2P7TA

Crystal structure of kcsa mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tA02
4R9HA 5IHBA 1FL3B 1CFQB 5H35B 4QKXB 1DVFB 4F7EA 2BVOB 3OZ9H 3MZGB 1N8ZB 1QZ1A 3EO9H 3WO3B 1BFVH 3L3GB 3LEYH 4GAGL 1GSMA 5JLZB 3QUYA 4XP4H 1MAJA 1D9KD 3TGXA 4G43A 4D9QD 2IFFH 4NKOB 3U7YH 1HQRA 1Q9WA 3HE6B 2XKSA 4Y5XA 4HS8H 1OAXL 3DUSA 5IG7B 4Y1AE 4NUJA 4MNGB 4TOYH 1LEGA 4WGVB 3KJ4B 1K3IA 3MRIA 4MA7L 3VD5A 3WIFA 3JV4B 2O5ZH 2PCPB 4YX2H 4PJAA 2CDEA 5I2IB 3VXTA 4K3JL 3IGAA 5D2NA 3NTCL 2FHBA 2ZJSH 4JKPH 5GRJH 3DV6A 5J56B 1GHFL 1MIEH 5CSGA 4KK9D 4PJFA 3JWDC 4YHNA 3QRFM 4OKDA 2WQ8A 5FUZH 3UJTH 4OZIA 3P9MA 1EXUB 4PRDB 1WZMA 1N4XH 1UEMA 4ONGL 2I5YH 5B8CC 5I1CH 3OKKA 2RR3A 1GC1C 1GZQA 4BYHA 4X4MA 4Y5VB 3KAAA 5K59F 3DX7B 4V2BA 5F7LB 1VSCA 2DYPD 4MJID 4PJGF 4LNRB 3MA9L 1IARB 3C2AL 3U82B 4QOKE 3MLYL 4KI5E 2BNRA 3MV9E 1KB5B 1MEXL 3U4EA 1MCEA 1EA9C 3BKCL 3IFOB 4AJ0A 1KIRA 1R0AL 2JJSA 2W0KA 3HAEB 3O3DB 5EOQH 4DZBB 4WIQA 3OTTA 2IH1A 1RZIB 1FFNA 4NKMA 4XHJD 4JRXD 3BOVA 1IMHC 5GGSB 1J86A 5JDJA 4X5WA 3QCUH 2JIXD 1NGQL 3CDGB 3VXUA 1YY9D 2AKRB 2BVOA 3R1GH 4PJGB 5D1ZC 1L7TL 2Q20A 4OGXH 4ELMA 5E94A 4FN0A 1FAIL 4YFDB 3G6JA 4LRNH 2WQRA 4TVPE 3RZCD 4O2CB 1C7SA 4M7JH 5D2LA 3VG9C 5BV7H 1ZT7A 3L3IB 2OTPA 1M05A 1D5XB 4F80A 6FABH 1A7PL 5DGQA 5JPMB 1KXVC 1UJTA 5I2IA 4EQ3A 5CJ8A 4IRJD 4X6FA 1NL0H 2YPKA 2ZUTA 1ADQL 4OLXL 3W9EB 1RJYB 2NR6C 5ICZA 4MB4A 4KUZH 5GGQL 5I73C 1G7QA 1NBZA 2DJSA 4XC3L 3BIKA 4IDJL 1U36A 2DBJA 4IJ3C 4Y5YA 5DQJA 4ZOEA 4EN3D 1QA9B 3WFZA 3ULUC 4MVBD 3MBEC 4F8TA 1GGBH 2VQ1A 2F54B 2YRZA 1P5UA 1U8HA 5FYJD 3MFGB 4LNRA 5AYUL 2VDPH 5LGJA 2PR4H 4EDXA 4Y16A 1XGYH 4NQED 1X5JA 3HZVB 5FB8B 1A7OH 2OQJA 5C07B 1NDMA 3JWDL 2R2HB 4DZBA 3IVKA 5LGKA 3WDJA 4HWBL 4Q58C 3RWEA 1YA5A 5EO1B 5IW1A 4NQVA 5LGHH 1IC7H 1K8DA 1VKXA 4C56A 4U1GB 5GGSA 1FNSL 4MHHI 4WW2B 3ROLA 1CGSL 1GC1L 3O8XB 4OQTL 2ARJB 3MJ7A 2D3VA 4DOHB 1ORSB 1FYHB 2UWEE 1U8QB 4GLRI 4AM0A 2ICCA 2EIDA 1CR9L 1NKOA 5IBTH 2NY1B 1JYXA 1P7QA 3D39E 4UV7L 3L3IA 3QUZA 3WBDA 5F7WC 3V5DB 3O6KL 4P2CG 4PJCA 5DMIH 1MCOH 2W59A 4C54A 4LVNB 4GJTB 3GSQA 2XOTA 4P2RD 4X8JA 4UDTB 1BQHB 3TIDB 2YA2A 1A6WL 3NFSL 4J3SA 4P5TA 3PWJB 1S5IH 4MNQB 3JV6B 1MCWM 4GW4B 4KJQC 2Y07L 3WFHB 2MQ0A 2WIMA 2VL5A 4PLJD 2QQQA 3BH8B 2YEZB 3DSFH 5H2BB 5T1MA 2VDRH 3BRGC 1BD2E 3N85H 3GB7B 3F62A 3D25A 5T3XL 3BP5B 4IIQB 1F11A 3QUMA 4H88H 1MRDL 4K3GA 5EZIL 1C1EL 4NZTL 2ZUQC 2VXTL 2YN3A 5SWZD 2XACC 4NRXB 4HAFA 2AERT 3AXLA 3GIVA 4P4KC 3TBYB 2XQYK 1HOCB 4A2MA 1L9NA 4PJBE 3U0TA 2BOCA 2ZOLA 4D9RD 3X13B 4TUOA 1GPOL 2IAMC 3O4OC 4FMFA 3UPRA 3QPXL 3ULUL 4WW2A 4HWEH 2XWBA 1YPZB 1UACH 4KDVA 3ARGC 1F97A 1HEZA 1FBIL 4C83B 2GTWA 1JNHA 2X4NB 4HWNA 2ARJA 4WFFE 1D5MA 2Z31A 2YPVH 1U8QA 3FZUD 4HUNB 5FOBA 4BQ9A 3LKOB 5C6TH 1FNHA 5I0ZA 2RCSH 3BEVA 1PY9A 1FZMA 3UYRH 5EN2B 5BQ7B 3OG6B 2XRAH 2HLAA 4LU5H 5C0CD 3ARFD 1C5BL 5ELIA 5ETUA 4YFLF 5FIEA 2BSTA 1BQHA 1QSFE 4M43L 4MJ6A 4HS3B 3GDBA 4I77H 3RWFB 1BLNA 4HS6B 4C4KT 1E4WL 4YNYB 3TZVC 1QFUL 2DQUL 3JSSA 3IDIA 3FONA 4FFVD 2DQDH 3ZLQC 4HKXB 1XZ0B 3ZYJA 3KPRA 4JRYE 3EYUL 1J5OL 5H2BA 4Z78A 3HMWL 4NNPL 5CEYA 3WO4C 4RMUA 3MRGB 2GFBB 1NAKH 1ZT4A 3DI3B 1I1AB 3OJDB 4TRPH 3NMEA 4NM8H 4F37F 4JZOB 4WW1B 3OAUL 1DQML 4JZJA 1TJGH 1PG7H 3GRWA 4HT1L 3OL2A 4PJEF 5JHDE 4M03A 5JQ6H 3FB7B 2VWEC 5C92A 3EO0A 3MREA 5HDLA 3SQOL 2EIZA 3BPLC 3X13A 5ANMB 1G0YR 3DV4B 4KVCH 1OTUC 3C6LC 3MOAL 3KLDA 3FB5A 1NFKA 1VHPA 1Y6NR 1UKQA 3WL9A 1EEUA 1MCSA 3MRHB 5HXMA 5DD0H 3WKNA 3TBTB 2JCCA 1I7UA 1RZFL 5KOMC 1FNEB 4N68A 1MFBH 2X4NA 3IDMB 2MKWA 3MRPA 1J8HB 4WDIA 5J06A 4Z7NE 4OI9A 3QDAA 4M48L 2YPLD 2OR7A 3LKOA 1FZOB 5I8KL 1MI5D 2LQRA 5ISZB 4C4KO 1G7LB 4G8GE 3W0WE 5HHVL 4R2GB 2I60H 3C60D 3MNWB 5JQHC 4LEXH 1WC7A 1CLYL 1I85C 2A73B 2Z4QB 4MYWB 5DUPH 3RWFA 5EOCH 2PO6D 3LDBB 4UIKH 2WP3T 1JMZA 2Y5TB 2OK0L 4YNYA 4XC1H 4Z0BH 3V0VA 2CLRB 3E8UH 4XVTL 4WTXA 5C8JB 4GS7B 1XZ0A 3GSVB 3LIZH 3FFCE 5BXFB 5HYJA 3EYFA 5DK0B 4GBXD 4YXHL 4KZEH 3RX5A 4RGMB 2OMNA 3LMJL 3VFTA 3A0OA 2GFBA 2F5BH 4HDIA 4OFYD 4X6EB 2P1YA 3OJDA 3CU7A 5BVJB 4P57B 4JZOA 3M45A 4YAQB 3LS5L 4WW1A 3STLB 15C8L 1D9KC 2Q7YA 2X5PA 4DUVA 4PV9B 2WK2A 4QY8B 3SDXA 1NBVL 5IB2B 4WWID 4KUCD 4IOSD 1R3KB 4WI7A 4NQTA 4RAHA 2H32B 1UM6L 3X12B 1KJ2H 5IVOA 4IS6A 4R97C 4XGZB 1RZ7L 3ULVE 2FHFA 1FYTE 4MA8H 2BSSB 2IBBA 4KROB 1N2RB 4E0RA 4JO3H 4JY5L 1KJ3H 4KK9C 3QP3A 3Q48A 2FJGB 5EUOE 4O02L 4L1HA 2J12B 4O58L 4NOFA 5JOPD 4QCIB 4YDVB 5C6PB 1F3DJ 5K93A 4BFIB 3TYFA 1CVSC 5TE4L 1U92A 2X9WA 1ZLWH 4PTUA 3CC5B 3AGVA 3WD5H 3L7EB 3HG1A 4Z7UA 4HGMA 3OJ2C 1V05A 4FXGB 4GG8B 3OHXB 5GISL 2FWOB 1BEYL 1H8OA 1K3ZA 3V5HA 3U0WH 2A6DB 5BVPL 3B8SA 4XHJC 1U91B 2DM2A 3P73A 1IT9H 5AZEL 1FLRL 1GCFA 3I3BA 2V5TA 3Q1SL 2VXSH 3SJVB 4YHOH 3GBNH 3WJLA 1R3IL 3ARSA 4NBXB 4F9LC 4WU5A 3QO0B 3AY4A 1UWXK 3U6RB 3TWCL 1MWAA 1RIHL 3S96A 4LHJB 1FN4B 3TYGH 3RZCC 4ZNEA 3OXRB 4P9ML 2FSEB 2ED9A 1NLBL 5CEZE 3CXDH 4U6YB 1PZ5B 1KENH 2H32A 1OGAD 3ALWA 3SDDD 3MCG1 4KKCD 3UTTE 4ERSL 2FO4B 4IRJC 4LLWB 2BSSA 1N2RA 2H9GB 4HJGB 4XB8A 3M8OL 3S34H 3ZMRA 1INQA 