 6YASA 5ITSA 1ECFA 3AVQA 3FSGD 3M2TA 4E5PA 5HA5A 4C43A 3TGPA 1S0UA 1EGVB 1I3LA 2EKLA 3RK0A 3AUYA 3AF1A 5A5FA 4HYYA 1P29A 4YMTA 2GVZC 3T7TA 2G5CA 4KTVE 2X8WA 1D2GA 1LPAB 2FMHA 3B1KA 3VO8A 4F56A 1YZHA 4IXDA 4UU0A 3GHHA 2ZSJA 1LI4A 3PGLA 2J4CA 1Z4NA 4O2AB 3VC1A 4JNCA 4D82A 1PSDA 4BO4A 3WWCA 3WHLA 2I80A 3MCAA 5F77A 3USCS 2B20A 3EEBA 1PZFA 1XLTC 1S8NA 1Z5ZA 4CQLB 5ITZA 4BKPA 3DLBA 5CMLA 4F1WA 3CB2A 4EL0A 4KYIB 5GINE 5K51A 2A1TS 3Q1LA 2ZETA 2VTVA 2Z3WA 4OX9B 1AUQA 4LSZA 3DEFA 1COWA 1EG2A 3E2PA 5T4EA 4YMVA 2IZ7A 3R0VA 4ZA2A 4OU4A 2OD9A 1IBCA 3IV6A 1REQA 4OHKA 2YVUA 2IF2A 2LPMA 3LCCA 4CKZA 1HDRA 5J5VA 1NUQA 1RXEA 2ZWOA 3A4IA 3FYUC 4ZT3A 3AR8A 3S2IA 1JDTA 4OYRA 4M1TA 4J0JA 4E0BA 1CQJB 5DDIP 4DA0A 2UVPA 1P5JA 4URUR 3IJRA 3PXDA 1OAOA 4AQYB 1USUA 4AXBA 2GYUA 4DABA 2CLKB 1RRGA 2A9KA 1GGKA 3IMKA 2OBBA 3O4RA 4L5AA 4PIVA 1AG9A 5H80A 1BMQA 5KJ1A 1C9EA 2IXBA 3GVIA 1A8UA 5FF9A 4F4HA 4DDVA 4R2MA 1QLHA 3EF0A 3LW7A 2YOFA 4KX3A 5B7QA 4YDHB 5FBVB 1UDWA 4JUIA 3I9NA 2XTMA 1PV4A 2Q9BA 1H93A 1QDUA 2GSDA 3MTBA 3ZOZA 3TOCA 3D8HA 5L51A 1ID8A 3BK1A 4UDXX 4Y2JA 3MT8A 1GDDA 4X7PA 1FUIA 1KH3A 4MAFA 3WK4A 3O0TA 4QU5A 5E3JA 3SS7X 5ICEA 3CE6A 2WB2A 4TTVA 4UM7A 1QS0B 4FLEA 1CR4A 4IRXA 3HUUA 2AW3A 4FCTA 4N48A 4AJ2A 2Z1DA 4D42A 3PQ2A 2YQ5A 2IA5A 2IS4A 1G8JA 3K4QA 4ZC8A 4L28A 1N2CB 2ZRFA 2H17A 4MUMA 1R66A 2OLEA 2JARA 4IUDS 7YASA 1I3CA 2EL9A 2O2XA 3I9FA 3K9LA 1TYAE 3E4DA 3E4CA 3DAYA 3IMCA 1U7WA 3GCXA 1QH1B 4KN6A 5FWYA 1G16A 1LC0A 3EMDA 4ZXPA 3RTAA 4AJJA 1Z2PX 1DEOA 4C3ZA 1QVZA 1MAWA 3KZOA 1O95C 1BVHA 2IZ5A 3C3JA 1UBKS 2PKEA 2HF7A 5CGZA 2UXCB 4EUKA 1QV9A 2QTHA 4R40A 5JZVA 4QWMA 3PWKA 3KV1A 3PGJA 3QKUA 4ROTA 4MKXA 4REQB 1QG6A 3P0JA 1Y6GA 2RKOA 2BJHA 3Q3EA 1OLSB 4TZKA 4XA8A 3RF6A 4DUPA 1V26A 1MXFA 4JB2A 2D7JA 1RWQA 3RRZA 1OMOA 2VPQA 5I7AA 1EUCB 4TRMA 4MW5A 1ULSA 4D9FA 5C32A 4HQNA 3A10A 1LPNA 1MJHA 1A5SB 1BO6A 2VBFA 2YXPX 3FOBA 4Q05A 5THQA 