2P79A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGAMWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p79A00
2PA0A 3F3KA 4JODA 3DCYA 3GP3A 5AJWA 2F90A 2DWPA 3FJYA 3D4IA 3IT1A 2P9ZA 4E3WA 2HHJA 1E58A 1FBTA 3PGMA 5AJYA 2HPAA 2EKZA 3D6AA 3E9DA 5AJZA 1RIIA 1ND5A 4D4KA 4IJ6A 1DKQA 3O0TA 4ODIA 1RPAA 1IHPA 4GPZA 1YJXA 4QIHA 1H2FA 2QNIA 1C80A 2P2ZA 3QPWA 2WU0A 3LL4A 1TIPA 1UJBA 2A6PA 2P78A 1QHFA 1BIFA 3D8HA 4PZAA 3HJGA 4FDTA 1SK8A 1RPTA 2EOAA 2WNIA 4MA4A 1QFXA 4PZ9A 3FDZA 2P77A 3IT0A 4ARUA 3LG2A 3ZHCA 4AROA 1SKAA 3F2IA 2A9JA 5HTKA 2AXNA 1DKLA 2ENUA 4HBZA 1E59A 2YN2A 3IT3A 5CX4A 1V37A 2P75A 3OI7A 5CDHA 1NT4A 3K4QA 3E9CA 3MBKA 1C81A 1T8PA 3C7TA 1SK9A 1QWOA 2OWDA 3DB1A 3NFYA 4IJ5A 2OWEA 2RFLA 3K4PA 1FZTA 3EOZA 3LNTA 3QPVA 2WNHA 1H2EA 3EZNA 3NTLA 5AJXA 2P79A 5HR5A 2DWOA 2P9YA 2H0QA 2HIAA 3FDZB 3R7AA 2H52A 4D4LA 4GPIB 1ND6A 1DKPA 3GP5A 3MXOA 1SKBA 4D4MA 1C7ZA 4FDUA 1K6MA 2GFIA 4JOBA 1CVIA 1DKMA 2IKQA 2P6MA 3QPUA 4EMBA 2YN0A 2P9FA 1UJCA 2P6OA 3IT2A 2EKBA 4JOCA 4ARVA 1BQ4A 1YFKA 2ENWA 2BIFA 5PGMA 4D4JA 3BIFA 3E9EA 4TSRA 4PGMA 2I1VB 1DKOA 5CU7A 1BQ3A 2H4ZA 2P30A 1XQ9A 5AJVB 2H4XA 1EBBA 4ARSA 1DKNA 3GW8A 2P2YA 4EO9A 3KKKA 1V7QA 5AK0A
chains in the Genus database with same CATH superfamily
4ER0A 1JKXA 1HG0A 1X80B 1UKCA 2HUNA 2ZE7A 2FPOA 2DWPA 1X1QA 3PE4A 3ZNNA 2NP7A 3KPWA 5LC1A 5FWNA 5TGTA 4HOYA 1IONA 1PDWA 2J87A 2JPDA 5GV7A 1F6WA 1VKHA 3TL2A 1HLPA 2DMRA 3QKRB 4KUGA 5TV2A 3H7IA 3NTVA 3V4SA 5AJZA 2NIPA 3KZKA 1JSLA 5K0LA 1W88B 5FNVB 5AXBA 1GY8A 2SCUB 4C0WA 10MHA 5I7FA 3HKBB 2IEBA 2ZI3A 2C5LA 4PHFA 4NOKA 3NBYC 3GFOA 1M34A 3FPFA 5JWOA 3QEMB 1UJBA 3FRIA 2DPGA 4JFAA 3HVHA 4RFSA 4TL6A 3DT6A 4I50B 4LJKA 4YJGB 3DVLA 2DG2A 2I3BA 2JZCA 2IBTA 2XWSA 3EXEA 5IXYA 3QF4A 1JE1A 4EVIA 5HX7A 5EMJA 3OC0A 4ME6A 1K0FA 4DCGA 5EUMA 5K20A 4NBRA 2B4AA 3VNQA 5ICCA 1QF6A 4N0QA 1WSDA 3IE0A 1I5RA 5B55A 1TKCA 3DW1X 5C1IA 1BMFD 3U9TA 5C51B 3T5PA 3GPLA 1RXWA 3CLSC 3CINA 2HSWA 3NI2A 3A9SA 4RMNA 1NJ8A 1HMPA 3AG5A 3KVVA 4BNZA 4EP1A 1NW8A 3MSXA 2Y1FA 1I3KA 1XNHA 3A2MA 3RYHB 5BN3B 1UMDA 2VP9A 4FSXA 3I32A 1VPDA 5IJXA 4DB4A 1MHPA 1TT5B 3QKUA 4CV1A 1PSDA 1U2EA 4DR2B 4YMVA 1VECA 3IFSA 1C9KA 3EPHA 5I7SA 2GDZA 2Q0HA 1NXXA 2BZ0A 2XCUA 3RT1A 2QTMA 3Q9NA 4RXUA 2L2QA 3TNYA 1CFZA 3LKBA 2WINI 3PFHA 5KINB 2PLWA 4LC1A 4B35A 1CDZA 3GJXC 1PK7A 1G20B 1B73A 5I45A 5AHRA 3UGJA 1JHXA 4XEUA 3TTVA 2WFLB 4R1UA 1JBKA 1YC2A 2ZI7A 3IQDB 4P92A 1RBMA 2APJA 3F47A 5AW3A 4Q4CA 4I6JA 4DUZB 3BB1A 1SKBA 2QP9X 1KMIY 3A3OA 4D3XA 3K2QA 3OUTA 2GFIA 3MGBA 4G2TA 4NJEB 2PKQO 4PYNA 4BLTA 2IKQA 3COZA 1BU5A 5A4AA 5DT9A 2RCNA 1APBA 4KYVA 5CA1F 1DX4A 4LWQA 1H6CA 2F1JA 4F4JA 2TMGA 1QU3A 2CDAA 3BE8A 1LGYA 1J0EA 4IWXA 5CXXA 1WPQA 2WF5A 3HBLA 3E9NA 4OQ4A 8ATCA 4FSHA 3PIRA 3V46A 2D3TA 3L1UA 3WYAA 4G5GA 3I04A 1YR9A 1ANKA 1XA0A 2K2WA 3I8SA 3ZYZA 2L0XA 4FCVA 5ALPA 2GX6A 4BFWA 4YRTA 4MP3A 4WNAA 3D8NA 1KTVA 2C7VA 3B6KA 3HJUA 4EECA 4P3XA 3N0TA 3EDQA 4OB7A 1B8VA 3PDHA 4Q3EA 3W8RA 4LXUA 4O3MA 3RROA 1CE8B 5L3RA 4C01A 4DRZA 2HI0A 2PX3A 3VPAA 1XAGA 4KO2S 2JCXA 3CJTA 3WAKA 1CEEA 4O2BF 1T1SA 1EB8A 2A14A 3A1SA 3COSA 3M5DA 1XDBA 5I48A 2WJGA 2GYVA 1I33A 3RSSA 2JGEA 4DA8A 1S5PA 2NT3A 4KLAA 2HPVA 5DW0A 3IAS6 3LHFA 3OCYA 3OLCX 1YI1A 2X5XA 1KAMA 4Q9KA 4KIGA 3RFUA 3UV7A 2HQOA 3FPCA 1E2FA 1VYUA 4L78A 3R20A 2WUDA 3LHIA 1YS2X 2F1OA 1MDBA 3N8NA 2H29A 4D9EA 2GM9A 3P26A 5IYZF 4XCVA 1VKOA 3RRMA 1GFIA 1UFOA 3LQ1A 4V0NA 1EDDA 4LHYA 3I9NA 3ZTWA 3FCYA 2R86A 2NSDA 2QTRA 3QPDA 2WIBA 4EG8A 5K8UA 5BSWA 4DWWA 1UPUA 2P7HA 1Q0QA 2WWWA 3QUQA 2GAFA 2IXTA 3GDHA 4JP8A 2VA9A 1H94A 2C3UA 1WQ1R 4XWYA 3LRTA 1U0TA 2JFFA 3L82B 5ILGA 3C3EA 1ZVVA 1EMDA 3V4VB 4D42A 3MFYA 3NW9A 2IYOA 3V6LA 4N41A 1M6NA 4K8RB 5JCOA 4RV9A 2DWUA 2R5NA 1NQWA 3GRPA 1MAAA 4BAGA 3M81A 3CN9A 2CUZA 4IAOA 2GQ0A 2LPMA 1NBOA 3QRWA 4GNRA 5HSGA 5LJIA 3NVMB 4L8FA 1R37A 1MD9A 3BREA 3EXHC 5EUCA 4E5KA 1IJKA 1GIAA 1E2PA 1XMXA 4LOKA 3QNMA 5CJJA 4Y9DA 1K6IA 4S2UA 5IARA 1UK7A 3H5LA 3ZVMA 3DR3A 1U9CA 2PXCA 2CW5A 3IVCA 2BMFA 4IDAA 4IRXA 4AP6A 2QJOA 4CKCB 4BE9A 1P4JA 2F64A 2Y9MB 3MTEA 3TQHA 1TD9A 3AONB 5LVAA 2JLWA 1E3IA 1XALA 1Y5MA 3W6UA 1D7AA 1RKUA 3RK4A 5AJTA 3ZIUA 4KVZA 2ONYA 5GZ1A 4AY2A 3C3KA 1ACJA 3OPYI 5FNVF 3SZLA 5CB8A 1TYDE 2Q5CA 1IZ9A 1T0PA 1A9TA 3ZDEA 3V9PA 4UOZA 3RH0A 2O8DB 3ZK8A 1G5HA 4D9MA 4LF6B 3EN0A 3I1FA 3ZNPA 5H7XA 4AI6A 3O8QA 4R8LA 2CZQA 2GCEA 2VVTA 1P33A 1GTSA 1N7GA 4AKSA 4DMFA 1UAAA 2DQZA 4HI0E 1IEXA 3D6TB 1VHTA 2P7IA 3EISA 5LQAA 4ZDKA 3ZD6A 3QVVA 3ESDA 1GG2A 1PJ3A 2OECA 1IXSB 4GXRA 2YXBA 2YWXA 3IC5A 4ZOBA 5TF0A 5KNDA 1GKIA 4XPIA 1AKRA 1YJQA 5F76A 1LQ2A 4MWOA 1CF4A 3WYCA 5KYVA 1WDMA 1MAVA 3U0BA 1MNQA 1NT2A 4QDZA 2XQIA 5EGNA 4REOA 1LPNA 5J3JA 2H7CA 3GW8A 4D9IA 4DBLC 2B8EA 1CZHA 4C9BA 1K8ZB 1WMBA 3C8ZA 3MT0A 3NTUA 2PUGA 3IQIX 3FAKA 1P6UA 4H1VA 1GL7A 3LHKA 2PA0A 4FFBA 2Y8EA 4H31A 2QORA 1FQJA 3RAPR 4JODA 5DHFA 4N0PA 5JBNA 1JU4A 4U7JA 3HDHA 4IO1A 5IZ4A 4QULA 5FF9A 1CQPA 4DW8A 1PR0A 4RANA 2I62A 3TNDA 4KO3S 3ZWWA 2QUZA 1QG6A 4JI8B 3OT4A 4JOQA 3WIEA 2PTHA 