4OLEA 4XRCA 2WINA 1MFNA 1G7MA 3B9KD 3QQ4B 2B1HL 3ARDB 5JXAH 3EOYG 1TNNA 4QRRA 1II4E 5TQ2L 1A4KB 2EYSB 2IEPA 4PG2A 5ABDE 1A21A 4P3CL 4EN3C 4MCYA 1IKFL 4L3AA 4MVBC 1A1MB 3HI1B 3KPLA 3L7FA 3UPAA 2H6PA 2VJXA 4NN7B 3F6LA 5DEGA 1LP9E 5EBGA 2IF7A 2DQJH 2PKDA 5BOZG 4MQ7A 5HHOD 5F6IC 4LDLB 3RGHA 1BQSA 1GGUA 4GG8A 1KN2L 1GZPB 2DKSA 1J88A 2Q6WA 3MBXH 5IB3B 3DVGB 1BZ7B 1M6OB 2YD7A 2RAMA 2HTKD 3HI6H 5CKGA 3HPLB 4H25B 1A7RH 3K4ZA 2BXYA 3QDME 4JAMB 4LLQA 4M9PA 1SYVA 3DX8B 2XIDA 1MCWW 2CUHA 3FQXB 4ZXBD 5J1AB 3MZTA 5A1AA 1N64H 3X3GL 3SJVA 5T3ZD 1MF2H 3MYJB 4R7DB 4FQLH 4XCEB 5EOTB 4B5EA 2Q8AL 2HG5B 1HSAA 1FFOA 2BSRB 1N59B 4EI5A 3PWUB 1U8LA 2VXQH 4M6MH 1JGVL 4HW6A 2FSEA 4MD4B 1QVOB 1TETL 4X99A 3FOMB 4YHZH 3FFDA 3E3QC 3QI9A 2BVPA 3T3MF 4U3CA 1U58B 5MEQB 1QLEL 1NBYB 2FO4A 4NQDB 2DQGL 3C5ZA 1HI6A 2JLLA 2BMKB 2H9GA 1KELH 2KZWA 4D0DB 2ZSVB 5D7IF 5D5MF 7FABL 5TDNA 1PGRB 5E6IB 3RL2A 4JHAH 1VFBB 3QFJD 1VFUA 4P23D 3S3PA 4PLJC 3U4AA 3MJGX 2EDWA 1A4KA 3MRFA 3EBAA 3RTQA 1TJIL 2FX7H 4KRLB 4PRHB 1AY1H 5D72H 5DD6A 5C70A 4LSSH 2HKHL 1FNGB 1N5AA 3D3VE 4IRSD 4WI8A 1U8OB 1TJHH 4R3SA 3I50L 4WEBH 4ISVA 5CZVH 2CMRH 4K94H 4PR5B 5D5MB 3PQYD 1XGRA 2R0LH 2WLZA 5I30L 2Y72A 4JM4H 3P4OB 3P11H 5HJ3A 4FOMA 2IANB 4YBLC 3GJEB 2C1PA 1B9ZA 1UB6B 2R23A 2RFXB 3B3IB 1UWEL 4P5KA 4JAMA 2EDYA 3EZJB 1JF1B 2GJ6B 3RWDB 2Z35B 4TYUA 2XPGA 5J1AA 2VDLL 4PRID 5EG6C 3LV3B 1CXKA 4L5FH 4YPGB 1ZVHA 4PJXB 3K80A 5FYJL 3MRKA 5EOTA 3FZUC 4Z0XA 3GZKA 4LLVB 2HG5A 3O6LH 4F7MA 5JDSB 4AMKL 1CXFA 2AABL 4ZYKA 1FE8H 2MCPL 4POYA 1OWWA 5FA3A 2PXYD 4UV4H 3C8KB 3ARFC 3UJJH 1J0JA 1U58A 25C8L 3ELAT 4F15B 4NQDA 4PRPA 3HR6A 2BMKA 1ZWIB 2FYYB 1Q9LA 3VXRB 3O4LE 1I7ZB 4D0DA 4YFLI 2CKNA 2EE3A 2XWTB 1EHXA 2AEPL 1T5XB 4FXLA 5SWSD 4XZUA 3D0VB 1B4JL 4FFVC 4NDMA 1YEEL 5KSBB 1NPUA 3ZE0E 1K85A 4YDLB 4R90L 3QFDB 4MWFA 3LHPH 3EDFA 3LEXA 1NCNA 2C1OA 2R1XB 5K9OB 4DGIL 5JR1H 4IHOB 3UZEA 2E9BA 4BZ1L 1F4WH 2BNUB 4KKAD 5E70A 5JXEA 1XGUB 3BWAB 1U8PB 2EYRA 1T21B 5INDA 5D6DA 4RX4A 3IDYB 5HPOA 2AXFA 1YUHB 4E9LA 4LVOC 1UZ8A 3L3OA 5I8OH 2K7QA 4LEOB 2NY0B 4G6FB 4FQXA 3SKUD 4P49A 2VZ1A 1QKZL 3O9WD 5FHBH 1MVUA 2EC9U 1UB6A 3PWVA 5F7DB 1CL7L 4OTXH 3RL1A 2DMBA 2GJ6A 4LCWA 3WMSA 3LKNB 3WXWL 4NQCB 3V4UL 1XCQA 2VZUA 4NZDA 4PBVC 1TITA 4J6RH 4PJXA 4TVPH 3X11A 3F7PC 1QRKA 4HUKB 1YMMB 2H2SD 4C57C 2P8MA 4IMLB 5C09E 2PF6A 3PDDA 3WFDL 3QXUA 2P24A 4OD1L 1G0DA 5SWQA 2E6QA 3VDCA 3V6ZB 4JE4B 3TC9A 1X4ZA 3HZYA 4LHUB 5I16A 1JWMB 3FMGH 3IT8D 4G8IB 1YDPB 4G6KL 4H20H 3C60C 1VEPA 2IG2L 4Y19E 1XF3B 1ZWIA 2JB5H 4HJ0D 2FYYA 4BA8A 4LPVA 3VFVB 1NGXB 3BDXA 2NY7L 1FJ1B 1I7ZA 2PO6C 5DD5H 1LWRA 2VR5A 3QEQE 4NHUA 5I6XB 4ZQKB 1JZ7A 4OKVA 3HPJB 2D7PA 3D5OF 3RWGB 4U2ZA 5J6HA 2XKNB 3PP3K 4GBXC 4UT7L 5FF6B 1NGWA 4DEPC 4I2XA 3QHFL 3RUGE 3TO2B 3KNBA 1R3HB 4PJIA 4APQB 4O00A 1BMGA 1ZT1A 3GSRA 3GMMA 3D85B 4OM0H 1JZ4A 4HWZB 4Z7VA 1T20B 3C2SA 3OB0K 4B41A 2R0KL 3QUYD 1H3WM 1I9JH 5GZOD 2VXVL 2DWEA 3SY0B 1LK2B 2Y36H 3G5ZB 3QIUA 5ALBL 3RI5F 1FZKB 5KS9B 1L7IL 4H1LA 4MS8D 4KJPD 1I3RB 1KACB 1NMBL 5ILTL 1YNKL 4FP8L 5IQ9B 3B9AA 2BSED 4S1QH 2Z8SA 4YEEA 2AXJA 2AQ2A 2WV3A 3EJZD 1RK1A 4K7PL 1C08A 5DRWB 4JGUA 3BZ4B 3ETBF 4OZGB 5IM7B 4OI7A 4HGWA 5EZLB 4DTGL 4XMKH 1O7SA 3SCMA 2VLLB 3CPLB 4L9DA 3OB8A 5DJZB 2J8HA 2XZQH 4UQ2B 4YZFE 4L4TA 4CADA 4DKFH 5A2JH 4M7ZB 3GSUA 2UVEA 4NOBA 1TVBA 3EYSL 4S1DD 2J8UA 3L5WB 1TPXB 5I75C 3CLFL 1I8IA 2V5RA 4K2UL 1AJ7H 4A2LA 3VFVA 4O51B 3VG0H 2BNRD 2QQLH 1X5XA 4HUVA 4WJ5B 4BQCA 3C8DA 2FL5B 2VISA 2XKNA 5IKCA 4U1HB 4HV8A 1Q0YL 5J9PB 1JMXA 4G9FE 3ZO0A 5DYOB 1K6QL 1NMAH 2YR3A 4GAYA 1KJVB 4APQA 3HRZA 1IGMH 4Z76B 3VXUD 4OM1L 5DMKB 1PG7X 4N0CD 3STBA 1T20A 5B3JF 3GI8L 4EEEA 5C0AE 3VFUA 4Z18A 1S7SB 4Q0XH 1F45A 1PX3A 3ARPA 3BXNA 2PW1B 3SDDC 4KKCC 1FZKA 2XV6B 3S5LA 1XIWB 3U4BL 3GBLA 5EC2B 1I3RA 3WNLA 4HIHB 3S35L 1UH3A 4JN1L 4P4RA 5DK3A 3H9SA 4ZTPL 3SQBA 3QA3B 1WAAF 4HG4J 3B9KC 3MRQB 5L8JB 4MA1B 3FTGB 1ND0A 3LN5B 4ESKA 1OSZA 2IH3B 1VA9A 3F6IA 4DFHA 5EBMA 4HBCL 1MFCL 4MAUL 3RJDA 3UC0H 3QQ3B 2QEJA 2QSVA 3E0GA 3B83A 4PRAA 5GGRY 4UQ2A 5D70L 3GSWA 4XNXL 3ZKQD 4ODVH 2QHLA 1KTLB 1N26A 4UAOB 5J3HD 5IIEB 3GNML 3PWNB 3KLHD 1X4YA 3LKRA 4XMLL 3T2NH 4LL9A 1EEZA 1WIPA 5F89A 3ZKXC 2XA8H 4O51A 2GIYA 2HKFH 1CGWA 3T08A 4PGEA 4GXUM 4G42B 2HTKC 4ZUTB 1WICA 1JK8B 2FD6H 3GK8L 4K8RD 4WO4B 3SO5A 1VFAB 3QNYA 1AHWB 3QG7L 4H1LG 4K7PY 4ZXBC 4PJFF 2GUOA 2X4TA 3LKSB 4C56D 1A3RL 1CFBA 3QRGH 5EO9A 2ICEB 4D2NA 3QO1B 2AGJH 2BHUA 4OZIF 2Z91A 1RHHA 1LEIB 1B0GA 1Z2KA 2D31B 4OIIL 3NA4A 5F88B 5HYIA 3O3BB 4UILH 3I3DA 3VU2A 5DVKA 4V1DE 1G6VK 2WMPA 4XPAH 1P7QD 3U7AA 1DANT 3MUY1 5BO1L 4RMWA 3M07A 1G84A 1CT8A 3ZYOA 2ZUXA 1YJDH 3AS3A 4F58H 2LABA 5DHXB 5HY9B 3RWJB 3INUH 4NP4H 1HINH 1QYGL 1W0YT 4QRPA 2J6EH 3BSZH 4XBPB 1RIVL 4PREA 1P53A 3DURB 3MGOB 3SGDI 4HUUB 2EIBA 4PS4L 2NY4D 4P23C 2AJZA 1EX0A 2J5LB 4P5TD 4MJ5B 3S9DB 1J0IA 4PGJA 3U0PA 2FEEL 3VXNA 2IGFL 3QIWB 3T3PF 2AXHA 4QHKJ 1NQBA 5DGRA 5JMOC 3WFCL 3HMXL 4PJ8B 5A2KH 3F7RA 1T1XB 4NM4L 1BVZA 2DQTL 4W4OC 5CJXC 4BZYA 1B6DA 1I1FA 4IRSC 