2P79A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGAMWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p79A00
2DWOA 3F2IA 1DKPA 3FDZB 2P9FA 1BQ3A 3EZNA 5CX4A 1SK9A 1E58A 1RPTA 1E59A 1DKQA 3NTLA 4D4LA 1C7ZA 2YN0A 2P78A 2DWPA 2ENWA 1QFXA 1C81A 2H4ZA 4GPIB 1V7QA 3MBKA 2WNHA 1BQ4A 4MA4A 4D4JA 5HR5A 3IT0A 5AK0A 2P75A 3EOZA 2AXNA 3GP5A 4ARSA 1H2FA 2RFLA 2ENUA 1RPAA 4FDUA 4E3WA 2P9ZA 2P77A 1UJCA 1BIFA 2P79A 1SK8A 5CDHA 2P6MA 1YFKA 3D4IA 3K4QA 3IT2A 4QIHA 3K4PA 3O0TA 2P30A 3F3KA 3GP3A 1T8PA 3DB1A 2WNIA 3R7AA 1ND6A 3LL4A 2IKQA 1EBBA 2HPAA 3LG2A 1DKNA 2GFIA 3PGMA 5PGMA 1DKLA 3KKKA 3MXOA 1SKAA 4PGMA 1C80A 4EMBA 1QHFA 3D6AA 2EKBA 1DKOA 3DCYA 3LNTA 1QWOA 2A9JA 3FJYA 5CU7A 1YJXA 1CVIA 4JOBA 4JOCA 1K6MA 2PA0A 5AJYA 1UJBA 4AROA 2F90A 2H0QA 3E9EA 1FZTA 2P9YA 1FBTA 3ZHCA 3C7TA 3E9CA 1XQ9A 3GW8A 2EOAA 3NFYA 3QPUA 2OWDA 2H52A 4HBZA 5HTKA 2HHJA 1IHPA 1V37A 2QNIA 2WU0A 2BIFA 3BIFA 2A6PA 1SKBA 3D8HA 3IT3A 5AJWA 4IJ5A 4EO9A 2P2ZA 5AJVB 3QPVA 5AJZA 3FDZA 4IJ6A 4D4KA 4FDTA 1DKMA 4ARVA 4TSRA 4ARUA 2I1VB 3QPWA 4D4MA 3E9DA 4JODA 1RIIA 2YN2A 2OWEA 4ODIA 3HJGA 1ND5A 2P6OA 2EKZA 1H2EA 4PZAA 2HIAA 3OI7A 5AJXA 1TIPA 2H4XA 1NT4A 3IT1A 4GPZA 4PZ9A 2P2YA
chains in the Genus database with same CATH superfamily
5J4LA 3OTGA 1XZEA 4BQEA 5EQJB 1NUAA 5TT1A 4KO8A 3WNDA 2JA2A 1U2DA 3CRZA 4S12A 2H5JA 4RCVA 3KZVA 3HCDA 1M5RA 4R6XA 5B7GA 1ZA1A 4JLDA 5JAZA 3D4BA 5LZ5A 1TYCA 3GEHA 4ZYXA 1G5TA 1NVKA 3KOWA 3ZY6A 5B1SA 1FYWA 1JF8A 3FGZA 3N2KA 3F2VA 3F4LA 4J2HA 2XKKA 1FS4A 5C4MA 3LXXA 3BD6A 2QTVB 4DCUA 3SCZA 4RZHA 4JVOA 1GVNB 1ZR4A 1QZZA 2BR3A 1B1CA 4HXEB 2R68A 1XMVA 3QHAA 3QELB 5GMOA 1K2WA 4YRMA 1X2BA 3H0CA 4OKIA 3DKIA 4L8WB 4U63A 2GBGA 1XZ8A 2WYUA 3AU8A 4IYRA 1ZD4A 4I08A 2GF0A 1ZSNA 2VNKA 4P31A 3V7NA 3EF0A 1EXDA 4H15A 2RCNA 4RF4A 1H9BA 2JD2A 2ISSD 5CK5A 3TM5A 2XCUA 1HT1E 3IDFA 4YFYA 4Z4CA 2TS1A 1PNVA 3PTLA 3K0FB 4PM4A 5ECDA 2D8MA 4J7UA 4LWQA 5KAPA 2Y0CA 4AJ1A 1L7BA 4YPOA 5KTMA 1JZTA 1R16A 5FPQA 4GUDA 1Z0DA 2OVFA 4FI3F 1ODKA 3AR3A 3U3OA 4NFHA 3WB2A 2ZULA 4OQZA 1ORIA 4QATA 2XD4A 2I2BA 2FX2A 4MX8A 4PNPA 4B0PA 5H3CA 3IQEA 4DBZA 1JEQB 1MX3A 2KHZA 2XNDD 3HKEA 4FBGA 5KYXB 3CKMA 2HQSA 1ZICA 1WXWA 3LUCA 3ORYA 5AOBA 3F8TA 1ZIPA 3TTXA 3FPAA 4G24A 4UBKA 2VHQA 3F5DA 4GSYA 4YAEA 1ZKDA 1YR9A 2PMCA 1UM9A 1Z2EA 3ANYB 1TJNA 4L4XA 5CB6A 1DFIA 1FMJA 3VR4A 4A6XA 4UQLA 3PJFA 1RJGA 2AXQA 4N4AA 2WIDA 5ESRA 3T7TA 4Z7OB 4B3TB 3K73O 3T3HA 2PKWA 5ELXA 3FB1A 3WGUA 3OD5A 2ERCA 4DLBA 4WL0A 1EVQA 1MXHA 3HCCA 3B3QA 4GZ3A 3ZDYB 1NXOA 3IE0A 3O5AA 1KAQA 5P8WA 1KU0A 3L4BC 1R0XA 4Y2PA 4RD0A 3FBWA 4XR4A 1I30A 3VHLB 2QM3A 2HA3A 3B5EA 3D7KA 3PS9A 2K2WA 4PHCA 3W3AH 1HNZB 2WM8A 2Q3CA 4CMIB 1HQKA 2D0OB 1SPBS 4HQFA 1GRCA 3DE2X 1DU4A 1RC0A 1VBMA 1K3FA 4F2HA 3TGLA 1L4KA 2H7XA 2V59A 2XNHA 3QITA 2WD8A 4GT1A 4L1KA 4C7VA 3NVAA 4LFAB 2F8MA 1E7YA 1U1EA 5EEHA 2VZLA 2C2ZA 2KLHA 1UC8A 1DMRA 2V7VA 221PA 4KWCA 2IU0A 4DCMA 1V35A 1VIMA 3W8DA 3K1AA 2FZVA 3GN2A 2VP6A 2PKYX 1U11A 3NDPA 1RMQA 1EB8A 4JJ7A 4TWBA 3BFKA 5LD2B 2G4VA 3PV0A 4PWYA 2CY0A 2VK2A 4TUYF 3BGWA 1GZ5A 1KGSA 1YIAA 4OH7A 4GBGA 5EUCA 1ILWA 2A0UA 4LJ9A 3ZEIA 5JHGB 4MUIA 1WPXA 3STYA 4EGJA 1USGA 5EJ6A 2CFIA 2ZT7A 5KTPA 5L4LA 4BZXA 1RPNA 1E6LA 4Z99A 3G8DA 2HADA 3ELWA 1P6UA 4JV5B 1J99A 2UUOA 3TQIA 5CNIA 2W2TA 2Q3JA 3JVUA 1FSGA 3K05A 3N1UA 4ZXFA 3L7OA 3UTCA 3CLSD 4MRMA 1AZSC 1X2EA 1G3MA 3NYRA 3R5TA 3TMYA 4FEAA 3WJ1A 3NP9A 4OK5A 4PZYA 1W96A 5F2OA 5KIAA 3H1PA 5A1TA 4MJ3A 1QFMA 4UBNA 1BHSA 1WW8A 2IC5A 3AEXA 3H2BA 3NHUA 4KDCA 4EX6A 2EQ5A 3NWJA 1ZUHA 3R09A 2FA9A 1G5FA 4KXMA 1GCAA 2LD4A 1T3SA 3UHJA 1KDRA 3FY4A 4BNZA 4ZIRB 2XE4A 3B3FA 1NXTA 4KHZA 3ILHA 4D4IA 5BNFA 4Y6PA 2EGGA 1DC8A 4CEJB 3ZJ4A 1HEUA 4G81A 3FMIA 1CETA 5JSHA 1Z25A 2NU7B 1Z82A 1GAEO 2B2XA 4QUAA 4QRIA 4BVBA 1X9GA 3QYFA 1EQUA 1EE1A 1HLFA 2HMAA 3HEBA 4RXUA 2I7CA 3UJ6A 2A9RA 1NJ5A 1O6CA 2PX5A 3TGWA 5CUQA 1A9XA 4U7GA 1NVDA 4CVNA 3DE4X 1Z07A 2F3TA 1SELA 3VUFA 3ELDA 4G4SP 4HWTA 3W06A 4MW4A 1KOLA 4A73A 3I2YX 4Y1RB 3DZIA 5AHOA 5BUQA 2WWIA 4MUXA 5T8KA 1M6HA 2WVHA 4DY6A 2QPOA 1E5DA 3GD5A 4NCBA 1Y5MA 1T0JB 1XDDA 2BZ0A 3E22B 4IRUB 2OA0A 1KNXA 5BV2P 2NMVA 1MA0A 4CM4B 1NLMA 1V25A 2PR2A 2IF0A 4P54A 1KY2A 3UUGA 5K0NA 2QV7A 1FLNA 1MTOA 1OGIA 4JEIA 2OHIA 1UEXC 2GN0A 4WXMA 5BSHA 5DI3B 3ZNPA 2N1MA 4GPBA 4INZA 4V24A 5LKRA 1X42A 1JHUA 5CYGA 1SG9A 3KFLA 1LQTA 2YZMA 3D0KA 1SO8A 1E5VA 3JR3A 4TUYA 2XSZA 3SYRA 1I0LA 1VGRA 3NHWA 4R9NA 4MQEB 5BN3B 5L8VA 4JJKA 4ED9A 4B3GA 2Q21A 2BCJQ 2AWOA 3GFBA 2FP4B 3E2MA 1F17A 3KWMA 3Q5EA 1BS2A 2DLNA 3F47A 3RVKA 1L5FA 3OTQA 3QKRA 5LOVB 2HT1A 2A9OA 4MYDA 3LY7A 4QT4A 1WCV1 4FX5A 1FRQA 4RKYA 1ODCA 1Q7GA 2X9GA 3SQNA 1MVOA 2ZBEA 1YCGA 5P21A 1K8RA 2DQZA 3QNUA 4XFKA 3T3EA 1IM2A 4MP3A 3L43A 4DDWA 4QNNA 1JU4A 4PS1A 2P6OA 2VDWA 5LIPA 1O94A 4DMKA 5ERGB 3NW9A 3T5DA 1U4SA 1Z2PX 2ZVJA 2ZJOA 3B6IA 4NMMA 4ARAA 3U09A 3G7SA 2V5UA 1ZONA 1EX9A 2BGJA 3FR7A 5DT2A 2IDKA 3AJ8A 1JXAA 4TLEA 3R7SA 4ZCMA 1H4SA 3SIPA 3OEYA 1UEIA 1RP7A 2HFKA 3NWBA 4EJSC 1S8NA 2ZBDA 4KOEC 3FYDA 4XRGA 1E3SA 