3QF7A 1EWYA 2WWGA 3O8LA 3WGGA 2VWGA 3H5NA 4KWTA 4EI7A 1J1ZA 3WO1A 2FVYA 1Y8RA 1D2GA 1X13A 2O3UA 5F4ZA 4BNDA 4B6OA 2L42A 5C8YA 3L6CA 3FFTA 3V4FA 2VA8A 3A1WA 4HAUA 3WMGA 2ORED 3VX3A 1ECJA 3N05A 2H17A 4MV7A 1UXJA 4EA7A 2D1FA 3NO4A 2VEOA 1G4HA 4TRRA 4IR7A 4WXMA 3FZEA 5JY6A 1KK3A 3I2FA 3R0VA 5L7TA 5FTWA 4PZAA 3KWMA 4CL8A 1YIDA 1HDYA 1THTA 1QONA 4HQFA 4BN4A 3Q5DA 1EGQA 3BE5A 3TTWA 2ZYWX 4DCCA 3S2GA 4DBVO 1KOLA 1XRQA 4WK0B 2N0SA 4BUJA 3EZGA 1CP3A 3NDRA 2J0QA 1OASA 2A1UA 4Z7QB 1BOFA 1DXOA 2CLMB 3AIMA 1BD3A 3EPRA 4M1QA 4N39A 1C9NA 3EMKA 4WXEA 5LIRA 1E1CB 4OGLA 2MYTA 3EF3A 4CV0A 2WYOA 1XKLA 3QA3E 1RZRA 2EV9A 2PRJA 2D5CA 2Y0CA 5ADVA 1JVBA 2CFOA 5AHWA 4KC0A 3QEAZ 1GRRA 2YQZA 3QVWA 1CUVA 4HPXB 2IV3A 4AN1A 2BI7A 3F6RA 8AT1A 1XKQA 4Q4HA 3REOA 3WLOA 1K5DA 5B5SA 3SFTA 3RUIA 3BERA 4QOGA 2X0FA 2VJYA 3MBOA 1MC4A 4TV8F 2BFBA 3FFXA 3ELUA 5F78A 3R76A 4ZTZB 3RV3A 1NU6A 5JJIA 1WLSA 1E8DA 2HMYB 1C7EA 4FFVA 3H42B 2GH1A 1ZMBA 4MS1A 5TPZD 3ASVA 3IJPA 1L5HB 3ZHSA 4DDKA 3JR7A 1CETA 5AVVA 3NPMA 4WY2A 2FUNB 1D6SA 4FNMA 1T6YA 1T2UA 3N2IA 1UPXA 4G5RA 1NI4B 1S1CA 5KBYA 5LDGA 3JWPA 3FTFA 2QRUA 4QYWA 2YN0A 4I1PA 3CUEF 3KWJA 4CM8A 3S0JA 2LW7A 2NYRA 3A27A 3S1AA 1TRHA 3RC9A 1Z08A 1VJGA 4JGGA 3VOAA 4HEA6 4NS4A 5LYJF 1Y34E 5BUQA 2NVUA 6REQA 2DLNA 3FYSA 3F5MA 4C6RA 4CQMD 1Q19A 2ZROA 1RKBA 4YJ2B 3A9WA 4C76A 2H4ZA 1OY1A 1ZBQA 2R7AA 3P9IA 2QLTA 2E55A 4IXMA 1KZ1A 1WB4A 4G0ZA 4WCFC 4LYHA 3DFUA 5COQA 5H3HA 3SYLA 3VV2A 1M10A 1SUWA 2Q9BA 5K0FA 2Z2ZA 3EEOA 1P5FA 1Z4PX 1G8GA 2FMHA 4MPDA 4O4HB 1UJ4A 2R7LA 4L27A 4UPEA 5A6VA 4G5QA 3P97A 3U40A 4LA4A 1TZ2A 1H5UA 4QEKA 2ODBA 1JTFA 2IH2A 2X3UA 5BWOA 3KHTA 2YVUA 2VCHA 4P53A 1RRVA 1KEEB 1NPYA 2FN7A 2JI9A 2YY5A 1SD1A 3E70C 3JU3A 3QQ5A 4HGOA 4KSYA 3A28A 4H7DA 3T52A 4C78A 3HKEA 4DDMA 4P81A 4JR2A 2HGSA 1RCUA 1FS4A 2H1HA 4E32A 3KALA 3OU2A 1SXJC 5LU9A 2I66A 1GNTA 1BMTA 1MF7A 3E9DA 5HNKA 4E7OA 5DNUA 4W9NC 3KD3A 2TRSB 1I2AA 2YJ6A 5JNTA 1U80A 3JQAB 4I5DA 4UHDA 5SZHB 3C98A 1Z0KA 5BN4A 3BDVA 3D7NA 4LSZA 2AR7A 1L4FA 3JPWA 2F8TA 3SAJA 4XVHA 3FN4A 5AVWA 1KK0A 5KWJA 3IP3A 2AHRA 4QWMA 5EZYB 4ALKA 3NBZC 3B2QA 3FF1A 5LUAA 5GM2A 3REFA 4DLKA 3ZPXA 3IUSA 4K6GA 5E1DA 1V35A 1P60A 2GM5A 1J9EA 4H2DA 4JVLA 4AWXA 4BATA 4ZCMA 2FFBA 4MVJI 5I9BA 3HL4A 4G0VA 5CCDA 3TXXA 2P2CA 2KW5A 3ZHXA 1C4OA 3FCCA 4ZO7A 4P58A 4PAGA 3D0OA 3DVAA 4CI0B 2FMTA 2BEJA 2J3KA 2JGDA 4I4LA 3NHBA 5T5QA 1YKGA 2JI4A 2W90A 2DQ4A 2ZZKA 4BQOA 1TVKB 1NI4A 4JELA 3U4CA 3VSAA 1Z5UA 2ZT7A 5EMKA 1DRUA 2OWDA 2RKWA 3PTZA 2JFQA 3BE6A 4NOLA 5CTAA 4ACAA 3AESA 4CDMA 1U2ZA 3KFVA 1YU9A 4IIXA 3O1HB 4UREA 2QJWA 4MIEA 1EK0A 1WUIS 1LW6E 2AFHA 4PG4A 3SBOA 3GPIA 1XZIA 4A6DA 4I55A 3VA7A 1Z8NA 1H65A 2JGRA 4BECA 3CEHA 4J1TC 1E4OA 3I2YX 3PUVA 1YMUA 5EUQB 4BFUA 2FZ5A 3IALA 2EX0A 3OCWA 2WJ3A 4R6XA 3A36A 1QG0A 4UBOA 2IWHA 3V8PA 4IMIB 3NCHA 4MZXA 5GINE 1E2QA 1Z75A 1E2NA 4DIEA 3DMTA 2C5AA 4K9QA 3ONWA 4KQHA 1OWNA 3GI1A 4LG1A 4LYEA 1WO8A 2IYXA 4MROA 3Q5EA 1ZM3A 4ZV9A 1L5GB 3V9AA 4IRUB 1RI1A 3OIYA 1UT8A 3JQEA 4JOSA 3SYTA 2BP7A 3D4BA 1QFMA 4XX0B 4OO3A 5F9HA 1M1NA 1OZGA 2G4LA 1PG5A 2O23A 3OT5A 3GG2A 1IJBA 1XJCA 1R6XA 1XEWX 1ZINA 4CW7A 3QOYA 1QGYA 1BQ4A 5CNMA 5A71A 4ETWA 1X1EA 1JHOA 3ER8A 1RS0A 1VLVA 3ZE0B 1I1QB 3N0XA 2D4AA 2YJ4A 5DW3A 3QA9A 1T8WA 4A6XA 4YV0A 1SG9A 1NKVA 3SOPA 3IEKA 3QKTA 4NSNA 1N2OA 4WNYA 4BQSA 2XCSB 1J42A 1O0CA 1PJRA 4ZHQF 2BFMA 3U09A 3GJ5A 1PUXA 4OLHA 3ZCTA 1X7HA 1UFQA 4QU9A 1HE5A 4NMHA 1PZGA 2VATA 4UD6A 4W6ZA 3WLNA 3SDZA 3ZV7A 3GDGA 3I64A 4OHKA 1XZAA 3AB3A 4WZ6A 1DT5A 2BF4A 5KKCA 1WUTA 1RZRD 3UT0A 4ER5A 2AFIB 1S2OA 1WVMA 1E5TA 2E37A 1G98A 4YC7A 5GZ6A 3TW4A 3B13B 3LWZA 2O0LA 1NP6A 3B8HA 4UHHA 5LDHA 4EL5A 4AXXA 3LPLA 3OF3A 4G5FA 1DAIA 4X95A 1TQ6A 4O2BB 4RHUA 4RD0A 1ZAYA 1AKUA 1XVVA 3DVAB 5JCJA 1U0BB 2Y6UA 1M72A 4XGRA 2OE2A 3TNFA 1Q7RA 3ZIAD 1EM8B 3WSTA 4JFRA 3C3XA 2B2NA 1NJ1A 4Q7MB 2N1BA 1XL1A 5EZQA 3ZGXA 5JAIA 2FEPA 3N1UA 1WV1A 2QL5A 1AK2A 1U28A 5CH3A 4NOMA 4CT0A 3U48A 1G8FA 4D3FA 4R51A 3DBLB 5T4EA 2C98A 1SAYA 4N0EA 5AK3A 2KBFA 1IN4A 5HBRA 2AIRA 3EIQA 5B3AA 4EB6B 3CB2A 3AEZA 2OM6A 1X1SA 2ID7A 3L5OA 4LPSA 4DS3A 1MC5A 1FU4A 4KPUB 5GZ3A 1ML4A 1VPEA 1JLLB 3D64A 3WHPA 5LQRA 4IHJB 3IEIA 4MKXA 4CIBA 1LRLA 3Q10A 2PNFA 4P3KA 4WXHA 5D6NA 1MR3F 4CU5A 5JTUA 1NASA 5ALUA 2YW9A 1E63A 3M82A 2QQ5A 5CHYA 2HWXA 4Q1BA 3T3NA 4CCWA 4RDXA 3COVA 4HN2A 4HXEB 2BHNA 3VVLA 1KEZA 3DNPA 3LZCA 7MHTA 1KZ6A 4JA2A 1MV5A 4KVAA 4HLUA 3T41A 4EPVA 3AP1A 4XRGA 5JRJA 2C4TA 3DE2X 4LUCA 2VDOB 4IJ5A 2NOAA 3D3WA 4PQYA 2JCSA 3RNLA 5BVGA 2GNPA 1T35A 4GRAA 1F8FA 3H16A 3LXXA 5BW8A 5JMWA 3PEWA 1HQKA 1I24A 1G6KA 1V4BA 3D2CA 4DM4A 1PTKA 3QHAA 4BMSA 2FXVA 2ZI5A 2D5LA 1R8YA 2BE9A 1E2BA 1FOEB 4KE9A 2AG8A 3MGKA 4NBKA 1XPJA 2WKQA 1ZGHA 2VR1A 4PGAA 3RM3A 3FLEA 4NXNB 3S7TA 2I2DA 4YP1A 1J0XO 4R98A 4MQBA 4YJDA 3VOTA 2OGUA 1Q7BA 1QVZA 3CKKA 3ORQA 4BLRA 5G0SA 2KJQA 2CXUA 4ZANA 4R0VA 4XIFA 1OLXB 4KIJA 4D44A 5KTRA 3ENZA 3L8MA 3MWFA 5K03A 4YAJA 2VT2A 2D0DA 2PYZA 3D7SA 4FCTA 1NFRA 5JNVA 2H8GA 4LV8B 1WW8A 4RM3A 2DPXA 3CZRA 1VA4A 