2P7TA

Crystal structure of kcsa mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tA02
4ZD3H 1KC5H 3ESUF 1BAFL 4X99B 3TT3H 3K3QA 5B22A 2Q20A 3PUCA 3TNMA 2AJUL 3F62A 5CLTA 4I77H 4ZODA 4ZOEA 1K4DA 4TQEL 1DBKH 1PVHA 1CICA 5F7DB 4PS4L 5DK2A 1LO5A 4LMQE 3ARTA 4LL9A 4K7PX 2VWEC 1RUAL 2A73A 4N0YH 3BD4A 4JPIA 4H25A 5DQJA 2FLBT 3HHRB 3PABB 1JNNH 5F9JB 1BX2A 1WISA 4HQQL 3WUWA 3T4YB 2Z31C 1IM9A 4JHAH 3RWCA 3KPMA 1NC2D 3AM8C 43CAA 1EEZA 3WE6B 1PQZB 1QRKA 4ZOCA 2GK0A 4MX7B 5ICYA 2DQIH 5BCAA 2VABA 1W0WB 5E24E 4TSCH 3D2UD 3K46A 4JZJB 2UZIH 4MJID 3SQBA 4OQTA 1UADC 4F37K 3HI1B 5EG6C 3SO3B 3BZ4B 4WUKL 3BP5B 3O2WL 4OZFA 1MY5A 2X4QA 4OV6F 3NVQA 2WM0A 1PY9A 1E4JA 4XNYH 3DX9A 4IRJB 1WUNT 1YDPA 2J8UF 3BGAA 4RSVA 4Y2DD 1YNTA 1UB5A 1L0QA 4KDWA 3KPRE 5I74B 4R90H 5BQ7A 3RTQC 2V2WA 3I9GH 2AJZA 3CLEH 1A1NA 1NCUA 3QEHA 4F9PA 4NGHL 3QCUH 3NCJH 1NDMB 1P7QB 4GRLC 3SO5A 3O41A 5D2NE 5I71B 3LSOA 2D0GA 1FV1B 1A7NL 1S78C 4JFEE 3QUYD 3WLBB 3MFGB 2R2EB 5I17B 2CLRA 2OJEA 5TE7H 1BBDL 1FGVL 1W0YT 8CGTA 4DGIL 1EPFA 3MCLL 2VDNL 2H41A 5KJRL 5DJCA 4W4OA 5CHNB 4CNIB 1WTGT 3BIAX 3V4PL 4OF7A 5HDQL 2ZG3A 1HINL 5GZOC 3QXDB 4X0KB 5A1AA 2XZAH 1XF3A 4P3CL 1K6QH 2C4FU 4F7MB 2AJSH 3S35X 3UJTL 1FZKB 1NBZA 2AVGA 1CZ8L 3EOTL 1LEIA 2ITCA 1IAKA 4NQEB 1G84A 5DK3A 5SX5H 3SEPA 1LWRA 4PJCB 5DJ2B 1LEKA 2WLYA 1JPSH 4X4YA 1AGFA 2ITDB 5HHXL 3GRWL 1DVFB 3AY4C 1JNHB 3FFDA 2VN4A 2NY5H 3HC4H 5F9WC 2O93L 3IXAB 5LVEA 3ARDB 4JRYA 1I4FB 1A6ZB 3KHOA 4Q58C 1ZHBB 4X6CB 1KGCD 2EIBA 3OGCB 3SKUD 4BELD 5LBSH 3QG7L 1KN4H 3U4EA 4I13B 1G9ML 1NGXA 4U7MA 5IM7A 3OAZK 1XF5A 3C60A 5FV2A 3CDGA 5HGBB 4YHLH 4GUPA 4MD0B 4TSBH 4DWHA 3IGAA 1S7VB 3E1F1 3VXNA 3MC0A 1ETZB 3MUGA 3O6KL 2EDYA 1CLYL 1I7ZB 3RWEB 3AXLB 1K2DA 1P7KA 3O8XA 4K71B 4RGNB 2C1PA 4FXLA 3RNKA 4AH2B 2NW3A 1OD7A 1NFKA 2QADB 5L8JB 1VA9A 4J3SA 1LK2B 3VXUA 4KK5D 1JRHH 5EUOA 1I7TB 3E2HC 1X4XA 2YHGA 4WENB 1T1ZB 3RX8A 4I48B 4Z6AT 4YO0A 4J1UB 1RIHH 5E2WH 8FABA 2YPLD 2DD8L 4U6HA 1FGNH 2VE6B 3S36H 4DQOH 1U8PA 3L5WA 2HLFC 2VLRB 1OQOA 3HG1A 4XP9L 1MJJA 1KG0A 1LDPH 1RZKH 4AT6A 4L8BB 3RAJH 4KRPB 1LO2H 2R39A 3R4DA 5HYSA 1RHFA 2C1OB 1A8JH 1TJHL 3C2AL 3HE7C 3HAEG 1CFVL 1X6LA 3TO2B 3DLQR 1KJ2B 2ZCKH 1QSZA 1F97A 1DN0A 2VAJA 5E8DH 3S34L 2LVEA 4M03A 4UQ3A 1RHHB 4K07A 2NY2C 5ICXB 4PRIE 1CN4A 4NC1C 2L0DA 4N90E 4LCIL 1JTPA 2LU7A 4FG6D 1V5JA 1DUZB 4S1SL 3NZHH 4NYLB 3VFSA 2CRYA 1UJTA 5IJVB 2ADGA 4OCXH 1A0QH 1FLTX 5LGHL 1BQLH 1YEJL 4P5TC 3MRPA 4WEUD 1YEGL 4JDTL 2P47B 1EMTL 1OAYL 4HS8H 5T1DL 2OBGA 5IMKA 3W39B 5KVDL 4C56E 5TDPB 5J57B 1KXQE 5CSZA 4RX4A 3VA6A 1R5WB 2PETA 4TNVK 3QPXH 2BHYA 2XY1A 3QNXB 5SWZD 2VL5A 4PV9A 5GJSL 1EEYB 4NHUA 2UUDK 3QUXD 3GMOA 2Q6WB 4FQPA 1AD0A 1RMFH 5CILL 1K8IA 1A7OH 4ORZC 1EA9C 5BW7A 3MX0A 3TPUA 2PO6D 1JJUA 1S7XA 3FOMB 1N8ZA 2CR3A 4LQFL 3EJYC 3RKDC 2VL4A 3CCHA 35C8L 4MS8C 4YZFF 3X13B 2DQHH 4PJ7E 3KPSD 1RURH 1T03H 5F1IA 12E8L 5JDSB 3O6FB 2NX5E 1CCZA 4GS7C 4JPVL 4UUJB 2W38A 1FLRH 4P9HL 3LPFA 4M43L 4X83A 4GAJL 4J3VA 2GCYA 3UTPE 5E2TH 3PWPA 4Y4KB 1O5DT 4BYHA 5J89A 1QSFA 3MRMA 