3FN4A 1UMBB 3DDCA 5KNCD 4OHCA 2CVHA 3L05A 1TC1A 2PK3A 3K8ZA 1UCFA 2I4IA 3EVFA 4L5CA 4XFJA 4XWAA 2X22A 4WQMA 8AT1A 1S2GA 5F3DA 3I32A 3OKPA 4UCFA 1O5OA 3KD3A 3DLPX 3NDJA 4C08A 4OOEA 2DTDA 4GX1A 2JGFA 1C1XA 1Y0BA 2ATVA 4OXRA 1R4MB 5BW4A 3WGVA 4TLAA 2GTHA 3I6IA 1TFUA 4WECA 4Y8VA 1JJFA 1Q83A 2H2GA 4DT1A 3K2IA 1DHRA 1E2HA 4HDNA 1IXRC 2EFGA 1YCHA 4YI5A 1Z18A 3OJ0A 5C1OA 4PAGA 1JFSA 1T0PA 3H16A 3KR0A 2OPHA 3OE7D 1CY6A 2EP7A 3HXOA 1P7CA 1U2EA 2ECFA 1PTJA 1TO1E 4XM1A 4EHLA 4QASA 3DCNA 1FTYA 4P7FA 2NZWA 3ZWAA 4DMHA 4ON9A 4ZA2A 4B32A 3BJIC 1J09A 2F00A 5J3JA 3PXUA 4B8ZA 2R7AA 3WRVA 2WR8A 2QTLA 1CDZA 3H1GA 1V3TA 3I2GA 1TCAA 4I9GA 4L2IB 2RG1A 1P1KA 1NURA 3IAAA 4KQMA 3LPLA 4YFVA 4YV1A 3SQXA 3OUTA 4U0JA 1E2IA 2XVAA 4NCNA 3IVRA 3QSGA 3TPZA 1TUEA 3EQ8A 4JOBA 1E64A 2NVUA 4NS1A 1P7PA 1QX4A 3F97A 4K0KB 1XTVA 4WN9A 4CLDA 2PO7A 3UPTA 1XAHA 4H18A 1QR2A 2A67A 1ZN2A 5LLSA 3RIHA 1QE0A 4NABA 1TYDE 3C7TA 3CWCA 3QOFA 1CKEA 2RSLA 3P2EA 4G8JA 3CLTC 4GF5A 1TADA 3NFYA 4KMRA 4QDJA 4B84A 1JTEA 1Y6GA 1XAJA 1DRVA 1SC6A 1VFPA 2X58A 4IAOA 3S40A 2B4TO 4ROSA 8LDHA 4IICA 3UTDA 2W2MA 3BMQB 3UFXB 2CLHB 3VU0A 5A7HA 2EX4A 1BU8A 2GEVA 2PUVA 2R62A 5DM0A 4NU5A 5HKBA 4EO9A 3LQFA 3KL4A 1O96B 5GOTA 4JFRA 4QGHA 2X0RA 3IFSA 2DU8A 1QO9A 3H5LA 3RUAA 4QUDA 4KYVA 3WRXC 5F35A 2PRSA 1XRNA 4K3UA 4CGYA 2NO5A 2VA8A 3DAHA 1PG0A 3DKKA 1FRZA 4K3VA 3HDTA 4X1IA 5FYDA 5CDYA 2PLWA 4IQGA 2CWDA 2OL4A 3WRYC 4PX2A 1ZOIA 2BKEA 3G89A 2HHLA 4LPKA 2VXBA 4U2BA 4BGDA 4AI6A 1WTCA 1E9AA 3AH8A 3DTVD 3G2HA 3THXB 2NXJA 3GOHA 4FPXA 5LBTA 2BM0A 1W581 1GSAA 3NXKA 3ZK9A 1RYHA 2OENG 2VAVA 1NW6A 4D7AA 1FYXA 1YDFA 3K0AB 3DAFA 1B8NA 4Q6WA 4WXPA 2VSOA 2CDBA 1K06A 1JT9A 1K4KA 3B85A 1ECPA 1TMKA 1A95A 3PXCX 2IYAA 2AFHA 2IY9A 1K6JA 1Y9ZA 3LX8A 2ZR0A 3C1AA 2YH2A 1QHIA 2QVLA 3RK0A 1FXWA 4Q02A 4DTIA 3HK2A 1G9SA 1UDXA 1X1DA 1ARZA 3OFSA 1WBDA 1I7PA 4E70A 1YRLA 4N41A 2X4IA 1ITZA 1P74A 1MPTA 3EUWA 4CCSA 3ANMA 4L7VA 5MFZA 2Q6LA 4URXR 1TKAA 3D8NA 3WKBA 4W4TA 5KOIA 1VDZA 1N5DA 3KQNA 1HMYA 1S96A 5E9WA 4RLHA 2R44A 2UXDB 3KUCA 3AR4A 3PGXA 4P3NA 2BW0A 3QPBA 3TBHA 4H6XA 4LRYA 1KJ8A 3KSRA 3HVJA 2REBA 3P2OA 1IZ7A 1DP4A 2II6A 1QQBA 1C8VB 2D1FA 1BD3A 2FSSA 2JLSA 2PL5A 3D7MA 2HJRA 2NO9A 2BFBA 4PHGA 5DN9A 1XAIA 4O2BB 3UICA 5B2EA 2X1LA 2ZXFA 2PL3A 5CVVA 1G55A 3IAUA 4KP7A 2XEDA 4PO1A 4XGIA 5FNVA 3HUDA 1AQNA 1OC4A 2XRYA 3DFZA 3FTNA 5HSGA 1I2CA 3WFJA 5JNSA 4O1MA 4BO8A 3U37A 4JITA 2FTKE 5BXYA 1NLFA 3TW0A 1WF6A 4HDAA 3IB6A 2YNMC 1L9XA 2Z9DA 1DMSA 2GMWA 3NUZA 1A9QA 1P0FA 2L2QA 1QXSA 2ACWA 1IQPA 2WMOB 4CLRB 4PGMA 4BQFA 3DSRA 1XHLA 1CUAA 1SQ0A 3E84A 4YQZA 1UPCA 3F3SA 3U4AA 3W6ZA 4BTLA 4F8YA 2BRUA 2F8SA 1GY8A 5A4IS 4IEFB 4G2TA 4B3HA 1S2OA 2DECA 3GJTA 1KC1A 1E3EA 2GN4A 4E5UA 3QPDA 2PMEA 3DZJA 1QS0A 2I6TA 2Z4TA 4MYRA 3TPCA 5DWVA 3EHDA 1P33A 2GDZA 4HF7A 4F84A 5AK5A 4BVKA 2D5CA 2Q5OA 3INYA 3PT9A 3UMMA 2PIAA 2RKWA 4RPLA 2ETXA 2ZANA 3UOAB 3NONA 2HBRA 1N9KA 4EP1A 4O29A 3T7KA 821PA 1TECE 3ITKA 2WILA 3DE7X 5DCLA 4WN3A 3WICA 1XWFA 4ZTUB 1EP2B 2O3SA 3U3MA 5KTSA 1A7UA 5F1PA 3GX1A 4V1CA 4NBWA 4X5OA 2E18A 1JFRA 2GN2A 3DHVA 1TTQB 4J75A 3CW2A 2WPNA 1C7FA 4FP9A 5CT6A 3D8HA 2CFOA 3T61A 3ZH9B 3N07A 4DCCA 3W8EA 4EHAA 2NV6A 5H9WA 1JH9A 3ZGZA 4WKCA 2C7QA 4B6FA 1E4VA 1QYXA 3FDJA 1TKRA 2C5SA 2H1FA 1UQTA 2XA2A 2ZRPA 3G2KA 3JZIA 4KRXA 1F2DA 3STHA 2BGTA 1KAGA 1L7PA 2XV1A 3W7BA 4NENA 1BFUA 1W5AA 2H57A 1UFRA 5MGBA 2IOQA 1DTWA 4ODIA 1NXSA 3A14A 1R9GA 2JFYA 1SUCA 2JH3A 3ADOA 3DS8A 3L07A 4RADA 2WJWA 5D6NA 2ZI9A 3WRWA 1MVLA 4M7PA 3ZWCA 2O8BA 1E2JA 3FB4A 3H7AA 3D7RA 1JHXA 1ONSA 5IJ0A 3DOJA 3HU1A 4JI2B 1Y9AA 4ZARA 3VDMA 2HQ1A 1HPLA 2FX5A 2QDXA 3KUUA 4PQFA 3CNLA 2R2AA 4K26A 3N28A 4B3CA 4JLVA 2ZJFA 3CINA 3GD7A 3R5JA 5ERYA 3UK0A 3JWHA 3PFWO 3FX2A 1DKQA 2B94A 3BWDD 4NTZA 5J23A 1UKCA 4CLHA 1FJGB 4CU5A 1NU8A 3OCYA 4XPZA 3AY6A 4O8CA 5CB4B 3OIDA 1FMLA 2VDJA 3QYJA 1L4EA 4ENTA 4KQHA 1GOTA 4W9MC 1UXIA 2JIBA 1GTMA 3CPSA 3O2NA 1K6IA 4KUEA 4B48A 1AVTA 3DMYA 3WLTA 1ZSVA 2QTFA 3AI3A 2HCBA 3FNEA 4G37A 1FNSA 2IGTA 3GRKA 3IRVA 3UMCA 2FNAA 4KREA 1DJQA 3EWSA 1GEEA 4N5HX 3R7LA 4C2TA 3UJBA 1GQSA 4Q1VA 2A88A 2QTCA 3AETB 4B73A 3LHFA 2D54A 3B6JA 4KEAA 5LDGA 3D3QA 4AK9A 2YOFA 3K4QA 2OM6A 3L0BA 3PEEA 4KBFA 1T34A 2OCAA 5IANA 4GVXA 4M8KA 4JXKA 2EVWX 3Q7SA 5E0KB 1ACLA 4EENA 4CJXA 1ZR2A 3B36A 3FRIA 3L1IA 1U8YA 2KB0A 3T7RA 2QAJA 4JOSA 3SFVA 1QU3A 1CJTC 1K6XA 2O07A 2P9QA 3PPVA 3I8XA 2C2WA 2JIZD 3NGMA 2FCRA 5AI0A 1RACA 2C00A 2VBIA 3TB4A 2CF5A 3DO5A 1CIVA 4DMLA 2QE7A 1RI1A 1HDZA 2XZPA 4HDKA 5JVDB 4XWKA 4HNGA 5MHTA 1VRCA 3I73A 1QF9A 2C59A 3DMHA 3KJFA 3QTTA 3UWKA 4BEWA 1R0LA 2JANA 1HE1C 4OHWA 2EP8A 2F90A 4X6LA 5HBRA 3RUIA 5HUJA 3HH8A 1OPXA 3RI3A 2B1JA 3WGIA 3ZHCA 1I1OA 4RH1A 4DRZA 3PNQA 4AL4A 2Y93A 1G3QA 5DLEA 4J1TC 2LKDA 2I29A 5CM8B 5CVDA 5HF9A 3VA7A 4XD7D 2O3JA 3FA2A 1EZ1A 2C5AA 2GVDC 4R9UC 5CA1F 3WAGA 3LZCA 2I7TA 4J49A 4Z7NB 3K0SA 5JROA 1NYLA 1XVAA 2OCXA 3PHCA 1C30B 2L69A 3ZI4A 2X14A 4KITB 3L8GA 4Q3AA 1QKIA 1RQNA 4DDHA 2W2QA 4I6GA 5EQTA 4ECEA 3RWOA 4AG6A 3GJ8A 2O52A 3DPSA 