1TA4A 2EWVA 3GEHA 4ZVOA 1M7HA 4AO8A 5DT2A 4MO2A 3HPQA 1J2RA 4PPYA 5FJIA 2WKSA 5I51A 4GWLA 1N7IA 3LUFA 4ITRC 5CD9A 5FRDA 5K3OA 4N9QA 4V03A 2W22A 1ZOLA 1IY8A 1PLKA 3UMRA 4KXNA 7REQA 3NWPA 4RH0A 1Y3AA 4WJZA 4IDHA 2WC1A 1GEEA 4F7WA 5EIHA 3TQFA 5BUSA 1VI6A 4QHSA 1LBTA 2QPTA 1XWFA 2SKEA 4HYEA 4L28A 3I28A 3UJNA 4R9SA 3MHTA 1XWIA 1KYTA 3WNQA 1YC5A 3H17A 3UYKA 4ZIRA 1KAEA 2Q1SA 3OJCA 5JU6A 2HSDA 5DMXA 3AEKA 5EJ2A 4NL4H 1YXMA 2Q50A 1MW9X 1NF9A 4C4PA 1EZ4A 1F12A 1Z35A 2ERCA 4GKVA 2ZRHA 3IBSA 3WL3A 4NZNA 1IG3A 5A9TA 1N2EA 4D26A 4GYKA 4NHEA 4CQLA 5GJBA 4FN4A 2H31A 2IYEA 3T15A 3STXA 2QUKA 2G71A 4OM8A 4DJJA 1Y33E 2HCBA 3R7LA 1AUOA 2J3QA 1QVWA 3GFFA 4ND2A 4KR9A 4YK7A 3X1WA 1MRZA 3GFRA 2GHIA 2JH8A 1J23A 2E18A 4LMRA 3GPCA 5IT0A 1JR4A 3EH2A 1P1BA 2OB2A 2H8KA 4LZNA 4W5WA 2AF4C 1LF5A 3ZZMA 3FZNA 2O8FB 1Y5NA 2PFKA 1MC8A 3FY4A 3N58A 1SVLA 4H3SA 3VZSA 3U1BA 2JD1A 1LZLA 3ESAA 4DC9A 3GLTA 2XNCA 2RHWA 1J49A 1EFLA 1Y89A 3DV0A 2ZWIA 2AA3A 2WUVA 5B3JA 3D0RA 4GGPA 1BEZA 4MB2A 4GRDA 4HLNA 4Q21A 2NYUA 2ZRPA 5CDUA 1Y3CE 3FIJA 4XIYA 3N9IA 1UZLA 5CFLA 1SIBE 2JGDB 4XYEA 4L08A 1J7JA 2I4TA 6NULA 2R7NA 1U31A 3LC0A 3ZNOA 4LJSA 5BN5A 4IIFA 4XSHA 1PX2A 1U7PA 2HY7A 5HJEA 1E7SA 1FX0A 1O77A 1V37A 1PNOA 3HBAA 3UA4A 1NAIA 5F1YA 2IY9A 1G41A 1BE8A 1ODSA 3P96A 1OFUX 3VU1A 4E5NA 1YBAA 1ABFA 1A7AA 4M87A 5D51S 1J70A 1SIUA 3SY8A 2OAQ1 5ALYA 4D96A 4LZJA 3TCKA 4C6TB 3CPEA 2P2NA 2E89A 4MHTA 2OORC 5GPBA 1NPTO 1Y4DE 2FQQA 1V9LA 3PZBA 4PSCA 3RQIA 4D0NA 3U4DA 3AV3A 5HJ7A 2EEPA 9GPBA 2R97A 2E4YA 2PZFA 3H0CA 3JQFA 4NNJA 1YFLA 4RS4A 2UV8A 2WKRA 3KVOA 3ROMA 3V33A 3I73A 1QO7A 2AZTA 1W6UA 4M9SA 1O95A 3KWLA 2H52A 3UWMA 5HKBA 2I78A 3FCAA 3M5WA 4XWTA 3C45A 3RJ9A 5LXTB 1I01A 3UICA 5FUQA 5JDIA 2EKLA 5KS2A 1YOVA 2GBLC 4HG2A 2FKAA 1Y1LA 3VHRA 4HJRA 1MORA 4CEJA 1X94A 2EWWA 2GRJA 2Y76A 3EQ9A 1K8QA 2H5JA 3H86A 2XRZA 2PGJA 1GG8A 2CMKA 2HQRA 2H0RA 1HC7A 3HU5A 4Q7KA 5C8YF 2O2DA 1KSFX 1N7HA 2DSNA 1X7XA 4TV9F 3U13A 4REQB 3VR6H 1A9RA 2QMQA 3VYWA 1RRKA 3T7TA 4RC9A 1M2JA 2OEPA 3FUWA 4ITVA 4R01A 3QM1A 2R6GA 4TWJA 1O89A 5JFGA 3I01M 5CHEA 4D6XA 2XHEA 2CNBA 2BZ1A 1EHIA 3IPYA 4YCJA 1XDWA 5T8KA 1SCIA 5JRDS 3RTGA 3NVKI 3GJZA 4P4NA 3HYNA 1JSZA 1NWCA 4B3HA 1U90A 2R7MA 3JYLA 1MZPA 4WESA 1SC1A 1JG7A 1G20A 4GZ3A 1QC5A 2G0AA 2YWBA 3N39C 1W30A 2C29D 3AEYA 1DG1G 5DSZA 5J63A 5AOAA 4BYMA 2WAYA 3QUTA 1FP1D 4GE0A 5DXFA 2BGRA 1XKTA 1VKZA 5A0FA 3CF4A 3GP3A 4WXPA 4R4JA 4B4KA 4KR6A 2EW2A 1FRQA 4C1BA 5A4JA 1KOGA 1DLIA 1ZMOA 2WWTA 2QVYX 5DMHA 5E9WA 3TDNA 2CLHB 4RHCA 4WH0A 3PEYA 1LRKA 2IKSA 4Y6PA 2G0TA 1ZRSA 1DU4A 2DPLA 2GBLA 2MTBA 2MSNA 1K88A 1EFHA 5E4JA 5HFAA 5I47A 4FR5A 4YCCA 4RVSA 4B7ZA 2WUWE 3DVQX 4WA7A 1M0EA 3RBVA 1DV1A 1DEOA 1UT5A 2AMJA 3GUHA 1SOAA 2D3WA 2O50A 3N0RA 1ONOA 3OQIA 4RZUA 1K27A 3LK6A 1TF7A 4IEIA 4U8GA 4QTYA 1FFCA 3EVFA 4QXQA 5B58T 2PMKA 3NAGA 1YRYE 1DNPA 3BWBA 2G83A 1G7SA 3K1AB 3AFGA 3M9WA 4BVBA 3D2AA 1N6LA 3H5WA 4DCNA 1OTHA 3B51X 4WADA 3C3DA 5EJIA 2DHRA 2HNKA 2VZ8A 1W2GA 2FPPA 4U9HS 3QVJA 4Z0TA 1VIMA 3CX8A 3GD5A 2VT3A 4Q19A 4PHGA 4UUBA 5DGDA 4HZUB 2R8XA 4ZQHA 5FNZA 3BT7A 3FBTA 4UXHA 5IF3A 1F6DA 2DFPA 2JHGA 3ZHCA 4AROA 2PPLA 1ZH6A 2R6DA 3OQIB 3SZGA 1J90A 4U02A 1E69A 3OEHA 1RQXA 1NOIA 2LIVA 2WFMA 3ANLA 3DV0B 4RVDA 4UAJA 1MOSA 2JK1A 3NOQA 2W8BA 1U8FO 3IQHX 1X7YB 2XMPA 4H0NA 1CR2A 4EW1A 2WWYA 3HB7A 5F4BA 3JTMA 1Z18A 5AKJA 4ZC8A 3VUFA 2C2GA 2GPJA 1GN9A 1IEVA 4PCVA 4MPJA 4DNQA 4LV6A 4W5QA 3NMUF 2OD7A 3PIDA 4B4OA 1WCWA 2AN4A 2VSQA 4IPTA 1O9BA 4BUZA 5AW9A 5DLEA 1M0SA 4C43A 1Y5IA 3IEXA 1W5BA 5C46F 4ZDJA 1V16B 4MARA 5IABA 1FLVA 2AMVA 4B2LA 4RA9A 4TRJA 5C1PA 1PWEA 3DZFA 2OBBA 1VIAA 3BC1A 5JR3A 1W0CA 3M6VA 4RPKA 3A2NA 1B0AA 2ZULA 2O4CA 1UXKA 1AXGA 1SC3A 2WD8A 2ZU6A 4IWYA 5FPPA 3V8RA 1DWOA 3GP5A 1RKVA 3X1DA 3ZK7A 3IDSA 3VPSA 5HQJA 2RAUA 4C0KA 4CCSA 5B57C 1H0KA 3ISVA 5LMUB 1J8YF 3VSEA 4IVQA 2ISSD 3F6EX 3TRJA 5HRCA 4ND8B 2Q5JA 4LC0A 4ZPXA 3KLMX 1JJBA 2WVAA 4I6GA 4QVIA 2AJDA 1H2YA 1XZGA 2GF2A 1GCGA 1W5FA 1W25A 1QRDA 3KV1A 3MRVA 5JEDA 3GY0A 2J5QA 1OREA 2A1TR 1NVGA 1CNFA 2P5SA 3M3PA 3FMGA 3O4RA 1T26A 1Y3DE 2O14A 2QN1A 1YMVA 3IV6A 4G1UC 3OZBA 2IVFA 3V34A 3FFBA 5EHZA 1XTJA 1GUZA 4X1YB 5C18A 5JYEA 2TSYB 5CH5A 1B8PA 1PUIA 3S68A 1BO6A 2OKGA 3KKMA 4Z0HO 1HOTA 2ES4A 4DADA 4OF4A 3AU9A 3TGLA 3HXMA 4UEOA 1WVGA 2C5GA 2Z95A 4LJLA 2WWHA 4ARZA 4OK5A 2Q5HA 3BMOA 2R4TA 2V9ZA 3AR3A 3DQQA 1DUSA 3EA5A 4HNAA 2XIQA 4MW7A 1PZMA 2IHBA 1F51E 4KZPA 4MV3A 3WGLA 3L1HA 2IHNA 2WF7A 2Y77A 3PUWA 3IEPA 1EFTA 1OBVA 1X9IA 3R6LA 4IIGA 3TAUA 4CV2A 4EZBA 1GPBA 4Y2GA 2G09A 4JCOA 2X1HA 2XRYA 4WK2B 1I7PA 1ZN8A 1HE2A 2O6HA 2VJQA 4W5TA 3FPSA 3NM4A 4TLBA 3RVMA 4PYQA 3EOBI 2Q5LA 1KYVA 1RBYA 2NUAB 5FDFA 4GX0A 2I03A 4PC7A 4DTIA 4COOA 1JWAB 1SRQA 2X0EA 1QOPB 3EDRA 1D6MA 3ZTTA 2QLNA 3OP1A 1AJEA 5AW7A 3DLIA 3GZNB 2RG7A 4I1IA 4TV9B 1T5TA 1P5HA 4AICA 3IUQA 1MB0A 3FNFA 3OD5A 4K6OA 1QTQA 2R5FA 4ZXPA 4NBTA 3RGWS 2ZKIA 3I2JA 3T1YB 1FRVA 5CDFE 1C3EA 4CQJA 4NICA 1EQAA 3OOHA 4PWYA 4Q18A 1I4DD 4PZ9A 1Z5VA 2H1CA 3KLOA 3QWFA 1PV1A 5D8DA 3QKRA 