1S8DA 5D1ZB 3F7YA 5DD6B 1IGTA 5TFSL 5C0DB 2VXQL 3FQNB 4QRRD 4OZIA 2ENYA 4MA3B 3E6FB 1HHKA 2FD6H 2WV3A 3FT4B 3ARBC 2BVOB 2F5BL 4X80L 5T5FH 2ZPKH 2VLKB 2BOCB 5GS2H 3M17A 3GMRB 3NCEB 1EERB 4E5XB 3BKJH 3FT3A 4DN4L 5I6XC 9CGTA 4DK6A 5IB3B 1X5KA 4JFDE 3TA3C 2WK2A 4P5KB 4TTDC 4MD4B 4NQDA 1KCSL 2EE2A 4OM0H 1MCPL 2A83B 4HH9A 1MHPH 1NCAH 1XH3A 4NQXA 1S7TA 32C2B 3DARA 2NY6D 1FL5B 3JVGC 3TBTA 3RY6C 2LTQB 3GSOB 1FG2B 5GGVY 2EDWA 4OT1H 4S10A 5JTWA 2WUCH 5D9SB 5DK0A 4F57L 3SPVB 5T1KB 1BVLB 1FIGH 4WU7B 4R7NA 1DR9A 3MRKA 1U8NB 3DMMD 3MRGB 4WHYG 2BXYA 4HULB 1KJMB 4O4YL 3DVNB 4FTVE 5BRZE 2VERN 1T2QH 4ALAL 1JGLH 5JPMB 1SVCP 5L8KB 5JW3H 5D7LE 4Y7MA 1NGZA 1IGJB 4QOKB 4ZXBA 3SDDD 4AMKL 4JO1H 1Q8MA 1KXVC 3HCVA 1WEJH 1J1PL 2NTFA 4GBXB 5GGRA 4AENA 4PJHE 4K3DL 5DEGB 3MRLA 4RDQF 3RVUC 4KZEH 1UCBL 4RNRA 4Z7WF 1CBVH 3LHPH 1CTNA 4BZ1L 4KAQL 4XP1H 3QEQA 2WMPA 3V4UL 3BP4B 4LCCB 3W11D 5EH1A 1S9YA 2R1YB 4ETYA 3HAEB 4XWGL 3SCMA 4H88H 5E03A 4M48H 3RNQB 2MJWA 5H37H 3G08A 2LQRA 3OB0H 2AGJH 4UQ2A 4QGTA 4OTXL 4PJ9D 1KTLA 1SBSH 2F53A 4MNGB 1F00I 2SEBB 2RFXA 2VNCA 4ELME 4LU5L 1QFHA 2KBGA 4Z7VB 4DZ8A 2PCPA 4O5LH 3B6SB 1MRFH 4O2CA 3IRZA 5HJ3B 3SY0A 4WWKD 4X5WA 3P73B 4JFQB 4L8DA 1UZ8B 3K1DA 4O00A 5DYOA 4U7SA 3AREC 3NA4A 5GS2D 4NDMA 4OD1L 3O3DB 5GGUA 3VMOA 1L0YA 5CJOH 1KTKE 4PJAA 3QNZA 1PEZA 3QZWB 5E8NB 2NXYC 3KPPB 3MOAH 5FYKL 2XICA 1EZVY 1WZ1L 3P0YL 4DGYL 3P0VL 4IDLA 4KH2A 2Z4QB 4JRWA 2WWKO 3P0GB 3HI6H 3CVIL 2WQ8A 1RZJL 1R3IL 4JFFE 4PJGE 2Z93B 3BKMH 3NFPB 4O2FA 4M62H 4QXWA 3T04D 1CD0A 1MAML 1NMCC 3L1OL 2FATH 2R56H 5DTFB 4JZNB 2R23A 4FQ2H 5F7NC 5FUCC 3LS5L 5IMOB 3KYKH 4MJ6B 5F7EL 2OMBA 4HXAL 2B1AL 2ZUSA 4J8RA 1AI1H 3LD8B 1HCVA 4PJBB 2HKHL 2D7PA 3OMZA 3TVMC 2DTSA 1QSEE 4DKEL 5HHQB 3RGVC 1XGPB 4GOSA 4NZRH 4GG8B 5FM5M 4AEFA 1JWMA 5HYIA 3HE6D 5JOPD 5E8OA 4TSAL 1JYNA 4MAUH 3AAZA 1JGDB 4ODVL 2PTTB 2X4OA 3WLWD 4PP1C 1G0DA 5AZ2L 4U1MA 4PLOB 3Q3GA 4JN2A 3TLRA 1E4XL 5A2LH 3WYRA 3VFNA 3BGMA 1U3YA 2ED7A 1N6QL 4M7ZB 1P4LB 1YA5A 4AY0A 3BKYL 5FUZH 3E8UH 2O5ZL 1MCWM 2PXYB 1OTTC 1W0VA 3BPCB 5F1NA 3S37H 2VLLA 5CIPH 2JCCE 1CL7L 1A6WH 2AXJA 4CVXA 3MCG1 3N06B 2FCBA 1ZA3B 1GXEA 2Q86B 1Q9KB 4URTB 2JB6B 2DYPD 1FRGL 3RY4A 3LQZA 4G8EB 1ED3A 5CD3A 3IETA 3RQ3A 3RL1B 5DD1H 3VE0A 4BM7A 4PYHA 1YY9C 1BLNA 2R2HB 1RUPL 1YEDB 5KN5A 5L88L 2Z92A 1MFBH 5C3TA 3THMH 4J2XA 5C0CA 1CGUA 5EBLB 5FHAL 3B9KB 1KTDB 3BPOC 3N1PC 4TRPH 4OF8A 4ZS6C 2H6PA 2X70B 3CVHA 1KFAL 4PJDA 3GJFK 3VRLF 1V3MA 5L6YL 2FYYB 4WU5B 1Q94B 2VR9A 3FQWB 4XBGA 4I18C 4JVWA 4M5ZH 1XF4B 4FFWD 1A6UL 1AKJA 1QBMH 3HMWL 3WMSA 1DBAL 2C4XA 4ORGA 4OGXH 4Y19A 4XX1E 3VD5A 4PJXE 4QRUB 4LSSL 3QAZB 3DUUA 1U2HA 3VRIB 3ULUE 4IMKC 1H3TA 4LEOA 4G9FD 4ZFGH 4AZ8A 1HH6B 1R3HA 3WIHH 4MHHI 1SEQL 1VADB 5IOPB 1FN4A 1I8KA 5BVJA 1G1YA 1QA9B 1QSVA 3P3YA 4GXVL 3SOBL 3VFVB 4UT9H 2AK4E 1GZQA 4KKLD 3DETD 4WV1C 4LSVL 5GXBB 3T3MF 4YK4C 3TBVB 1QBAA 3DX7B 4M1CC 5F71A 3WUZA 4Z78B 1I1AD 1QO3A 2NTSP 2HT2D 3BKCH 5DZLA 1DFBL 2I9LB 4LRNH 4KK6C 4UNUA 1MCNA 1Z2KA 3IDGA 1FZOA 1CLZH 1A64A 1BIIB 4U3XA 