5BUSA 5K0EA 2J9GA 1YR3A 1F2UB 4R8RA 4Y7CA 1RM4A 3MIZA 5AJTA 4YAJA 3GH3A 3H42B 3B9PA 4EAQA 4Z7JA 2VNJA 3IKJA 3QXHA 5L45A 1PKXA 3E1KA 4G25A 2UYCA 2DWUA 4M0KA 3AM5A 1EFPB 3KKPA 3D3EA 2QWXA 1M0WA 1B3BA 2O2IA 3ZU6A 1KKUA 4BTEA 1VXOA 4LY3A 1O77A 1QLJA 2ID7A 3E8XA 4R05A 1VRWA 3OHPA 3PHLA 2IXAA 4PHHA 1JX6A 2YJGA 3TW4A 1NZJA 5JFGA 2WHPB 4EJ0A 1WDLA 1MC5A 1FYVA 2XT0A 3I37X 3A1VA 1I36A 4JJ4A 2VKQA 1XEXB 3AUTA 4F2DA 3BIXA 2BTOA 1BYUA 3BVPA 1W0JD 2PGIA 4WSOA 4BWGA 4WZBB 4EB0A 5JCPA 4ZYZA 1MAUA 1YQDA 3LBIA 2OGWA 3OJFA 5EUBA 3I52A 5CFRA 3IAS6 1YBMA 1PEDA 2WHEA 1I6WA 1MW9X 5DX1A 1G8JA 3PKIA 3RC8A 5CLLA 1U8XX 1MGPA 1IZYA 2JZOA 1T36A 4NH0A 4TXMA 3C6QA 3T38A 1A71A 1P9LA 3BWBA 3I09A 1ZM3A 3JR7A 1M74A 4Q82A 5CT4A 1Q7RA 2GZMA 2H8GA 3SXPA 4UFOA 1P2BA 4OL0A 4RCZA 5B12A 3LCMA 1NN5A 4TSKA 4FILA 3EGDA 2R1VA 1MX1A 1Z45A 3L6CA 4RQAA 4WBSA 1EDZA 1XLTA 3A8TA 3VVMA 1GPJA 1C1DB 2ZDHA 3T7IA 1ZMRA 4QUBA 3BWYA 1VLHA 1JAZA 2OHVA 5JS6A 1V8BA 2CE2X 2O2ZA 2RGBA 3JZDA 5GONB 3RIMA 5L9AA 3HJRA 2UUCB 1OV6A 2REQA 2C20A 3C70A 4E5VA 1K89A 3OC0A 3PJEA 4MLDA 2C8KA 3BJZA 4D6XA 2F67A 2H4FA 3OZWA 2HV8A 3TTSA 1FZQA 1RRGA 4G6ZA 5IUJC 2J6BA 1FE8A 1HRDA 3ESXA 4OXQA 5DHAA 3GJSA 3AVUA 2VEDA 5L7WA 1F4VA 1E98A 4LWZA 3U4GA 4IJWA 2FHPA 2OBLA 2OLKA 1P2UA 3IBTA 1SQGA 3M5CA 2IGBA 5CA1A 1P4SA 3VO1A 1SGWA 5IAGA 2D59A 4PFSA 2WEKA 4TSFA 4A8TA 4NOKA 5FEUA 1GNVA 1TVMA 5DGDA 4UATA 3T06B 1JAHA 4AUNA 1Q22A 3BTOA 3FNQA 4IHQA 4WXYB 3MWYW 3L77A 1X38A 3SEFA 1P2VA 4TS9A 1J00A 1XQXA 3PYMA 5LYJB 3MSXA 1L8LA 3BAZA 4E12A 3VC1A 2A0WA 3E61A 1IRXA 3GA7A 4QM6A 1C4WA 2QY6A 3IVGA 4HYQA 4ZO4A 1KDZA 1BXRA 2XA1A 2Q3LA 2WF6A 4BE4A 1M76A 1RFGE 2PXAA 3IBFA 4OLFA 3PX7A 4DRYA 2AJLI 4F2PA 1H5UA 2SCUB 3IT3A 3VDNB 3AFGA 4C14A 4EHJA 1FF9A 5EHQA 2C3PA 1H4TA 1R2QA 4NG4A 2I3BA 1OT3A 4OV6B 4R83A 4LGYA 3IAHA 5EPEA 3SSAA 1Z75A 4LDNA 3V5NA 4CMBA 2VF7A 5GJCA 3WNQA 3K53A 1ZD9A 1DADA 1OYWA 1NVEA 1ODLA 3BGVA 3M1AA 1HZZC 2OORC 3I9KA 5KTRA 3RYCA 3JQ8B 3THRA 2BLLA 3IR5A 1YQXA 4HEQA 2D4AA 3F6YA 4DSAA 3BKWA 5H7XA 5SZKB 1E5TA 3RCBA 3RARA 1XNJA 5HJEA 3HB0A 3DZCA 2P4QA 5DTQA 1FDTA 1TRKA 1VPDA 1YB2A 2COUA 1XMOB 3BS4A 2Z5VA 3AFHA 2FOXA 1L5LA 4CM7A 1LSUA 4N5MA 4R3WA 4DYDA 3WGLA 3LPMA 2OCLA 1IM8A 4BBPA 3Q4GA 2RHOA 3S2YA 3SMQA 2IP2A 2WJIA 3KETA 1T8UA 2BKXA 5BW8A 1EQ2A 2AG0A 3SJAA 5JASA 3S70A 4ITUA 4P4UA 3OZTA 4E2ZA 3L8ZA 1NXPA 4RV5A 2VHXA 3VOTA 1L7QA 4FFSA 3ZJUA 1FDUA 4BFXA 5ALTA 3QVGA 2FLWA 3CG0A 3KUKA 3GJRA 4OOFA 3AR7A 3LW8A 3WGGA 3LPAA 5BURA 2O8CA 2QZ9A 2J31A 3Q3VA 1RYNA 1SZCA 3RRXA 2X3YA 4WCFC 3B78A 1JEOA 2Q5JA 1DCMA 3NS7A 3EX7C 4D8XA 1H23A 2R85A 2VJMA 1AB5A 1CUVA 1M2OB 3LUKA 1FQJA 3E9QA 1A8UA 4MB0A 1ENYA 4OXKA 1SVNA 4IZIA 3EH1A 5AKJA 5FWNA 2ZITA 4DCOA 2ZJ1A 3YASA 3JQAA 3ZCRA 3W04A 4Z51A 2CUTA 3EA0A 5LQMA 5BN1A 2B21A 1BDIA 3FLAA 2XDYA 3MFYA 4S1OA 3A9TA 4DQDA 1SC3A 5JQWA 2HZ7A 3A7DA 3KYCA 1SUIA 3R4VA 4EZEA 1YS2X 2OFPA 4MWOA 1Q0UA 3OQ6A 1HLPA 2ZIXA 3T3MB 4BFWA 1I4TD 4DS3A 3DT9A 4P0TA 1LW7A 2NYUA 4IIBA 3MT0A 4RTLA 4UCQA 3TRDA 3DKPA 2I8AA 3GJ3A 1C80A 2PZEA 3K72B 4YT8A 2ATEA 5DGCA 2BEUA 1V47A 2DKFA 4I1VA 4UAUA 3K96A 4LECA 1JR3D 1V96A 2VDNB 3PPYA 1Q0SA 2VC2B 2FRDA 3JASB 4CG0A 5KNBD 2IYTA 1PJRA 1TTTA 2QVYX 5EFZA 1NN0A 2IITA 4TV8F 4AICA 4E5YA 4WNCA 1ZI9A 5JH7F 2R7KA 2X5NA 3A32A 4C0WA 2MJLA 1GPDG 5KDOA 3IIJA 1ZNQO 3OFVA 3IE2A 4E6EA 3OLYA 2UUAB 2C31A 3I5MA 1QLHA 4JSRA 3INRA 3GUYA 5BR7A 4ZZ3A 3FHJA 2W8BB 3IPLA 1XCPA 1Y5LA 3IIMA 5K01A 2WLSA 4G26A 2FWJA 1JKFA 3P9KA 1L4MA 2OV4A 4XH9B 2RB4A 1IUKA 3BD9A 2D2EA 1NBAA 3H9EO 4MW1A 2HUNA 3N6RA 1P7WA 3ZWBA 5DM60 4AJKA 4X20B 4MVJD 4D9KA 4OHYA 4K9DA 4X84A 2WZBA 5C80A 3D6UA 1M34A 1BVRA 5D5QA 1U8TA 3IVMA 2BSAA 3ZU5A 1PJTA 4QXQA 5LQRA 4ZI2A 2Z6UA 1JG3A 4EDFA 1WPRA 2OGTA 3PIDA 1NYTA 1OLOA 5GY7A 5EKUA 3VJKA 4RYDA 5EGNA 1CQJA 1O6BA 2W4MA 3M4NA 3NAGA 4K6FA 4TROA 2HJGA 3NVDA 1C1HA 3SJ7A 4FC7A 4BN5A 2NSLA 2XF2A 2RAUA 1L4NA 2PNJA 4KAFA 2J33A 1DBRA 4W9NA 4H2DA 1DG3A 2BZSA 5K3FA 4ZT5A 4I50A 4LQCA 3VTKA 4KR2A 4AX4A 3F78A 5FI5A 1JYFA 1L7AA 3AKDA 3DEJA 4XVQA 1J0AA 2W6MA 4D8VA 1XMQB 1YJCA 2ATIA 3DNMA 4B80A 4US1R 13PKA 5IS2A 3SE0A 2RGYA 4GX5A 1UIRA 1UOQA 1U90A 3IO3A 5JUWA 1D09A 4L95C 3JQ6A 2G7MC 4ZMBA 2W6CX 4P0QB 2ZIVB 2WTMA 1MZPA 1SNYA 1O9HA 4DR1B 5JSZA 1ABBA 1QFXA 4TKVA 1QM5A 1CRWG 1CULC 2VTDA 1E18A 3Q7QA 2ZWOA 4R1PA 4RZQA 3T12A 3UBTA 3VPSA 3LBNA 2TSYB 4UE2A 2VDOB 2M32A 4RHXA 1GPNA 1W94A 4XD2A 6NULA 4OHXA 1LRJA 1E63A 3HL0A 4DJJA 1PS0A 2HSWA 2QRVB 3EY9A 3BGDA 4FYXA 1EHIA 4OU5A 1LJLA 1Y80A 2XUHA 5IMSA 1NVFA 3W5DA 3VTZA 4LMAA 3SOZA 1SU6A 1VYVA 4ADSG 4YRIA 1NJSA 5G4KA 1I33A 1I4DD 3ZXUB 5CBPB 4Q3BA 2Q4OA 3NEPX 4HZUB 1Z83A 4TV8A 3U31A 1UC9A 3R74A 1JA9A 3FETA 1N4AA 2C5LA 3PE6A 3Q8MA 4LGCA 1GSHA 3R9XB 1U2PA 4X7PA 3Q9UA 4LZWA 4KGVA 4E94A 1FA9A 4B3JA 4D45A 5I7WA 4BRZA 1ZK1A 1F9AA 1R0BA 1TW2A 3AL3A 1XPOA 1C3XA 2YBEA 1MQ9A 1VZ2A 4EHKA 1FNNA 4PINA 4E7PA 4DG5A 3HGTA 1V2GA 2VK4A 3VKWA 4R2JA 4WJKB 1ST2A 3COWA 4QUJA 4GHWA 5IJWA 5A0VA 5AICA 3VFDA 4OQLA 4GYWA 5AI5A 5BOSB 1JQDA 1Z17A 2I1LA 4JOCA 1MAWA 