1A8IA 2VZ0A 4GLLA 1UXHA 5FYDA 1F0NA 4HAOA 4EK9A 1XIVA 4L3VA 1U3FA 2Q3DA 4KQ9A 4MI9A 1HKHA 1Z12A 4GC9A 4ZZ1A 3IT3A 1NXPA 1ZJ4A 1IM2A 2FLWA 5EJ4A 1CY6A 1I2BA 2HMSA 4LZWA 4Q5IA 3PLRA 4RADA 4B73A 2XKKA 2ZRGA 5FUXA 3OCVA 2NLOA 3UUEA 1SK9A 3PGXA 1XQYA 1FFAA 2QGZA 4R8RA 2PQMA 3GGOA 3M1LA 4I1RA 4X63A 2ZJOA 3ADOA 3DOJA 3P2IA 1RHJA 5EUBA 5J47A 4ZQEA 4DNOA 2HK7A 2ZWAA 1I3LA 4Y0VA 3QWAA 1YKSA 5AUNB 1THZA 1MB9A 2CF6A 1UPAA 3OWHA 4I81A 1A9OA 2ZJ6A 2R9VA 3EXEB 4R5HA 5CVCA 1AKYA 1AXEA 4ZGGA 1VRCA 4MW0A 1LC3A 2E3JA 2IYZA 3ZJYA 2OG1A 4FNGA 3QHPA 2WB2A 4BUCA 5I7AA 1DO0A 2GEKA 4MQFB 3OKCA 4URFA 4X93A 3WJ2A 1VLJA 4QRDA 5ADUS 8OHMA 2OBFA 1AB6A 3CZAA 1E6MA 1OLUB 2QX4A 2P1RA 3BMOB 1XRJA 2KLBA 5EIBD 5HFNA 1WHTA 2E1RA 2LDBA 4BJ6A 1GQSA 1O0SA 2Q4OA 3P8ZA 2BGGA 1AQNA 2CHVA 1J22A 4D46A 4JC8A 4UM7A 1Z26A 2JATA 3T5MA 5KOHB 3OMLA 1N5OX 1SQ6A 3PICA 3KR1A 5KNDD 3OF5A 4MLDA 4ZOLA 5E1OA 5KVCA 3JQBA 5L51A 4S05A 4TLCA 2PH1A 1WDWB 3GLHA 2H2GA 1KKLA 2H4XA 4KIUA 4X6UA 5ICSA 3LUBA 3NIGB 1M6VA 5FBZA 2Q5IA 2XB2A 4IP0A 2DVMA 2QZ4A 2ZIAA 3FSGA 1KRXA 2CZGA 3KKKA 4BKRA 3F6YA 1YE5A 3UFXB 2GVZC 1EUZA 1LY1A 1OZFA 2FWRA 2FGJA 3AF0A 4HFJA 4Q3AA 4TXJA 4BGVA 4EJ2A 1P7CA 5EPEA 1CPYA 2AE1A 3O3MB 4PZUA 5FADA 2C4NA 3VO8A 1NTRA 1Y6JA 2J07A 2CMGA 2WT9A 1U2QA 4YAOA 3BIWA 4N8SA 2W0SA 4AP5A 2CDCA 3FNRA 1OI4A 4PY2A 5HP4A 3USES 1Z45A 1AC5A 1KI7A 1NVKA 5HZHA 1DSSG 3LIPA 1XI2A 1BDMA 2J3MA 3RSGA 1XAHA 1SUAA 2Q2VA 3K3PA 3KB8A 3O4GA 4PO9A 4F0JA 5CMLA 3I62A 2DFVA 4Y6OA 1GKUB 1HYHA 1KH2A 4YHHB 3VC2A 3AR6A 3VMFA 4NKRA 1RJWA 4D74A 4YB8A 4DMRA 3HXQA 5AO9A 4BQNA 2BEWA 4D0LB 3LECA 4MTCA 3GGGA 2J33A 2PAAA 4INAA 4N6OA 5SZKB 4OXKA 2OBLA 5JSZA 5TJ9A 5LXTA 1ZM2A 4BO0A 1O5IA 4MHSA 4B32A 2GA9A 3H11A 4EOGA 2O7NA 2BBTA 3H4MA 3E1SA 5J9FA 4KK3A 3UKOA 3B1XA 4MQ4A 2OUIA 1WZCA 2BCEA 2RGCA 4ZVNA 4Y9UA 2YMLA 4I9UA 2RJ3A 1T3ZA 3LDFA 2VK2A 3QMPA 5JWRA 1EEXB 2WM3A 4XD7D 1HZZA 3KXPA 5TF4A 3RBXA 2IOYA 3SF8B 1DCFA 1UWLA 1ZIDA 5BV2P 2ZPUA 5EA2A 3S1LA 4G0PA 3MD9A 1DJNA 1T8PA 3BHNA 4M76B 3OZXA 3VR3D 3CF2A 1DAPA 1MENA 1RMTA 2ZYGA 4P35A 4YQEA 3RJZA 5ALWA 1SA0B 2H2FA 2WIDA 2LKCA 4K9OA 1ITZA 1JIUA 1NYLA 3GXOA 1O6CA 1YQ9A 2I7CA 1JWBB 2HHLA 3E7PA 4F2PA 2X23A 4RA9B 3IAM1 3L8FA 3JATB 2WM8A 3HO8A 4BFTA 1KDOA 3ZJVA 1YRBA 4A0SA 4NDZA 2Q2QA 1W4BA 5E7QA 4I99A 1AUQA 2Q3EA 5J2TA 4ML3A 4CF7A 1CUGA 2YZNA 1KERA 4R69A 2IL1A 2PGLA 3HZZA 1BS1A 3G2OA 4TKMA 2VC2B 3CEMA 2AD1A 4KO4S 1DRVA 1RP1A 4L15A 1Z22A 4OAOA 2CZCA 4UEQA 2ONKA 3T34A 3EF0A 2REXB 5DK4A 2REBA 3IE2A 1B26A 1FDUA 3K8QA 1JFSA 2C82A 5EYPB 1E1MA 1O08A 2BOVA 1SCBA 3UQZA 5DHUA 1EFRD 3FMVA 3N6XA 2EX4A 4PC1A 3VR6D 1USVA 1UJCA 1TZCA 3OTWA 1XUOA 4M8IA 2AQ8A 1QTNA 1C4WA 1Q5PA 3PXXA 2NU8A 2XXAA 4DPKA 1U2GC 5AWFC 1NNLA 2P9HA 4CQMA 5JNRA 1KXZA 3VYTB 2I33A 5CAEA 1PZNA 2COUA 4B40A 3R40A 4BRUA 2CL5A 2CLOB 1C9YA 1G63A 1W1IA 2QN7A 3RK1A 2AZ4A 4HFRA 1WBBA 1FUYB 3KR2A 1P39A 1E94E 2Q29A 1SZCA 2WEKA 4B3JA 4Y8VA 4F5DA 1DRWA 2VYFA 2XMCA 3D02A 4WOJA 1CZKA 4WBNA 1Q17A 1FMCA 3LXUX 2AEJA 4RD2A 1ETHA 2QG6A 2B1QA 3OM8A 4IHAA 4C06A 4DCUA 1LTHR 1TU3A 3FPLA 3LFUA 3GLKA 2ZSKA 3H11B 4KGZA 2G8NA 2W6OA 4B6EA 2VP5A 2JDID 1C3VA 4RY2A 1CY7A 1KF0A 4M9XA 4EYKA 2O3TA 5KX5B 3TVYA 2I6GA 1X15A 1KMNA 2HJRA 1M0WA 2FR1A 3O91A 4XM0A 1U5BB 2PZAA 4B84A 4WNIA 3KELA 5K0TA 4FSDA 2VCYA 3B6EA 2IHVA 5B12A 2XX3A 1ODLA 3I45A 3L6UA 2IYLD 2O8BA 1PT9A 3MK31 4BKOA 5KHOC 1YVPA 4DA0A 3DMGA 1UBJS 4B3MB 2B4KA 2EX1A 2WSSA 3P2KA 1JEOA 3AGQA 4LBVA 3OOSA 2E6UX 3G5MA 3MWKA 2Y9PB 1K98A 2QYHA 2YWRA 3ZWOA 3ZC3A 1IXRC 2EJUA 1UOEA 1X77A 1TIPA 1UCFA 1UC9A 2Q41A 1QGDA 3AI1A 2I2BA 1UINA 3BKWA 3H8JA 3AUFA 3R5TA 1N7JA 3U3OA 2H11A 3Q1LA 1SVKA 4QQNA 3UV6A 1KDYA 4KRGA 4EAQA 1VCIA 1THGA 3D3WB 3INNA 3P4XA 4KFRA 4DDHA 5JO0A 1PFVA 2D2IA 3KEGA 2C54A 1U0NA 4XTRA 5DX8A 3VZDA 4BL5A 4Q9DA 2FW1A 4UULA 2AJCA 2R11A 1DO8A 4ISCA 3VHQA 1K2VN 1KOJA 4QD3A 3U7EB 1KZHA 3MGCA 2QQ0A 2NO9A 1AZLA 1T1EA 1A9QA 3FVRA 2XUZA 3SEQA 5E9AA 4G4IA 5EVJA 3E81A 4PRKA 1T8SA 2VLBA 1OR8A 3H2BA 2WILA 4GLFA 4ESOA 1ADBA 1TPYA 4M0CA 2ZJAA 4MVJD 4C04A 3ODGA 2A58A 4F97A 5EKSA 5J23A 3JAMA 3QVKA 1NJ5A 2O2HA 4W9NA 1Q0RA 1RXUA 1NN1A 3O38A 3B89A 1TT5A 5IG2A 1II0A 2WTBA 3L0DA 5K4AA 3Q9UA 3RS8A 1W19A 4LQCA 3GA0A 1KZ7B 3A1VA 4UBMA 4F3NA 4BY9E 4XYGA 4MMYB 4E14A 2HJVA 2QPAA 4ZJPA 3KL2A 5JLAA 3JQGB 4FW8A 3H7AA 4P4TA 2GTIA 4N4AA 2H4WA 1F3OA 2JAOA 4MVXA 2QWXA 4YACA 5I4KA 2IF2A 1HX7A 2H7YA 1TVMA 2IXAA 2W4IA 4UCQA 3L7YA 5EPUA 3TPFA 3UAVA 5DHSA 3UPDA 2VYVD 5C1OA 5B3LA 4DQVA 3GT3A 2ZKLA 2CJYA 1B74A 2WVHA 4RSHA 5FFFA 5ECWA 3TKAA 5ESXA 3JSXA 1FS5A 3I3SR 1N6KA 3TL3A 3WRYA 1T0JB 4YHBA 1IJEA 3EC2A 3VYSB 2JIPA 4IZIA 1UODA 3T9FA 3SQWA 2IP1A 3MHPA 4GBJA 4BO2A 5KCMA 3ELWA 2BJVA 1A97A 4DMHA 1TJPB 1RI5A 1P2FA 4AJKA 2FN3A 4MZDA 4YMGA 2QJTA 3A9VA 5JJCA 2R79A 2YDYA 1U1GA 4NNPA 2Q99A 3KYJB 1FQWA 1CR0A 1FW8A 2RGGA 2O8EB 4IFBA 3A32A 3BRQA 1JDPA 4MSUA 3RJMA 1E5DA 1FP4A 1N6IA 5BV0A 1ADFA 2JVJA 3HZOA 4Q3KA 1L3CA 3WWEA 4J6EA 3T9BA 1GPMA 2GEUA 3MD0A 1U0JA 2I1WA 3C3WA 4B3IA 1X80A 3EVNA 4GZLA 3JWEA 2Z6QA 4LRSB 