1MF2H 4K94H 3C5SA 4YHPB 4JG1L 2YBRB 5JW5B 4QTHB 1CFSA 4QHLB 5DHYA 4MNQE 3H9HA 3OAUH 1WICA 1NLBL 5GRXG 3U9PH 4Z7UA 2YEZA 4HIXH 4U1HB 5C08A 2E27L 1U8LB 1EHAA 4POZC 4UB0H 1RJZA 4K8RC 3VWKB 1F4WL 4P2OC 4ZO9A 3W9EB 1H3WM 1FPTL 3BZFB 5FO7B 4P0DA 4M9PA 4Y16C 5BS0B 2O5XH 1QKZL 3GSNA 3QFJD 4D9RE 5IEKB 1E4WL 4N8CL 1AP2A 1IC4H 4CU6A 1HWGB 3RKPA 4MCYB 3FOLB 4WNQB 5GISL 1MHHA 3QDJE 2J8HA 5E95B 5I2IA 3V2AR 1HHHA 2QQKL 3TC9A 5CBAA 3ARGB 5IR1B 2DBLL 4S1RL 5JORA 4TUKH 5IQ7H 4ODWB 1EGJL 2IH3B 4JM2B 3SGJC 4PB0L 4NN7B 2F58L 5EA0L 3W0WD 4U0RC 3MSPA 3H2WA 3L7FA 1U36A 4MAYC 2XKSA 1M6OB 3LKPA 2DICA 4HIIA 2AJXH 3T0WA 1UWEL 2BVYA 5SWSB 1DBBL 4XXCC 5MERB 4NNXA 3CFKB 5C9JA 5AG8A 3DSNA 3ZE0E 4HPOH 5F7HA 3BW9B 2H9GB 4C4KT 5CGYC 1HKLL 4Q74A 1Q9WB 2OL3A 1JL8A 5GJTL 3HPJB 1WT5C 1F3RB 3QI9B 3G5ZA 2DMKA 2DTML 2NY3D 3EW3B 5B8CC 2VAAA 4IOIA 2QQQA 1Q72L 2P42B 5HDBF 3D3VA 3VXSA 3FMGH 1E6JH 2R1XB 5D2LF 3F58H 3T77A 2AI0H 4GAYA 2G2RB 3B2UC 5DSCA 3ZYIA 2UZYB 3IAQA 1J1XH 3MA9H 5DC9B 4NNYA 4QCIB 4CAGA 4J7RA 1Q9OA 2VOTA 1SM3L 3QWQB 1N2RB 1MREL 5HHMD 4GW5A 1A02N 4KJYB 5ISZB 1OPGL 1UQSA 4JKLA 4R2GD 3OKYA 5DMIL 1G7IA 2NW2A 3LEYH 1P2CB 1NSNL 1IKNC 1MLBB 3GMLB 3UTTA 1N0XH 1PKQE 3G6JE 4H26A 3LIZL 3NABH 3BP7B 3V5DB 1C16A 3S88L 5DUMH 3RZCA 1BGXH 3MV9E 2YA1A 1FVDA 3CFEB 3P4OA 3P9LB 4NZTL 1KGCE 3WEXB 4WTZG 4Z8FH 1TITA 3KPQA 1OM3L 5T3ZH 5KANI 2BMKB 4K9EL 3O3EB 1NCBH 3O4LD 1W72L 4M6MH 4YXHL 4X99A 2HT3C 4LPTA 3AVEA 1IAII 4LAJH 3INUH 4OCSH 2OJZL 2GEEA 3VI4F 4XPBH 3VXRD 4S0SD 3IU4H 5F6IC 1ADQL 4LHUB 3VFMB 4QRTB 4WIQA 3WJJC 1RFDH 4M61B 5F7DA 3NTCL 4NUGH 2W92A 5HI3C 1QFWM 2PYEB 1I7UB 1JN6B 2EDNA 3HZYB 4ISVB 3RUGB 2CH8A 4N0UB 4LVEA 4KROC 5DF0A 4EEEA 2WAHA 1SYSB 3GJFB 4OCWH 5F44A 3VWJD 4FMFA 3PABA 4G3YL 3TWCL 4FQCL 5F9JA 1L4IA 5KG9B 4I2XE 1WIUA 2R0LH 3K80A 3T4YA 5KAQF 2MQ3A 3TJEH 2RR3A 5DRZB 3T65B 2NNAB 4GRWF 4HUVA 2A77H 3TZVC 4R0LC 1LE9B 4LCWD 3WE6A 1AQKL 2P5WD 4PRHA 2V9TA 4NQTA 1W0WA 1A47A 2BNQE 2RIKA 3IDXH 3RZWA 4JZJA 4OGYL 2GQHA 1ZLUK 5MHSD 1ZLWK 3LS4H 4MZ3A 2IH1B 3SJVD 3DUSB 3HI1A 3V4VL 3BZ4A 2YA0A 3BP5A 2ZUTA 3LH2L 3QXVA 1NAKL 1GH7A 1MEXH 1L6XA 4XCYB 4I0PD 4U49A 4O58L 4K7PY 4YUEH 5J11C 2CLVA 1A14L 5A40E 5DQDL 2W1NA 1NL0H 4Y1AA 1G0XA 2V5YA 1AXSB 5K9OB 3EDFA 1NDMA 1P7QA 4GAGL 4FFVC 3B9DA 4NJ9H 5FYJH 1P9MA 4Z76B 3BN9D 3VXMD 1VEOA 1JPTH 1D6VH 5HI5C 2EDKA 4OBRA 2XTJB 3QDAA 1KIRB 4YHZH 1HN1A 3WLBA 1INDL 2R2EA 3MNZB 1BQHG 5DD3H 2AW2A 5I1LB 4H1LB 1TJGL 1J0ZA 2YOCA 5FFLA 1UM5L 1PGRB 5D96B 2X5PA 5CHNA 4CNIA 4QXUH 5HHOA 3O2DL 5T3ZD 3TYGH 1KPUB 2OXHA 4F7MA 5DURD 1T7WA 4F7CB 1FNEB 2DLGA 4CGTA 1OP3K 1RULH 1FZKA 3D9AH 5BVPH 5CUSH 3TP4A 4F58H 4MD5A 2EICA 2CUMA 3T0EB 5JHDD 4XVJL 5SWZE 4NQEA 2QKIB 5ETUA 5F3HB 2NY0C 3K4DA 3QWOA 1YEEL 4FQJH 2ITDA 4PLKD 5EDXA 1DVFA 2DRUA 3A67L 2CLZB 3C6LC 1JNHA 4V1DB 4D94A 3IJYB 3EGSB 1YPZB 4DVBB 2PNDA 4XWOD 3DGGB 2MKWA 3IXAA 3ARDA 1I4FA 1A6ZA 4LSRL 4YC2C 3GMMA 3EJZD 4ONHB 1MJ8L 3GFUA 2NQCA 1ZHBA 2D4DA 4X6CA 3OGCA 3KPSE 3GKWL 1WFTA 2DQCH 2CR6A 1U3HC 1H3PH 3MLVL 1AR1D 1PG7W 5HGBA 1IZKA 