4C07A 2ICAA 4R1SA 3A2LA 3FMOB 1XPUA 3D7RA 3DXFA 4JBYA 2GGSA 4D3ZA 4CIYA 3UB4A 1N9GA 3DFZA 3NB0A 4UMVA 2ET6A 4BMOB 5A1JA 4ZAYA 2ZREA 2OVFA 1UBLS 1SXJD 2W0MA 4INJA 5I7SA 1X9GA 3MOSA 4UHJA 5L7TA 4PE5B 4GLBA 4B2PA 2ALJA 5KVVA 3K09C 5SICE 3AU8A 4JROA 3M8KA 2IL1A 4D6PA 1JH9A 1E9CA 4H6WA 2HIGA 3HGMA 5ALUA 1ISHA 4WZAE 2WLTA 5JZ9A 1NZFA 2PEZA 1VFNA 2HMSA 1JPJA 2M6LA 3GP8A 3L4BA 5JMWA 3RVQA 1YTUA 1H2FA 1SOWA 3OSZA 4S1PA 2ON6A 5AVQA 5KYTA 1KK3A 2JA1A 3DWIA 2VRNA 3HVIA 5FADA 4I08A 4QOHA 1WKBA 2H5LA 4OFXA 1BDMA 4QPZA 1SBHA 3NC0C 2H1IA 1YQTA 5ES4B 2MINB 1NJ2A 4ARAA 1QF6A 5DN9A 1SQ5A 4GO1A 4TVBA 4MAMA 3TTSA 1FQOA 2O2GA 3GFSA 3TCXB 1ZW1A 4RK4A 4LZOA 4LRYA 4O25A 4Q1AA 3FUTA 1GTMA 2NP6A 2CZCA 1HLPA 2BDUA 1OXSC 3JVEA 3IDOA 2O8BA 1LFAA 1BEZA 3INTA 1CY0A 5B4UA 2DQYA 4JKOA 2C8JA 2N47A 4JQCA 5EIXA 2H9AA 2P41A 2VHZA 5LZ5A 4KI7A 4PO8A 1CUZA 3UNXA 3ZGVA 2DKFA 3HZRA 2CKDA 4Z9AA 3JCZA 5JMTA 4IV5A 1BVYF 3EVGA 4J16A 1TK2A 4IIUA 4L6IA 4LRSB 4P4LA 1JDPA 4H77A 3K30A 1ZGHA 2CXUA 3H2BA 3TZEA 5A3JA 1CE8B 1SWVA 4YDQA 4KMSA 1NY6A 2GZAA 2JATA 3P2MA 4RSRA 4HBGA 2ZUSA 1JWLA 5F2OA 4JQOA 4EI7A 1V5WA 4CM4A 3TQSA 1YR1A 3VM6A 3K5PA 5HWSA 3D2CA 5IZCC 4NU5A 3U62A 4F2PA 3VKFA 3EXEA 5EHIA 3RJ9A 5FA8A 5ARDA 4BIIA 3QMWA 4G1FA 4ZHQB 5BW5A 1QR2A 3ZR4B 2NUAA 4TZTA 1YGYA 3FPJA 2ONKA 3MCZA 1SZCA 4HNAB 2BFNA 1A5TA 4WTOA 5J59A 4P4SA 1ZH6A 4R51A 2BFPA 5MN4A 1FFEA 5B37A 3ZY6A 4XWAA 3IEVA 4N76A 3HFSA 2F64A 2FJ0A 2HFJA 2G5GX 4CQMA 4ABTA 1U3WA 1Q7GA 2QU8A 3W7BA 3DFKA 3OQNA 2OHGA 3N2KB 5KVSA 2AQIA 4M0PA 5EJ4A 3DBVO 2D1RA 3OE5A 5A6SB 3K6RA 1NBWB 1NVMB 1Q57A 2QTBA 2Z8YA 2ZYSA 2IU3A 3AT1A 3FF4A 3GRCA 1QQTA 3G23A 3K70D 1D8AA 2UDPA 1KMHA 3QNMA 2A9VA 3S29A 2GWRA 2CUTA 4ZT6A 2QI9C 4MJ7A 1DKOA 2IPOA 4PBSA 2EP8A 2ONCA 3QG5A 4G5OA 3TRDA 2WJZB 5EI5A 2PE5A 1IMOA 4LE0A 3TSYA 2PKRA 1HZZA 2W8BB 2PAFA 3VYVA 3CF4G 3G0CA 1ZM2A 2Z04A 2FRDA 2VVTA 4QO8A 2OBXA 4AJHA 1K7CA 2ZRAA 