1FFXB 4JIMA 4NCHA 4P0QB 2FZVA 1PGPA 3DEYX 3KCNA 2QR2A 3DNMA 1WSWA 3D4IA 2VTDA 2YNMA 2P9EA 4US1R 1LSSA 1N5DA 2DF8A 1YZ3A 3IIMA 3SEAA 4FEAA 1UBSB 2B25A 5JUWA 5F77A 1M34E 2HREA 2NYAA 2YIMA 5KYYB 3OE5A 2J85A 3KYIB 5F2NA 1JIXA 2E87A 4RV4A 2PUBA 3CO5A 4CTKA 3M6UA 1LDMA 1TL7C 1DC3A 3BE4A 3ZWCA 2FN4A 4CZ2A 2JLVA 1DBIA 2J0EA 3PKIA 4H15A 4QIHA 1E1RD 1LTKA 2QUAA 4FB5A 4KFCA 3UGTA 1BHSA 4MYCA 5HMLA 1YONA 4P38A 3HL0A 3D8RA 3BD8A 2EJWA 4RVNA 1Z2AA 2O8BB 2H57A 3ZHUA 1RJFA 3WXMA 2HAEA 5EZ6B 1DWUA 4I66A 4MJ7A 2OD9A 3ZWBA 4F3RA 1ZXLA 1QFXA 3MSCA 1UMKA 2G72A 3MWLA 4G1CA 3UG7A 2FE4A 3ANTA 1H2AS 3RVKA 2H5IA 4AJNA 2G88A 3EAGA 2CNDA 4AZTA 5KSYA 3TM4A 4IHJF 3PA8A 4LRWA 3KFXA 3FVQA 1ZGZA 5IT4A 1E0AA 2IDZA 2Y2VA 1GTG1 4BLVA 4ZP1A 3SIWA 3EIEA 4FOSA 4UASA 5EVCA 5F7JA 4D8YA 3SOZA 5KZMB 1L5OA 1F5NA 3AYZB 3HI4A 3ZD8A 1L5NA 3G1UA 2RKOA 3EZ2A 3RS4A 1NXQA 2DJIA 2Y1GA 3B52X 3KT6A 3LDUA 1M1YB 4NMLA 1DELA 2OORA 5HZGA 4EKIA 1DV2A 4HMPA 3JALB 3IKLA 3P9QA 1TDJA 4UXJA 4ND8A 4Y2TA 3VGPA 2EFEB 4ENUA 2HJGA 1ZCZA 3PQEA 5C2JB 1Y9EA 1UXOA 4C7OB 3I8XA 5E6SB 1CUDA 1EGHA 1U1DA 1Z82A 4FHCA 4F5YA 1AIPA 2XY4A 4TTTS 1WDTA 5HJ5A 5BYKA 1C8LA 1OFGA 3FETA 4GOND 4YI5A 1E1RA 4O2BA 4XWAA 5B2EA 2J9RA 3W5DA 2I4RA 2XUGA 1ADGA 3B20A 4OU4A 4W7IA 3DHVA 3CZ4A 2ROQA 3L5KA 4IJKA 4DIOA 5EIBC 3GAZA 3STUA 4EW2A 4YR9A 1TLTA 1PK9A 1VG1A 3HHEA 1RJDA 2Z2JA 2C04A 3Q7QA 4RXMA 1KIFA 3ET5A 5DWVA 5H1YA 3SG0A 3CG4A 4ZKDA 4F12A 4EELA 3I9LA 2Y4OA 3B2NA 1KI3A 1K75A 5E4FA 5GQSA 4JMPA 4QBHA 2UAGA 1UADA 3DONA 3G3EA 3Q2KA 3RYHA 1Z68A 2I1QA 2V7QA 4OAPA 1XMOB 1XZ8A 1W48A 3BTVA 4JBWA 1P4HA 1CLEA 4TXHA 1MX1A 4BLUA 1PJ2A 3AOEA 4PM4A 2Q7OE 3RKSA 3C6KA 2NPOA 2XRMA 2XJ9A 2X1VA 5EXTA 2BM9A 1XYGA 2GFQA 3C15C 3M6LA 5LQUA 2ZGVA 3EVEA 1CERA 4G67A 1QHIA 2CUTA 3VV3A 2C2BA 1UEXC 2V8OA 3W2TA 5L3ZA 5FR1A 3IMCA 4KQXA 3I6IA 3S3TA 1KFJB 4ZMBA 2PS9A 3UHOA 2FLKA 3EW7A 4EVSA 3D0QA 5TVKA 1XQXA 3A7DA 2PUEA 3UANA 4N7MA 2IVZA 1KO1A 3R3JA 5FULA 1I14A 1QTIA 1RLUA 4D25A 4BRSA 3JXEA 1K92A 4JJ7A 2N3ZA 3K1AA 2B61A 3UC9A 3BD7A 1S2IA 5EFZA 1LDYA 4TM7A 5H9VA 4B4WA 5AJYA 3MJHA 1QU2A 3CLTC 1U8ZA 1P2TA 1T9ZA 2I99A 3TVTA 4AZSA 1FFSA 1GUFA 2ACKA 3BWEA 4YAEA 5EJFA 4G0NA 2X1LA 4DR7B 4CNQA 1EWTA 2FW6A 1W0JD 1DRJA 1I80A 1DIRA 2O2XA 2PZJA 2XUQA 3UWDA 2H5LA 4HDSB 4AY3A 5C8VA 1JMVA 1JEDA 1SCDA 2J3JA 1JG3A 1O7JA 2VYNA 4FDAA 4IIHA 1GV0A 3LL4A 3CSUA 5F1OA 3OU7A 4M36A 1NBMD 3C8DA 4EGSA 5C81A 1SCKA 2W2PA 4PG5A 4UM9D 4B46A 3FZQA 4E70A 2XDAA 4B2YA 5CA1B 4NCXA 4K26A 2BRUA 1CQWA 3V48A 4PVDA 4WESB 5LQJA 1LJ8A 2GRUA 4L8GA 2GHTA 2N47A 3CSDA 2GR9A 4P7KA 4RHEA 3RC2A 3JARB 4FP9A 2I3GA 5HCIA 2A1IA 4Y0NA 1DX9A 3N2KB 1N77A 1DE0A 3UG6A 5DULA 3RAFC 1O4WA 5E7MA 5G4KB 1RHQA 2G63A 3GBPA 4F91B 5C5EA 1V3QE 4RZQA 2ZWMA 3NHYA 3F7NA 1BOOA 3DMPA 3A05A 2UYCA 4QOEA 1Q91A 3ADKA 4QC2A 1IXYA 2V5VA 3C5EA 1PL7A 3QNUA 2ICAA 1OIVA 4EYQA 1RQPA 1NYQA 4F04A 3HJTA 1T2VA 3JQ7B 3NC0C 3PC7A 4PWZA 3C5CA 3B78A 4Z4CA 4PC2A 5BUCA 2WAOA 2VI5A 3PT5A 4REQA 4KDCA 1VIDA 3JQGA 1GPKA 1MABA 3NP7A 2QRVA 2IWRA 4B31A 1MA3A 2GKSA 1NP7A 1CUCA 2PS1A 3DAHA 4Y2RA 5TXGA 3GLGB 2VP6A 1LDGA 2VSOA 2QTFA 1R9JA 5IAOA 3V8VA 2A9PA 4KVFA 3KJNA 1XDDA 3KT3A 4P0PB 2R6ZA 4YUVA 3KYCA 4FONA 4LVCA 3OJXA 4YFVA 1NXWA 2Z4RA 3IOMA 3FPEA 3AETA 1ISPA 2QN9A 3AIIA 3EASA 1KYWA 1F2TA 3OM9A 3FM9A 1Z34A 1Q95A 2FUG1 4IIEA 4MYRA 5AKLA 2HA3A 5UKDA 4CKEA 4MEAA 5E6SA 4ZVRA 2ZR9A 1SVNA 2B1JA 3BGVA 4MVJF 2EAUA 3A9TA 3PLNA 1MQ9A 1ZSYA 2WWIA 1A7UA 3D7LA 1KI6A 2FFRA 5KUTA 3TTYA 4MS3B 2Y1KA 3ERCA 1HBJA 1JSCA 5IZCA 2NUTA 4DMCA 2WTXA 4ZZ0A 1GPNA 5EQTA 3PX3A 2LKDA 4IDOA 4RTMA 1OLSB 1YQUA 3ZZ0A 2QSYA 2M6RA 1VHWA 2D1RA 2DX7A 1B1AA 1FTYA 1RABA 3SJ7A 4YIHA 1JTVA 3NH6A 3GLFA 1J4AA 3KKLA 4ALIA 1QZ3A 2WUGA 1KP3A 2PLNA 2ZRMA 4MR7B 4PTLA 1KHTA 4UEWA 2FW8A 3JY6A 3OOYA 1C0PA 1OU4A 4ZI3A 1ZD3A 2Z8YA 3EWIA 4IUBS 1PK8A 4QGAA 5E8RA 2DFLA 4BWFB 2D5AA 2OHOA 5DWQA 1U5BA 3W9UA 2F4VB 4IY1A 5ALXA 3DYVA 2O3JA 3ZOKA 2WU1A 5CIYA 2O0JA 1IY9A 4HADA 5AVSA 4FTWA 3A10A 4U0KA 4IRMA 4H1TA 1VCHA 2I7XA 2O2IA 2IPOA 3VR6A 3WXBA 3DZGA 3H04A 2FE1A 1Y7TA 5LLTA 3G2MA 3DE6X 2EP5A 1VG9B 2FG6C 4GI7A 3GCDA 3O2JA 2A0FA 2W42A 1B8NA 3PHCA 2MT9A 2XAAA 2HRDA 2H1SA 1KE1A 4JU9A 5AW1A 2KB0A 5M5BA 1BDBA 3G1WA 1GT91 1OLOA 2WFAA 3TQTA 1I36A 2WBLC 1JDTA 1ULZA 2R1VA 1XZMA 4JR0A 3G2HA 5B7PA 3A4YA 4TL9A 4OAQA 1QDLB 3ICCA 2C0PA 1GNLA 4N49A 4MRPA 4Q7LA 3WBBA 1XZJA 2E0IA 2EJTA 1NSYA 4HGYA 2ZS9A 2G08A 2YJTD 3BQNB 3SKYA 1DO2A 1RXYA 1ZL0A 2OHXA 1XR3A 1O6BA 3F8TA 3NHMA 4G07A 4RGYA 4RQBA 1Z2PX 3HJCA 4TQ9A 5ESWA 5HJ2A 3R6GA 5EHGA 1Y4SA 4KIWA 1WY5A 1K1EA 2CY0A 3QUSA 2FWNA 3G2JA 1FFWA 2C92A 3FB4A 3NTQA 3T1HB 3DTNA 4O33A 4KQFA 1LWNA 3NFYA 4PTZA 3Q7IA 4L8VA 4PSAA 5AKEA 4DLRA 2BY4A 1JSRA 1OW3B 2ZI4A 1WAMA 3QNWA 5FTMA 1E5XA 3IMKA 3EZFA 4WACA 6Q21A 1PKXA 1H2WA 2BFBB 4JUIA 4Q6BA 5BR1A 2PS0A 5I9NA 1KMHA 2XLBA 4HQ6A 2DWOA 1J8MF 2XYGA 3HZRA 3RYFB 3ROTA 1N32B 1HZZC 1U6KA 2EARA 2XTAA 3KOXA 3N70A 1RJGA 3SC4A 4DLPA 3S1SA 4XDHA 1GFWA 2O1WA 4OBBA 3KKZA 1MU0A 3AJ9A 1Z2EA 2B4YA 3H3JA 5JFOA 3CZ9A 3QVSA 