5D8JL 4U2YA 5FDWA 2IAMC 2VDQL 3H9SD 4MD0A 2YPVH 4GAFB 1S7VA 3O4OB 1IGFL 5I19H 5K33A 5J3HD 1DBMH 5E0QA 4H0HB 3D85B 3CZFB 4TVPH 2Z8WC 1ETZA 3DOSA 2AS5M 4GQ9L 3FO9B 4GMTH 1XMWA 3ARBA 4MQXC 4NOBA 5C6PB 2WIIB 1I7ZA 3RWEA 3VDAA 3AXLA 3AS1A 2MMXA 5JMOC 5EOQH 5EPMB 4PR5A 2FL5B 1JUFB 5E8PB 3VFGH 3MV7D 5SV3A 5J13B 1D6EB 4XPTL 4AH2A 5K93A 5FYJD 3GSXB 3GBLA 3MV8E 5I1IH 5A3ID 4YDKH 2A6IB 4GKOA 3TA3A 1LK2A 1RD6A 4MWFB 4QTIH 5SWQB 5ELIA 4ZTOL 3HNVL 4PJ8B 1I7TA 1CFTB 3STBA 4AQOA 5ITBH 1J05B 1WZLA 1S7UB 4FNLL 4I48A 2BY2A 2WUBH 1NGQH 3WS3B 3OF6D 4CUCA 4EI5B 2VE6A 2MKLC 1Y0LB 4P4KD 5C70A 4ZAKB 4ODUB 1S7WB 2OTPA 1HHGB 1R3JB 2EH8H 5F9DC 5I0DA 4YJZL 4L8BA 4MVBC 1BEYH 1OF2B 2C1OA 3VGFA 4UV7H 5CAYB 2IANB 3TO2A 1KJ2A 4Z0XB 4JB9L 3G6DL 2EXWC 4OGAD 1S5HB 1R3KB 5LXGH 3RA7H 1RHHA 2ESVD 5ICXA 1QBBA 4FQ1L 2EDHA 1WZMA 4QRPB 5F97E 4YX2L 5C6TL 3LCYA 4NYLA 2VZTA 4OFVA 3C5JB 5IJVA 3MACL 3SE8H 4IRSD 1MSPA 2NY7H 1BFTA 5IMLB 1DLHB 5TE4L 3A6BL 2IBZX 2DIJA 4KJWC 4PJ5E 5IFAL 1E27A 2MCPH 3W39A 2FX8L 5D72L 3BGFC 5TDPA 5F70A 2Y6SD 5TQ2H 4XMLH 5GGQL 4KC3B 3ILQC 4E9LA 1R5WA 4ZOAA 1J12A 2BSED 2DKUA 2VZUA 1ND0B 3QNXA 4ZFOB 1EEYA 2DMBA 2VXUH 4FA8A 2CJUL 4TVPD 3EAKA 4GKZB 3PGFH 4M93B 3SE9L 2Q6WA 3NGBC 4GG6A 3FOMA 4CKVX 3U9UB 3HI5H 5I1KL 3C8HA 1IEBA 1LVEA 1FVEB 5I15L 1F45A 2OS7A 3TO4D 5K9JL 4YFEA 4JRXD 4HGWB 3X13A 1DQML 1FFPB 2EE9A 7FABH 4UBDC 5C7XH 3CUPB 25C8H 1AY1L 2F8VA 3W5NA 3BSZL 5I1EH 1GVIA 4DTGL 3O6FA 4UUJA 3L5XL 4FXKB 1ZSDB 2X4PB 4BUGA 1H3GA 3NPSC 4Y4KA 5L2KA 1BZ9B 4NN5C 1C08A 4XNMB 2VIRA 3PGDB 4GRMB 3F7RA 3X14B 5D1ZA 4R4BA 4N1HB 5EUOF 3CFBB 4KMQA 1LO4H 3GIZH 1DN2A 3FQNA 3B4NA 1F58L 3E6FA 2DF3A 3DSFL 4EVNB 3FT4A 1OTUC 2BVOA 4HW6A 4HJGB 4XTRC 1P84K 4L1HA 3QIBD 1FNLA 1VEMA 2BOCA 3IT8D 3RIAF 2R69H 5JOPE 2ICEA 5E6ID 4HLJA 1ZT7B 1YUHB 3PL6B 1GGYA 4MXQC 5IB3A 4HFUL 3R8BB 4BFBD 2VZSA 4P5KA 4MD4A 5I18H 2JK5B 4PGCB 2BZDA 1LEGB 5C0RL 5IJKC 3D25B 4HKBB 3BMWA 2A83A 3PHQB 4NRXB 3WIIL 1QLFB 3OJDA 3UC0L 4DFIA 1X5AA 1FAIL 5D71L 3OXRB 4OKDA 5D7JC 1HOCB 1FL5A 3PJSB 1FG2A 1QACA 5KVGH 1BVZA 2WNGA 3TN0B 1NCWH 4Z7WE 3RDTB 5IW3A 4K3HA 5D9SA 4Y4HB 5TE6L 3SPVA 3VXTB 5T1KA 1BVLA 3KJ4C 3IFOB 1Z3GL 2NXZC 1H8SA 5A2FA 4L4VB 2EYRB 1U8NA 4L3EB 3MRGA 1A2YB 5EC2A 5IBLC 3DVNA 4WW1B 3ZE1F 2A9ML 2XWTB 1JWUB 1A5FL 4LEXL 5HVGB 3OKMB 3PWLB 1IGJA 4QOKA 4FABL 1G6RH 2YD7A 3AMLA 5C0AB 5DMGC 1V7NL 5B3JE 5E08L 4GBXA 1G1CA 3WO3B 3KNBB 4JR9L 1I3RB 3MGTB 3MLTB 4HFWB 1B0WA 4RIRB 4WCYL 2W65B 2V6HA 1UT9A 3TESA 2VUOA 4YE4H 3BP4A 4LCCA 3X11B 2R9HC 1U93B 2R1YA 2R0ZL 4H5SB 3HAEA 3UZQA 1JI1A 3QQ4B 3TNNB 1JYXA 3RNQA 4ZUSB 1QLRB 3QIUB 1QUNA 3GI9L 3LMJH 5EBMB 3HRPA 3CAFA 2EO1A 3BDYH 5JUEH 2DQEH 3PNWB 4MNGA 2SEBA 3SE4C 1M1SA 1W72B 1P4IL 3QHZH 3N9GH 4PBWD 2A74B 4Z7VA 2PF6A 3FN0H 3B6SA 4YXLH 3HPLB 5HJ3A 5EO1B 3P73A 4JFQA 5DVOA 1UZ8A 4O51B 3O3DA 4TOYL 4JKKA 1OAXL 4OZIF 4A6YH 4HJJL 4UDTB 3QZWA 5E8NA 1CVRA 2QQNH 4Z95L 5EZOH 4TPRL 2CPCA 4ONFH 4TNWF 3CC5B 3BPNC 1WLHA 4MZ2A 2Z4QA 3TBWB 5E6YA 4P59L 2Q8BL 3MJ9L 3OZ9L 2NZ9D 1QVOB 4YGVB 3T2NH 5C07B 2Z93A 