4PC2A 1IG0A 2EJWA 4D99A 2A1UB 3C5EA 3SSMA 1A69A 2BFDA 2XF8A 1P60A 3DMTC 3FZNA 3ZI0A 1D5WA 4B7CA 1X19A 2QL6A 2B4KA 3PGA1 3QVWA 2KW5A 3WZMA 2WD7A 5EHXA 2BHNA 3NBFA 5JS1A 1THTA 2YHBA 3HCEA 2IPNA 3U7FB 1JFTA 4F6LA 4UPDA 4HR7A 3JZFA 4Q7EA 3KPVA 3RS0A 3OSUA 3ZWMA 1HE2A 1EZZA 4F4IA 2QENA 2SKDA 4KO4S 3F4BA 1Y7LA 3E7PA 3WQHA 2H2FA 3TIIA 4QLAA 1HORA 1J33A 2WJ6A 1I13A 3D0OA 4IGAA 1E0JA 1U0OC 3HG7A 2V98A 2ODTX 4J9VA 4JUDX 4ML3A 4PRYA 5I9IA 1H1LA 2B7LA 2DT8A 1IN8A 1YI8A 1BCRB 2WUEA 3QLTA 1ES9A 2AX3A 4UFPA 5FP0A 1BE6A 3K4HA 4PFKA 5DTRA 4Y6LA 4AMYA 5EP2A 1AUOA 4MZXA 4RQBA 1NWHA 3D64A 1LPBB 5K4HA 4OFWA 2Z83A 3SM9A 1Z5PA 1M9NA 2QP3A 1R6VA 2GO1A 4DV2B 4PC6A 2V97A 3ZQ4A 1MTZA 1YB1A 3TKAA 4H1TA 1OT5A 4JKIA 4M0FA 3FPSA 4RX1A 2QLFA 3AG5A 4M83A 2BL4A 4Y0AA 4YT4A 1JFLA 3ICVA 1YZNA 3HZRA 1U5CA 4OF4A 4AJEA 2CLFB 4Y6RA 3VU8A 3HBJA 5DK4A 4M1YA 4EB8A 4K9PA 4O02B 3WGOA 2C61A 3QKWA 4LC1A 4H4CA 4KUHA 3ZLJA 1W2WB 1WQ3A 3VYVA 2IZZA 1GO2A 2XVYA 3LK6A 5DKFA 4BRUA 4XJXA 3O9MA 4KFTA 2BONA 4LXIA 1CUDA 1DIBA 2J87A 1QFYA 2QRUA 4JVSB 4L8VA 3V3TA 5AK3A 2ISQA 2FPOA 3E9NA 5DYYA 1EG7A 5E1OA 2GZ1A 5IEBA 3ZU2A 1ZJZA 4UMDA 5LPNA 1FK8A 5J43A 4O63O 4EHDA 1CZKA 3V7YA 3TIVA 5EXSA 2YBDA 3KYDB 3PR1A 4INOA 5K7SA 1KI8A 4K2AA 3WQRA 1WZIA 5K99A 2OY0A 2O2DA 1KSFX 2VFAA 2WE8A 5EWMA 3UWMA 1EE9A 1XR3A 3INGA 1NHWA 1YC2A 2M2IA 3PUJA 1PL7A 1T4DA 4K86A 4NZYA 3ZYZA 2QTVA 5IULC 5J1SB 3CZPA 4E1BA 2C9YA 3D4LA 1Q16A 4QIHA 1F5SA 3HBLA 4UAGA 2IV7A 1XEFA 3QELA 2JEZA 1SBQA 1BW9A 3KTDA 1ST3A 3UMJA 2WA2A 1YR1A 1IEWA 2YWHA 3C7AA 1JSLA 3DQPA 3MJEA 4JBYA 2DHDA 3L79A 5IN5A 3ZGOA 5JARA 4KJXA 1QG6A 5B30A 4XM2A 4GLOA 1JDPA 1ODSA 2VG8A 3CSDA 3CCCA 3OIYA 3FYHA 3P97A 4HUQA 4QXPA 3K0FA 3OEWA 3VZSA 4F71A 2AJDA 4JSTA 1DKOA 4IILA 4WW0A 4CG3A 3MWDB 4QOGA 4X94A 2G4CA 2VSXA 3BEDA 5CT8A 4DABA 1V9LA 2E85A 3P9YA 4ZFNA 1MDBA 1NW4A 1W1UA 2HRRA 1R8QA 3BRQA 4PLWA 3CRQA 5IARA 4BB0A 1KXJA 1QR6A 5AJYA 4BJ1A 3CCBA 5HK9A 3S29A 1KMHB 1OFGA 4AWXA 2BGWA 1W88B 2ZROA 1ZN8A 4FLFA 2GNOA 3R40A 3ETCA 1U0TA 4WASA 5CPFA 2Z57A 1J8VA 2Q3MA 4Y6OA 3IOBA 3DD5A 3TSYA 2GLXA 4PS0A 4EO4A 3ZZMA 4V0MA 1H66A 1R12A 2VF4X 3WFIA 5BVGA 2IUFA 4A82A 4IEIA 2B5WA 2J5QA 4MVXA 3ON5A 4CMEC 5HX7A 5C52B 1NMEA 4J94A 2VT3A 4CHTA 3A3NA 2I67A 2GA9A 3ZC3A 4YUYA 2NAFA 3EQ6A 1DEKA 3EFHA 4N9WA 4CTNA 3SYLA 4YCSA 1PDWA 2Q27A 3ASVA 4FLEA 5IKXA 1Q0LA 4MS1B 1E1DA 4YAUA 3LE8A 3OCUA 4V03A 2IPMA 1B0UA 1CUHA 4H16A 5SZIA 3TW8B 3ZHXA 2AG6A 1AUVA 1KPHA 2JBWA 4RS4A 3WJ7A 4P58A 3EG9B 5DXJA 3CEMA 2YVAA 2IOHA 1U8FO 1OIVA 4Q7LA 2GF2A 2JLQA 3IT1A 3M49A 3ICWA 1V4BA 2GGSA 2CEKA 1MJHA 4EQ6B 3MB8A 3JVVA 4J4HA 3WWPA 5L40A 1JWLA 1KBZA 1ZLXA 2ZYDA 3BIJA 4LYGA 1Z16A 5K3DA 1ZGCA 1E7RA 1EH5A 3DZBA 3OQPA 3PQDA 4LE0A 4RIIA 1F5NA 4WJLA 4PG8A 3PXXA 4JFAA 4QJIA 3NWOA 5EMLA 2OQVA 5AVRA 3H9UA 4IIJB 1AKWA 1GPH1 1T0IA 2BGUA 4Z4QA 4I8DA 4DXHA 1PQYA 4H0FA 4MEJA 3RO7A 4F4JA 1NNSA 2J07A 3F67A 4NY1A 2ZJ6A 1R66A 2B20A 4F72A 1NPYA 5JATA 4NXMB 3BA1A 1A5SB 5IC6A 2G6BA 2PUWA 3IUJA 3ONFA 3RLFA 1Z8NA 2BGKA 3ODPA 5KJ1A 3DZFA 4Y98A 4BVGA 4E1AA 3TAHA 3W9BA 1A5BB 1U0NA 3FCEA 3UJ3X 2H1OA 3NNNA 2R79A 3FGOA 4M2LA 2MSWA 3ZDCA 1Z28A 1T5BA 2FPPB 5AW6A 3G5TA 3M1LA 4FMBB 1J9GA 3IODA 3OCVA 1DG9A 1Z56C 1JVNA 4Q21A 4NHOA 3PSAA 5DOZA 5GGYA 5EWLB 1UXKA 3BG5A 3KOZA 1JTVA 5FLXA 2FMTA 2AFRA 3DLCA 1R8YA 2EC5A 3KAJA 3QA9A 4WVLA 1LLCA 4BO3A 3P9CA 1TO2E 5HQTA 4ZIRA 4LFBB 1GKYA 4PLFA 4DIBA 3AY7A 3SX0A 4E14A 4HH4A 2CXUA 4KNYA 1HYEA 2O0HA 2RI6A 1WXXA 3AVQA 2NU7A 2QG9A 4YPVA 1XZDA 1Y3DE 1EFVB 3GNLA 3JQPA 2WTAA 1NLYA 4V0LA 2QD5A 3AR5A 4DZTA 2XGJA 3GUHA 3C1TA 3VNAA 4ZXPA 2CJXA 3BXHA 1ZMBA 2VQ6A 2Y76A 3AP1A 2FKNA 4WADA 4DEVA 3SC2A 1KK3A 3AR8A 2HMWA 4ZVSA 4DL9A 3LFTA 3QW2A 5TXGA 3ZGXA 1BAPA 5I7FA 1OR8A 2G71A 3K92A 1UDRA 3ILXA 2O8DA 2B5OA 2F3SA 2Z98A 2HXYA 5BWLA 4R0NA 1TIKA 3W6NA 1KJQA 3D6HA 5J4HA 1JEYB 1K8ZB 3IUPA 3Q3CA 4I4NA 1QJCA 5J58A 1GTRA 3R6DA 4R0MA 1FMTA 4UD6A 4PRZA 2OGZA 4TN1A 1WVIA 1F2VA 1V5IA 3E22A 2XUOA 3EF3A 4X6YA 4PQGA 1Q6ZA 4WCFB 4QYWA 1IUOA 1R64A 1ECCA 1XU7A 4CM4A 5D6OA 1N5RA 3FHCB 3IDQA 3NASA 4ESHA 4YHHB 1DV2A 4OHZA 1SVUA 2JGKA 3MT8A 1IBKB 1CUBA 4NZNA 4Z0HO 3RJZA 3AHJA 4DA8A 2LP4Y 5I01A 1GZSA 2HDHA 2XVZA 1W4BA 2H9IA 2XXBA 1LF0A 3A36A 3LBFA 3IIIA 4N7RA 1SG6A 2A58A 2QMOA 1URPA 3P0IA 4CIDA 4FHEA 4IFTA 1ZU4A 4L5YA 3LXRA 4MQEA 3FZQA 4GSKA 5EESA 3ZWWA 4Q01A 5BN3A 3C6XA 2FP4A 3CLUD 4FOPA 4Y2GA 4DIMA 4R2LA 2P5YA 2WU8A 3LYLA 3BD8A 3ED1A 1NW3A 4S35A 4ZAGA 4LWPA 2R8PA 4UHCA 2ODAA 2C4TA 5JYBA 4N3BA 4MOWA 4ZVRA 4NG5A 1F6BA 4RD2A 4MWTA 3FNHA 4KFRA 5CPBA 1K4YA 1Z33A 3DE1X 3MF4A 3PRYA 3IUMA 4L4ZA 4MYUA 3RJ5A 3UT5B 3VMMA 3Q0TA 4RLSA 4AJOA 3ZVKA 1XZKA 1X9IA 2AE1A 5LLDA 1CQIB 1G18A 1PUXA 2C8JA 2RGGA 2YQ4A 4J3JA 3DVSX 4D9CA 5ILQA 5BRAA 3OIWA 4MS3B 4V2IA 1B26A 3A6GA 2WUDA 1JVBA 2ZRJA 1QGED 1K27A 3ITDA 1ZH4A 1K63A 2IHYA 2PV7A 4EL0A 3CM0A 1V6SA 2XDAA 3AWIA 4Z1OA 1ZP6A 4XCVA 3RPEA 2XITA 2XLBA 1AMOA 4E4RA 4LJRA 2WV7A 1GFSA 4EF6A 1P0QA 2NU8B 1GZ7A 1VYUA 1ZD3A 1EVEA 3FWPA 1P2DA 2RHWA 5T4BA 4LF6B 4NFSA 1TYBE 1QB7A 3R0ZA 