5DM70 1RQGA 2ZW9A 3AYXB 4HDKB 4K2AA 5EMLA 4CF3A 2QT9A 5JD6A 1DKMA 1N2ZA 2UZ0A 3EULA 3N74A 3RG8A 4PCLA 3SYNA 2XZOA 1DWPA 1OJ7A 4GWGA 1ECFA 2VXOA 2A1UB 3FW1A 3PZRA 4M9CA 4R7ZA 5AM4A 4RTKA 2DWQA 2YIJA 3C8UA 3UBMA 3VJKA 2A35A 2X76A 2VKQA 4P3YA 3TWOA 4E1VA 1S8FA 4PFJA 4ARVA 3CFYA 2GPTA 3VH2A 1COWA 1VJ1A 3LY9A 3NAQA 5JAHA 1UC8A 3H2ZA 5LOVB 4XQ0A 4L5BA 4JJFA 4K9KA 3LA6A 1R5JA 5EE1A 3F1KA 4JLVA 1CLUA 4L2IA 3I42A 4ZRMA 2GEVA 3JRNA 1GADO 4CU2A 3UMYA 1D2CA 4DJTA 4E46A 4CLDA 4UU8A 1OXKB 1TIKA 2A5DA 3VNUA 1UBGA 1FP7A 1P5JA 2XJ4A 4OJTA 3P4YA 4QYXA 1GZ7A 4LXXA 5CM2Z 3OKAA 3AMVA 3HPRA 3ONVA 4GZMA 3TLAA 4F96A 1YTUA 3B3JA 1JIQA 1GDDA 1A1SA 3GD7A 3AG6A 4MGYR 4TROA 1DZ3A 3V80A 1JR3D 4P5PA 3EEBA 5A3RA 2P6RA 1LI5A 1XOIA 3E8XA 4OLFA 4R2KA 3K0CC 5EZ5A 2XNDD 3RYIB 2BMJA 1HRKA 3AX6A 4CLOA 3MCWA 5AHOA 3QUCA 4IQGA 4S0ZA 2MR6A 2D2VA 4CUKA 2GZMA 3LF2A 1RP7A 3RF6A 3RREA 3RT7A 1YTLA 3QVMA 3QPBA 4QDOA 2ZWOA 5D6OA 3EJ6A 4QQKA 1TEZA 2VN8A 4LJ6A 1X8KA 5ITZB 3DDUA 1ND5A 1E1QD 3HBNA 4BAUA 4BCCA 1DLJA 1GAEO 3L0OA 5K51A 2VWPA 4RY9A 2Q1UA 3BXPA 4J7CA 2DQYA 1K89A 1QAQA 1QKJA 1TKBA 5DGHA 5FAXA 3HDJA 1D6JA 5C3UA 3GCZA 3U5ZB 4ZZ3A 3FA2A 1ZVKA 4GAEA 5JC8A 2EQAA 1S3SA 5BWCA 2REOA 1R0WA 2QENA 1TF5A 5K2OA 4V39A 1JPVA 5F1KA 1UL1X 4URZR 4XSVA 1ZBDA 2OENG 1Y6FA 1UOPA 1U0GA 2GAIA 5AXAA 5IHPA 1J2UA 1R0SA 1QGUB 1ZOOA 1U0RA 2C3PA 3JAKB 4KU4A 3UMSA 3X2FA 4BB5A 3T94A 2Y67A 5M3BA 3VI4B 2R8ZA 1XU9A 3OY7A 4HC4A 3NKVA 1DCKA 1TZMA 3DEHA 4ND7A 1U7TA 3VVMA 4MUYA 1NXVA 4CFZA 1WDLA 2XGGA 2AOUA 4YCAA 1EWVA 2YMPA 5TS3A 3LZDA 5TPWB 1RVDA 4ZYZA 1U3VA 3C7KA 3LWBA 2AGVA 4ZXFA 1L7MA 5JBQA 4FHEA 1QC5B 3CUSA 3NBFA 1P4AA 1PS0A 1F2DA 1KAGA 4MAMA 1F6BA 2Y05A 4QAJA 1WKVA 4KLCA 1M83A 1XTUA 2I4LA 2DKNA 3DPIA 4UAVA 5HDQA 4BVJA 1E64A 2OCLA 1ZOSA 4WOBA 3SGLA 4BP9A 2ZJFA 1LFAA 2FI1A 3MUEA 4LK3A 3R0JA 3NH9A 3KQYA 4YRCA 5IJ9A 3HM2A 4WZBE 3HADA 3C3MA 3GLHB 5IM4A 821PA 1FTGA 4NFYA 3PPIA 2ATIA 2BUCA 2VQEB 1VLHA 1ZJZA 5KNCA 1R2QA 2FH5B 4KXYA 3K72B 3R3YA 1QHNA 2R1ZA 3DDSA 3EIFA 2RSLA 1X7WA 1W47A 5C8DA 2FMKA 1V11A 1KH1A 1JE0A 4YALA 2B69A 1EE9A 5FBKA 5H16A 4V0LA 1FTNA 4M1WA 1U2DA 1MEOA 4N5DA 2V7VA 3KLPX 3B5IA 1MVNA 1CY4A 2ZVPX 5FO0A 1XVTA 1KRHA 5AYVA 4EFKA 3P45A 4M0LA 1R0XA 4Q4JA 5KVSA 3HNPA 2ZAYA 3KQQA 4DG9A 1P1KA 2OG2A 4WZAA 3BBPA 3ER6A 3MB8A 2BH9A 4RJJA 5L7YA 5LBIA 1ST2A 4CTOA 5J4KA 4M6WA 1QYXA 2FY8A 1EK5A 4RPHA 1QO9A 2QL7A 1R18A 1AGXA 3OFJA 3W8DA 3TE7A 3C6BA 4WDQA 1Y9AA 3FYTA 4LYFA 4UM8B 2WAMA 1JXAA 5EJGA 3RWOA 3RFXA 5HS4A 2PZMA 3EXG1 2MSEB 1ZG3A 2J31A 4M7WA 4JI0B 3KTOA 5LOVF 4HO1X 1FMJA 4JP2A 2LNDA 5DM4A 1M1ZA 3R2JA 4PX9A 3IR5A 1QIFA 3AHEA 3T3HA 1SC9A 3OZSA 5BMVF 4LJ9A 1V47A 5C31A 2IZ1A 4G0YA 3V6MA 1YR1A 2XBUA 4QFBA 3CA8A 1THMA 1KDZA 4KH0A 1SXJA 2HHJA 3JQ8A 4U4AA 4LVUA 2M6KA 2N9UA 3TLXA 3TOXA 2Q4EA 2B7CA 1MB2A 3MTGA 1KQFA 1BYUA 1YA4A 3EQ6A 2QPLA 3VR5A 4BJ3A 4R3UC 3R23A 1ESNA 4PZ0A 3DBIA 5HZKA 4IYJA 2B9VA 4NFHA 1NBEA 1BW9B 4UCFA 1JAZA 1YOVB 5IK2A 3SFZA 2YWJA 1CYDA 3K4HA 5K0ZA 5BQXA 1PHRA 5A7GA 4V1CA 3A9UA 1NNEA 2CLSA 4BFSA 4RSMA 5KSWB 4IUYA 4JL5A 4DA7A 1PWXA 4LXHA 5LMCA 3BZBA 4LE2A 3IQXA 4RTQA 2O0KA 1D2NA 3L8CA 5KO2A 3HKEB 2I1LA 1Z3CA 1NM5A 4Q7QA 3LQFA 3QX3A 3ZGNA 2ZYIA 3GEPA 1NQOA 1JR2A 3KZXA 1L8AA 3SYKA 3ABZA 4TYNA 4D79A 2J3LA 3DAGA 3NLLA 2BFWA 4GHWA 4PGFA 2JIBA 2WQ7A 5K3SA 5ESDA 2BMEA 2EVWX 8LDHA 4IDFA 3BULA 4KSBA 2HCFA 5EXPA 4L7QA 2A59A 2VAMA 2L19A 2H2AA 4TS4A 4DLVA 1W0KD 2QVLA 5P8WA 5JI2E 3TZHA 5KPDA 4MA5A 3FNHA 4XJVA 4UDNA 4MWCA 3RABA 4DV5B 3E5HA 4Z53A 3HYLA 3R7DA 2IGTA 3KCQA 2AI2A 3WYEA 3ZV6A 4CGYA 2DXIA 1QUEA 4H4EA 3LUKA 3BILA 1ZY2A 2R6HA 1RJ9B 13PKA 1XN4A 3VX4A 5THKA 4JP3A 8MHTA 1RHKA 2FOXA 3G7UA 1O2DA 1O8BA 3OKPA 5E9JA 4C3VA 4CDRA 1DXQA 4Y1FA 3UW1A 2ZYHA 2BW0A 1P9OA 4MI6A 1WXDA 4LMAA 3RYFA 3EZXA 4N65A 1ULUA 5AVKA 4ARIA 2O5EA 1PKEA 1MTOA 1DTSA 3FVVA 5D3QA 5C4IA 1GXSA 2ID8A 2CHGA 3NHRA 5BO5A 4YRSA 1CHDA 5AUPB 1JT9A 4ZMSA 4YNBA 3MYYA 5BSKA 1L4YA 4HWPA 3IUEA 2O59A 1A8UA 1C1YA 1F0PA 3O9VA 4MPPA 4GMGA 1W93A 5TGDA 5HF6A 1EWKA 1SUEA 4XB2A 4KN5A 2E21A 2C0CA 3ZEIA 1FIUA 4TN1A 4IDNA 4OLJA 4NEQA 3Q3JB 3BJIC 5JCZA 2CXRA 5GAJA 3F1LA 2B78A 2XNDA 2W58A 5IYZA 1KJYA 1OYWA 1P17A 5PGMA 2LE0A 2HWYA 2Z1DA 3W3AA 5GWXA 1AM4D 3N0WA 1KDRA 2QU7A 1C5KA 1XZHA 4Y18A 5A06A 3KYBA 4JKOA 1ENYA 2W2KA 1HT3A 1GGNA 2EQ5A 3WI7A 2IK8A 5TLSA 2ZEJA 5KOIA 4UNPA 5DM1A 1CRZA 2ZQYA 3NHJA 4RTRA 1L8LA 3AVOA 2B7LA 4PFKA 4DEVA 1H6DA 3PD7A 4ESHA 4YMHA 4NQRA 7GPBA 1UBMS 5E2BA 4BP1A 4WZBA 3SZRA 2D8MA 1TZKA 4K1XA 4J0KA 2E5LB 1F8XA 3ZQUA 1QQTA 2IX3A 2ZOSA 2GEBA 5IXJA 2CHQA 3CH5A 1QV9A 2ZRAA 3BMCA 3P9SA 3NPAA 1M2HA 3PU6A 5IUNC 1MJHA 4RSGA 3X44A 4FLEA 5I8WA 3GNQA 4Q1DA 2IYFA 1FBTA 5LWQA 3EFOA 2O8CB 1AUVA 1G2OA 2J5BA 5KSOA 1G38A 4DPMA 2VP2A 2ZJ8A 1Z5ZA 4HCJA 4HH4A 3JSAA 4U0JA 3WJ7A 2HF7A 4DUGA 3OTOB 1CQXA 2FP4A 2JGJA 5IDWA 5KMGB 3AO0B 1KI2A 1R6BX 4IG4A 1BSVA 2FUG6 4FEEA 3S2EA 4GSYA 4IJQA 4V38A 5FKJA 3RUFA 1YQGA 1E1YA 2O2ZA 1RJ9A 1U1FA 3DKIA 4G1VA 3RAGA 3OX2A 4GL4A 3IUJA 3DYBA 1E3WA 2FW0A 4NYIR 4ZCQA 1ZSVA 2C20A 