5GRUH 3NFPA 2LV4A 4X7TB 3LRSB 1F4XH 2B4CL 4QT5B 5DTFA 4JZNA 3WS6C 5DUPH 5IMOA 1WBZB 5F7YC 4KXZI 5D5MB 2Z8RA 4MJ6A 2VMFA 5CP7B 1DSFH 3V6OE 1HYRC 4PJBA 4WO4C 2HRPH 1XGPA 4GG8A 4Y4FB 3QFJE 2VXTH 1R5VB 2GSGB 1SYVA 2GIYA 1JGDA 4DZBB 2PTTA 1GOGA 1MIMH 2A9NH 1GGIH 2W0FB 5LCVL 1PLGH 1P4LA 5F1OB 2IPUK 3SGJA 4B7IA 5HVFB 5CEZL 3VW3H 3BPCA 1HNGA 2GHWB 3S9DB 3TFKC 1OD9A 1J8KA 4NN6C 3W0WE 1PKOA 2Y5TB 4JCMA 1ZA3A 4MAYA 2YMXH 4KY1L 1Q9KA 3RVWC 4W6WB 2JB6A 2RB8A 1ZHKB 2OZ4L 4G8EA 3HZKB 3SKJH 2J6EL 5CMAB 3V0WL 2NY4B 2VR5A 3RL1A 4EBQH 1KCVL 3QCVL 2C3HA 2R2HA 1YEDA 4D2NA 2EDDA 5EBLA 3B9KA 2BJML 4QHKJ 1KTDA 4RFNC 4WGVB 5JIHA 4NO5B 2X70A 1KENH 2HP4A 5T1LB 3WFEL 1LP9B 2WQRA 3DYOA 4WU5A 1Q94A 3FQWA 1J5OL 2FBOJ 4AIZB 1KN2H 2YD6A 5EZIL 4R4FL 1QG3A 3T3ME 1EAJA 3LOWA 4FQLL 4JPKL 1MCIA 3HZMB 3GRWA 1OARL 1U8QB 2LU3A 5A2IH 3UO1L 5HI4D 1RU9L 4QRUA 3BWUC 4OCMC 4KI5C 3T1FB 3H3BC 1IT9H 4U0QB 4F7EA 4HPYH 4PJAF 2JJTC 5HHME 4IMLB 1U8IB 2XZQH 1HH6A 3D69B 4ZYKB 4OLZL 1IKNA 3NA9L 1VADA 4G6KL 5IOPA 5DMYA 5IK3B 1QA9A 4S1DC 4FQXD 3VFVA 1OGAB 4DFHA 3MREB 4YHOH 2X4RB 2V2TA 3GBNH 1FZJA 3TBVA 1K85A 3O6MH 2RCSL 2IPKB 2FO1A 3ZHKA 4CDHA 2QSCH 3O4LE 5ECJE 3JWDL 5D1QD 4XCCL 4KTEL 2I9LA 3QUML 3BQUC 1S7RA 1BIIA 2YK1H 2P5EB 4J4PC 3UTQB 3WJJA 3ARRA 4YHPA 1NFDA 1DUYB 1UA6H 2YBRA 2BRQA 4YDIH 1QYGL 4XAWH 1ROWA 2FLRT 2XNAA 4QHLA 4MXWH 4LKXA 2P7TB 3BH9B 2H8PB 5D6CB 1FAKT 3RU8H 1HWHB 4KRLB 4ONGL 4NKIL 4U1HA 5F7UA 1U8LA 2WBWB 3EO9H 1JHKL 5EU5B 5FOBB 4NQCB 3MBEC 5DC0A 3VWKA 3MLXH 5D2NB 3W9EA 3P30L 4PV8B 5FO7A 4G6JH 3NBNA 1A4JB 1S5IH 4WY7L 4JFEB 1JGVH 5C2BH 5BS0A 2FB4L 2X1PA 3QBTB 3TZVA 4R0LA 5DJ6B 1F90L 3K2MC 5MEND 4YHYB 1UH2A 5SWSD 3HMXH 3H3PH 5JXAH 5IEKA 1JE6A 5AWNH 5TF1L 4M1GH 5KW9H 4JDZB 3V8CA 5GGRY 1QFWL 1CLOL 5D1XC 1L9NA 3FOLA 4WNQA 5C0BB 1NPUA 4EN3D 3ARGA 5I1HL 5IR1A 5MHSE 4ODWA 4JM2A 1D5MB 2IH3A 3QRGH 3SJVE 4NM4L 5DFVD 1X4YA 1OAKH 3PQYD 4JFOB 3KWWB 1OAUL 3W2DH 4JPWH 4OIIL 1I9JL 1I8MB 2G60L 3ARYA 4H8WH 1FBIL 2VLME 4PJDF 4XP5H 3V0VB 3OKNB 4CN6A 4DKDC 4MQ7B 4LLMB 3FTGB 2X1QA 3V6ZB 3CLFH 4UNVA 5MERA 5HXMA 4MA1B 3VXME 4CJ1A 1LQSR 3BW9A 4KUCF 3W81A 2XQYG 2YXFA 4FFZH 2H9GA 5INCB 4UV4L 3SDAB 3ZTJG 5L0QC 4MMZC 3GNML 1RZFH 5AZEH 3C08L 4Z7QF 4N5ED 1MIEL 4UINH 5GGTH 5DR5H 3HPJA 3QIWB 1LO3H 3QI9A 2UY7A 1T4KB 2J88H 1KIUA 4QRSB 2H32H 4YDLC 4N9OB 1LD9B 2CGRH 5I1AB 1CD9B 4JHWH 3O9WC 4XPFL 5LAXB 2R1XA 3MODH 2HN7B 5I1DB 3UYPA 2G2RA 2AEWA 3DNKA 5T33L 2D31B 1T1XB 2ZSVB 2XRAL 1FZMB 4G6FD 1IKFL 5JHDE 4QCIA 1GZPA 2Y06H 3ET9F 4U1GC 4LNVA 3IFNH 1N2RA 1NGWB 2HTKC 5DJAB 1J7VR 1I8IB 4MDIB 4OCYH 1ZVYA 3C6LA 4YFLF 3LDBB 5ISZA 3OPZH 15C8H 1P2CA 1MFCH 1XIWB 1QRNB 2APFA 4U1LA 2K7QA 2IFFH 3MTRA 5CZXD 5E9DD 1TFHA 5IFHL 3CFEA 4U1KA 4Z7UF 3WEXA 1IC1A 4UU9B 3JUYA 1U3HA 4ZPVB 2BMKA 4XVUC 3O3EA 4IJ3B 5BV7L 1TENA 4GRWE 3WHE1 3SDXE 2IAMA 3V95A 2YXMA 5IESL 3VFWB 3VGHA 3MLYL 5CD5C 4LHUA 1RUQH 4LVHC 3VFMA 3H9SE 2D7TL 5HDOA 4QRTA 4M61A 3STLB 1HEZB 1T22B 1T5XB 2PYEA 2R29L 4D3CL 5KSBE 5DVNA 1JN6A 3HZYA 4RGMC 2PYFB 3GSNH 5EZJA 5GS1C 3RUGA 4N0UA 