1MFPA 2OBYA 3QOXA 4HAWA 1AS2A 3GPDG 1UMBA 1W4LA 4OH1A 1XXHA 4EGSA 3V1NA 2VJOA 4FXPA 1T4GA 3MJFA 2CCJA 1GTVA 3MWGA 3A6KA 4PTYA 1I6MA 2IU6A 2QRGA 1TM2A 4ZVKA 2CDCA 1YDWA 4GXNA 2AI3A 3FTEA 5E9QA 4ND6A 3QJGA 4JL8A 4MVJI 5A6SB 1VLVA 1I3OA 3CZRA 1KOJA 4BBJA 4TLDA 5AVJA 4B2YA 2CCGA 4MUMA 1TQDA 4H7IA 4AZ3B 3FJOA 5JSQA 2QSZA 2H2WA 3ASZA 3LU1A 3U2QA 2BSQA 1R8JA 4PLYA 3JAKB 5HXAA 3SXUA 3CVUA 1CR6A 3ZXIA 1T6NA 4FWTA 2HREA 1VE5A 4UZEA 3C5CA 1EAYA 1UODA 1XZIA 2I9PA 3H5IA 4XUDA 3SDBA 1A8SA 3GJ5A 1W93A 1SUBA 3KOMA 4BQPA 1KS9A 1N6RA 2RH8A 5KTTA 4EUFA 1HR0B 4EWLA 1TCUA 1DEHA 3TJRA 2YY7A 2DTXA 4K5QA 5DN6A 3JQ9C 4DSOA 1LDMA 3R5KA 1CFJA 1Y6RA 3G9UA 1PF7E 4EO7A 3G3EA 5CM2Z 4L2IA 2XCTB 2PKQP 3CUTA 5FOXA 2IOYA 3W5UA 1DGQA 4WUVA 5TB5A 4KX5A 4MVWA 4L28A 2ODQA 1UT8A 2DZDA 1MX9A 2W2LA 3AHHA 4O2BF 5IXJA 2J7PA 1NI5A 4L0MA 1OW3B 1PNQA 4L4RA 5HEKA 4ALNA 2X5OA 1R9MA 3I6BA 4KR9A 1C8BA 2VP4A 3F5SA 1IPHA 2XQIA 4IMIB 2H7CA 3BWEA 4QYMA 3VOSA 4CIAA 3U61B 1X0XA 3UUWA 1FFGA 2WWRA 5BWNA 2QYOA 4NYMR 3IKMB 4HNAB 1GLGA 3UXYA 3J7AC 1NR5A 3I2IA 3WBFA 4AUKA 4UNSA 3CUEF 2NO7A 3ER8A 4KRGA 5FL7A 4LSZA 5HKOA 4FFBB 3UFXA 2OYCA 3NHKA 1VP3A 3TLGB 4XQEA 1O97D 2GS9A 2GO7A 1UJMA 4OJMX 1E2NA 3RW9A 3TZ6A 3UBMA 3R0IA 1OBVA 3Q10A 1JKMA 5DX0A 3V8QA 1DDOA 2FUEA 5HFAA 3O38A 4J7XA 3VDRA 2E9SA 3LPCA 2VNSA 1UP7A 2NP6A 3T3OA 1A9SA 1LBHA 1Y3HA 4DYVA 2O1SA 3DFMA 3HXTA 3MAJA 5FI1B 5C0OE 3OJOA 2PG3A 5KQSA 1WB9A 1JDJA 5DTEA 1K8QA 1JIJA 3H4MA 3RDPA 2X0JA 1S8AA 1PJSA 4D97A 1RXVA 1EUCB 5H70A 3TQRA 2R6CA 2YS6A 1FTGA 1Q15A 1B6RA 2NPOA 4GOND 3U13A 3THXA 1B14A 1PYDA 5UKDA 5JRDS 2Z8ZA 5JE8A 3DDZX 4MKGA 1Y3BE 4KWTA 3K0AA 4PGGA 3NRJA 4EITA 4UOEA 1XZHA 1XL0A 5KYYB 2QN8A 4HRAA 4NRDA 4JI7B 5IDQA 4BMCA 2QBYA 3QEKA 4KWIA 1W4RA 4AJJA 2Y99A 1X9HA 1YZKA 4H3HB 3CGGA 4PONA 5A9RA 5A02A 3ESDA 3UWDA 1W49A 4YUWA 2RMKA 2PX8A 3MBKA 1Z0UA 2OBXA 3JD1A 3L01A 1PHRA 4M55A 1ZBDA 3S8MA 1T2AA 2XE8A 5KUTA 4TZ6A 3GFOA 3HYRA 3EPLA 2GRJA 4QC2A 4NBUA 3G2LA 2AV6A 4REQB 2JFBA 1JQ5A 3NI2A 1VECA 4GM4A 3FOCA 5D86A 4AQDA 1EB9A 4YRKA 5GZ1A 5KWEA 1ZM7A 1WUKS 1PT9A 4MVYA 4QGGA 3D5EA 1TU3A 1V7CA 3CNQS 4HQ6A 5E2BA 4IRXA 4N9QA 5LB2A 4U4AA 3UAZA 2DHRA 3MWKA 3C3EA 3CIFA 1XL1A 1EVJA 2I4MA 4I6JA 1KFCB 1NTOA 2Z2IA 1ULHA 3N8HA 3MHPA 1IY2A 1X14A 1RJ9B 3O0DA 4MCHA 2AFHE 4WLNA 4O2BA 1QDUA 2OCYC 3GGOA 3UV6A 4DJ5X 4YP5A 4X24A 1ACJA 1B3RA 1MCZA 2GXUA 3EEBA 3KEQA 3MTBA 4FFDA 4I1RA 2C9MA 2PZJA 2XAAA 3GG2A 4IKEA 4XR9A 5CB4F 5F5XA 3DWGA 4HLNA 5L6LB 2BMEA 2E55A 2AG8A 5CXQA 4J2TA 2CVOA 2GEBA 4IDEA 1L6IA 1AK2A 1GQRA 2QNRA 5C1BA 3GZNA 2AQ8A 4EHFA 4EMBA 1G59A 1GDTA 4DZRA 1WMSA 3E5RA 4OM8A 3T1VA 1XU4A 4R8MA 4Y9DA 1YR7A 4N54A 1CVIA 3D3JA 2G67A 2R84A 3CURA 3BHIA 3JSXA 4RGQA 2E4WA 5CD1A 6Q21A 2XA9A 5A03A 2QTAA 5D00A 4OAQA 4IJQA 3ZCSA 1GYPA 2XUIA 4LX0A 1U6KA 3GUUA 4KQ1A 1QV6A 4X44A 5B7QA 3O8CA 2RE8A 3EGXB 3GB9A 2ZCJA 1EUZA 2EOAA 1MB2A 1GUFA 2PGAA 3EMBA 3ILSA 4I4CA 4L75A 2LR0A 1OD6A 1G8YA 2H52A 2Z4SA 4KUGA 4NYMQ 3TJZA 4DBLC 1TKBA 4HNUA 3KRTA 2Q5LA 4ZT4A 4DPMA 3MYYA 1HQDA 2PTGA 4ND8A 1TQ8A 4DEYA 3PNVA 5AYVA 1SMKA 1LPSA 1DOHA 1CK4A 1P1RA 2XGGA 3T9FA 2XCQA 1L5HA 1X87A 2XZOA 1QP0A 5AKLA 3HN6A 3OQJA 4CR6A 5JVDF 1Z2NX 1RWBA 1XKTA 4OY3A 4UTOA 4JI0B 4DIKA 5IF9A 3S5JA 1COWA 1QH8A 3LBYA 2BM8A 4M60A 3ESCA 2DAPA 3AEQB 3O1HB 1XA4A 4F97A 1GHTA 3H6GA 1E9CA 4YY3B 1XTUA 2FQXA 3JWIA 1X8KA 2JFOA 4FBMA 4I1PA 3T5TA 1RXCA 1T5TA 3BHMA 5J4KA 1JSXA 1CLUA 1NKVA 1VLLA 3K8QA 1ESZA 1W8DA 4XYBA 2VCEA 5FWYB 2FF5A 3WMEA 4NZOA 1CG6A 2NYRA 1QF7A 2WJ3A 4EF5A 2MYPA 2DHQA 2O2GA 3E70C 5F3RA 4BAUA 2IBTA 1YKSA 4RKRA 4F46A 5EJ9A 2H1SA 4JQYA 4N3CA 2WVAA 4D26A 2RKOA 5DV9A 4ZMRA 4R40A 4BO9A 4L22A 3KJZA 4JGGA 4IXNA 4LI0A 4TM7A 1KQNA 3RLIA 3KT6A 5C8ZA 3CUWA 3VO9A 2BPOA 2H0RA 2H4ZA 1HEYA 2P1RA 3A1EA 2WMDA 121PA 3L5OA 1B8OA 5EMMA 1RCTE 2I3ZA 2PMBA 2WNHA 3L1VA 4IIYA 4B2PA 1J5EB 2B8NA 5HR5A 1XCMA 3LGXA 1P31A 4KK4A 2Y9MB 3NATA 1IIBA 5CB4A 4HUJA 2O2JA 4R9RA 5K9ZA 4ACAA 1P0CA 3AVXA 1M8GA 5DASA 4RFVA 4QU9A 1WXEA 5EQDA 4J7CA 3TTVA 3W7AA 4N7BA 5DYIA 4AG5A 4Z49A 5M2QA 3QVKA 1QVVA 3G9TA 3KB6A 4FT2A 4JVNA 4RPCA 3DLAA 3SI7A 4UHKA 2Y6UA 1NPDA 1G20B 3OU2A 1QSGA 2HU2A 1UC4B 3TRIA 2EDCA 3L4BA 4R69A 3FPGA 1Y1RA 1GG5A 2G8NA 4KR3A 1UBNA 3K31A 5DBGA 4ZAVA 1GGVA 2ZE6A 3F71A 4HGQA 1EP1B 3I04A 4WEOA 1UPUA 3CF2A 2DE0X 4G0VA 1Y8RA 5ISMA 3LRTA 1I0ZA 3VYTB 1W29A 3VR2D 3L4JA 2SECE 2DWCA 1W34A 1HNXB 2J4FA 3RBZA 1QGDA 5LZ7A 3TCXB 1E1MA 4OHPA 4IRMA 3UKDA 3A6EA 4GNKA 4C2AA 1OX5A 4C3ZA 4QLOA 1LJUA 2VEOA 2N1BA 4J4BA 4LS3A 1VC2A 1GRQA 5EE3A 5L6MB 4OJYA 4YRNA 2XXAA 1RTTA 1W0CA 2IU4A 3OJLA 3R3WA 5D51S 5JWRA 2A5YB 5JVDA 2DQ4A 5A4JA 3FPJA 3J81k 1QRSA 1F2TB 5GONF 5IVKA 1IK4A 1NHGA 1V1MB 1E1YA 4X90A 2DXIA 1Z22A 4RV4A 2XHEA 4MZDA 4V02A 1S1MA 2JCYA 3KQVA 1UQUA 3K15A 3PJGA 2DSNA 3P26A 4UVHA 3OCXA 1MBZA 2QE6A 2QROA 5JMTA 4RM2A 1O9GA 2PN1A 2YZ2A 3O9VA 4Z9AA 4DJDC 3F6CA 2OMEA 4GI3A 1TA4A 1Z38A 3BCUA 1G7TA 5LA6B 3WB0A 1W44A 5DE3A 1YS9A 4IPTA 1XQWA 4Y18A 4WCVA 4UEQA 3HUFA 1RAHA 4NBKA 1YV9A 4BDSA 4BO4A 3N0RA 4J91A 3DKRA 