2WU8A 5G4LA 2IXFA 5FEMA 1ZJYA 2FN9A 1WDLA 2BEVA 2JFVA 4NCIA 1O6BA 3JQPA 3ZCTA 1TI7A 2WIBA 1U9IA 2ORVA 1VOTA 4MR7B 1FS5A 5I9BA 2VATA 3IKLA 5IT9A 2E5FA 4RKFA 2FQYA 2PJZA 3N6RA 1M7HA 4I36A 4JS0A 1DDIA 5CLHA 4C2BA 2GSWA 3F4BA 3L79A 4X3OA 5B6IA 1V8PA 2JGKA 2KX7A 4F5YA 1NR7A 1OI3A 3HLTA 3W90A 4NZYA 3OI7A 4HC4A 2AR9A 5D3MA 3W3ZB 1ORWA 2OY0A 4C7JA 2IJGX 1VPWA 3MJTA 2WAXA 1I0ZA 5IDQA 5J23A 2FMFA 3QPCA 3ISJA 3SZ3A 3SIRA 4RVNA 2WIJA 3LP5A 2PGLA 1GADO 2CB0A 4UAUA 5AUNB 3O8RA 2V3VA 2XRYA 5HVNA 3S4YA 3WQBA 2B4RO 3GC6A 3QNWA 2QPOA 3EG9A 4XRGA 1DARA 4UMEA 1B42A 4M9ZA 3MILA 3BERA 5EMKA 1W59A 4Q01A 1EX9A 3KOOA 1B6TA 3MELA 2D1SA 1XCLA 4OIFA 4BNZA 2J5KA 2AKYA 1W94A 3LUHA 3LGXA 1K06A 4OJTA 4PO3X 4RYLA 2UZ1B 2LW7A 4BU1A 3JZFA 1GGVA 3UO8B 2BFMA 5CB4B 5IWCA 2YV2A 3OM9A 1NUTA 4CDMA 1AQNA 1FUUA 1L8AA 3ICPA 5INTA 5EEGA 2H7CA 2YXDA 3BXPA 4TTSA 8LDHA 2XCUA 2A35A 4L8LA 1GAEO 1K8QA 2G9UA 3WGNA 3SS9X 2CDCA 4DC1A 1EFRA 3R0JA 4EATA 1U3TA 1SD5A 3H9CA 2ZIZA 3FLEA 2NU8B 3DMDA 1IBLB 3NJ8A 2QNBA 1RBQA 1HMPA 4BBZA 3THWA 1FU7A 1Z75A 2AI2A 3ANXA 1ZQ1A 3OY7A 1SKMA 4YXWD 2BM9A 2P79A 2VAXA 1TLFA 4Z1MD 5EHZA 1T0PA 4J3JA 4AT1A 4BO3A 2IYWA 4M0DA 4FINA 1BMFA 2FPPB 3E7WA 4JSTA 1LDEA 1JPVA 3IQWA 5A71A 5BSTA 3ZWPA 2J3IA 2W37A 4UJ3A 2C07A 1GN9A 1T5SA 2D4AA 1L1QA 4ND8B 1KU0A 4O2LA 4UEKA 4QC2A 4YJFA 4W1RA 1TIPA 1KNXA 4RVUA 1IYZA 1UJCA 2Q8PA 3JD0A 1BDJA 5JJ5A 2Q1XA 5FPQA 3CNLA 3M3HA 4E14A 4D4JA 4KXFB 1NX9A 3N3BC 1NBMD 4RM3A 2PL1A 1L4MA 2JLZA 1R15A 1NPTO 2EFDB 3A25A 3B1JA 4P92A 4TOIA 4D0SA 3RADC 4DC9A 3PFWO 1EK6A 5DKFA 3HRHA 5AW0A 3N59A 5EKDA 4BZWA 4DIBA 1USWA 3AF0A 5JAPA 1TF2A 1FP4B 1NYTA 2I3DA 3OZIA 2FSHA 3AERB 3WGZA 1D4OA 2VNIA 1J7JA 4PO9A 3DZKA 3O74A 5IKXA 3N53A 3LUAA 1YO6A 2C95A 2ORIA 2C5AA 2WHPA 2F62A 1Q95A 4MAAA 1RPTA 2GNOA 3NWEA 4V39A 1ULUA 3K9GA 1CJVC 2PS3A 3QIVA 4PN3A 1Y6RA 3GLFE 3KT8A 3UJCA 1L7DA 3MUNA 1XRJA 1KI9A 3SBEA 3KYDA 4B33A 1JA0A 