2VQ1A 3WXWH 1J0JA 1WVZA 5C0CD 1IM3B 1TDQA 2YA2A 3GJFA 5E5RB 1O7VA 4PRIB 2ZJSH 2A2QT 4KKBD 3G9AB 1QBLL 3MV7E 4OLWL 4XMKL 3ZDZF 5KG9A 4RMQA 1N4XH 2ATKB 2DIBA 5DRZA 4HZAA 1JK8B 3MLZL 4J6RL 2NNAA 4EUPB 4ZS7H 1U6AL 4ZUTB 1LE9A 1BM3H 1HIMH 3LEVL 1S9VA 4XMPL 1PJ9A 1F2XK 1CGVA 3FO0L 4E41D 1R24B 2R0KL 4N68A 4X4XB 2IH1A 4AL8L 1HXMB 2I9TB 1OW0C 4ZUUB 1L0XA 2QTEA 4XHJC 2H2PC 2QHRH 4XPAL 4JE4B 3B2VH 1ZLVH 4XCYA 2EZ0D 3NN8B 1IRAY 4NM8L 3U7YH 3X3FH 3LEXB 2CRIA 2J4WH 1R0AL 1ZEAL 5E5UB 4Z77B 2A0LC 4X7EC 3UP1A 1KC5L 1IAIM 1HKFA 4KGJA 5KAQG 5K9OA 4AM0B 5JQ6H 3OKOA 4Z76A 2ESVE 4Y5YB 4I77L 2E7MA 3EFFB 4K55A 1DBKL 1MI5D 4P23C 5DXWA 4ERSH 1KIRA 4JREB 2FJFB 4PJ7B 3MNZA 3V5KB 4ZO6A 5I1LA 4H1LA 1J9CT 3VFUB 3I6GB 5DC4B 1RK0B 1RZ8B 1X5ZA 3ARFC 4KJQC 4HUWB 4N0YL 2NX5B 1EUUA 3H7LA 1NCDL 4OFKA 4D0BB 1JNNL 3F5WB 4U4BA 5I8EA 1I8LA 1KPUA 4I3GA 3B5HA 3WDIA 4F7CA 1FNEA 4JHAL 3WFBH 5C08D 5IBUB 1UWGH 1XGUB 2C3VB 4LIQH 3CXDH 1FFQA 3T0EA 5CS7A 2Z31D 1E4KC 2DQIL 2QKIA 4JY4B 3T1WA 5F3HA 3NFSH 3S3SA 4TSCL 3ME0A 5EUKB 2E9JA 1FDLH 2LFGA 2UZIL 2AP2A 5MEPB 5FB8B 3HTLX 5DJZB 2CLZA 4V1DA 3IVKB 3LDBC 4G43B 3IJYA 3IKCB 3EGSA 1YPZA 4DVBA 1NBVH 3DGGA 4XNYL 4LVOC 3T3PE 3U0PB 3BE1H 1ZLWH 4ONHA 4JRXE 5TDNB 1FH5H 4R90L 3BRGC 1D9KB 3WJLA 3I9GL 2DQFB 3U4AA 2ZSWB 3CLEL 5JZ7C 3V79C 3QCUL 3KXFD 3NCJL 2LVCA 2AAVA 5FO8B 3V6OC 1E4XI 3P2TA 5F9AC 4MYWB 4PGDB 5HVHB 3RTQD 2B2XH 3Q2CA 4OCRH 4XNQB 2ZUWA 5CJXC 5TE7L 4GRLD 3D85A 3GM8A 3CZFA 3FQXB 1T20B 2Y9RT 3MUY1 3WXVH 4PJEE 2E7LA 2EDJA 5EU6D 2V2XB 2A38A 4PB9H 1S78D 1ODAA 3C5ZB 3FL7A 2J5LB 4JKPH 2WIIA 1YEFH 3PG2A 4FTVB 3GO1H 5BRZB 1CT8B 2XZAL 5E8PA 2FL5A 1JUFA 1K6QL 2AJSL 3E3QC 1D6EA 3GSXA 4WTZA 1D5XA 3ZL4H 5GZOD 4YDVA 2YN5A 2A6IA 4MWFA 3QA3B 4PJHB 3TCLB 3IFLH 1J11A 3SHSA 5AYUH 4U2ZA 5SWQA 1IAOB 1EFXA 1DQDH 4PJ8A 1CFTA 1I7RB 1J05A 1CD8A 1JPSL 1S7UA 3WS3A 3SE3C 4K3JL 4HIJB 4EI5A 3HC4L 2G5BA 3QR2A 5K9QI 1I85A 1Y0LA 4ZAKA 5JO5B 4ODUA 3QEUB 3LB6C 1HHGA 1R3JA 3U4BH 1G0YR 2JJWA 2DQDH 4ODTL 5IVXE 1EDQA 1OF2A 5LBSL 1KN4L 3K7UA 2XN9B 2IANA 4HUKB 1UH3A 4Z0XA 3EZ8A 1S5HA 4M4RA 1KJ3H 1FFOB 4OZFG 1MPAL 1R3KA 4MXVE 4UIKL 4XPHH 3H6JA 1XCQB 1EX0A 1EO7A 1BMGA 2HT4C 3QUZB 4QRPA 1WFNA 4LDOB 5KSAC 1HE7A 3FKUS 3QP3A 2EC8A 4OD2A 3ULVH 3C5JA 2IF7A 2GT9A 4LSPH 4AEEA 1BOYA 3JV5A 4X9HA 5D93C 5IMLA 1DLHA 4ZTPH 4O9HH 1NUFA 2DIAA 2OR7A 4PJGB 1KIQB 3H42H 5CWSB 4LGSB 1JRHL 3GIVB 3I6LE 5GS0H 3DRQB 4NP4H 2E6PA 3KYOA 5HSFA 4X6CF 1ND0A 4I9WD 4ZFOA 2X4NA 5E2VH 2BNUA 2YUVA 1V3JA 4GKZA 1RIHL 3NAAH 5B4MC 5CFHA 2DJSA 3KS0H 2BHUA 3IDYC 1QSEB 1FGNL 1N3NB 3DI3B 3QUMB 4MB4A 4YR6B 3S36L 4APQC 5C0EB 3U9UA 4PRHD 4DEPC 3L5IA 3AS0A 1FVEA 1LDPL 1J1OH 4K2UH 1M71B 1RZKL 1O7SA 3EDKA 1U92B 1KPVA 1LO2L 1IBGH 4AIOA 2HLFD 5CP3A 4HGWA 1FFPA 4LSTH 4JGUA 4XNUH 2ZCKL 5E8EB 2IBZY 2B4CC 3ELAT 5E8DL 1E6OL 2HVKB 4UTBH 4XPGL 2JCCB 3HE7D 3WFHB 1FCCA 2X4PA 3QNYB 1KCKA 2WWMC 1A7QH 1BZ9A 4P3DB 3NZHL 4Y1AD 4AQ1B 4XNMA 3OJMB 3PGDA 4GRMA 4J3WA 2NY2D 4OCXL 3X14A 1EIBA 1MELA 4F8TA 1A0QL 3CFBA 1J88A 1INEH 3OR7A 4ZUVB 2BHZA 3TN0D 4HS8L 