2JFUA 3IUBA 1C30A 3PBKA 1DKMA 1G4AE 1YQGA 2EFJA 4NPAA 2FPLA 5KYKA 3B3JA 4CCAA 4F45A 2BYTA 1F2UA 1MC1A 1R00A 3AUYA 4KDRA 3IXMA 3W3AD 5TC4A 2OWEA 5LYJF 2JDID 2EZTA 5K2OA 2Z1MA 4F93B 1A8QA 2XKAA 2XUPA 3STXA 3DV0A 1TLFA 4LCBA 5FOSA 1ULTA 4J0FA 5G1PA 2GHRA 1EUDB 3JV7A 3QE0A 2W37A 4LYJA 5JO9A 3NR2A 3FDZB 2J9XB 2C98A 2JIQA 2JGDA 2X41A 3DKVA 2WHPA 3PNLA 1OAKA 4MQ4A 4OHOA 4OA5A 4S2EA 4EG0A 5BMVA 3MLAA 1QRTA 1AGYA 2HK6A 4IH9A 5KJ6A 1ZXXA 4M86A 3T99A 4F92B 1Q1AA 5IFLA 3RB8A 1O58A 1XEXA 4YJFB 1TXGA 2NADA 4U5XA 4WZBA 3U39A 4ESEA 4HEA6 1M2FA 3EGIA 1H0HA 2CK3A 1CDEA 4RAQA 5KC9A 1D0IA 4QGBA 4O2LA 2DVMA 1YQUA 4AZTA 1WXQA 3HJTA 2R751 2B82A 5K6RA 1P6XA 4BU1A 4LZPA 3C4VA 4C7XA 1T3HA 4P4NA 4OJKA 5BQOA 3ZWKA 2YVLA 3TQFA 2QW0X 4JWKA 1ZHOA 4JELA 1OLUA 1E6MA 1UXJA 1XB2A 4LMRA 2H6EA 4QEKA 5EIHA 1W46A 6AT1A 2C0PA 1VCMA 4GH5A 2O0LA 3L04A 4RZ3A 4IV0A 1DUVG 1ZLYA 1PFUA 1P4JA 3MCVA 3RUCA 5HIJA 3KT8A 3VHXB 1ICIA 1SVOA 3FPCA 3OKCA 2XNSA 2ZU0C 1OOEA 5IJAA 5CFNA 5HWSA 2H63A 3BE8A 1I2ZA 3FMGA 4JBGA 4MV0A 3QP9A 4O08A 4WERA 1TZMA 3KFVA 5DBIA 2DBVO 4CL2A 1P73A 1N2SA 1UJ4A 1CE8B 1F14A 2C95A 3QBDA 4NC9A 5GONA 3NHRA 5TQVA 3ECAA 3RC3A 1DIGA 4BLTA 4BO6A 2NUBA 3LL4A 2PNFA 4QSHA 2JS7A 4Q9KA 3I2FA 2HCJB 4KXUA 5KOJA 4CM9D 2ZKLA 3K1TA 5ARDA 1PR4A 2JNWA 4NDZA 1EK5A 1WU8A 4E5NA 1DAIA 2RHGB 1L5QA 3BBLA 5TS3A 5J63A 3RSQA 3KV1A 5BORA 4KC0A 3WK6A 1ZD5A 1C9JA 2W2KB 3B1FA 3MD0A 4N5DA 1KXZA 4QGAA 4AO7A 4DRXB 5TPWB 4DZZA 4ZOBA 3GCGA 1Y5RA 1LK0A 3QZUA 2WJ4A 4DWOA 1UBMS 4FHZA 4ZJPA 2FUNB 2PPVA 4TMVA 1O87A 1OWPA 3C24A 4G0MA 4RS3A 4ZKEA 3ICPA 4IHKA 2CLIB 2JVJA 1RI5A 2QTHA 4H7EA 4Q1FA 1AK9A 1UJ6A 3TD9A 1J8MF 1UKZA 1EUQA 1EGHA 4LRQA 3DPIA 3CKLA 4EJSA 3QPUA 1JIUA 5LVAA 2QPAA 1W36C 2R11A 5DHQA 2AYYA 1V5WA 5LYJA 3LHKA 1GPKA 1PEAA 5DRTA 5ADHA 2VDPB 5DNVA 1VIYA 2FI1A 2NX2A 4LF5B 3MMZA 1M3SA 5AJWA 4EI9A 4JI1B 2G1UA 5EGSA 4QXRA 4L4YA 4GOLD 2P27A 1JG1A 2BFFB 3CT4A 3Q6NA 2H7VA 5F2NA 4OA8A 2PWZA 4JI4B 1GZ3A 3DFIA 4FC6A 2SCUA 3OOWA 3ZIAA 3GCWA 3ZD6A 1RVV1 3EGCA 4RH0A 2UVPB 4KKVA 1EEHA 1P1CA 2WV9A 5AW1A 3OLXA 1U7XA 2ADFA 3MK31 3T1NA 3ZK8A 1K5GA 4EGFA 2RAFA 3NBYC 3O2JA 5SZJA 3ZZNA 1E79A 3NBQA 4YC7A 3N6VA 3LF1A 2J48A 3BULA 4L9AA 1WLYA 3RSHA 4IIEA 1T9AA 4D0NA 1UK6A 3WADA 4E2XA 1H4VB 3ISJA 3AM3A 1Q12A 5EP3A 5JCXA 2A33A 2DT5A 3EZNA 3IVAA 4UM9D 3W2HA 3EIWA 3KQKA 3IJPA 3GLHA 2HB6A 1Q57A 4PRKA 1UZNA 1G7RA 5AJHA 5H83A 4L7QA 4ACBA 2C4UA 2VNHA 4HAZA 4UAVA 4ALMA 3O82A 4P5PA 2PUFA 3R8XA 3OECA 3PXDA 3K6JA 5BSWA 3HKDB 4FX2A 5U1PA 1N75A 2QZJA 2WINI 2YHIB 3C14C 4FKZA 4M1ZA 4UXHA 2YN4A 3QU2A 4BAGA 1N0HA 3BGIA 3KO8A 4H27A 4LGVA 4H3SA 1NI4A 2WHQA 2C58A 3QQ5A 2CHFA 1H85A 3R24A 3SFTA 5LWQA 1AE1A 4REOA 1BVUA 3ZCTA 2GYYA 1JHZA 3IAXA 3CR7A 1ENZA 1G1MA 2P9ZA 3H5RA 1VG9B 3QVUA 1IBRA 5DM4A 1L3BA 4HADA 4JLBA 4Q9HA 5TMBA 1FTNA 1DXOA 1UT6A 1ZNZA 2YYAA 5CG2A 4G85A 4YCDA 3R7FA 3H04A 3ADBA 1Z36A 3MTIA 1M2OA 4N8DA 2EV9A 1H2RS 1X1SA 2GD1O 4KO3S 1A5ZA 2F8LA 2QIPA 5AKZA 4B46A 4C4TA 3B20A 3EIEA 1ZGGA 1U8UA 4D8WA 4HB2A 4Y2JA 2OOKA 3N0WA 3WRXA 5H0IA 3ZDFA 5ITWA 1IJFA 1T2NA 1PZNA 5FWXA 1CCWA 1MJGA 3HA7A 4FIZA 4XQ9A 5SYNA 1A1SA 5TEWA 1L1RA 2PKQO 4UMFA 3WRYA 2PCJA 4DR5B 1EWTA 1PO7A 4H3KB 3IX7A 1YB5A 1KJJA 5G0SA 1JE0A 1BH6A 5F2EA 2Q2OA 1LWNA 2ZYAA 3JD0A 1BRMA 1DC7A 3AP2A 1THGA 2V5VA 1Z6XA 2AFIB 1ZW1A 3M6UA 3OIVA 4RSGA 4F1JA 3T1HB 1DDIA 2LV8A 2X6TA 4RD4A 5DWDA 5EHGA 4LBWA 2HRBA 1F4LA 4ZEWA 5DCYA 3A4MA 2JCSA 2YFKA 1M8JA 2VQDA 3BC1A 2D7JA 1UJBA 5LFAA 4GOKA 1ATZA 2GBCA 3JASA 3JQBC 2HF8A 1YACA 1D9XA 1TM3E 1ZCJA 3H1AA 3PRHA 3UCEA 4CDMA 1JDNA 2ZXUA 1X39A 1GRNA 4ROTA 5HA5A 3OA0A 4WCDA 4CMKA 3ZWXA 4RK4A 5I9SA 2F8TA 4RSMA 4YUXA 4EF4A 2PCLA 3OPVA 4RIFA 1SBIA 4EA6A 1C0LA 1TYAE 1J8DA 3OX3A 4FJ1A 2DFTA 1Q92A 4BMYA 1OXKB 1UJNA 2BDTA 2LKCA 4V0SA 5G4LA 2R6GA 2BEJA 4KB5A 2W8BA 3ZE9A 1GEGA 3OESA 2XJ4A 3UATA 3MCUA 3NEYA 4D74A 1NNLA 5JECA 2XPCA 2KYRA 1USKA 2GYUA 3LIPA 2BJWA 5L3ZA 1WM1A 4X20A 1ZOOA 5J9FA 1NDQA 1KVQA 3BK1A 4TSRA 4FVTA 4WX2B 4B34A 1QP4A 4AKTA 1CNMA 1GGJA 2G1JA 1XP5A 3BTVA 4ZHSA 5ALQA 1AKTA 2FW9A 2HLHA 1LBSA 2ZSEA 1Y4ZA 5H3HA 3GVCA 1TLTA 1KGDA 1K92A 1H6CA 1CRLA 1MO6A 1N9ZA 4GG1A 4PSDA 3G1WA 5CCEA 1DWUA 1PI3A 4MW6A 4B6JA 4A8HA 1FS5A 2X5KO 1GU7A 4QSMA 4R0VA 5IF3A 5BNZA 2B6NA 2YNMA 1CJKC 2HGZA 3ILYA 4Q7MB 1Z5GA 4EKIA 1YE5A 2XD9A 3F73A 3P7MA 2HBZA 1I1QB 2IXGA 5EHIA 4AIRA 2JD1A 4I1YA 3R6TA 2XT9A 1I32A 1YS4A 2GJKA 2W6ZA 4RTQA 1SC1A 4OMUA 4MWGA 1B8UA 2H1CA 3HR7A 4XPIB 5EXTA 1CRZA 1P5RA 2H06A 4ABYA 4XWWA 2I2WA 2GB4A 1PGNA 1KDOA 2IV2X 1JTFA 4EB6B 1M34E 2I2CA 1FY2A 4L8GA 4BFCA 3RIXA 1IN4A 2W4IA 1YS6A 1L1QA 4JC0A 1PE0A 2Q8PA 2QRZA 1FUKA 4LJYA 2MT9A 4I2NA 4IWNA 4QBFA 4RY8A 2HHCA 1SHZA 1LPAB 2UZ1B 1BDBA 4URHA 2ZJ8A 3OE1A 2EZUA 4OATA 5IASA 3QSYA 1ISPA 1UAYA 4Q1EA 2HPHA 4JLAA 3T1TA 4P82A 2EZ9A 3T3GA 4OFXA 4P22A 2NM0A 1SHTX 5FFMA 1BIFA 2ALJA 3D8RA 4GUAA 2FN3A 4L74A 4C29A 4I2VA 4F4CA 1I3LA 1QOZA 2J0UA 3HU3A 5TJ9A 1ETHA 3PLRA 3W5JA 5COBA 2XQVA 3UO8B 1XNQB 2QN6A 1O6GA 2Y1XA 3RTCA 2F4VB 1NFQA 1V9CA 4E6PA 4UE6A 2C88A 2JB9A 