3QSGA 5E6SA 3E1GA 4HXFB 5GONF 1JP7A 2PD4A 3NTUA 1YZFA 1Z12A 1KC3A 1UODA 2Z09A 1K89A 1A27A 5HEKA 1JVBA 1GM5A 4C5BA 2Y1DA 2PKXA 4EMBA 4MUJA 4YMHA 2PU7A 1S3SA 3OMLA 2WD8A 3ZV6A 3P0RA 3KDSE 3DT6A 4HL6A 5K3FB 3UK1A 1Z47A 4PG5A 1CJKC 1JFVA 3G82C 4Q3KA 4C6SA 5CD9A 4LOKA 1UKBA 4ENPA 2PV7A 4RPHA 4C9BA 2R5NA 2GA9A 3OJ0A 4BN0A 1YQQA 3D7SA 1BW9A 4JLNA 2FWIA 1IHDA 3DVSX 4S12A 2QLLA 3T4PA 2XGGA 1E1QA 2Q27A 4AVYA 3GHYA 3JYQA 2J7KA 1IJBA 2ID4A 5BSHA 5BP7A 1E2GA 1NL3A 1YU6A 1YHZA 2PQ0A 3KQSA 2X4LA 2XMBA 1SVMA 3DE6X 4FYVA 3SQOA 1YZGA 4NMXB 5JS1A 1KARA 1BE1A 5C3MA 2QTGA 1A69A 4M7WA 1WXWA 3OM0A 1E1RA 3K6KA 4L5BA 4LWQA 4O8CA 1XZMA 2AN5A 3NTQA 3IXLA 1UOPA 4J4TA 4O0LA 3A14A 3RS5A 3ZJUA 4MROA 1BE0A 1YE3A 3J7TA 2HN9A 4LI3X 4J3NA 1KO8A 4GZ3A 5FI5A 3EIWA 3MCTA 4RJIA 4HWKA 3ZTWA 4OHWA 3PB3A 1Y1QA 3PZRA 5IM4F 3CSSA 3BE8A 1O3YA 2ES4A 5LUBA 3LSTA 1E2KA 4CLHA 3E61A 1QNLA 3EXHC 2JPDA 3MAAC 4J49A 4J0HA 4CLRA 1G20E 3MBKA 3ZXUB 2ZCUA 3L9WA 4MUHA 1ZNZA 2NLOA 4K40A 1HT2E 3HMQA 4AWBA 3F1LA 1XVIA 2YZKA 3K1JA 4UOZA 2BONA 5KX5B 7MDHA 1T9GS 1YJAA 4W6QA 4RKRA 1IOZA 2FMIA 3DL0A 2ZJ7A 4PXSA 1I2AA 3S1AB 4CETA 3UBTA 2JZNA 1K92A 1Y9EA 3E9CA 4R9UC 1U8TA 5K0JA 1OLUB 2VJPA 4S0ZA 1KOLA 3GFFA 4DV6B 4FGKA 1RVV1 3V4LA 2XKKA 4V02A 3L1IA 4H3KB 3U6BA 4S1NA 3CTPA 2WAAA 3DE2X 3LECA 2CXTA 1GPYA 1Q11A 1NXTA 2WFZA 1MO5A 1QZUA 4A03A 1DQPA 1P2DA 5IYZB 4LXUA 3OJWA 5CFLA 4P7KA 1LA2A 5CIQA 1G0OA 5C8XA 2BL4A 3OFJA 1SU8A 3IV9A 3ZDXB 4MEAA 1R00A 1CQIA 3E22A 4LYHA 3FTDA 4OFZA 3SXUB 3D3WA 5J4VA 1N6RA 5CPFA 3MUOA 2C2MA 4NBNA 1ZVMA 3RBVA 3WL4A 2J0QA 1Q77A 3L92A 5FPYA 3HVJA 1H2WA 1TVKA 3CQ9A 3VNQA 4EYQA 2J46A 1EFCA 4NONA 1IZ8A 1JBQA 5D8DA 5JAUA 1FX1A 3L05A 5JI2E 4GVPA 4DY6A 4DRXB 3UYKA 3JS5A 3TLEA 2NACA 5KU1A 2WNHA 1PYOA 3MWGA 1EDDA 1XMIA 2WTXA 4M6WA 5FPTA 3GZTB 4JI8B 1OX5A 3PJEA 3EIFA 3HNRA 3L84A 4WFIA 4IMRA 1G1AA 2IPLA 2QL5A 3OJXA 4HQLA 4LFCB 4J0FA 3ZX4A 1TLLA 3QYPA 