4EVNA 1J8HD 4BFIB 4WO4A 2Y07H 4PRPB 4Z9KB 4P5TD 4HJGA 3IDNB 1KLUB 3ZE2E 3D39D 1EGJA 2XOTA 3BZDA 4RWYH 1A4KB 1BJ8A 4YQXH 5DD0H 5IG7A 3QPXL 1ZT7A 5CCKH 1IMHC 1YUHA 3PL6A 3D0LB 2UWEA 5E00B 3ULVD 2OQJB 4PGCA 3B83A 4JO4L 3D25A 4HKBA 3V5HB 1TMCB 2B5IB 4NRXA 1QLFA 1RMFL 1A7OL 3OXRA 1D7FA 1VFAA 5IHUL 3PJSA 4PJXB 3ECBA 5JPNB 3T0BA 4LDEB 1B6DA 1LILA 3RDTA 3BH8B 1FORH 4MJ4A 3SKOA 3T0XA 1UACL 4LGRB 4JQVA 4Y4HA 2IEPA 2Q87A 5JA8B 1RURL 1T03L 3IFOA 5GS0D 3EJYD 2N1KA 3RKDD 1NCNA 4L4VA 2EYRA 4L3EA 4MS8D 5KTEH 1NGPH 1FLRL 1A2YA 4JQIH 1OHQA 4WW1A 5E2TL 2AK4B 4NPYA 4NWUH 2XWTA 3VFTB 1JWUA 2FWOB 3FFCD 3GK8H 5HYSG 5EORH 3OKMA 3PWLA 4XB8A 5C0AA 1SVZA 5SX5K 3KNBA 4HD9A 1I3RA 3MGTA 3MLTA 4ODSH 3DV6B 2FD6L 4R7DB 4EKXA 5T5FL 4RIRA 1K4CB 4GG6F 5EWIL 1AHWC 3X11A 4OZIE 1RJYB 1U93A 1IGMH 2EDBA 4H5SA 4F37F 4MNQB 3BKJL 1BF2A 3QQ4A 3TNNA 3MR9B 4PRAA 4QWWC 1QLRA 4ZUSA 3ULSB 1MHEB 1BWWA 4OM0L 5EBMA 1MHPL 1NCAL 3BP6A 3PNWA 3Q1SH 2DL9A 1AO7D 3TA3D 1W72A 4TTDD 2K9UA 2A74A 3GB7B 4LHQB 3IB4A 3HPLA 1CGTA 3OKEB 1CYGA 5EO1A 3ZYJA 3UCRA 1NC2B 1JMXA 1ADQA 4TUJB 3WFCH 2WUCL 3JWOH 4O51A 1G7QA 1U95B 2LABA 4P46C 1IZJA 1FIGL 4Q9QH 1URLA 4UDTA 2F8XC 3D2UB 3L3GB 4MJIB 2EDFA 1U91A 4WI2A 2VDLH 3CC5A 3TBWA 5IBTH 1KIPB 1T2QL 4NC0B 1JGLL 3NZ8B 1ITBB 2ZUQC 4ZNEA 5JW3L 2DQTH 1QVOA 1SY6H 4YGVA 5IVZB 4YBHA 5C07A 4JO1L 4X7TA 4GW4B 3C09B 1UYWH 1WEJL 3LRSA 4FMKA 2WBJC 4Y2DB 4UNTA 3EYQC 4FQIH 3SDCD 4QT5A 2IALB 5B3NA 4KZEL 1CDIA 1WBZA 2F8OA 1X44A 4X4ME 1CBVL 5D5MA 1L7IH 3L5HA 3LHPL 3UPAA 4NT6B 3LQAC 4XP1L 3OL2A 4HS6B 3QUYB 1K5NB 4CN4A 4NNPH 2ZCHH 4Y4FA 4H88L 4M48L 1R5VA 2GSGA 3T8XB 2BCKB 1H15B 4G6AC 4DZBA 2AGJL 4XNZB 4P2QD 3FO1B 3VGAB 4N8VB 4X9BA 2Y7QB 4NKOB 5C0NC 1SBSL 1OT1A 1EVUA 5J12B 1T5WB 4LSUH 4JG0H 4O5LL 1JPGB 1MRFL 4XC3L 5I8CB 1KELH 4XXDB 3FONB 3PQYE 2Y5TA 4HG4K 1BP3B 1ZGLB 1Q9LB 4ZOBA 2DAVA 2F53E 3UTSD 1SBBA 2OXGA 4JEGB 4X6DA 4JN1H 5CJOL 5D4QA 2G5RA 3F7PC 2GTWB 2BVTA 1ZHKA 3MOAL 1BVKA 3ARED 1WAAE 3HZKA 1CICC 3S5LB 2BOBB 3BO8A 4I3SL 1OSPH 1PKQB 3HI6L 3G6JB 4OGZA 4Q9RH 3O2DA 2NXYD 1NLDH 5DZOA 3CDCA 2YRZA 3DTXB 3BKML 3MRJB 3MV9B 4LPXA 2XACC 4M3JA 4LMQI 2FATL 3L95B 2ED9A 3MA7B 2EDQA 3OR6B 4NO5A 4FQ2L 1U9KA 2CDEB 1GC1C 5T1LA 3KYKL 1LP9A 5JOFB 5E4IA 5CEXB 3WN5B 4FFYH 1AI1L 4Z7VF 3P4MB 1WSST 3M07A 3HZMA 4NZRL 3UYRL 2VZOA 1U8QA 4YIQB 4MAUL 3BXNA 3TVMD 3T1FA 2AJUH 3I3DA 1YQVH 3RGVD 4LDLB 3BEVB 4QHMB 1INQB 1U8IA 1PX4A 1TJIH 3RWIB 3D69A 4ZYKA 5FUZL 4DGVH 1CF8H 3E8UL 1YYMH 5C09A 4PP1D 3S37L 2MWCA 3EYVB 3KPRD 4U6XB 2CMRH 1A6WL 2M26A 3VFPB 5ICZB 5BV7C 1OGAA 3MREA 2F5AL 2X4RA 1OTTD 3MLRH 5CZKA 3G5VA 4DN3H 3AC0A 4LVNB 2MTPA 2YKLH 1PW3A 4KK8C 3NCMA 3C6SA 3LKQB 3MYJB 1TZHB 5DD1L 4DVRH 1AH1A 4PJBF 4JVPA 5D6DA 2V7HB 4K8RH 4N0FB 4A2MA 5HDLA 2P5EA 1MFBL 1J0IA 3UTQA 1UZ6E 4WI6A 1X5HA 3KDMA 3JTTB 4TRPL 4W4OC 1WV7T 1YY9D 3ZKSD 2JJSA 5GS1A 3KHQA 2P7TA 3BH9A 1ZVSB 2H8PA 3L3IA 4TNVF 2FHBA 1Z9OA 3O2WH 5C0CE 5EU5A 4ZS6D 5FOBA 4M5ZL 4NQCA 1F6FB 2MSPA 3BEWB 1QBML 5D2NA 2V5MA 2ZUVA 1IEAB 4PV8A 1NKOA 2EKSB 1A4JA 1FNGB 4OGXL 4D0DA 