5F1KC 3O81A 4OBRA 4ELMF 1PSKL 3JV5A 3OXSB 1NFIB 4BSJA 2CXKA 2IPTL 3G6JF 3UBXB 1F4YH 2K7PA 3V6BR 3O3AA 3JWNC 4OLUH 4M5ZH 3VGEA 4MB3A 5D2LF 1G7JA 5FGRA 2X6MA 5JW5B 4QXGH 4JRWA 1J10A 2LU7A 4DN3L 3TNMB 5GS1A 1FGVH 5HI3D 3NGBB 4U0RC 1XCTB 3IJYB 5GS2H 3S5LG 1VFAA 1AHWA 1C12B 5F6HI 5CMAB 4HPYH 3LKSA 1MUJA 2ED7A 3O2DA 2NZIA 5C9JA 1KGCD 5HVWA 1LEIA 2APWA 1EGJA 4YGVB 1AQDB 4L9LC 3KPQB 3NFNB 2Z31D 1U42A 4Q97A 1H3XA 3GSNH 4ZOBA 4XCFH 3ULVH 1OAYH 3RNQA 1F4AA 1UXSB 3BAEL 3MFFA 5CWSA 3U46A 3E6HB 1FPTH 3VXPB 1FZJB 1JPST 4JFPA 5IHUL 3DROB 1ACYL 2ATKA 3RWJA 5KSAA 1XF1A 1X5HA 5I8EA 2XZZA 1XGPB 1T1WA 1TFHA 2J1KA 4QO1A 5I1IL 3FT4B 5T3ZL 3SKNA 3MO1A 1D6EA 3PABA 5CJOL 1DSFH 4S10A 1FNLA 3VDAA 2XN9E 1AQKH 3FB6A 3VGAB 1QLRB 3MRBA 4JFZL 1DBBH 3KPRD 1S9VA 1A14H 5GJSL 3DUHA 2NTFA 4EXPX 3CVHL 4KKAC 5I19L 3JWOH 5E56A 5JW4M 4UOJA 3T09A 4WNQA 2A6IA 4ELKA 3GMLA 2F8XC 1R6VA 3B5TA 1RFDH 4LRIA 3OXSA 1RUKL 3MLWH 5DLML 5LCVL 3VWJA 1V7MH 1JYNA 1G9MC 3ZYIA 5KAQG 4K23H 4JVPA 4KQ4L 3QEGL 4F3FB 3GM8A 1LGVA 2IPUG 1MIMH 4Q9BA 12E8L 1NC4B 4OFPA 4HKJA 2P5WB 4PJCF 4ZAKB 5CILL 3TNMA 3FL7A 5DJYB 3WHE0 2HFFA 1O0VA 3O9WC 4BFEA 4L4VB 4OGYH 4GG6A 1EMTH 3IJYA 1C12A 4Z8FL 1MHHB 4Z6AT 2YWZA 5DS8A 5GJTL 1FFRA 1F4HA 2XZAH 5DRNB 1MOEA 1QRNE 2DWDB 5CEZH 5MI0B 2V17H 2H2SC 2EEDA 1U6AH 1QFWM 3KPQA 4LQ1A 2W9DH 1KPVA 1T0MB 5FUOL 1JN6B 3B2UD 1Q0XL 3VGFA 4I18B 1EAPA 1IAOA 1NCCL 1S3KL 4M61B 1VADA 2VLKE 4HJ0C 5L2KA 1KJ2A 5DZNA 3Q5YA 4IOIB 4KY1H 1LE5A 5TPWL 4XBEH 4HKZA 5FFLA 1MHPH 1U8MA 2ITDB 3TM6A 1JHLH 1IAIM 1U41A 2DTMH 3BWUC 2ESVE 1PLGL 3SO3C 2VIRA 4PGDB 3L5IA 2EDOA 4HK3N 2B7DT 5DQDH 1LO0L 1YYMH 1JGEB 4NC2B 4BZ2H 5MENA 2VDOL 3I75B 5HYJD 3VGHA 5AG8A 2ILLA 5IVNA 2PETA 3T1WA 5CBAB 1P2CA 5INCB 2P8LA 4N0YH 3BKYL 3B9EA 3P0YH 5C0DB 3TP4A 4KVNH 4PP2B 4DVRH 4YHLH 3QUYC 3K8MA 2CLVA 5GZOC 2ZOKB 5I8CA 2PNDA 4Y5XC 2VLJE 4R0LA 4PJ5B 4MS8C 4KJPC 1CDJA 3NFPB 4N8VA 3U7WL 5EORL 3K74B 4OF7A 2P5EA 4NUGH 4LKCA 2FIKB 1MHEB 4O5LH 5D2NC 5T3XE 1HSBB 3R06A 2D7NA 3EJZC 3NZHH 2MFNA 1EJOL 1RZ8A 1CDIA 5I9QB 4OV5B 1DFBH 1K4CB 5FYJU 4EUPH 3I9GL 3N1FC 1G1CA 3FQNA 2NLJB 1TVDA 1CFSA 5H8DA 3OR6B 3BHBA 1F8TH 2DN7A 1T0MA 4HCRL 1J8HD 1G9ML 1DP0A 3EDKA 3F5WA 1J12A 5GRUH 1MLCB 3WFEH 2R56H 1FQ9C 1Y6MR 1TCRA 5DFTA 5SX4H 4S1DC 5FK9B 1NGYB 2DS4A 3VCLB 5I1EH 5GS0H 3DXAE 3HG1D 4JHBA 3JTTA 3SKOB 2WANA 3DO7A 2R39A 3PV6A 5IJVA 4WUUE 5IVXE 1NDGA 4MXWH 2ITDA 2JJSC 2F58H 2QHRH 3T65B 2ICWB 3QDGA 4ZUUB 1BQLL 3KGRA 4I8DA 2EH7H 1RUAL 1SY6L 4L3EA 2JCCF 4FZEH 4J12A 5A3ID 1TZIB 4I4WB 4CJ1A 2AK1L 2IC2A 1S5HB 3FN0H 5DMJB 3LD8B 4WI2A 2CO7B 5INCA 1KF9B 4N0CC 4U3XA 1XF4A 4GQ9L 1RIUL 4OAWB 8CGTA 5HYFA 3ZDXE 2R15A 1HDMA 3NZ8B 4FTVE 3DVIA 4PJ5A 3ECBB 4NBZB 3QULB 4ORGA 2XTJB 5F7KC 3KDMB 3BDYL 2EO9A 2NY6C 4DK6A 4BSWB 2WUCL 3ET9F 5DTFA 43C9B 2DQHH 2NY3B 5KW9H 4I9WD 1FP5A 4OGZA 4M7KH 1P4IH 1L6XA 1IC5L 1ZLWK 1T6VN 1MH5A 2FBJL 2OXHA 3VXSA 4Y5YC 4QRRD 3OR6A 1UCBH 4XNMB 3PWPE 1LK3H 2X1WL 4Y1AB 1CF8L 1SEQH 5E8PB 1V3MA 5J3HC 5HPMB 4ZPTB 3KLHC 2AQ1A 5HGDA 1CBVH 3DRQA 1CG9A 1I4FB 4O2EB 2IBZY 3VFWB 4FFYH 5C2BL 5F9JB 4X8XA 2QSCL 1T03L 1ZEAH 1KLGA 4WCYH 1KB9K 3O11A 1G9NC 1JNNL 2ORBL 2Y23A 3HZKA 2FB4H 1DN0A 1N7ML 4K8RC 3T77B 4MCZB 1K5NA 3CX2A 1Z3GL 1T3FA 4JFXA 4N8VG 2X1PA 4P3DB 3M17B 4QGYA 1Z9MA 1CDHA 1TZIA 2OS7A 5E6ZA 4HPOL 4JPIA 1S5HA 3PV7A 4PFEA 1KLFA 1AP2A 1F3JB 1IJ9A 1HIML 2OR9H 5E8NA 3SJVD 2VDNH 2UZIH 2CDGA 4F7TB 4LKXA 1SEBA 3UTOA 2EEAA 2J4WH 4QOKB 5I71C 3MV9B 4EI5D 1H8SA 1MFEL 4JREB 4HZLA 5ACZA 1J18A 4O2FA 3ZTNH 4NZUL 3KYOA 4D0BB 4EI6A 5I1GH 3L9RA 2C7UA 3QUZC 2B1AL 5HYSB 4KPHL 3QI9D 1JRHL 4WHTB 1MCBA 1ZA6A 1SJHB 2OL3H 43C9A 1IEAA 2WUBL 1EZVY 4KWUA 2NY4C 2O5XL 1TZGL 3UBXI 5KANG 1MCLA 4P5TC 3B5GA 2Q87A 3L3HA 1LILA 1WCBB 1HHGA 5C0GB 2PYEE 1FIGL 4JO4H 1NCDH 2W07A 3HB3D 4NGHH 3QZWA 3MODH 3RTQD 4CL7A 3GMOB 4HUXB 4DVBA 3JBG7 1WQVT 5C86A 4LIQH 3D2UB 5DRZB 3Q6GH 2BDNL 4YHMH 1JBJA 5A43C 1QEWA 3R8BB 5DURD 5D96C 4U1LB 2KQNA 5F8RC 4QHNB 1ZGLB 3MJ9H 4N90E 3D9AL 3V8CA 4RGOL 2APVA 4OCRH 3D87B 5E99H 1ONQA 5HI3C 1YEDB 4NQSB 2ZSWA 3L3KB 4F8QA 2VWEE 4LNVA 1JYWA 4XCNB 4NPYB 3HLAB 3LQAH 2VXUH 5I74C 2CLZA 5FO8A 1S8DB 4Y0GA 1F6AA 1A9EB 4WW2C 3FO1A 5ENWB 5DFVD 4I0PB 4PLNC 2EDEA 3DRTA 3I6GB 1DBKH 1AGFB 2XZCH 3A6BL 4CW1B 2Z31C 2UWEF 1EPFA 5FHAH 4F7TA 2A1WH 1Q72L 3MV9A 4JG0H 1OP5H 4NO2B 3WSQH 1LVEA 4JO1L 5HYSA 1G9NL 3MTRA 2XXCB 5IFHH 1SBSL 4LSQL 2APXA 1SHMA 4HWUA 1UWGH 5HVHB 4K8RL 3NIDF 4NQDD 4G6MH 1T04B 5C0BE 4PRPD 1DLFH 1SJHA 4YIQB 4G6JH 1YECL 5GRWA 1NCBH 1KN4H 3BGFB 3B2VL 3NAAL 3QWOA 3O2WL 4JG1H 1WCBA 3OJVC 4FQJL 1G9EA 2UWEB 5J7CC 1H15B 1J1XH 1UA6L 1CD0A 1MJ7H 1EV2E 1MCPL 1FAKT 1CU4H 1JP5A 4UT9L 3NVQA 2Z93B 3CX5J 4FQ2H 5ESQB 4NWUH 1ZSDA 3D39B 3QYCA 4LLYB 2UV3A 1K8IB 4ZNCD 5KOVC 3PHSA 5DRZA 1NLDH 4IIQC 3UTSE 3CK0H 2IBGA 2VMFA 4ODTH 4N9GA 5B21A 4JHWH 4QHKI 1Q1JL 5FGCE 5JXED 1Z9LA 3HZMA 3G5VB 2LTQB 4H5SA 1WVZA 4RX4D 1RAMA 1ZANL 4OCSH 4H26B 2YSSA 5E08L 1S7XA 4QHUB 4BM7A 1YEDA 3QUXB 4FQXD 1M71B 2H1PL 4XCNA 4O4YH 3TVMA 1BD2B 1E4XL 4N8CL 1OW0A 