4D9IA 4FM9A 1FS4A 3ZY4A 1E63A 3DOUA 1MAUA 5L3RA 5JXJA 2WK1A 3CT4A 4W8OA 5FO0A 3T5DA 1D6JA 1JBEA 4QDXA 4X1YA 1JSXA 2EEZA 2OAEA 3OOJA 1RHUA 4M0UA 1SGWA 4UNQA 4E7PA 1X94A 5E1BA 4V1CI 5KBYA 4TV9A 1G42A 3WNCA 3HJFA 3P32A 1UDAA 4K9NA 2ZB8A 1HFJA 2Y1EA 4GMXA 4MINA 5JCJD 3NHUA 2KJQA 5ELLA 3FHLA 1VSUA 3AJAA 4XUCA 5FLYA 2V7TA 1XV5A 2RH4A 3NBXX 3T9FA 1TM1E 5J2TB 3MCWA 2EV9A 1ADYA 3U49A 4AX8A 4H7FA 3MPUA 1MC1A 4QQ8A 1FDTA 3ZQUA 4EHAA 5LOVB 4LJ5A 4WDQA 1WXEA 3GFVA 1PFYA 1UOQA 2OL4A 2Z2XA 2GXQA 3QPDA 4Z54A 3JAKB 5KS2A 1J1UA 2JLRA 5TQJA 5FOVA 1SCUB 1TCVA 3A4VA 5DULA 1P4AA 2KB0A 2NG1A 3MA0A 3TD6A 4LMPA 1EA7A 4RZ3A 4DQLA 2HSGA 3VDQA 3BMNA 1EINA 3HCPA 5KKAA 5E4FA 4MRSA 4OHMA 5G4KB 3ETLA 1PFUA 1Q1ZA 4W1QA 1RPJA 4MUXA 2IZ0A 1E5QA 3ULKA 3BM5A 3C15C 3E23A 4CCAA 4WKGA 3O2SB 4ILKA 1G3RA 1O8BA 1LLQA 4U7JA 4H35A 5A4KA 1Z35A 4O0MA 1PX2A 4POOA 2DHDA 3ITDA 4Y1RB 1XZHA 1Z25A 5DCYA 4CODB 1ZJ6A 1FLNA 1VHJA 2F8TA 1CXZA 1PV1A 2HT6A 1RKBA 3CGWA 1A9XA 2WSLA 2GBLA 2BFFA 3A1CA 3CWCA 4IW3B 4DMFA 5C1DA 5KNLA 4F5EA 5FTLA 4F71A 4BC0A 3BMCA 2OO3A 4NAVA 1HQCA 2QZJA 3UJ6A 4LXHA 1M1XB 3GG2A 2O5VA 3L06A 4UBJA 1U1EA 5GWXA 3WGJA 3CS3A 1RM3A 4BGEA 1RZRD 2FTKE 4JDUA 3EODA 4KRFA 3N7UA 3V34A 3JYPA 5CYPA 4I1RA 3FSRA 3EXHB 3DEAA 1J70A 3L7KA 4ZOLB 3P97A 3JQGB 3ODPA 4M1QA 3W2HA 5AVZA 3BZWA 4KYTA 1PR1A 4TTAA 3TS1A 2WP0A 4G67A 4Q9NA 5JR3A 1PG5A 4JT4A 2OPBA 4JGBA 4LOLA 5JD6A 1CYDA 1YR9A 3VYRB 2XGMA 2HHHB 3QE3A 3Q7IA 3C74A 1JJBA 1ZEMA 3ESRA 3L93A 2ASEA 3ZZTA 5BQ3A 1NVUQ 2FHSA 3PUXA 2BF4A 2I76A 4KMOA 4WH0A 1VMAA 2WC1A 3ETEA 3BFVA 1T43A 3N8NA 3MJRA 1FW6A 4I1IA 2VSQA 2PKYX 5AK5A 3WY9A 1X7YB 3KKLA 3RAPR 4UPEA 1J33A 1JFTA 3SYMA 2QORA 2IXAA 1QRAA 3WGIA 2BMEA 1JLLA 2A0WA 2G67A 2ZI7A 1JYFA 3P27A 3V7UA 5CA1A 1UMCA 4EFMA 3KWFA 5IKPA 3OTQA 4YBRA 4NZ9A 1FFCA 2V6BA 3B20A 2X4GA 1P19A 2ZRPA 2I4NA 3HXPA 1ZKMA 3GQBA 2OMKA 3CH6A 4HTAA 4TKUA 5IJZA 4JJ8A 3H5WA 4DCMA 2KBFA 