3HP4A 4WY8A 4UFNA 2HDHA 2P9JA 3R6TA 2Z58A 1PFWA 5G1PA 2NTVA 1BG6A 3IDFA 2W2LD 4WZZA 1DQRA 2FRVA 3ADDA 3CX3A 4DR1B 1WHSB 1XFDA 4V1CI 2FPIB 3W5AA 1C7FA 3P9YA 2UZ3A 5F73A 4CDNA 2I87A 3M2PA 4C0JA 4EARA 3C8MA 5CB0A 3Q7TA 1NG9A 3HJHA 1YSCA 1V1MA 4BVFA 1E9AA 3A6HA 2RGXA 1NR1A 1QLWA 2K6GA 2AXNA 4DRXB 3AHIA 3G8AA 3E3AA 1M5RA 4QPPA 5IASA 2J45A 3TQOA 2AN9A 4NZPA 3NC1C 4U2CA 5GONA 3WLKX 4C4OA 4CN9A 4IFIA 3G89A 3L0SA 1TB4A 2HU5A 4GM0A 4IVPA 3HS3A 3C7TA 3SJUA 4GXTA 5HVNA 2ZIWB 4FJ0A 4ND1A 2BEWB 4O2LA 2LV8A 3R3UA 1DGQA 4B5KA 2XYPA 3HXTA 1OXBB 1V9CA 2WNSA 4KPUA 4L2IB 5FD8A 2FFHA 1N5KA 2YIDA 3IOYA 1TM5E 2Q49A 2GZAA 4I2VA 3BFJA 4AS3A 4WN9A 1ZM9A 1CY1A 3A6KA 5AW4A 5JC1A 4MRAA 2IC5A 5CNIA 2NXEA 3B60A 4IEFB 4Y98A 2VK1A 2P40A 1UBNA 2W11A 2QEQA 1M7BA 4QZVA 1CRPA 4YCNA 3N3BC 1J39A 1LEHA 3DBOB 1D4OA 3VDRA 3K31A 2XSZA 3TAHA 5GVSA 3OMXA 3DPSA 4KXQA 4YJHA 3K5HA 3TLEA 4DG8A 5JROA 2F9MA 4FQ5A 3RU7A 1C3XA 1GTJ1 4YRPA 1C3JA 1C7IA 3GNSA 3TTSA 3VZPA 4AD8A 4QJ3A 5D1HA 1WS6A 3RS9A 2ZSAA 5E8JA 4YRGA 4Z1MD 1XQVA 2ZBPA 2JLZA 1M76A 4QNNA 2NG1A 2JFWA 2RAPA 3E0XA 4YV1A 1H8HD 1IPFA 4TZKA 2HLDA 4TX1A 1X2BA 4F3KA 3PC8C 4JLBA 4LPKA 3B1VA 2R8RA 4W63A 1DJMA 1E6EA 4UNSA 4D2IA 1BGXT 3OQMA 2Y99A 3O4FA 1S4MA 4RK7A 3PS9A 2C42A 3OFKA 3T12A 1JU9A 3INRA 1FMLA 1GSHA 4E51A 1XD2B 3QG5A 1ZRMA 4YT8A 3TL6A 2FJ0A 4IH4A 2C4MA 3NBKA 3WWZA 5ELMA 3GRKA 1M54A 4W9MC 3M5CA 3O84A 5J40A 3ZZTA 3HCBA 5LQDA 1UDXA 5REQA 1A3CA 3O74A 3URMA 4BZWA 3MTIA 3MBIA 1WJGA 1V5FA 4YUXA 4B87A 1XT6A 4I3GA 2Q3CA 4PSUA 4DIKA 3PQ2A 5FBHA 1U7DA 5FXMA 3CNOA 4PRLA 3VNBA 4QG3A 3PJRA 2ZXEA 4CIXA 2XVAA 3E61A 2JH3A 4HLDA 4YJGA 1A0OA 4UJ3A 5CAEB 1T0IA 5KTYA 1QFZA 2C9ZA 2DUUA 2ZRLA 2QROA 1T9CA 1SZJG 1A8HA 2QD2A 1E60A 3ISTA 2OLJA 4G63A 3ODPA 4AZ0B 2NO0A 1W8IA 4Z0PA 4J0QA 3PP8A 4F45A 1E3DA 3NHWA 3T9DA 1SHUX 3JVVA 4LEIA 2GS9A 2IT1A 2COKA 1NLUA 1POWA 2YXLA 5J58A 2GJ8A 2JJ2D 2FHPA 3VO9A 1ULHA 1L4HA 4KR7A 3JD0A 3O4IA 5ICMA 1CQJA 3BF7A 5KSZA 3TZLA 4DV2B 3DZKA 2Q3LA 1WVIA 5L4SA 2HO4A 4O4IF 3E18A 2MYPA 4AUEA 5L45A 4RKWA 1NQVA 2Z6VA 3N8IA 3K0AB 4RMHA 3PUIA 2PRKA 4GLBA 5CDYA 1BXZA 1GZ6A 3EZ7A 1MJ5A 3EC7A 2AB0A 2HZ7A 5AESA 1F8UA 2AC2A 1F14A 3ZLBA 4CMEA 4L3OA 4EUEA 4RWZA 4JUDX 3FR7A 3G2PA 3KR9A 4E07A 2QN3A 5CDSA 4QL3A 4U9UA 4KWEA 3GH3A 2Q6VA 2VDWB 3LX6A 4TWZA 2BTOA 4G25A 3E35A 1K9SA 5HWSA 3K9LA 4POAA 2PEYA 5CUQA 5CD1A 1LLCA 4DV7B 3PUJA 3WLPA 2XNKA 2PT5A 2VAPA 3V1LA 3Q0TA 1LK7A 2ZJ3A 1HG1A 3W34A 5IUJC 4IF6A 4M53A 1A9PA 5HF9A 4XAQA 5U1PA 5CVUA 2F43A 1JDUA 3EIWA 4HATA 4RF3A 4IQ0A 1OX5A 4NBVA 4BDSA 4MWTA 1EESA 1MB4A 2VJOA 4LF9B 1KC3A 4X6XA 1WXQA 1R74A 1J09A 1HLGA 3QPUA 4YP7A 1E2IA 1X0XA 3AJEA 3KKQA 1KKUA 4FVTA 5F5LA 2EIHA 1BH6A 3RANA 4HSEA 1L4GA 2ZUUA 16PKA 3EDYA 4DUYB 4TYWA 1D1PA 4W1SA 1WHTB 5INTA 4RAQA 3G6KA 1T4CA 1OLXA 3ANXA 3E9EA 4JXKA 1GPLA 2NO7A 1JFRA 4HQ0A 2F43B 5IZCC 1ILWA 3ZQJA 1NTOA 5M7EA 4KUEA 1NLYA 4TTVA 1LLUA 3NVDA 3QWHA 3SM3A 3PQ4A 1HFKA 3SS8A 1YQTA 2ZYDA 1X8LA 2H00A 5I01A 5AQEA 3QUAA 5A1TA 2Y1DA 2ZB4A 4KXWA 1EVLA 3RARA 4BLQA 1R66A 2Z43A 4S35A 4MO9A 4EO9A 4N3NA 4MAAA 5IX8A 1J07A 4GQBA 3THWA 1QAOA 1EK6A 3QYPA 1RAEA 2GNAA 3F71A 4A1FA 5DM60 1NIJA 1E3EA 5CLQA 2P6NA 3H13A 5ERXA 1JPUA 3PDCA 4I50A 2FWJA 4UMVA 3SZ3A 4GOXA 1EXDA 4KHPB 1L1RA 1VG0B 4MDEA 2R44A 3ICVA 1PZFA 1TKAA 3PVCA 5ALVA 1PAUA 2MU1A 2ETVA 4Q47A 3L0YA 1R88A 3NV9A 2OCBA 4KE7A 3C4QA 2X3YA 1GPAA 2FWBA 5DTRA 1IL0A 4CF4A 2DETA 1G8JA 2OP0A 1K5GA 2AQHA 2JFYA 1AMOA 5JD5A 3S6JA 1IHPA 5JSYA 4C0LA 2P2DA 1N6HA 1V39A 2F6RA 4UZSA 4Y1GA 1NW7A 4XQ9A 1Y1KE 3JQAD 2VNIA 5ADHA 2DM6A 1A27A 1UJNA 3OO0A 1JVNA 3DVSX 3DM5A 3BTOA 3ROXA 4JEMA 1DIGA 1RAAA 1JMKC 3DF9A 3UK2A 4CTNA 1IM8A 1D1QA 4QYTA 1UIRA 1LB1B 5JVDF 3J80A 1JIIA 4KCGA 4DUGD 3TKYA 2CC2A 2W6JD 4I9GA 5AFSA 5E6UB 5KYWB 1H85A 3T1TA 1SB9A 3H0KA 3A11A 2ZBVA 1KK2A 3SJZA 1WNTA 1N8KA 2HDNB 3H19A 4FR0A 5TDHA 3AKDA 5AHKA 1EFDN 4ZEVA 3AP2A 4II3A 4U2KA 1AN0A 3UMBA 1OAOA 3MS4A 4JT9A 2QW0X 4Q7JB 4QNMA 4WUVA 3WDSA 5E7IA 4C0XA 4M1SA 5F5XA 3B48A 5LSAA 1ZC3A 2BUBA 5DFAA 4CG3A 1OGJA 3EGCA 1W94A 4Y2HA 5KTKA 1DC6A 1BCRB 1YK1A 4Q3LA 4Q66C 2JAUA 3FI9A 3H87A 2JLUA 4WOPA 1XGKA 1PFQA 3NT5A 4IX1A 2ZSJA 1FNDA 2XWBF 4B79A 4DLNA 3OY2A 4EQ6B 4RF4A 1GL9B 2DGDA 3OWXA 3R8XA 4FT2A 3PJEA 1H2EA 4PYMA 2P79A 3G2QA 3NGXA 1E9DA 1UM9A 3WG9A 1N25A 1E92A 1E5LA 2XI4A 1FYWA 2PWYA 3HUUA 4OJNA 4LDQA 4Q3OA 4RD3A 2H65A 4AURA 4PN3A 2X8JA 2XLCA 2ZAGA 4JYPA 2RBGA 1Y7PA 4S1VA 1XEAA 3RHFA 2C7QA 4YASA 3I5XA 1ZR2A 5BYBA 2ZXUA 1L5WA 2B20A 1NSTA 1DHRA 5DTMA 2BLLA 2YBEA 2J4CA 1U3UA 1NZDA 2VUHB 4AF7A 2NZ2A 2ZQ5A 3IUNA 3W4JA 4DSNA 5JYBA 5TSDA 4FFLA 4JN6B 3RUAA 5ELLA 3DWFA 2W43A 1PE0A 4G0WA 1NF8A 4C0HA 4JIGA 4PIPA 3QOFA 2ZR7A 3TW6A 4XYMA 2FDRA 1T34A 4IMRA 2IZOA 3C6YA 2AWNA 1JECA 1OAOC 4I1OA 4KNVA 4MYHA 1OWLA 1YL5A 2BVNA 3Q7RA 3QFFA 2NVWA 1WUJS 4RQAA 4B09A 1GFSA 1RW4A 2OR3A 4HMOA 3ZDDA 4NENA 4WRRA 5JANA 3VBEA 5DRYA 5KYGA 1PNRA 2P3SA 1X7XB 3DHNA 5IDQA 5GIPE 4ESEA 3R5HA 3GDWA 3PD0A 4LXIA 4C4RA 1WOYA 5THXA 1H23A 1ECBA 2YIVX 1XLTC 3EBLA 1IBLB 2YWEA 4AS1A 4IJWA 