3HE7A 1A9EA 1XH3B 2XICA 4GKZA 1N6UA 2EKJA 2GJ6D 1NAMH 4I0PA 4LCWD 3VFOA 4YK4B 4KH2A 3QUML 1QNZL 4LSUL 2E7LA 4PV8A 4CW1A 5F3HB 3UTQB 3B2UC 4V2CB 3QNZA 1I3GH 4Z9KB 4AT6B 2HT3D 3DX9A 4AYFA 4PJBB 4NO2A 1SM3H 2M1KA 3QZWG 2CIKB 1LDPL 3WHXB 3UCRA 4WENB 1WIUA 2BCKA 2HMID 1MSPA 4Z7WA 3PGCB 3FKUS 4POZD 1DBJH 3ILPB 5CZXD 5ITFB 5JW4Q 2GK0B 4MJIE 4JM2B 3VFRB 3PGFL 4MSWA 2A83A 1O5DT 1YMHA 4L29B 1OM3H 3F7VA 4K3HA 4E41A 1QQDB 3TBWB 1P6FA 5IV2B 3V9FA 2Z93A 3LQZA 1OAZL 1DBMH 3GBMH 1RU9L 3QG6A 2E9JA 3ILQD 5B38A 4FQ1H 2R29L 3H3BC 3MXWH 4GAJH 1P4LB 1F5WA 1ZLVH 3IXTB 1BF2A 1FL5A 4JPKL 1YNLL 4JRXE 2HH0L 2BP3A 4XNQB 1QSFB 4M6AA 2NNAB 1IQWH 3U1SH 4D3CL 1P5VA 3VFNA 3MV7E 3D69A 2AV7B 5HHPA 3EYVA 1YEFL 3NPSC 3QIUD 2BNQA 4F33B 1XAUA 3LRSB 2NXYB 4JRYB 4GRWF 4NO0A 3DIFB 5IFJA 1P7HL 1TXKA 4ODHL 5LWYL 3QQ9D 3MLSH 5IB4B 1IQDB 2BVQB 5JHDB 3C9NB 1FNFA 4N0UE 4PD4J 5F3HA 3GRWL 4TQEL 3WFBL 2ICWI 3CCHB 4OUOA 1U0QA 3SCMD 1UM4L 1YC7A 4AK1A 4PJBA 5DJ8A 4JZNA 5CZKA 2OCFD 4PTTB 1N0XL 2X1XR 4L4TD 4KTDL 4M6NH 1NEZB 4H8WL 3PGCA 4J8RB 1CFTB 3GGWA 3BRFA 3DECA 3KVQA 4UQ3B 1UYWL 3WNPA 5FYJE 3T0EE 3FO9B 5E2WH 3TV3L 4LAQL 5EIVA 4L29A 2RIKA 2GKIA 5ERWB 4NQEE 4S0SD 3HNVH 4Y4KB 5IV2A 2P46B 4ZSOE 3GJFH 4Y4HB 1XGTA 3N1QC 3P9LB 2XY2A 3RVTD 4I3SL 1JPGB 4YDIH 4R6UA 5IEHB 5FO7A 4Y4FA 2F5AL 2AK4A 5KSVB 4APQD 4G8GB 3WJLC 5C0RH 3W0WB 3MGTA 3AY4C 4HKBB 2R8SH 3PL6B 5FCSH 1AXTH 4X6CF 4YE4L 2XFXA 3VGBA 1OLZA 4YPJA 2YK1L 1V3JA 4NWTL 5JORB 1KNOB 3I6LE 2VH5H 4U33A 2X4UA 1YYLH 3BQUA 3LRSA 3FFCB 2QR0B 4PJEE 4LMQI 4LSVH 4RAVB 3H9SD 2AJVH 3GIZL 5E8OA 3QJFB 5EUOF 4P2RE 5BZDA 4LQFL 4PG2C 3F12A 1U8NA 2NXZC 3B43A 5T1KB 3X3FH 4QF1A 3KPPB 4PJIF 1L9MA 4P2QA 3CCHA 5BRZE 4ZUSA 2C26A 3IAQA 4JFHE 3TN0B 1ZTXH 4LPCA 1ITCA 1IFHL 3GSNB 1FORH 3OG4B 4JDZB 5CD5D 1NGQH 4Z7VF 2N7BA 3FQWA 1DQLH 1FYTB 1HHJA 4JLRA 3Q2CA 3VMNA 1FC2D 5B38G 4JFEA 4Q6YA 5CP7B 1A6AA 5I1DB 1FAIH 4M6OL 3RWHA 1JFQH 1W72A 3MV8A 5EUOB 3TPUB 4PRBB 1G7PB 5GHWL 4L8BB 5ERWA 4M5YL 4NZRL 3HNSL 3OSKA 3ES6B 5C0FB 1ZHKA 2RHEA 3T1FB 3IU3A 1AO7A 2FGWH 4LLDA 4OCWH 4D9RE 4OLXH 1JPGA 1OTTD 3P4LA 4ZPVB 5IEHA 1ZS8B 4LVEA 5GGQH 3SEPA 4LP4A 3W0WA 4ZODA 2BRRH 4HKBA 3IKCB 4DK3A 4EI5C 2HT4D 2BX5A 3RKPA 4K71C 2NCMA 4OF5A 5ID1A 4KAQH 4Y8DC 5E8EB 1AFVL 3QWRA 4N5UA 3QI9C 3LPWA 4X6DF 4QXWA 4U7KA 5I66A 3UTZA 2QBWA 3C5ZC 3QIBA 5KSUA 3I6KB 3GO1L 2L4OA 4QRPD 4NHCL 5C0CE 5IW6B 3O6FB 5C9KA 2DLGA 1UB5B 1IGFH 3BPCA 2NY2D 4OB5H 2BVYA 4GW5B 5DJDA 1OAUL 3GSXB 3HB3C 3RTQC 3PJSA 4XP5L 1MWAL 2HAZA 3KYKH 4GLRH 3H9ZA 3DUUB 1FLTX 2AJSL 1S7QB 5DK2B 4NN7C 5F9WB 5EU6E 3TN0A 4OJFH 1MCFA 3UTTB 4JDZA 4DQOL 5DDHA 3VA6A 1QSVA 4I3GA 5L7XL 1JWUA 4OQTH 1KIUA 3KHQA 5ESVB 5AUMB 1GOGA 2V2WB 4UINL 4MXVF 1WTLA 3MMEA 5CUSH 4S11A 2AJUH 3EHBD 2WNGA 4M1DH 1JHKL 3QXAB 4WUKH 4CAGA 3K2UL 4PRBA 1IGJB 4NYLB 3RBSA 1BM3L 1TIUA 1C5CH 5AYQA 5D9SA 4WFHD 1BGXL 5FYLH 3RY4A 3OR7B 4MB5A 4ZOAA 1J1PH 5DFVC 1LP9B 4KU1A 3LOWA 2DLTA 2DKMA 4ONHB 4DGVL 5F44A 2R4RL 2C3GA 2ZPKL 3WNKA 4RNRB 1JGDA 2I07B 5J8OA 1CK0L 3GMNA 1YEHL 4F7CA 1WFNA 3IKCA 1PBYA 4HJJL 5TF1H 3V0WH 1JPSL 2EH8H 5DRXA 3QEUB 1FO0B 1WEJL 3LH2L 2W1NA 3DMMA 3FQTA 3CFIC 4M93C 3GMRB 4EJ1C 2YPLE 5F7UA 1MI5E 3QDMB 5FV1L 4JFYB 3BKJL 3KXFA 3P4NA 2FJHA 1F4XH 1E6JL 5KSAD 1C1EH 4KZDL 4NZTH 1JGUH 3K46A 3RDTB 3WN5A 3ARBA 3BP4B 4X4ZA 3ULSA 4GT7A 4I48B 1N0LA 1Z5LB 3LN4A 4FFZH 2FJFB 3QISA 4EUPB 3V79C 2CKBH 3OF6A 4R4ND 5FM5M 5KAQF 1JPFA 3U2SB 3QBTB 4MD5A 4U1KA 3QT2A 1R3LA 3K1KC 5D71H 5JXEC 4ORZC 5D6DC 3QEHB 4TNVF 4OZHA 4FNLH 1IGCL 4ODWA 1PAMA 4L8CB 4ZS6D 5CIPA 4MNHB 3HFML 1VACB 3GFUA 3OKLA 1R5WA 4FQXC 4CMHC 4KRPD 5TDOA 5IBUG 2A77L 1MREH 1C5BH 1U3HB 1HHKB 3V4VH 4P5MA 1ZHLA 3ARRA 4ZO9A 4BKLB 4ETQB 3G5YB 3D3VB 4M43H 4OD2B 4QYOA 1ED3B 4XCCH 1U8KB 2YUZA 3P4MB 3AMLA 1QFUH 4I1NB 3EOBB 4J3XA 3BDBA 3VFPA 3KPNB 2CK0L 3MRNA 5F1NA 2IQAA 2R0ZH 3AC0A 2HT3C 1PZUB 3NN8B 4GKSA 1G7IB 5JOPE 4HK3J 5LAXA 4PJ7A 3S4SA 5E6YA 2HMIC 1PYWA 1M7XA 1QFHA 1QR4A 1FVDA 4JFYA 5HHNB 1IVLA 3V4PH 4POZC 2YUXA 3IFPA 5CZXC 1KTRL 4PGBB 5L2KD 4HT1H 5F96H 5F3BA 1CICB 4JFQB 4L8DB 3AFLA 3VH8A 3SN6N 4JFFA 2DKUA 2XWJA 4M00A 4M02A 3ZE0F 3T3ME 3OKDB 1WBXB 3IETA 3G04A 2V5SA 5C7XH 4GXVL 2VQUA 2OJZL 2X9XA 4GOSA 4EUPA 4JQIH 4XBGB 1AIFB 3ILQC 1DDHB 5D7IE 4CVXB 5MEND 3VWKA 1Y18B 1Y0LA 1HILB 4LLUA 2DQIL 5I18L 3TH3T 1GGIL 3VRJB 3RPKA 3QEHA 3O4LB 1PKOA 3EFDH 4ZMAT 3ZKND 3ISWA 5F93C 2VKWA 1AGEA 4KQ3L 5L6YL 5BZWB 3QIUC 2NPLX 2EECA 2CJUH 2DLEA 2OSLB 3U36B 2VC2L 3D18A 2OTUB 2P5ED 2V7NB 4CU8A 1OGAE 3H3PH 4G7VL 3O3EA 2HFTA 4MA3A 1CLYH 3W2DH 5F21B 3NOIA 4QRTB 2OBGA 1ED3A 3QQ9C 4U31A 4JCMA 4JPWH 5GGVH 1X7QA 2FZ3B 3BUYA 3BZDA 3P4MA 3EOBA 3EJYD 1BJ1J 2GCYA 3SCMC 2JELL 5DQ9B 4IOFD 1IE5A 4GW1A 5IK3B 2VITA 1VDGA 3SGEI 3FQRA 3UO1H 1G7IA 4KFZC 4P59L 5EC1A 3BGMA 5BV7C 5CBEB 4GRMB 3BPOB 3VFGL 1FC1A 5IR1A 3GHEL 2W9EH 3P77B 4JFQA 5EUKA 2HN7B 4NKDA 1FL6A 2OL3B 1KPUB 3EJJX 1G6RH 1LE9A 1WBXA 3QDGD 2N1KA 1DUZA 2EC8A 3OZ9L 4FQHA 5C09B 3RVTC 4XBGA 1K2DA 3EO9L 1BFVL 3HAEH 3CFEA 5HYQA 5CAYB 4U1SB 1P9MA 3LEYL 4ETYA 5C3TA 