1EEXB 4LVUA 3SC3A 3EGXA 3LWDA 5KB3A 3OQPA 2I4RA 3T7KA 2P6RA 2XYVA 1ZS9A 1ZQ9A 1WQ4A 3SSOA 2PXXA 2C3MA 4ZZ2A 3LY5A 4IXNA 1JDUA 1P73A 3GBVA 1KA9H 2WUEA 3CSDA 2J9GA 4G5HA 1WSWA 3CN7A 3KZCA 4RD3A 1UJBA 4CZ2A 1MFZA 1B43A 4HD8A 2X0NA 1VLHA 4MS4B 5IF9A 1NOJA 2H9IA 3H9UA 5BRAA 6ABPA 4ZN6A 1ULZA 1LQ2A 2PQ6A 4CT5A 4XYBA 1EEHA 2PU5A 1DXHA 1HKHA 3S44A 2CLDX 5SY6A 2EXXA 4EKYA 1WHTB 3ZHUA 2IEZA 3L40A 2GF9A 3HXMA 1NMYA 1XZDA 3PJGA 2F3PA 3VO9A 4C5AA 4IICA 1XQ9A 1P62B 3TNLA 1DAKA 3TUJC 2O6HA 3U4MA 1TZ2A 1C1DA 3GWZA 4V3CA 1UCFA 2DHEA 1NQ5A 1U2DA 3GU3A 3H9EO 4C7MA 1RAAA 4ECAA 3G2NA 3HZOA 3VAZA 4JBWA 1GQQA 3L07A 1RXSA 2WTEA 4HCJA 1M72A 3CH7A 1TRHA 1DTWA 4R3NA 1OI2A 5T57A 4DA6A 4ZV7A 3N0VA 5HFNA 1KEWA 1A1SA 2I6GA 2VZ9A 3VDMA 2JG3A 1NBAA 2ZJZA 4BGUA 1CVIA 1W4LA 3FIUA 1XZ8A 2GM9A 3F7OA 5IU6A 1S8AA 3EEYA 3KSBC 2J87A 4FXOA 2P7HA 4LXYA 1OHHD 4ZMSA 1AXGA 5JS7A 1QAQA 4J3FA 4MR9A 2FOIA 1F7UA 4D26A 2CSUA 2OXEA 1MJFA 2ZE6A 1PWHA 3RS9A 1DIOB 2Q5LA 4AYXA 2EC5A 3NLLA 4IIJA 2DY1A 5LQNA 1XD9A 2ZGVA 1AKVA 1GSIA 1ZD2P 3FDFA 2EJUA 3OJCA 3M1YA 4EG1A 2FZLA 5AICA 1LBEA 1ST3A 1XLWA 2HTFA 5LP6C 2PLFA 5FOTA 3T0IA 4EKNB 3I09A 1XFAA 4M9RA 4R5HA 4LF5B 3X43A 3FSGA 4L8VA 2ZCVA 1GD1O 2CF5A 4FZVA 4KFTA 4GRAA 1CUCA 1ZEJA 4KODA 2V0GA 3OFSA 4HR7A 1G41A 2IYXA 1W0JA 3N3AC 4AS1A 4WPGA 1FZQA 1TNDA 2OFOA 5FWAA 1U80A 4BNDA 4J4BA 3G1UA 3U3JA 1A98A 1Z5PA 3DO6A 2JBWA 1CV2A 3FNQA 1R6VA 4J43A 2YUIA 4V1CA 3AF4A 4RA6A 2C5BA 2YWHA 3O95A 5ECYA 3RS7A 3KSUA 4NCAA 1NUSA 4EJSC 1WMDA 2VP9A 3CPEA 1YTLA 1FYWA 3VHRA 1JDJA 3NS7A 1U9ZA 4KACA 3T5MA 4EZIA 9ATCA 1T2FA 1U7PA 2KM1A 3H8SA 4JI1B 1L5YA 5EZYA 3PNBA 2ADOA 1CETA 4NKRA 2QROA 4DIEA 1SAYA 1YRQA 2H08A 5BXYA 4C0BA 3PPXA 1L7AA 5JMPA 2VJLA 4C0QC 2HCTA 1PG0A 3G1TA 5AI8A 5T6MA 1V5IA 2Q0XA 5FFFA 5IM5A 1ZNYA 4B40A 2QJRA 5HMLA 2C58A 2JH8A 2CDAA 2HHAA 2IELA 4M98A 4DLXA 3M7IA 2BIFA 1XVUA 4M55A 5NLLA 3FTNA 4X1IB 5SV2A 4Z99A 5EY5B 