2W83A 1FDWA 4QXRA 2EDAA 1K6XA 1V2HE 4IHJA 4HDNB 3IP7A 1DT3A 1TVKA 1ZEMA 5SYNA 5T67A 4DRXA 3UM9A 1J0CA 2YMQA 2YQ4A 1VGVA 4IDCA 3ZIDA 1W7AA 4N54A 1OLUA 5JNUA 3U60B 1Z6GA 3PX2A 4G5HA 4XVCA 1IZ7A 5JI3E 1FXWF 3C5HA 3QWIA 1E4YA 2PUJA 2EKZA 4PLGA 4A92A 1X7WB 1TCAA 3TLBA 2C7BA 3LS2A 4M22A 1CDOA 4HRXA 2WJHA 4P2BA 4BWGA 1D4AA 1EK1A 2A5LA 4D5EA 1ZW6A 3I6YA 3UJ8A 3FX2A 2PG3A 3OEED 1FX1A 4KQIA 3A6GA 3FFWA 1ECLA 3Q2OA 4IZ6A 4Q9JA 5B7NA 1ISRA 4HN4B 2ZETA 1H2FA 2XGOA 2X9VA 4F3CA 3C3AA 4TQGA 1MJGA 4HYQA 1ATIA 4D43A 1SKQA 1XG5A 1T4BA 4YAGA 1I7LA 3IERA 1FPMA 2GBGA 2YFYA 2GPSA 2ZIUB 4UVGA 5AM5A 4YWJA 4CV3A 4E88A 3B82A 2WJJA 3VO2A 2J7PD 3O4VA 2HA0A 4L0DA 1YGYA 1KY5A 3R7BA 1Z4IA 4BFXA 3A3NA 4FYJA 1RZUA 3IQFA 4FGLA 4CKEB 5HM6A 1LI7A 5F3WB 2JZOA 1YI0A 1KJZA 2HA7A 4L4UA 3QXGA 3UKJA 3OPNA 5EKTA 3WNCA 1ISSA 1GLVA 3G6WA 1VOTA 1ZH0A 3DE5X 2F67A 4ZCPA 4RHTA 4D81A 1JHQA 3UPUA 2HMWA 3W3AH 1EI9A 2RC5A 3O83A 5AOVA 4YAIA 2NN3C 1N0WA 3GCGA 2C61A 2FDXA 2J8ZA 3MCUA 1X42A 4WLNA 4JL8A 4AULA 4OKSA 1IMOA 4NY1A 4BQEA 1ORRA 2D2XA 2PLRA 1YDHA 4G85A 3OPMA 4WZBB 3ZVLA 4CM4B 1QAMA 1CU1A 4RNDB 4E11A 4ERNA 1HEYA 4ZQFA 3D2BA 5BRAA 4DV4B 2RGRA 2PH3A 2O1SA 3EOAI 4S2EA 1H1TA 4C14A 5KOJB 1ZA2A 2QD3A 3BDAA 3FCUB 1RYBA 5IHXA 5FPHA 2QDXA 3WRYC 1NF3A 2GJAA 3IIJA 3ZDBA 4LE0A 5ICGA 4RZ2A 4F5ZA 4DXAA 3JVIA 2FZCA 4H18A 2OXRA 4IKOA 1TMKA 2POCA 4RIIA 4UPVA 1JR3E 2JBWA 4A0RA 5AW0A 4UVEA 2OPHA 5TS2A 1LTQA 3GUVA 1CVRA 4I08A 3FGNA 3FROA 3U49A 4HNVA 4YUAA 1WXGA 1KFBB 1K6MA 1RRPA 2GF0A 1K9VF 3ZDYB 1BFKA 4MUXA 3W6PA 1ZJYA 3VSBA 2I29A 3H3XA 3PFWO 4YCMA 1UP4A 2Q4TA 1AKNA 1QZZA 4Q02A 4P4SB 1QX3A 3FZGA 4FUQA 1YQXA 4QPZA 4D7AA 4DOMA 2Q21A 3AKYA 4EDFA 5CT6A 2QGFA 2X5OA 4G81A 3AM1A 5I3CA 1REQA 1V1RA 2GMWA 2QTVA 2ZUTA 4LECA 3IHWA 4OREX 4ZODA 3ZCPA 3BSFA 4FW9A 3RB8A 3JYQA 1RXCA 2YCLA 2OLEA 4M88A 2V1UA 3GHYA 4OFZA 1TU0A 4FFOA 1R8QA 3ZCVA 2F55A 2FRXA 3MPOA 4P33A 2IDMA 1BMDA 4HGZA 3O92A 4A10A 1IXKA 4POOA 2YJZA 4JB8A 4ZT5A 4CR8A 1Y42X 4B7CA 4EH1A 1Q20A 4C21A 2Q6KA 3VAZA 1E2LA 3P19A 1XCBA 2V58A 5BSMA 1WABA 3DP9A 1D2RA 3AWDA 3ETLA 5LP6F 5LP6C 1IG0A 1V3VA 3G0BA 4XM1A 2ZSFA 4KYUA 4LQ4A 1Q21A 3FUTA 3GCWA 4OMDA 3AVXA 4V3BA 1EXVA 3W78A 2EQBA 1Q2XA 4P5EA 1KP2A 1WZ2A 1XAIA 1W5SA 4JSRA 4Q0MA 3N2ZB 4M7OA 2YN4A 3PG5A 2Q2NA 4K3UA 3LA8A 4H1WA 1PO7A 1Q3HA 1SUIA 4BO7A 3ZXSA 4AT1A 2CLDX 1IHDA 5BVHA 1JBQA 1G7CA 1MPTA 3TLCA 1SB8A 1WDKA 1DOHA 5F12A 2AW3A 2K5UA 1U8CB 1TM4E 3PQDA 5IWCA 3QU2A 1LI4A 4IXDA 5C8YB 4DSTA 2P0AA 3T4PA 3RSLA 3PEEA 4MUHA 1XLWA 2YV3A 1YB5A 3EGXB 3TGWA 2ZUVA 5K0BA 4ZDWA 2J5RA 2XVMA 4ZHQB 2OCPA 2NZYA 3GC6A 3JRWA 3OZRA 4M1KA 4X3CA 1CDEA 4BNLA 2GEFA 5EIAA 3SEZA 3JQ8B 1GVHA 1VJRA 1UKYA 4GG1A 1XF9A 3FDFA 3RD5A 1G0NA 2JIZD 2VHXA 1PGJA 3R5KA 2CFTA 2PKEA 4NS1A 5IVDA 1GGHA 2WHPA 3CJRA 3EA0A 4QARA 5KYYA 3GLGE 3K05A 1TO6A 2AJ8A 5AJXA 4QREA 4R1LA 1GZ5A 1VCMA 1J8QA 3PKJA 1Z6ZA 5DH9A 3KHKA 1ESCA 1GNRA 3NS7A 5DF1A 3A6FA 3EHEA 4K9RA 4HNQA 1A04A 4Z8YA 3ST7A 2JGLA 4CEIA 1MIOA 3NNNA 3QQPA 5MGNA 3N2EA 2A5YB 3CF0A 3LPMA 3PXDA 5T6MA 1ACLA 1JIVA 1BAPA 2VQSA 2W2TA 3L43A 5D01A 4OXXA 5CDTA 3K8OE 4UHJA 1JL3A 4H27A 4KGVA 4RO0A 1YS1X 5ALEA 3TR6A 2AZXA 3WGHA 3U7QA 3ZHOA 1S7CA 1VYTA 2BONA 3JAWA 3B6MA 3HNRA 4J9UE 2WSYB 3ZVRA 3GUCA 3QU4A 3L0BA 1ZWKA 1QKIA 3KKOA 2AEEA 3L8YA 4IXWA 1JFTA 5K3EA 2V7PA 4O4JB 5L9AA 2P90A 2YOFA 1QTRA 5FPQA 1HI9A 5FWYA 3MJDA 2WDZA 2LBPA 2IEDA 1XEWY 2BEVA 5CPFA 2QTGA 4N76A 1A76A 1JNXX 3MJEA 1L7XA 3Q3VA 4MR7A 4ZREA 1EU1A 3ZOZA 5CG2A 5GIOE 2X0NA 1JZQA 1OV6A 4M9QA 2AG0A 3N7TA 4WJKB 1RXVA 4ARSA 2B0JA 1J0BA 3H1EA 3VFDA 1ONPA 1R3UA 1RLMA 2X4GA 3P2YA 4FX2A 4RVCA 1TPZA 4AKEA 1BXGA 4EO4A 3OU6A 1WXWA 3G82C 3SXUB 1XBTA 1VJTA 1B0ZA 2IXEA 1SR8A 2AI1A 3AEXA 3DH0A 3PNYA 3UMGA 3E2MA 2AOUB 4URHA 4LXTA 1U9IC 3G5UA 4EHKA 1TA9A 3KPYA 4MGHA 2AOTA 3LOQA 4HL6A 4M0KA 3KYDB 3LM8A 2MSDB 1WMDA 3DSRA 4BQFA 1HUQA 3CVWA 1Q50A 3LO8A 3WQRA 2IYRA 2FP3A 1WKBA 3JWGA 4MKZA 4R2MA 4S12A 1R8JA 4FU0A 5CFZA 4TMZA 3B6JA 2W2NA 1LJUA 3PKZA 5DTJA 2GZSA 4E5PA 5BW5A 1UC5B 4QODA 3R0ZA 1BXRA 3LQYA 1N4DA 4G1EB 1AA6A 1Z6TA 2YV1A 3WLSA 2WMYA 3H2HA 1I3NA 3MEQA 4W9RA 3PGKA 4ZO6A 2AL7A 3WB0A 3ZK9A 1JT2A 2JIQA 1ULSA 1M6EX 1T5IA 2WF6A 5A0TA 3V32A 3QBTA 3ZQ6A 4TTAA 1N0VC 1QIGA 1LNZA 3MUNA 4EGAA 1N33B 4C4ZA 3TX2A 3NAZA 3C1UA 3C1OA 4RVOA 4PYJA 1PZHA 1GZ3A 1UZNA 3SLRA 4IUCS 3KAJA 2BV3A 1FVXA 2IYWA 3IT0A 4KK4A 4PFQA 4NOJA 4ARUA 2B3TA 3ENWA 4PLPA 1VL8A 5G41A 4AMUA 2ZDHA 3H99A 5ITZA 3KQTA 4L7VA 2ENUA 2A88A 3IKJA 2VDJA 4HEJA 3JWHA 3GLIA 4DQKA 1NE7A 2XADA 2RHDA 3BCUA 4ROSA 3BGWA 4PAOA 3IP8A 2KS6A 4K7JA 1KEUA 3U39A 4ZYUA 1SXIA 1BRMA 2ECQA 3TEJA 2QW1A 2G4CA 3NP9A 4YQYA 1UJMA 1QIDA 2WZBA 3C41J 3E15A 4XPIB 4X20B 2OOKA 1XPUA 4WBNF 1YB6A 3T3GA 2XGMA 2D0PB 2CXOA 1KZYC 2RI0A 3QJYA 1P72A 4OB6A 3TNLA 1G5IA 4V0RA 1CXZA 1WXFA 3QZUA 5GMOA 2Q46A 4LZOA 4KDEA 2PKYX 1T1GA 1B15A 2ZTMA 3NHKA 2EGGA 2JEOA 1RC8A 1S4QA 1V8FA 3BCHA 2E4UA 2G7ZA 5EIXA 4CIWA 4M86A 5K2MA 3EUFA 4BNJA 4EY4A 2BWJA 2AFVA 3DAOA 1KS9A 1A5SB 1GG5A 3HZHA 4GUDA 2IXFA 1Q44A 3NQ41 4IQ8A