2V9CA 1KQFA 1OU4A 4OK6A 3UF0A 1PL8A 1UWLA 2QR5A 2QN2A 2W70A 3X1KA 1E1LA 4N8SA 5AW5A 4HZUA 5JS7A 5KU1A 2N47A 1CJVC 1EVZA 3BXXA 1NJ8A 3UUFA 3SS8A 2FZEA 3V4LA 2ZJ7A 3R9XA 1VGQA 4RKQA 2OO5C 4F60A 4XX0B 1PX2A 1V6AA 1FS6A 3PFHA 4P7BA 3P9PA 3UMVA 2PZBA 4JJZA 3ZWVA 3TVDA 3B52X 1XTZA 4QOHA 5A4KA 2I8LA 3OPMA 1QWOA 2CE7A 3K71B 1E9FA 1WULS 2Q6IA 3M2TA 3A27A 2JIPA 4PFJA 3TNYA 2VKTA 2ZT6A 1P0IA 4BNFA 3MNFA 4WFIA 3LI2A 4C2UA 2E1RA 2GX6A 1P2TA 1RQGA 1ZISA 9ATCA 2YHUA 1CUXA 4F3RA 1R6DA 3A31A 4KTTE 4U2CA 4B44A 5ADWA 4PNZA 2A1UA 4C22A 5K0FA 3OOSA 4J0CA 3JQRA 3HY3A 4Q9JA 4YUAA 1SBTA 4F06A 4H7PA 3O95A 1N2IA 4HBZA 5JLAA 4LYDA 3MJVA 1XCLA 2PJRA 1BROA 3LWNA 4ENQA 2ZPUA 4W5TA 3QU5A 5JAOA 4DF3A 2GKOA 1VL0A 2AUTA 2A78A 3HJCA 4C4SA 1RYBA 3TZBA 3PGLA 5DEOA 3QUSA 4EI7A 3BA6A 5EXDA 4F3NA 5FTLA 1P3DA 2GD6A 2SNIE 5ES3A 4BDTA 2QN9A 2HHAA 4PNHA 1DEAA 1H0KA 4IBOA 4PZZA 5EIEA 1G6HA 4R1QA 2JLBA 3EXHC 3ZOKA 4IL5A 1N2CB 5C9ZA 4NV3A 2NO1A 1BCRA 3QEOA 5FKJA 4D4MA 1NG1A 1J97A 2PT7A 1Y6JA 1BDMA 3F9IA 3AWDA 2P67A 2HNKA 4AJHA 3S1AB 3FMPB 4DUPA 3HKBB 3TVTA 3RAEC 1WG8A 2GARA 4IIVA 1G8AA 3UOGA 1P77A 1QCDA 3EQ7A 3VI3B 4ERXA 4WBNB 2CKMA 4DGQA 1YAHA 1JHPA 2QLTA 3C0KA 1DSSG 2I2XB 3CLVA 3OCZA 4M7RA 1IOWA 1KI3A 3OEHA 2J6HA 3QVJA 4YAOA 2OD9A 1SD1A 4BASA 4CETA 2OAP1 3A4TA 4HG2A 2PIDA 1M8PA 4ZYVA 4WKPA 3OQOA 1MVNA 4CKXA 4IKPA 5FJIA 4EFDA 4DV5B 5J40A 5JYCA 1ZVJA 1CDOA 2LDXA 2PUTA 3TR6A 1CWUA 3LC7O 1G2PA 3UMSA 1J2YA 2QT9A 5TMEA 4BGEA 3IEXA 4RPKA 4TTTS 3BRSA 4BXOB 5IJZA 1Z4NA 1A3CA 2PS0A 4U3JB 1LK7A 1LZKA 4X85A 3OY7A 1NR7A 4IIFA 2LXNA 3IP5A 3UQZA 1DB3A 3QXSA 2AOUB 4DJEC 1YZVA 3RS7A 2IXFA 3PDCA 2Q29A 5ARBA 5C46F 4A0HA 5B5SA 2ZRDA 4ILKA 5EE0A 4JT9A 1XLWA 5CNJA 4MCAA 2NO0A 3M5DA 3V4RA 1L8XA 2O1EA 4J1TA 3LT1A 2ZSFA 4I66A 1UJCA 1GUYA 2AB0A 4LW8A 3KYDA 5ALDA 3WL7A 4JBNA 1WZ2A 3VSDA 2D2VA 3NX4A 2VHEA 2QMHA 4HDOB 1WBJB 4EY8A 2F55A 1AXGA 3LCVB 4BX9A 1IHOA 4LJSA 3G9QA 3DHWC 4YJ3A 1L5GB 3VZDA 2JATA 1QDEA 5IXYA 2Q5QA 4R8LA 2HTFA 2R6HA 3KOOA 3E23A 4OIFA 4DMRA 5M5BA 5M3BA 3S8EA 2VYVD 3DEIA 1T1JA 2IS2A 3R7AA 3MCZA 1T9GR 3BOSA 4JXXA 3WY9A 2A3RA 4RMJA 4IIJF 4MAFA 3PNKA 1JBQA 3RKSA 3W7VA 4BWYA 1QQAA 3PFFA 4F1KA 1SHLA 1J1IA 2XDWA 3IILA 3JRXA 4TMWA 3HVHA 1OE0A 4DPKA 3DC7A 3LZDA 1YC5A 2EJUA 4IX1A 1Q1ZA 3HR8A 4NYJR 3HO1A 4PO8A 4RTPA 3WA7A 4Y9UA 1I7NA 1USWA 4LJAA 3VR5H 2Q1UA 4Q24A 2H3EA 1S0UA 2QP4A 1GUAA 4MMZB 3WK5A 1SHKA 3FSGA 3TOCA 3MWDA 2Z2YA 2YWJA 2OT3B 2JD0A 5FR2A 5KO2A 3DNFA 1PN3A 2AT1A 1FBTA 2FGJA 3AF2A 4BUCA 4P7KA 1N6LA 1PLKA 1IBSA 1FU8A 5LLTA 4QBTA 2Y9PB 4DMFA 2YXPX 1XDUA 4MRPA 4YP0A 4GU5A 1GV0A 2CZGA 2P4HX 1YRQA 1K7XB 3FWYA 2ZJ5A 4XDHA 4EUNA 3IEMA 1KO8A 4HWOA 2QJFA 4ARCA 3WMWA 4DUGA 4FSDA 4LF4B 1KI4A 4A8JC 5KYUB 2EZ8A 4ZQHA 2CHVA 2IOFK 2WJVA 3ZZUA 1XZJA 2ZUVA 1Z4IA 4CKBB 2G08A 2HRZA 3F3MA 5DSZA 4BQIA 1ONOA 3L8DA 1PD0A 3O21A 3OEEA 3GLIE 3KK0A 2O14A 2PRJA 2VPZA 2JI8A 4K8OA 1E3DA 4IFBA 1T15A 3FZGA 2UZ4A 3LTNC 3JWPA 1SAYA 4WLUA 5HILA 2PL1A 2ORYA 5COQA 3R44A 1T5OA 1UMCB 1VJ1A 5FT9A 2RGUA 3VH4A 4QO7A 3ZHYA 2JIDA 2OVBA 5E3JA 1V2HE 4MS1A 2OCDA 4QTUB 5KYWB 3WNBA 2W0MA 4RA9A 1QO7A 2PLAA 1K7EB 2PT5A 4AJLA 2OK8A 4FGLA 5JZ9A 3MS4A 3TRJA 2WSYB 1ZAKA 1NBMD 1Y5IA 2H92A 3EG9A 3KWLA 4IDNA 4GE3A 2PZKA 3G8BA 2ZE8A 3Q15C 1T13A 2Y0PA 4V0ME 4R31A 4CCWA 1G5HA 1V5GA 2OKGA 2I4RA 4EQ6A 4HCJA 3QOWA 3KVVA 4AC9A 1U3FA 2D8AA 1QVWA 2HA2A 3C3BA 3OIGA 4P80A 3R6GA 4TLMB 4TQGA 4ARZA 2JFHA 1EA5A 3A1DA 3Q40A 2IUTA 1F7UA 4JI5B 5CB8A 5DM2A 4PHFA 1QCZA 3NUQA 5TEVA 4IIJA 3HCFA 2JI7A 2F1KA 421PA 4PZLA 2MTBA 1H2HA 5B3KA 2GSWA 1H1TA 2E3JA 4RDXA 1SKUA 1E7WA 2KE5A 5IH7A 3IPAA 2CJYA 1OVGA 2H59A 3OX2A 1C8LA 2Q0HA 4B9EA 4BV9A 1YFLA 3R6LA 1RMTA 1QQTA 1VCIA 1I4OA 2A94A 2YV5A 3BDVA 3PQ8A 3QBEA 1FRFS 4DR7B 5JJCA 1T9BA 1PNRA 4IQ4A 4AQ7A 3GEIA 5B7PA 1FX1A 2R6JA 4X71A 5CDGA 1GJRA 1MJGM 1NXXA 3HWRA 1AY0A 4MDYA 3TG2A 3DTTA 3HFGA 1DAFA 4Q66C 2V7EA 4YUVA 1FDSA 2ZR8A 4XCQA 3HB1A 4XVHA 2J7PD 2QUAA 1HZZA 2OORA 3JXEA 1R0YA 5K1ZA 3WYGA 4NCAA 2ZUCA 2PGLA 2Y77A 1UOPA 3R5HA 1IYZA 5DJ5A 5A7FA 2WHXA 3M1YA 1PK8A 4MKIA 1R5BA 3D6AA 4OB8A 1H8EA 4OAPA 1GR1A 1NBHA 2ZRFA 1IDN1 1UOOA 4EW3A 5C51B 3ZNNA 3WMFA 4DSTA 3HWX1 4MWDA 4JJIA 1FPMA 4PZ0A 2ZUSA 4PCVA 3BKXA 1WOMA 4P3OA 1O8CA 4YAGA 1CFZA 2ID4A 2QZSA 5B3JC 5L3QB 1PZHA 4QUGA 2F64A 2OXFA 2JA1A 5EAIA 1RLJA 2CEAA 2GNAA 3PQ7A 2IRWA 3M6WA 3PWTA 4MGZR 4PAQA 2DR2A 3F0TA 2OBMA 1GPAA 4LYEA 1QHNA 1T1GA 4JBXA 3T0IA 2X42A 4N01A 3IBYA 1JEYA 3AKEA 3UK2A 3AL0C 4NICA 4C43A 3DZDA 2BMJA 2AJTA 2VJPA 5AI6A 2ZIEA 5I7OA 1XDSA 3G8CA 3OICA 2C1ZA 1GQYA 1BMFA 1F8GA 3CX7A 5E7IA 4WCFA 1IJEA 3HDJA 4U00A 1D5CA 2JAUA 3UYLA 4FZVA 3DYVA 2BN4A 1DXYA 1R4NB 1MC4A 1JXOA 3LTEA 4XOIA 1GCUA 2LTAA 2BMVA 5CGQB 4OGFA 5A05A 3GJQA 1W73A 5AK6A 1ZI8A 2I76A 4KR6A 2IHZA 1JSZA 4RTRA 2VN8A 1OFUX 4OO3A 2CFCA 2PGDA 3OM8A 2OXTA 4BZZA 2IEBA 1T9HA 4S1PA 3PNSA 5CH8A 4RTNA 1MEOA 1CERA 3HN2A 3BE5A 3GBSA 1UKVY 4NSNA 2B9VA 3SSNA 1RC8A 2HRCA 3D2CA 1M8KA 5B37A 1BOOA 2V74B 4EG4A 4EUSA 4LV8B 2VTEA 1ZD8A 4OSPA 3T7CA 2ZTMA 3UUEA 4X64B 1SUAA 4IHAA 