4FR0A 1TA0A 3WB0A 3PR3A 3PHHA 5C7LO 4PY2A 5JE8A 1P4HA 1EVKA 4O3FA 4L78A 5TRTA 2CXQA 3ZEAA 1JHMA 2P77A 3INGA 2YJ6A 4EEXA 4OQDA 3V46A 3OTIA 4L85A 4AZ0A 3IB3A 1Z22A 3MMSA 4A8HA 3FN4A 4EF6A 1UC9A 2Q50A 2QG4A 4JSYA 4KLCA 1ADFA 1E3WA 4X9XA 1IY2A 1N2SA 3JWHA 1NW3A 4YT8A 2VNSA 1QHXA 1T8YA 4ZMBA 2PJDA 3KSRA 2ZJ5A 1IDOA 5GZ6A 2GTPA 2WTBA 3VNBA 3MSXA 3B1WA 3PXBA 3L4SO 1M7BA 4LHEA 2ZIGA 1PWEA 2ATEA 2Q6VA 2DPGA 4RV4A 2JHFA 4PZ9A 3EAQA 3ZY3A 1DCMA 1H65A 3L7JA 1FJ2A 2Q1UA 3D4IA 4OHOA 3BOSA 3ZLJA 4P80A 3KVYA 2OXTA 1GU7A 1EE1A 5AVTA 3MS7A 3NBZC 3BUSA 4N1AA 4CJXA 3PI7A 4J2TA 4BNKA 2QN3A 3ITEA 1JQJC 1M2OB 1BXZA 5KSOA 1CF4A 3ZWCA 3X44A 4OA5A 1ESEA 3OFVA 1JHDA 3RVNA 2X2OA 1UZUA 4JVLA 5K9ZA 1OLXA 3N2YA 3EPLA 2IUYA 4CW7A 1KMQA 3F6BX 4IHAA 5KVCA 3DONA 3OQVA 1YB5A 4HPJB 1N34B 3IDFA 3C8ZA 5CIYA 3EUEA 4EKDA 5BWOA 1N5IA 1Z4LA 2D5LA 3K7EA 2D8MA 5D1HA 3BG5A 1GV1A 2XMRA 2VXYA 2F1OA 3C6MA 1JQBA 3QXHA 2QIPA 1GGFA 2Q41A 2RGUA 4TTTS 2DECA 3I1JA 1SB8A 1QHYA 5TXGA 2YVLA 2FVXA 1HT1E 2O2YA 2CVOA 2OXRA 1IN1A 3CJQA 4IDEA 4HAUA 3OZBA 2R7KA 1N1GA 4V0KA 2OBNA 1I6KA 3BWEA 4ZV9A 2PFGA 3PA6A 3N86A 3C3XA 1CFJA 1J1IA 1WDTA 3MJSA 3NEJA 1XI2A 4EECA 3FUVA 3QKWA 3UZUA 3CJRA 4AMZA 3DTVA 3CNQS 5EUQB 3SJZA 2OYRA 4DDTA 3JQFC 3QW2A 1YL6A 4B46A 3K9FC 4RIHA 4P9NA 5GGXA 1E9RA 2PS1A 2VJCA 4JLSA 2JLAA 1SXJA 2MSEB 4OJMX 3FTFA 3VH3A 3ZCQA 1UQRA 4YCNA 3PEUA 4KWIA 1U3GA 2R6AA 3IOCA 1HOXA 4N3NA 2EBFX 4JKYA 4FHDA 3KKPA 5MN6A 2JGFA 4DQUA 3FVQA 3R0ZA 3NBUA 3OCUA 1U3DA 3IUSA 3H04A 4QYXA 4YACA 3WIBA 4RGQA 4Y2HA 3VSCA 3QW4B 4PTLA 2C97A 2ZRDA 1B41A 4NI5A 4C2UA 4Q9DA 5TEVA 2YYYA 4FEEA 4YQZA 1N36B 1RXYA 3IKTA 1XRRA 2H4WA 2JASA 2XB4A 4O29A 4DLKA 2YS6A 2OZVA 2I0FA 1DIGA 1GCGA 2Q3LA 1RQ7A 3EA0A 3H4MA 3IA2A 4QOJA 5KHAA 1PLKA 2WKWA 4FKZA 4XVHA 1GR1A 1P2GA 3PE6A 4J29A 3GGJA 3DS8A 4WAUA 3U4QA 1GNRA 4JP3A 4EP1A 1NVEA 1NF8A 4ADSG 1S01A 4GMFA 2P75A 3E82A 3IUMA 1WOYA 1LX6A 1Z8HA 