4APQC 4XP4L 3IYLW 4X6BB 4JDTH 5TGBB 5HGAB 1KCSH 2GHWB 1XR8B 2IFFL 3U7YL 5L9DH 4AH2B 4UIMB 1AGBB 3U9UB 4HS8L 4Y19B 3RVWD 3MNVB 4RGND 1IC1A 4TOYL 5KJRH 2Y5EA 4P2OA 5T3ZE 1G7HB 2O5ZL 1CLZH 4YX2L 3BO8B 4XPFH 3QEQB 5BZWA 4QT5B 4PJ5D 2ZJSL 5GSRA 1MCCA 4JKPL 5GRJL 1J0HA 1B4RA 4IDLA 1MIEL 3RUGB 3KJ6L 1BIIA 2JJWA 4TUJB 3U36A 3ZL4H 2OTUA 3TBSA 1EVTC 1EERB 3C5SB 3S4SG 2QQKH 3UJTL 2NW3B 4G7YH 3MLUH 3SDCA 1N4XL 5BS0A 3RIAF 3VW3L 5I76A 5I1CL 4YWGH 3J7HA 3SE8H 3VH8G 3IDXH 5DI8A 2Q8BH 4GMTH 5D7SL 2XNAB 3QFJE 2D9QB 1ETZB 5D8JH 5CD5C 3KPMB 1A6UH 4NIKB 4M7ZC 3EOTH 1W0WB 2PTUA 4HC1A 4LGRB 1OT2A 2DL2A 3CFDA 1IKNA 3NA9H 3QCVH 4NN6C 4Q6IB 4BSVB 4I5BB 1NCAH 3ROOB 2HN7A 5D1QA 1KCRH 1FSKB 4UNTA 5HSFA 2OL3A 1X5ZA 4GSDH 4TNVK 5FDWB 1KPUA 5IMKA 3AUVA 1AC6A 4ZO6A 3PQYE 3QCUL 4X4YA 2CDFB 2ZP0T 1E27A 2BHZA 3R1GL 1CDCA 5HD8D 4HIIA 2N7AA 4OGXL 4JANB 4XPTH 2BRQA 3M8OH 3HC3H 1GJIA 5TGBA 3DVNB 4LRNL 5DSCB 2W60B 1OF2B 4XAWH 2OLDA 5BV7L 2HT4C 2C5DC 1S7RA 1QR1B 1OQXA 4ZUWB 5TQ2H 1UJ3B 2D03H 4U2YA 2BERA 3CFCL 1G7HA 6FABL 5JW3H 4CU6A 1HWHB 4Q2ZA 2LVEA 1NL0L 5HVFB 3PUCA 3MJ9A 1HH6B 5JOFB 2EYTA 2MCG1 2DIBA 3CDYA 3RUGA 3D1MC 4IEFB 4G9FB 4ODUA 5E5MB 3BW9A 3CUPB 5F7YC 3MCLH 1X5AA 2WIIA 4Z77A 2NY2C 2YBRB 1H3UA 2V7HA 3MRMB 3HN3A 3QQNA 1H3PH 1NAMB 1GGBL 2HVKB 5I0DA 3WE6A 4R8WH 3DYMA 4MMXC 5ICXB 5CEXA 3KPSA 4U6HA 5C0AB 3S88H 5SWSE 3SKMA 1R3JB 2ADJB 1H5BB 2VDPL 1ETZA 3S8WA 3KPMA 4XNZB 4RSVA 1XGYL 1A7OL 1A7NH 1W0WA 1R5VB 3LPGA 1RK0A 1AR2A 2Q8AH 1X5GA 3K8KA 5GSVB 3RWCA 3HRPA 3EHBC 3MROB 1JGVH 4JKLA 5C71A 2BY0A 5I1JH 1PKQA 1F58H 1TETH 2X44D 4J7RA 5LGHL 4LDOB 5FDWA 2BY2A 2X4RA 2E9IA 1E4KA 5CGYD 5GS1C 5EWIH 5EZOH 1FV1B 4OZ4A 4RIRA 1A2YB 1AHWC 3TA3B 4X7CC 2OM5A 5IMMA 3BP7B 4HIXH 3BE1L 3IFNH 3LRHA 4P3WA 4XX1G 4LASH 5E4EB 1NC2B 5IBTL 4E5XA 1U8IA 4A6YB 1EBAA 3G9VA 1AI1H 5E00A 5DJ0B 4HBQA 3RPIA 3FQUB 3IFLH 4Y2DB 3S37H 4KI5D 3MV9D 5DMIL 3U79A 1P84K 4PLKD 2X4OA 1EJ6A 1FFPB 2HKHH 4HMDA 3L3DA 1S5IL 3G6AB 1REIA 4NT6B 5B3JE 3I50H 1HNFA 5KSAC 1NFDA 4LBEB 3VFMB 2P7TB 5J13C 3SDAB 3H9YA 5DUML 1JGLH 3DSFL 2VDRL 2DQFB 2QJDA 3TIEB 3BKMH 3O45B 3N85L 2ADFH 3RY5A 1UWXH 4M7LH 3VXME 2GK2A 5C0AA 1ES0A 1QFWL 3LSOA 4NO5A 1I8KB 4R4NC 4V1DB 4HXBH 1WAAE 1UWEH 4TVPD 1IGTB 2ZKHH 4KI1A 4HXAL 3FB8B 4N1EA 4QHLA 4F2MB 3D2UD 5DR5H 4LRIC 1R5VA 2YC1B 2UYLB 4MLSA 3VWJC 4DN4H 1QFWI 3B9VA 4MDJB 4ZS6C 4O9HH 3HUJA 2W91A 3N0PB 1BFOB 4KRPC 3MRDB 4FA8A 1MLBB 3C5JB 1I9IH 1TLKA 2VTFA 3C6SB 1M1SA 1UACL 3NGBC 5FKAA 5DD3H 4J1UB 5C08A 4TNWK 2C4XA 3EYOB 2M26A 3TVMD 2RB8A 3Q5OA 2YPVL 3HE7D 4K55A 1S9WA 2SEBA 1NC2A 4PJAE 5C6TL 1IAII 2X4SA 1DANU 4I0PD 4P48A 2RCSL 1B4JH 32C2B 5T5FL 3VGDA 2ZZUT 4FQQA 3UYRL 3TNNA 5IWLA 3CXHK 2XRAL 4PY7A 4LU5L 1JNJA 1UT9A 4PJFE 1U9KA 4X80H 5JTWA 1MJUH 1EHLH 4N8PA 1TDQA 1CS6A 5FKPB 4Y88A 1AD0B 1FFPA 4OZIE 3WS3B 5IEKA 4JGJA 2IMMA 4I77L 1OSPL 1TENA 4LPXA 4WHCA 4JCLA 3G6AA 1YEGH 4GRLA 3LS4H 3VFMA 1YN7B 2G5BA 3QHTC 4JJ5A 2DQDL 4X4ME 2JE8A 1CYGA 1OGTA 3VFSB 4KHXH 3O2DL 3G5XB 3O45A 1NAKL 4S2SA 1N5YH 4TRPL 4E41D 1EGJL 1QBLL 2BNRE 4NM8L 3FCTA 1RZGA 1Q9OA 1I8KA 5D7LA 1A6ZA 1TJGL 2BC4B 3C8HA 5T1DH 3B5HA 3P2TA 3SKJH 5JQ6L 3V4UH 3EDEA 5E2TH 4LHQB 3FOLB 3KYMB 4YDKH 4DGYH 3CFKB 3VI3F 1I9EA 3ZKNC 1CXIA 2G9HA 3LKPA 1OB1B 1VENA 5IQ7H 2WW8A 5GRVL 4QHMB 1BVKA 4JKMA 4UUJB 5E8DH 1BFTA 4R7NB 5EPMB 3MRJB 3VXUE 4AY0A 5FOJA 4N0FB 4R0LC 1PQZA 1BFOA 1MY7A 3WFDH 2X89A 4NC0B 4ELME 5DD0L 4XP9H 2XN9B 1JCKA 2X7LB 3G6JE 4MD0A 2FX9H 3WNNA 2BNQD 1CDUA 4PBWD 5LXGH 3CVIH 3JVGA 2CH8A 4HIJA 5D2LE 1KSRA 4NO0D 3QJHB 1DEEB 3GJFA 4CMMA 3AREA 3EO1B 1VFOA 5DHYB 4LGPB 3EJYC 4J3UA 5MI0C 3CMGA 4IOFC 3TBVB 1QFOA 4ZD3L 3THMH 3QHFH 5DJAB 3OKOA 3DARA 4P46A 5MEPA 3N1MC 5ITBL 3P40A 2I60L 4NNXB 5IFAH 4HX1B 4LEXL 5JNYA 2HFEA 5F71A 3IJHB 4J3OC 1OVZA 5DUPL 5EOCL 4UIKL 5FM4A 3ZHDA 4XC1L 3KWWB 4Z0BL 3E8UL 3OKMB 2MTPA 5L88H 1F00I 3FO2A 3LIZL 4JO2H 2F53E 2VXVH 3VFSA 4KZEL 4AENA 1QRNB 4M4PA 3JUYA 4WU7B 4WTZA 1A1NA 1L7IH 1BX2B 1TVHA 2F5BL 4KJYA 4LCCA 4WFFD 2APFA 2CIIA 3T0AA 1IEHA 4JVWA 1JPTH 4J23A 5ACMA 2GAZA 4D8PB 5KN5A 1CFNA 4Y4FD 3RVWC 2VLKB 2AK4D 3ZTJH 4RGNC 1IRAY 5B8CB 4OZFB 1QSEA 4C56E 1KJ2L 2B4CH 3IDUA 3UZQA 4E42B 5IOPB 3PDOB 4R7NA 1KCVH 1KG0A 3PIQA 2ESVB 4JO3L 2Q86A 2FH6A 1JV5A 2O61B 1JZ3A 1BHGA 1KJ3L 4X83A 2FRGP 4Z7WF 3ALXA 2R1WB 3BQUD 4L3CA 3KLAB 2NXYD 4JRYD 1V7NH 3CLFH 3VRLF 2PTVA 3IXAB 4ODSH 1PX4A 1W0VA 5IHZA 5L0QC 1BIHA 2O26U 1IAKB 2M8XA 3MX0A 4ZUVB 4PJCE 4WI4A 2ZUSA 4YR6B 1KUMA 3CJJA 3QDHA 1R24A 2VAAA 2HT2D 4RFNC 1YY8A 5CD3A 3V5KB 3WD5L 2X05A 4ZFFB 2VLJB 4P2QD 4Z7QE 1JI1A 4QRUB 5D1ZB 4XNYH 4NNXA 5E24E 2Y7QB 3VJ6A 2HRLA 3WDIA 3P3YA 3HHRB 3ULUF 3VG9B 4OM1H 5CP3A 1Q9KB 3U0WL 1DE4A 4XVJL 2C3VB 2AJXH 4JFED 2PXYA 1LEKA 3C09C 3QNXB 4LPWA 1WFUA 3MV8D 1AXIB 1IT9L 4NO3A 5E9DA 5BMFH 1EFQA 4PJHA 1QO3A 2G60L 1JVKA 3G6DH 5HD8C 2VXSL 5I73B 4YHOL 3GBNL 5AEAA 3QXDA 1KT2A 4X0KB 5EBLB 1EEYA 43CAA 1MCNA 1RURH 4Y4HD 1AO7D 2X4QB 3W39B 2A0LD 3MJ6A 2CK2A 3TYGL 1J05B 3TESA 3BP6A 4NJ9H 4S1SH 4LCIH 2VLKA 4MZ2A 3DXAB 5DFWH 3MBEB 