3UT5A 5JTUA 4RCYA 3EGVA 1A2KC 3JCZA 4G8CA 1LH0A 4TT8A 3SXJA 3RV4A 2I6XA 5F3WB 1CQIA 1EJ2A 4ZODA 3LUBA 4Z9BA 5ERXA 3HU5A 4U2FA 1C81A 4D8YA 2GAJA 1IY9A 3N0TA 4S24A 4AN1A 3PXBA 2KQUA 3A6DA 4NFYA 3EBOA 1LDEA 3OX4A 2IHNA 2H29A 4UW9A 5K3BA 4YXWD 3MOIA 2FJUA 2RH5A 2WKWA 1SWWA 3ND8A 1DKRA 2X4GA 2FFHA 3RYIA 1I2MA 4Y2SA 3I1IA 4U2KA 3Q9LA 5HCUA 3RT9A 2ZAMA 1CF4A 5KHLB 2XWSA 1KDTA 1C7RA 1KYWA 2FETA 1IIRA 2P2SA 2R97A 3HV0A 4IGEA 4TGLA 3KZOA 1RWXA 3RBXA 4C7MA 4HMQA 3U4HA 3D3WB 4H7KA 3P0FA 3X1YA 2VQSA 3LLSA 3R0VA 4MRAA 6ABPA 1QHHB 3P0HA 4GPEA 5AK4A 3O8LA 2H1HA 2I62A 4KLZA 4K6MA 3WOVA 2WFZA 2JG3A 2O2HA 3V4ZA 5JIBA 4COKA 1G16A 2QRLA 1WTAA 4K28A 4X92A 1VIVA 3G49A 5B4UA 3ROKA 1SQSA 2XRFA 3JATB 5ALIA 1LXCA 4R68A 3FFXA 2ONKA 4KXLA 4L02A 5JD3A 3VBEA 4AZ3A 1E1RD 2GESA 1XP8A 1X13A 4M98A 1VOTA 1FQWA 4YH1A 4LXGA 3LIIA 3AF4A 3EN0A 2VHUA 4MVJG 3NTRA 5BSRA 1O4WA 2GJ8A 3ETNA 3ZDXB 3UXEA 2HU8A 2JHFA 4M1TA 4UBOA 4YRTA 3R3UA 4J1QA 4A0SA 4E7OA 2C42A 5A3QA 1HF3A 4UCXA 3PWSA 1OY1A 3FCSB 1QYCA 1XXHE 2BD0A 3FCOA 4Y2TA 2IYXA 5D1HA 1HOTA 4DNFA 4EPTA 4AKSA 2C8VA 2J0QA 2A5FA 3C6ZA 2GK7A 3LCUA 3T15A 2PQ6A 1YGPA 4UDNA 3WKAA 4ZGBA 2OFWA 3G7UA 2PO5A 1JJIA 1QOPB 4AWBA 4G9EA 4DGSA 3AHCA 4C4OA 4DKXA 3SP1A 4QBGB 4TQUS 3WYAA 5HKKA 5LQJA 4WESB 3ZJVA 4FMDF 2ECKA 4GI7A 1B00A 1GUDA 5WRFA 1ID1A 3A4YA 5HIMA 1RZVA 2LIVA 1L7VC 2P3LA 4ER0A 2Q5EA 3HA3A 2EXXA 3LDGA 3KC2A 3OZXA 3ZE0B 4L4SA 4DREA 1NY6A 3FVRA 1SVKA 4ZZ0A 2Q7DA 4BO2A 4EAAA 4JX8A 4UE3S 2MU1A 3MWLA 1TC2A 4HNAA 2CLOB 3SZRA 4TLBA 3ROXA 2OV8A 2X5JO 3DOCA 1EM8B 2Q9CA 4J0QA 1DIRA 4LHZA 1B8PA 3ET4A 3A1CA 7GPBA 4YV2A 3GUZA 2VYNA 1KTVA 1N9GB 2Q6TA 4FFBA 1U9IC 2IS4A 4ZP1A 2D1SA 4P34A 1TGVA 3COVA 5I47A 5EI5A 2VT2A 4GI2A 1VLMA 2B37A 1WMEA 2R8BA 4MQBA 1PTKA 1YBFA 3A9RA 3VNSA 4BNIA 1JHDA 4D0GA 4M54A 3CO5A 1T4MA 2RHJA 3MJDA 3O2SB 5AJUA 3ZWPA 5IVPA 1UR5A 4E5SA 2C9CA 1Z7BA 3MXTA 5BR8B 3VNVA 2YXNA 1IUPA 2ZAIA 4N3GA 3FVTA 2VRBA 4OJTA 2J3DA 4PEVA 2CMHA 4DHEA 4CM6A 1V4NA 4QJ3A 4F4UA 1VE3A 3W4KA 1EUCA 3Q8WA 3ZR4B 3UAGA 4TWZA 3U26A 4MPTA 1E32A 3SQDA 4D9NA 1M83A 4N5NA 1TK2A 4KV7A 1UFOA 2IU3A 3BEOA 3TFOA 1P80A 3I5UA 1WB6A 4R7ZA 3TL6A 3EDMA 5C37A 4KFCA 2QSYA 4QYXA 2VF2A 4RL6A 2G3YA 4C7JA 3IEKA 2AL7A 2DCMA 5KYYA 2DEUA 4JBHA 2A86A 5BNIA 3DMTA 3ABIA 1PZFA 3ZTWA 3RIYA 3T1YB 1JI3A 2LNDA 4YRGA 3NHYA 4OSEA 3BH0A 1YU6A 4Q00A 1XRQA 2Q07A 4EIWA 5BY2A 1CHDA 1DRJA 4M37A 4QELA 5FUXA 2V03A 4Z4EA 4CTOA 3LCJA 3U4MA 3PDIB 4FFRA 2OAGA 1NVXQ 3NEAA 2QP9X 4V0OA 2V4ZA 4OHBA 1PG5A 3C8ZA 1JLKA 2AW3A 2VZ0A 2WABA 2BC9A 4KZKA 4OXNA 2DY1A 1G21B 5TR9A 4E22A 4HH1A 2PH1A 3AINA 4QOSA 3VH1A 2A92A 1OHHA 1DG1G 1E2MA 5JWHA 3ZLTA 2JCBA 1F4PA 3D0QA 3EXHB 1QHSA 4YMSA 3UC5A 4M9ZA 1A9PA 1DCFA 1SOUA 2R7NA 3BZBA 3GLSA 3PUXA 4I1IA 4JUBA 2ZUWA 1KH3A 1JKJA 4LYFA 4O2AB 4XXHA 2ZYSA 2XUFA 3I23A 1Q0TA 1HE4A 5KCMA 4GEKA 5CHEA 1XZGA 2PKXA 3PUYA 4FQ5A 1S02A 1U0EA 2ZIWB 3SY8A 4XQGA 1BVHA 1ZM2A 3D43A 1VIAA 4P0PB 1M8FA 4C5BA 4MYTA 4QPCA 3DOEA 5HDBB 1MA3A 3DW1X 5CXSA 3MFQA 1K6MA 2FEKA 5KPJA 1IZZA 2Q28A 3DE3X 1SPXA 1HK7A 5LMUB 2Q4RA 2ZVDA 4JDPA 1VPLA 4BNTA 1K9VF 2W6IA 4FNOA 4N0DA 5IZ4A 5JO0A 3B9QA 1WUYA 3D2AA 3OQVA 3GLQA 3R3JA 3KXIA 3Q7PA 4H7HA 4XSGA 1JR2A 5DYWA 2RKBA 2GPSA 5K8TA 4C0BA 2B9EA 3ZDDA 1HV8A 2JKYA 2D62A 1CUJA 4KAAA 5LL6P 3LPDA 1IEVA 5BO5A 4H17A 2DHCA 3W5BA 4ASUD 5L3VA 4GGOA 4B79A 4D46A 2G07A 4YREA 4DC0A 3W6UA 4B47A 4MUHA 5FBZA 4BQNA 1CD5A 1D4AA 5A7GA 2YCBA 3Q5DA 5GVRA 2FEPA 4OQ4A 3Q72A 5CLGA 2VHTA 3M8KA 4UU8A 3EVGA 1CZNA 2IVZA 5ADVA 1AV7A 2NLOA 4YA6A 3L0OA 2JASA 3GRUA 5KCZA 4NARA 2FK8A 3PLNA 4BX0A 1SU4A 5IKPA 3OMLA 4HSGA 5ITVA 2APJA 1YRBA 2GM5A 1T6XA 2VDUE 3T7DA 1ECFA 2CNDA 2D7CA 4GGMX 1N36B 3DM5A 4BNDB 1R3DA 1ZINA 1VZ3A 4FK8A 5MN4A 2O8EB 2W48A 3AEQA 3BQMB 2I4LA 3MSCA 4Y67A 4YJGB 1LNQA 1P45A 5HMMA 5BVHB 3E3AA 2Z6QA 2PANA 4DLSA 3R3ZA 3F2IA 4E51A 5FWYA 3U4QA 1N1DA 2CVFA 4UM8B 5AI8A 3ND6A 1MIOB 3CLSC 4AN4A 4AYXA 2JCXA 2OC4A 4YMWA 3W9YA 4OSOA 1XDBA 2BGLA 4BN4A 3R23A 2EKPA 4OQNA 4PYKA 3OM1A 2VWPA 5LA6F 3GDWA 1PW7A 4UHFA 5AVQA 2UYGA 4W1SA 1FFYA 3EF1A 3UGKA 3DFUA 3ZHVA 1YOBA 1LPNA 1XJWA 1Z2OX 4O0LA 1YNSA 1H9AA 2B7BA 3V8PA 1QPZA 3MBIA 4RIGA 4M6WB 2C97A 2FWPA 1PUIA 3DBRB 3I8SA 5F51A 5I48A 5JADA 3KJIA 1M67A 1W4ZA 3KSBC 3LQRA 4TV9B 3M6AA 5CHYA 4W7SA 3T94A 3N9IA 2XCOA 1S6YA 2QA5A 1RPAA 2VZ9A 4QNRA 3FDFA 2CHQA 3GXOA 3EUEA 4HP8A 4TMTA 4K7JA 1Y33E 1E6UA 1EFTA 3E4CA 1U0FA 3A2KA 1M33A 1ZH6A 1KOFA 2QS9A 1B6TA 2H08A 4GKAA 3DTNA 1ISIA 1WZEA 2CL7X 4WPGA 5C5EA 2A0YA 2R1ZA 4CMEA 4BKMA 4D9HA 3FRJA 1PX0A 1W5EA 4EZBA 4PXAA 4ZYWA 2NWQA 2ECQA 1J5PA 4DG8A 1NMQA 4CIXA 1RS0A 1G41A 3NFRA 4PLHA 2FH5B 2ZB2A 3NJRA 3R8CA 2ZSUA 1KMNA 3KR2A 3RF7A 4DQLA 1Q5PA 4BRSA 3C1OA 1EBBA 3PGMA 2X2PA 5D1NA 4NBTA 1P91A 1ZCBA 2FU5C 2GTIA 2OO7A 5JCJD 4IOLA 2XW6A 2YMMA 1QH1B 4FGUA 4NKRA 1RE1A 3KQSA 4I5DA 5ANRB 2WIFA 2GEUA 4ND2A 3BXGA 2ZB7A 5AM4A 1K3TA 5AM3A 3HJAA 1OFIA 1Q44A 3LGSA 4F4HA 2IE0A 1DC6A 2OK7A 3WKEA 4QO8A 3EXEA 2D1YA 3BSFA 2FUCA 1ZL2A 1T5IA 1QBKC 3BMCB 1E2EA 4B71A 4R5HA 1XDZA 2OP0A 2YXEA <