3HSKA 4D3FA 4EJSB 3W6ZA 2C5SA 2QEQA 3IVGA 3N8GA 5I4BA 2Y9PB 1P9RA 1NYLA 3KKZA 1GLGA 4TS9A 3FPHA 4BE9A 4Z8YA 3LCMA 3OM8A 2R5FA 2BCEA 4K6KA 3GZNA 4LK3A 5LCXA 4RWZA 3OSUA 1WSAA 4N4AA 3KCQA 4HXGA 5BT9A 4ZK2A 3WYFA 1RHKA 5IJ9A 1AS0A 1NP7A 3AB8A 3HN7A 3DOCA 3H1PA 3JZAA 4CM3A 1QZZA 3JVDA 3IAS6 5IXSA 1BA2A 1UMBB 1X6VA 4C1BA 5CBPB 1ZUIA 1LVGA 2Z6QA 4JODA 5FLKA 2DWOA 2F2TA 2NVUA 5IAAA 3DOFA 4D4GA 3NHJA 1Q1NA 3LO8A 1Y8QB 4WK6A 4GP7A 1NE2A 4NJEA 3RB8A 1QM5A 1II8B 5BW6B 4DSZA 1B73A 1QGED 2HSJA 2FZ5A 3RD5A 2D5CA 3KSDO 3RSFA 4DJJA 2VKTA 1SNYA 1KJWA 2GM5A 5DGIA 1X1AA 2FKAA 4OH1A 1ORVA 4UXJA 4IFEA 5I7UA 1P9OA 1Q91A 1FRNA 4KMRA 5FNVF 5I9MA 4RQTA 1J0CA 4MI3A 1OWNA 3M4XA 3ODGA 1XMPA 3EFOB 4XTCS 2NZ8A 4K3VA 3TSAA 1KSHA 2ZYIA 3AF3A 4HWRA 2XQJA 5D3QA 1WMSA 3ZZ1A 4R8LA 1SXIA 2EKBA 4TWRA 4ATNA 4DR7B 1SXJE 2ZPUA 2ZJAA 2HYIC 1JSRA 1NQVA 2Y0PA 1F2DA 2BBOA 4XPZA 4CMEA 1Q7TA 3AEKB 4MPDA 1RJWA 4W4TA 4L8YA 3NV9A 2J7PD 1C8KA 2XI4A 2XV1A 4CRWB 4CG1A 3BS4A 2ONZA 3NEAA 3TNFA 2HK7A 3CURA 2I7XA 2IDJA 1I13A 5KTMA 4CFZA 2PJRA 1ZRSA 4ZICA 5DSZA 2R44A 3EVFA 3P4UA 2QTLA 3FYCA 4P36A 4O4IF 1OFUA 1EXMA 3HBAA 2QK4A 3JQAB 4I50A 1MIHA 2C9YA 4RVFA 3NEYA 1CS0A 3NUGA 1WRBA 3PZBA 4N0PA 1Q15A 1RQLA 5ESXA 4D9EA 3IQZA 4Q3EA 4OMDA 4RKEA 3B48A 2CVZA 4BFVA 2I87A 2QRVB 2WILA 1QSGA 1I1QB 1ONBA 3E1KA 5F2KA 3R8XA 1M2HA 2W83A 2Y27A 3JVUA 5CJ2A 2HQRA 2CD7A 2GFHA 3JQ6A 3QUBA 1MTZA 5YASA 5IMBA 2EWMA 4U2FA 3IMEA 2BMDA 4M9SA 2CCKA 4YCBA 3ZIDA 1P74A 2IKSA 3QY9A 3LCUA 4WZBA 2P5YA 1JQEA 2CEAA 1SBTA 3GNSA 1JT2A 3CF2A 1FSSA 1Y9AA 2JHCA 3DNPA 4JB8A 4RSHA 3UJAA 3ZV3A 3OTOB 1J2TA 3LVBA 4Y2TA 2Z30A 4Q3LA 2IY9A 3U7GA 1B8UA 1T3TA 2WJGA 3KQLA 3RSZA 4BE7B 1Y1SA 3MNFA 3ZZ0A 3VJMA 3EYWA 1E66A 3U81A 3ZBUA 5EJ8A 3WL7A 2QLMA 1E3LA 3ZV4A 1E1DA 4DV3B 3MTDA 4MV0A 2Q9CA 2C94A 1A9QA 3QX8A 4CCYB 5JAMA 1N75A 4HHEA 5KQRA 1E3TA 1P2BA 2QE6A 3CUWA 4TM8A 1DAGA 2G9ZA 3C0KA 1KXZA 1DU4A 4XVQA