4JGMA 3W0WD 1KENL 1UQSB 5LQBH 1B90A 4WUUB 5IVXB 4NC1C 1KGCE 2PW2B 1A47A 1F3DH 2ESVA 4K94C 3H9HA 3S34L 1KBGL 1W8NA 3QWRD 2QADB 5ADPH 2DBLL 1ZLUH 5JXAL 3I02A 3MR9A 3VRIA 1CE1H 5TH2B 3WJJA 4NQXA 3QIBD 3O2VH 3H0TA 2ZCKH 4Z7OF 5ALCH 5GS2D 2FR4B 1LNUB 4PUBL 4AIZA 1A4JA 5E1AB 2DLIA 2DQJL 1GH7A 2H8PB 2E27L 2I9LA 1UC6A 4CNIB 3V5KA 5HI5D 2YXFA 4FTVB 1PFCA 4WTZG 4K9EH 1M7IB 3ZT7A 1QBMH 4WVRA 2NTSP 3TN0D 3AU1B 1HH9B 2FO1A 3KPRE 3SDYH 2AP2A 4TSBH 3HCVB 1VPOH 2CRIA 4HUWB 2RGSA 4OIIH 2QKIA 2C3VA 2H3NA 1J11A 3HI6L 4BQ8A 1A7RL 2I24N 2OTWB 5CGYC 4D0CB 1BECA 1GOFA 3IDGA 4K7FA 5IVZB 2R1YA 1RUQH 4QXTB 1N64L 1NSNL 2X42A 3OGCA 4N1CA 1MF2L 2CPCA 3BUTA 3PWPB 4FQLL 1QYGH 1XGQB 3QDJA 3TPKA 2X70B 4WI6A 2VXQL 4M6ML 2L0DA 2CKBA 5D1XA 1KEMH 2KH2B 2J2ZA 2L7UA 3CLEH 1LQSR 4YHZL 1INEH 2CQVA 4KI5C 2JCCE 3HMXH 4PLKC 2EDNA 3H42H 3PNWA 4BK5A 1C16B 1HKLH 3FN3A 1KELL 2EDQA 5HDQH 3DMMD 4NSKB 2ZUQB 1GGCH 3Q6FB 1D5ZA 2IPTH 1MCRA 3QUKB 4LVHC 4JHAL 4P4KB 5JIPA 1X3DA 3KXFD 5KVGH 1MFAH 5B4MD 4RMVA 4G8FA 4RCAA 1PJ9A 2FX7L 5D4QA 2IAMB 1AY1L 5D72L 3OAYH 3O4OB 5DD1H 2FR4A 3KPOB 3HA0A 4JN2A 4OD3H 3ARBD 3V6FB 4LMQE 4LSSL 2K3TA 5KG9B 3ARGB 3HC0B 4WEBL 4WFED 4G3YH 3OF6D 5FA4B 5CZVL 3RAJH 3BX7C 2CMRL 4K94L 3P30H 1HH9A 4PJ9A 4WWKA 2R0LL 5B39B 5HYJE 2B2XH 1KTDB 4JM4L 4UTAH 3NCEB 3BVNB 5HGHB 1A64A 3P11L 3MLXH 3CSYA 5IB5A 4M8QA 5F7MC 4P0DA 3AS0A 2V2TA 1WITA 2W65B 2GITB 4RISH 3NACH 3SDXE 3N06B 2PYEB 1XT5A 1VGKA 3K1DA 3TVMC 2MQCA 3MLZL 4L5FL 3JXAA 1G6RB 1V3KA 2Y9RT 1T0NA 1OW0C 3TZVB 3HE7C 3O6LL 1VESA 4WV1A 4I0PC 4MJ2A 1BPVA 1FE8L 2E7LC 1A6TB 4JFDA 4UV4L 4XWGH 4PJDA 5IW3A 3DHJA 3L95B 1WISA 1EVUA 4I0CC 4D9LH 1FL3A 3PHQB 2K1MA 1CFQA 5H35A 1DVFA 4CRPA 5DMGD 3SE9H 5CGMA 1N8ZA 1EEQA 1KEGH 5T1LB 3L3GA 3AAZB 4TVSa 5LBSL 5JLZA 5E2VH 1DQDH 2X41A 1WK0A 4NKOA 3NCFB 4Z95H 3HE6A 3BPLB 3LHPL 5IG7A 3C6LB 3DGGB 4MNGA 3HG1E 4Z7UE 4JFFD 5JR1L 4WRLA 3KPOA 3JV4A 1F4WL 1EO8H 2PCPA 3V6FA 5FECB 4QRQB 5HHXL 1MVFA 1U8JB 2Z92B 3MUZ1 2YHGA 1OLLA 5FA4A 3MLRH 3OQ3B 1OHQA 3VWKD 5GJTH 1HK6A 2MJWA 2ADIB 5I8OL 1KTDA 1EXUA 4PRDA 4PB9H 5C0BB 2EKSB 1C8PA 1OAQL 3RGVB 1QLFB 5F8QC 5FUOH 1WGOA 5FHBL 2F74B 4Y5VA 5DWUH 5H37H 4XT1C 3DX7A 5ESAB 3QXVA 4ZNEE 4NCC1 5EIIB 3TJHC 1G6RA 4XP1H 4J6RL 4TVPL 5B3NA 1KB5A 1H0DB 1KYOK 2Q7NA 2ZG3A 3IFOA 4GH7B 5FYKU 4NN5B 3UTSB 3RJQB 3HAEA 3O3DA 2BFVL 4RMTA 5FGCB 3EGSB 4NNYB 1A6TA 4TSAH 2D0HA 4I9WE 4HD9A 1EO7A 4HQQH 3S37X 4OCXH 5JIHA 1RZIA 3A6CH 4FHBD 3FMGL 3UDWA 3FT3B 2J8OA 4H20L 1D9KB 1SMAA 2W0PA 4QRRE 3VE0B 5GIRB 3CDGA 2AKRA 3BYYA 2H41A 4LAJH 4PJGA 2DLHA 5DD5L 4OZHF 5FYKH 2BVEA 2EXYD 5FUCC 4AEFA 1KLUB 3TCLB 4R97B 4O2CA 1NCTA 1CICD 5EZJB 3TT3L 5MP6H 1D5XA 2LU4A 5JPMA 4WY7L 4U1MB 1MCQA 3NIDE 4OM0L 3W9EA 1RJYA 5DJXB 1AXSB 3BIBX 1EJOH 3TJEH 4Y4FC 5J12C 1I9JL 3X14B 4GKOA 5CJQH 2Y36L 3I9GH 2BK8A 1AGCB 3OV6A 3KYAA 5AWNH 1QA9A 3RGVA 2DYPB 4MJIB 5L2JB 4P2OD 3N1PC 4PJ7F 1A6PA 1KULA 4JQXA 2F54A 3IF1B 4HFUH 4KK5D 1KCKA 3L5HA 2DD8H 3T0DA 3BQUC 5DF0A 3FT2B 2NXYC 3O6MH 2YZ8A 5I15H 2GJJA 5AD0B 3HZVA 5FB8A 4YO0B 2VOTA 4XXDB 5C07A 4XMKL 3OKEB 4JRXB 3SDCD 2R2HA 4QNPF 2HT2C 4NNYA 5BS0D 2ITCB 4U7SA 2IPKB 5EO1A 4DKFL 4FQIH 5F72S 3FT3A 3E6FB 3MV7B 3CZFB 1XF2B 1AJ7L 5GIRA 3O8XA 4LCUB 3MLPA 3RZCB 1ORSA 2QQLL 1TZHB 1T2QH 1RIUH 1YJDC 2XQYG 3TCLA 4OIBA 4IRJB 2BVUA 1KCUL 5D1QD 3CSBA 3V5DA 1NMAL 4LOUD 5C0EB 4N0UB 4Q9RL 4LLMB 3BD4A 4WEUD 4LF3B 1IGML 4UDTA 2HJFB 3TIDA 1CTOA 5J57B 5C0JB 2A38A 3ZZ1A 2A0LC 3PF2A 1KC5H 3PWJA 1AXSA 4RBPH 4MNQA 3JV6A 4GW4A 4XAKD 3VMOA 3WFHA 1RMFH 1WBYB 4XMPH 4U6XB 3STZB 3BH8A 4JB9L 2FBJH 2YEZA 4RFOH 5D7KD 3HAEG 2EE6A 3T0EB 3GB7A 1QPXA 4OIAA 3BP5A 1CD1B 5C0IB 3QWQB 3FHAA 4IIQA 4NQEB 5F6IB 3HI5H 1BP3B 3FT2A 4ZSOB 3OKYA 4FABH 3QIBC 1JTTA 2ERJC 2Q3ZA 2WWKT 2AJYH 2B0SH 4NRXA 3UC0L 2YWYA 4PGCB 5C2BH 2IQ9L 4RQQB 2VDKH 3TBYA 1HOCA 4ZS7L 2O93L 4PRPE 3T4YB 2ORBH 2DQCH 1WZKA 2JJTA 4GRWE 2CRZA 1SYSB 5HI5C 1HHIB 4ODVL 1MCJA 3PHOB 3KPSD 4F57H 4LGSB 4ZFZB 3MV7A 1YPZA 1JL8A 3T2NL 3TN0C 4EDWH 1YNTB 2PN5A 4C83A 3OX8B 4QXUL 4PJEB 2R2BB 1GIGH 1BOGB 4EOWL 2APTA 1IM3B 4Q9CA 4P2RB 4JEGB 5EN2A 5BQ7A 2OZ4A 5DJ6B 5JIKA 4B7IA 2QQNH 3QRGL 1IZJA 1A0QL 5BRZB 2AGJL 2HJFA 4RMSA 5C0JA 4HS3A 5KZCB 3H7BB 5KVFH 5MERB 4HS6A 4ACPA 3OMZA 4UILL 4AQOA 1WBYA 4XPAL 3ZE2F 4HKXA 3PG2A 5IMLB 5K9QI 4LCWE 1A3LH 3O0RH 4G80B 2WWKO 1YJDL 1B2WH 4RMRA 3T0EA 1OT1A 3MRGA 4F58L 5TQ0H 1I1AA 1YEIL 3INUL 1HINL 5CGTA 1W72L 3DMMC 4YH6A 1DR9A 4PG9B 3T0XA 4HEPG 1T5WB 5IF0B 2VABB 1EUTA 2BDNH 2RQ8A 3BEWB 1RUMH 4X6CE 3FB7A 5B4MC 5E2JA 1MHCB 4YBLB 3RRQA 5SV4A 4RQQA 5ADOH 4RGOH 2YUWA 3WN5C 3ARBC 4AZ8A 1L0YA 3T4YA 4RWHA 1UVQB 4UDUB 5ANMA 4OCMC 3DV4A 1MJJB 1CE6B 1I9RH 5LJYH 3WLWD 5ID0B 3MRHA 5C0AD 5DVMA 2A6KB 5E95B 3TBTA 1ZHNB 2EDTA 4ZFZA 1F4YL 4X7FC 4OLUL 4M5ZL 1N3NB 4BH7B 1FNEA 1BQHG 4S0TD 2XG5A 3IDMA 4I2XE 3RWIB 1J8HA 3EW3B 4P2YA 4PJIE 5C0CB 3ARFB 1FZOA 3NCCB 1FGVL 4YC2C 2EDJA 5GGRB 3ESVF 4DW2H 5EB9A 1F6LL 5ISZA 2Q3AA 3DX6B 1G7LA 5HGBB 3WUWB 4Z7VE 1VGEH 4HPYL 2CR3A 9CGTA 3N9GH 5BRZA 2D2OA 3MNWA 4XWOD 3RP1A 1XMWA 5EU6B 2A73A 3H7BA 2Z4QA 5C08D 1CXHA 1NKRA 4PY8J 5MERA 4UU9B 2Y5TA 2XQBH 4NRZB 2R2EB 4XCFL 1OAYL 1NC2D 2CLRA 4YUEH 4FXKB 5C8JA 5IMLA 3GSVA 5BXFA 1FPTL 1S9XB 5DK0A 1DQQB 5DHVH 3O41B 3QB7C 1X44A 1BZQK 4UT9H 1JZ6A 2BHYA 4OFKA 4X6EA 5DMGC 1BAFH 1YY9C 2WZPD 5BVJA 4P57A 2Y4SA 3CH1B 4YAQA 5DMYA 3STLA 5HI4D 3ZKSD 5IESL 4LVOB 3C08L 4LARH 4PV9A 4DZ8B 1QHPA 4QY8A 1RZJH 1Q1JH 4OFIA 5IB2A 1IM9B 3T04D 4GRLD 5I1HL 1R3KA 4L4TE 2AAVA 1CGUA 2GJZB 3W5MA 1AQKL 4LFHG 3MCKB 3X12A 1DBBL 5LKNA 4X6DE 2J8UE 1A14L 4XGZA 2A9ML 2IALB 1MJJA 4L8SB 2OXGA 3VD4A 1P1ZB 4X9GA 4CUCA 1RFDL 4U1IB 1I3VA 4YHYC 2W0FB 4ZDHB 1ZHNA 3MLWL 5D7LD 3VWKC 1V7ML 5F7HA 1A1OB 2FJGA 4BH7A 2YPLB 4K23L 3RU8H 1MI5B 1MIML 2YD2A 4QCIA 4YDVA 4U05A 4G8EB 5JW4R 1JUFB 4OGYL 4BFIA 2OX5A 5GGRA 4UB0H 3LEVL 1J1OH 1D5IL 1EMTL 3C60B 4UMGA 2DM3A 3GUTB 3CC5A 1AGDB 5ICYB 2WBJB 2X89D 3L7EA 4P9HH 1U93B 4KUCF 1NFDF 3FRUB 2HWZH 2PO6B 3ARVA 3S3SA 8FABB 1DLHB 3W9DB 5MEOB 4H0IA 4FXGA 2E7MA 4MXVE 3RA7H 4F37K 3CDFA 4M1GH 3OHXA 5EIQA 5EU6A 3SE3A 2FWOA 1U6AL 2PTTB 2W9DL 4GBXB 4LPUA 4DEPB 3ARED 2A6DA 5FV2A 4X4XB 3H9SE 3HKFA 1U91A 2CUIA 4WHYH 2KPNA 1T7VA 1U95B 5T33H 4KY1L 4P46D 2HTLD 2EXYC 3QO0A 1MHPL 3U6RA 5CCKL 2DTML 2HH0H 2WBWB 1FN4A 3HUJF 4ZTOH 2R4SH 1IM9A 3OXRA 2YKLH 3BYTA 4CKVX 4CN6A 4KMLB 2GJZA 5DQDL 4U6YA 1PZ5A 4X7SH 1YYML 5HVGB 1X6LA 2DRUA 4LLWA 5CSZB 2FECL 4L8SA 3CFBB 2AV1B 3GI9H 4HJGA 1X4XA 4X5XB 4U1IA 3P0YL 4UOW1 4ZDHA 4KVNL 4DVRL 1P9MC 5M95B 4YHLL 3QQ4A 3ARDA 1R5IB 4OUUB 2EYSA 5LG1A 4DKDC 5K9KB 1IC4H 1JWSB 1A1MA 3HI1A 4P2OC 4PP1D 1QSED 2KQMA 5JA8B 1CGVA 5FM8A 1J0KA 4NUGL 4KK5C 3B4NA 5I75B 1DBAH 4X9IA 5DEFB 3VXOB 4O5LL 4CDHA 3HTLX 1AGDA 2HP4A 2WBJA 3NZHL 1JIBA 1U93A 1HXYB 1OL0A 1WJ3A 1DFBL 5D7IB 1OCWL 1ULVA 2IADB 4OLZH 3F7YB 1GZPA 2PTTA 3SDCC 1F8TL 3PP4L 3DVGA 1BZ7A 5IB3A 1M6OA 3FRPA 3IRPX 5GRUL 1KPRB 1J9CT 4QRPE 3WFEL 2GY7B 2R56L 4POUB 3HPLA 1BVLB 4H25A 3HC4H 4L4JA 1IL1B 4TSCL 3DX8A 3FQXA 2D7QA 5I1EL 1A7BA 2X4PB 1MPAL 3MYJA 2VERN 2CGRH 2EDDA 4R7DA 4XCEA 4MXWL 2BSRA 1N59A 3BZFB 3PWUA 1IKNC 1OGAB 2QHRL 3QCTH 3SDDB 4CVUA 2LV4A 4MD4A 4Q9QH 1QVOA 5DT1H 1T4KB 4NFCA 2EH7L 3FOMA 2MQ3A 3QXTA 5D1QC 5D6CB 4LOUC 2JKXA 4FZEL 2FDBP 5MEQA 3SPVB 2B5IB 1NBYA 3B9KB 5CSZA 3FN0L 3N50A 1MY5A 3CFBA 5E9DD 1XF5B 4PRNB 2C4FU 2ATPB 3WYRA 4OCYH 1CDBA 2ZSVA 5E6IA 4B53A 4WFHE 2GW5A 3GIZH 4ZFGH 1VFBA 1YEJL 1R5IA 3RHWF 3LZFH 3D0LB 4GUPB 5IGXH 2VLKD 2VDQH 2FLBT 4PRHA 3NIFE 1B88A 1I1CA 1FNGA 3CMOL 3ZTJG 3ALPA 5HBBA 2ESVD 2DQHL 3ZKXB 5KW9L 3L5XL 3OKNB 5E0QA 1U8OA 5CLTA 4M7KL 1P4IL 5FM5O 4LCYB 3BZEB 4F9PA 3C87A 4OLVH 5D7IA 4FG6D 3GSOB 4PR5A 5D5MA 2E8YA 2DMCA 3F7YA 2W92A 4JR9H 3KLSA 3P4OA 4BQ6A 1MRFH 4B0MM 1UCBL 1WZ1H 1LK3L 5FYLD 2IANA 3U83A 4JKKA 4ZXBB 1SEQL 5CHNB 3GJEA 3BH9B 1D7FA 2RFXA 3B3IA 4YQXH 1IL1A 3HNSH 2YMXH 4NZRH 3L6FB 4XTRD 1JF1A 1BZ9B 3RWDA 2Z35A 1CBVL 1FGNH 2HJKB 4RZCB 3LV3A 3PGDB 4AL8H 4YPGA 3UPCA 1LO2H 2ZCLL 3MV11 4LLVA 3JTSB 4WCYL 3CVHB 5JDSA 3ARUA 4LPYA 3BZFA 3IDNB 4EBQL 3MOBH 5JHLH 1CL7I 2CXGA 2NW2B 2V2XB 3C8KA 1JZ2A 3GHBH 2GT9B 4HK0B 1SJEB 1E4KC 1XF5A 1KIPB 2HFGH 1LO5B 3QFJB 4P23B 3VXRA 2W38A 1RJZB 2VDNL 3L5JA 2UZIL 4HLZG 4DFIA 2XWTA 3QDJD 1DQTA 1JF5A 1T5XA 2E8ZA 3D0VA 5KSBA 4GG6E 5D1XD 4LSRH 2H26B 3QFDA 1NGZB 4HC1L 3VA2C 5I1GL 4YXLH 1ZLUK 2VE6B 2R1XA 5K9OA 4IRSB 4XP5H 4IHOA 4UZGA 3NCYS 1K4DB 2F19H 2BNUA 2OL3L 3PQYB 1XGUA 4YHPB 3BWAA 1U8PA 1T21A 5TE6H 2QADD 3BZEA 5GS3A 1YUHA 1FG2B 4YDJB 4UINH 1BF8A 4JO4L 1NCDL 4LEOA 4U0RB 4NGHL 2I27N 4PJHF 5L2KE 1MELA 1EZVX 1T7WA 3WLWC 1T1ZB 2A74B 4LIQL 1NCWH 5EU5B 3Q6GL 2O5YH 5F7DA 4YHML 1DL7L 3CFJB 1BZ9A 4XVUD 5E7BA 3LKNA 2OJEB 2CRMA 3MACL 1HQ4B 4NQCA 2HJKA 4L9LB 1ZMYA 3PGDA 2I9TB 4UTBH 5HHQB 2R4RH 3B6SB 3MJ9L 4DKAA 4OCRL 4PJ9D 4WWKD 5MENE 5JO5B 4JFOB 4M62H 4QTHB 1YMMA 4GXUN 3NCBB 4IMLA 4AG4H 2G2RB 4R4BB 3REVB 1ZHBB 2VXUL 4ZO7A 1S7WB 5MHSD 3V6ZA 4HK0A 3IDJB 4LHUA 1JWMA 4G8IA 1YDPA 4U1JB 4XWOC 5SWSB 1EIBA 3EFFB 1XF3A 1DBKL 2XZCL 1NGXA 3OJMB 5KTEH 1FJ1A 1WF5A 5FHAL 5D93C 2A1WL 1GGYA 4ZQKA 4JG0L 3T8XB 5FO9B 3HPJA 2P5EE 3MRCB 2YA1A 3RWGA 5TDPB 5J6GB 5FF6A 4DAGH 4R4FH 3WSQL 4JFDD 5CS7A 3TO2A 5IWLC 1EFXB 2P4AB 5IFHL 1R3HA 1UWGL 1K4DA 5F70A 3F58L 1OP9A 3OPZH 5HI4C 4G6ML 1DLFL 1DVFD 3D85A 1OP3H 3OAYK 1CZ8L 4G6JL 4HWZA 1NCBL 3ARQA 1KN4L 3PE9A 4GRLC 4JG1L 1F6FB 1ZVSB 3O9WB 3SY0A 1LK2A 1J1XL 3G5ZA 1CD9B 2A2QT 2ARJQ 3HE6D 4KJWD 1CU4L 5A16B 4FQ2L 5KS9A 4NWUL 3PDGA 4L1DA 2C3XA 2NYYD 2HVJB 1DN2A 3P0VH 5IQ9A 2OR8A 3CK0L 4M7LT 2MPAH 3RBGA 2PYFB 3CFJA 4JHWL 1ZK9A 3QDGE 5DUBB 3RZWA 5DRWA 4G9DB 5KVDH 2ZCHH 3BZ4A 1MAMH 4OZGA 5IM7A 4L3EE 5F7NC 5EZLA 1ZV5A 2VLLA 1IGYB 2P8PB 4ODXB 4X7TB 3CPLA 3M1BB 2Z0BA 4W6WB 5DJZA 4PBXA 4R4BA 1ZA3B 3D6GA 2E6JA 1KXTB 4RGNE 2HJLB 1A8JH 2P49B 3IDJA 3ZYZA 5IB1B 3VXMB 3BD3A 3L5WA 4XH2B 2PYED 3JVGC 4TUKH 3DNKA 3SO3B 4DCQB 1J0YA 4CVZB 3AREC 3T8XA 4PJAF 4U1NB 1I3GL 4WJ5A 2FL5A 4KRMB 2R0WH 4U1HA 5J6GA 4FZ8H 2J88H 5J9PA 4KMTH 1SM3L 4F7EB 1EFXA 5DYOA 3I3EA 4BELD 4ENED 4P46C 1KJVA 2HTLC 3QUYB 1DBJL 3VXSE 4AEEA 4K3DH 4Z76A 5JZ7D 4G43B 5DMKA 1HQRB 1Q9WB 5TFSH 1VERA 4Y5XB 3DUSB 4NCDA 1OM3L 4NUJB 1LEGB 1ZVSA 1FH5L 3MRIB 1S7SA 5GGUB 2VLMD 4PJAB 2CDEB 2PW1A 3VXTB 3IGAB 2AEQH 1DBML 1XIWA 3GBML 1IBGH 4LCCC 5EC2A 4BUHA 2HVJA 4FQ1L 4HIHA 3QXWA 3DV6B 3MXWL 4GAJL 4OT1H 5JW4N 4PJFB 3QA3A 4LHUG 4HIEB 4RWYH 3MRQA 4YHNB 2PYFA 5FCUH 2UUDK 3FTGA 3MXVH 3LN5A 3SGEH 4OZIB 3IU4H 3P9MB 2HA1A 2IH3A 1IQWL 2EDXA 4PJDF 3U1SL 3R4DA 3EYQD 1JZ8A 5L8KB 4PP1C 3FJTA 3QQ3A 1GZQB 5C0BD 2ENYA 3CZJA 5EA0H 4FQCH 3RGVD 2V5YA 1OTSD 1KTLA 4I3RH 2F54D 2DJUA 2FEEI 3VXMA 4RDQG 2BNRB 5IIEA 3PWNA 2AJ3B 1KIRB 1F90H 1YEKH 1WAAA 2EDRA 1TTUA 2BY3A 4H0HB 5C3LD 1ZKAA 3MLSL 1D6VH 4MX7B 5H94B 1S7TB 4G42A 5C07D 2IH1B 2OP4L 4NKMB 1FFNB 1KFAH 4ZUTA 2EZ0D 1JK8A 3EDDA 4X5WB 4WO4A 3W11D 1CFVH 1CLOH 1MNUL 3RI5K 4UNUA 3VXUB 3LAFA 4M6NL 3KS0J 4ELMB 1OARH 1L0QA 5E94B 2ICEA 3QO1A 3G6JB 3O8XD 4UT6H 3MUJA 3ZDYE 5AZ2H 2D31A 5E2WL 5D2LB 5F88A 1ZT7B 3O3BA 1M05B 2DDQH 2PXYC 4ALAH 2D0GA 3HNVL 2NY1D 5GGUA 5F1OB 4ONFL 1B0RB 1TQBC 2ICES 2NY6B 4X6FB 2YPKB 2GI7A 4YDIL 5ICZB 1RQ5A 5HY9A 1J8KA 1FRGH 4XPHH 4XBPA 5C0RL 3KJ6H 4NFBA 4HIEA 1G7QB 1NBZB 2R8SL 3DURA 3BIKB 3MGOA 4HUUA 5D7JB 4Y5YB 1AXTL 5DQJB 4MJ5A 1MFDH 4MNQD 3QIWA 3VW3H 2DMKA 3LB6D 2WM0A 5E2UH 4PJ8A 1SJVA 1T1XA 2VH5L 2VQ1B 3U9PH 2DQEH 3MYZA 1YYLL 4XPBH 4KV5F 2BJMH 2F53B 3FAWA 5D7SH 1P7KB 1U8HB 5LGJB 3MSPA 4LSVL 3AMKA 4EDXB 4Y16B 1NFIA 2AJVL 3UBXA 1AE6H 2OQJB 3VI3E 4H1LH 1OPGH 4W6XB 2AJ3A 2VLRE 4FG6C 3WJJC 4JY6B 1EHAA 5JW5A 1NDMB 4XP6H 1GGTA 4MX7A 3IVKB 5H94A 1S7TA 1WTGT 1RUPH 3X3FL 1H9VA 1G0XA 1WCQA 3RWEB 5IW1B 4NQVB 1K8DB 1VKXB 4FFWD 2CD0A 4C56B 4LSTH 4CDGC 3MUGB 1ZTXL 3ROLB 1WBZB 4RRPA 5IROA 1FORL 1XCTA 4XTRC 2D7TH 4PB0H 1DQLL 4IRZH 5CMAA 4Z7QF 3MJ7B 5DHVB 3DYPA 3MV7D 2FX8H 4AM0B 5I71B 4YBHA 3WIHH 3HNTL 4TULH 5GZND 4YGVA 3GMQB 1P7QB 1JFQL 1AQDA 3FAXA 2GTZB 3NFNA 1A5FH 4LFHD 3VD3A 1LO3H 3QUZB 3CFCH 4PJCB 3S36H 2YOCA 1NJ9B 1B0RA 1UXSA 1GAFH 3E6HA 4RAUB 3SBWA 3GSQB 4HMCA 4RBPK 2FGWL 4X8JB 3VXPA 1MAKA 4OCWL 1FZJA 3KR3H 2NZ9D 2YXMA 3CIQA 3F65A 3DROA 2NY4B 4HHAB 4P5TB 1T6WA 1XGPA 2BRRL 2Y1VA 3CDCA 2VYRE 4NKIH 3FT4A 4HSQA 5D7JA 2VL5B 5D1XC 3B8YA 5T1MB 4KAQL 5HDBE 3P0GB 2VSDA 3D25B 4WW2F 1QLRA 2HRPH 5IT2H 1F11B 3QUMB 2F53A 1P7KA 2KDGA 3T0ED 1IILE 3MRRB 3J8F7 5D96B 1I1AD 1RI8A 4K07A 1CQKA 1CIUA 4R26H 2QADC 4OCNC 1FO0H 4NKQB 3AXLB 3GIVB 1E0OB 1IGFL 2I26N 3NCJL 4JY6A 4OB5L 3U0TB 2BOCB 2ZOLB 4F3FA 1NC4A 4TUOB 3KYKL 2P5WA 4ZAKA 5DJYA 5I74B 3UPRB 4L4VA 4KTYA 4Z7WE 3MUGA 4OJFL 2XWBB 1WBZA 4CBPA 4XVUC 3VRLE 1HEZB 1MHHA 2GTWB 1JNHB 3SOBH 3BJLA 3U30C 2MNUA 1A7QH 3CH8A 1D5MB 2Z31B 4E41E 2YRPA 5CUSL 5DHVA 3I6LD 4U6VH 3RVVD 3BE1H 4MAYB 5FOBB 2MKLC 2AJUL 1NMCC 3A67L 4PJ9C 2DWDA 2Y25A 4WWKC 5DRNA 4M1DL 3GMQA 5J11C 5K33A 4WUKL 4NRYB 2GTZA 3BEVB 1FZMB 4DKEH 4MGXA 2JK5B 1PW3A 1JN6A 3WKMH 1C5CL 2HLAB 5HHME 4KTEH 1NJ9A 4HG4K 4I18A 4RAUA 5ETUB 5FYLL 5ISZD 2BSTB 1J1PL 4M61A 4MJ6B 2Z9TA 3GKWH 1QP1A 3TH2T 1JNLH 4HHAA 3ULUE 4IOIA 1BLNB 3MRLB 3ZDZF 1RV6X 5BRZD 4R2GD 2L7JA 3ARYA 5TF1L 3IDIB 3V0WL 3V6OA 4JFHD 3FONB 3UBXG 4WV1C 5JOEA 5DUMH 5KZCD 2BNQE 2EH8L 3KPRB 2NMSA 3ZSTA 3WXVH 2YD3A 4Z78B 5CEYB 4U4BA 4PGDA 1ZT4B 4U0QB 3DYOA 1JGEA 1YPZF 5EU7C 3I75A 1P4BL 1QFWH 1ERNA 1RVFH 4LPTA 1EH9A 4XNUH 4JZJB 1DVFC 4RRPG 3MRRA 1F4XL 5CBAA 4KRNA 4HXAH 4ZO8A 5C0DA 5C0ND 1JGUL 3UMTA 4PP2A 3EO0B 3MREB 2BY1A 1FDLH 2ZOKA 1LO4H 3HE6C 2EIZB 4KJWC 2NX5E 1XR9B 4FFZL 3FB5B 4AQ1B 2ZWLT 2E7HA 1T66D 2CKBL 3NFPA 2NYYC 3KJ4C 3WL9B 2XG4A 5FUCE 4PLOB 1IAIH 2AI0L 3K2MC 4YEFA 2JCCB 1I7UB 3BGAA 1FVCB 2FIKA 1MHEA 5JMRA 5D71L 1HSBA 4KROD 5GGTH 4KHTH 4Z7OE 1P6AB 5F7EH 4GAFB 3MRPB 1E6OH 4FNLL 4OV5A 4WDIB 3HS0B 4MAYA 3BESR 1K4CA 2AEWA 5FXCH 1MJ8H 3EKCA 4OF3A 3QAZB 2NLJA 4NRYA 4J3VA 5T5FH 1UM5H 2JK5A 3Q3GB 2QTEA 1MLCA 2AK4E 1MREL 3V4VL 4Y5VC 2E7CA 1FFQA 5FK9A 1NGYA 1WC7B 3SDXF 3VCLA 1EHNA 1OSPH 5DEZA 3MRLA 4XCCL 3SKOA 2FATH 3V0VB 1NGPH 1GXEA 5EU6D 4OF8A 3NABH 4NJAH 3FN9A 1IZKA 4OLYH 3T65A 2R0ZL 2ICWA 5HYJB 3EYFB 4ZUUA 1RULL 3OGOE 1YQVH 3O2DH 2BOBB 3VFTB 4HDIB 1OQOA 1EGJH 1QBLH 1U2HA 4ENEC 3UDWC 5J0BA 4I4WA 1F2XK 3V4PL 3BD5A 2Q7YB 5IJKA 5JZ7C 5F96L 3SDXB 2ZNXA 3V52L 3N1GC 4OAWA 4P2QE 3DPBA 3K0WA 4WEMB 4X5LA 3T2QA 3NZ8A 4W68A 4IS6B 2WBKA 3NPSB 3WEXB 1IM9D 5C7XL 1XR9A 2DLFH 5ACLA 3ECBA 4Z7UF 4JQIL 4E0RB 3QULA 2OYPA 4JFEE 3KDMA 1FVCA 5EBWB 4BSWA 3DTXB 3QR2A 3MV8E 5EULV 1JI2A 3EFDL 3EYQC 3HS0A 3ARDD 4YBQD 1JRHI 4XPGH 5K9JL 4TPRH 4S1RH 1AO7E 3TYFB 1U92B 2EICA 4KKNA 3JUZA 4XNMA 3Q3GA 4MQSB 3RGVC 4PTUB 5JIIA 2CJUL 2P47B 4Y1AA 4ZD3H 3I2CH 3HG1B 4Z7UB 1OTSC 5E8PA 4JQXC 4LSPL 3H3PL 5FEBA 5HPMA 4ZPTA 4EIZC 5ITBH 2D9CA 3W2DL 2WBJD 3X17A 2F8OA 5DJCB 4JPWL 5GGVL 1I4FA 4O2EA 3VFWA 3CSPA 2R69H 5F9JA 3V5HB 1UZ6F 1EAJA 3UZVB 3SE4C 2NY5C 1FCCA 4NN5C 2EZ0C 1WFTA 1P69B 3P73B 2BOBA 3W11C 3T77A 4MCZA 3WIIH 3UO1L 3S6CA 2DI7A 2OMBA 4P3DA 2YD1A 35C8H 3M17A 1M7DB 1NANI 2X40A 4JKWA 4U1GC 1MRCH 4BJLA 4WU5B 2DTSA 2D4FA 1N6QL 1MWAB 1OAKH 3S96B 3O8XC 1F3JA 2W9EL 3IB4A 3UJIH 4QOKA 4WHYG 1G6RL 2NY1C 2XXMB 4PGZA 1KB5L