4N0RA 4PJDE 1TPXC 3GGWB 5EZLB 1OL0A 1JGUH 5K9KB 4JDZA 4D8PB 3W5MA 5B39G 4ZFGL 4KFZC 3QXTA 3BD3A 5C0BA 2R4SL 1MWAH 4E41E 5F7KC 4Z7QE 1TTUA 1D5MA 1FGVH 1MCLA 4DGIH 3MCLH 2VDNH 4UT9L 5KJRH 5M95B 4NCC1 2FEEI 4JFOA 3KWWA 3BHBB 3WNNA 5SWZB 3K74B 3C60C 1B2WH 1I8MA 4JM4H 2PR4H 3FQUB 3QUXB 4X5XA 1J10A 3NCYP 2KKQA 3V0VA 3OKNA 4KVNL 1EH9A 3BKCL 4LRNL 4Y5VB 4MQ7A 4LLMA 4LLYB 2PO6B 2DWEB 3FTGA 1CLZL 3V6ZA 1T04A 1MF2L 4K94L 4ZQKB 4C54A 1NGYB 4FRWA 5LWYH 5F7WC 4X8XA 4RA3A 1IILE 5J6GB 1MI5E 4KK6D 3T2OA 5INCA 5TGBB 2PW2B 3SDAA 2E5EA 3U36B 3O8XC 1MCDA 4Z0BH 3OB0K 5CINL 3Q48A 3KPSB 3U9PL 3CX2A 1FNAA 4JKWA 1XGRB 3Q0HA 1A7PL 1ZT1B 4HIXL 4GLRH 3QIWA 4B0MM 3I6KB 1F8TH 4UB0L 4QRSA 1QPXA 4L29B 4WHYH 2BSSA 1OLLA 1LD9A 3KR3H 1BFVH 5DRNB 5KBNC 5I1AA 2E8YA 1FL3A 2VWEE 2QLVB 5LAXA 4POZD 2O5XL 2VQUA 2CXKA 2HN7A 5I1DA 1JF5A 2ERJB 4K8RD 5C08E 4P2OD 2D31A 3NCBB 1T1XA 3NH7H 1E4KA 4M00A 4XBEH 1FZMA 1IC4L 2ARWA 4QRRB 3MQIA 1VSCA 4Y16D 4JQXA 4G5ZL 1YN7B 5DJAA 4AK1A 4NZDA 1I8IA 4MDIA 3LN4A 4NO3B 4CU7A 4TUKL 5IQ7L 5ACMA 5DJYB 5EBWB 3FB8A 4DKFL 1NFDF 3MV8B 1XIWA 1QRNA 4KU1A 3U30B 2OYPA 2CSPA 5D7IE 3O6LH 3U1SH 3EO0B 4JJ5A 1CXEA 2J2ZA 1EJOH 1JHTA 1LNUB 4RMWA 2D9QB 1CD1B 1C5CH 3QO0B 4MA8L 1NUDA 1JHLH 4UU9A 2AJXL 4ZPVA 1N5AB 3KXFE 4L9LC 1CU4H 2NY6B 4MAYD 5HPMA 4Q9CA 4HPOL 5ACZB 4POYA 3PV6B 2MHAB 4H0GA 3GSQB 4ELKB 5GSRB 3VFWA 4PY7B 4YHNB 3TIDB 1VFBB 4JO2H 4NKMB 1HEZA 1T22A 3STLA 2IQ9L 4MHHG 4C56D 5EU6E 2PYFA 1BZQK 5CGYD 4HK0B 3EKCA 3DMMB 4M6AA 5GRWA 3QISA 2EE6A 1T7VA 5HPOA 3IDMB 2HJKB 3FMGL 4PRIA 4JM2F 3C2AH 3F58L 1CIUA 2ATKA 4JFXB 3QT2A 3SDDB 2X41A 4C57C 4LARH 3GSRB 1J1XL 1JK8A 2AQ2A 3MA9L 5CZVH 2QEJA 4EUPA 5BW7C 3D3VE 3VXSE 4PP2B 2J1KA 2BSRB 3B2UD 5GRYA 3GHEH 2CDGB 2BDNH 3LEYL 4B41A 1N0XL 3HRZA 1HXMA 5J1AB 4HK3J 4Z7NF 2I9TA 3NABL 4ZUUA 5DUML 3NIFF 1B3JA 1BGXL 3ZTNH 2FHFA 1MCRA 2JELH 4GLRI 3UTPD 1PBYA 3BMVA 3NN8A 4RGOH 4Z8FL 3LEXA 5FKPB 4PJ9B 5T3ZL 1NCTA 3UTTE 4Z77A 4LIQE 2JLLA 3O3BB 4LPUA 3VCLB 4M6ML 4XC1H 3INUL 4OCSL 4OLEA 3DGCR 5K59F 4AM0A 4WWKB 3IU4L 4Y5YA 1IQWH 4HBQA 3EFFA 4F8QA 5L2JB 5FXCH 1A6AB 4GSDH 1RFDL 2HT3D 2IWGA 1BD2D 5CILH 2FJFA 3KPTA 4PREB 4PJ7A 4IBLT 3V5KA 4UIMB 4XHQA 3VFUA 3I6GA 2OR9L 1FYTD 1RK0A 1RZ8A 4RQQB 2EEDA 3FZUC 4HUWA 2IQAB 2NX5A 4RBPH 5HI3D 4Q6YA 3ARPA 1IVLA 4OCWL 1YECH 4JFDD 2XKUA 5DA4A 4D0BA 1GPOH 1P5UA 3F5WA 4QRQA 2D7MA 2DLFH 2R0LL 4KROD 3TJEL 4NO0D 3QJHB 1HDMB 4PBXA 4AG4L 3Q5OA 2C3WA 2GUOB 4JPVH 1XGUA 2C3VA 3NCYS 4HH8A 1L9MA 1AGCB 4ZUWB 2I24N 4JY4A 3FN9A 2EECA 1CVSC 3IDXL 3TZVD 5EUKA 4IHOB 5MEPA 2PTVA 3LS4L 4I4WB 3RBSA 3RX5A 5FB8A 5DJZA 3IVKA 4G43A 3IKCA 3HE6B 2VKXA 4PRHE 4V2BA 3KYMB 1ZVHA 3MJ9A 1MEXL 5JXEA 3U0PA 4YUEL 1QEWB 2NY1C 2X4TB 3RUGF 5D7LD 5TDNA 1NL0L 3VI3F 2PN5A 1D9KA 4LNRB 4L8SB 2DQFA 2ZSWA 1CXLA 4ZXBC 4NJ9L 5FYJL 1IAMA 5DGQA 1F3JB 3HUJE 3MGOB 4PGDA 1JPTL 1D6VL 4WUUA 5DHVH 3NMEA 2AK1H 4Y1AE 4FFVD 4P4RB 2DYPB 4TYUA 2R2BB 5DD3L 5EOCH 2D7OA 3ZDXE 1T20A 1PG7L 4NC1E 5HI5D 2V2XA 3ES6B 2HVJB 4XGZA 3C5ZA 4R4ND 3RVTC 2VXVH 3CSYB 4QXUL 4AIXA 1J8HE 4PGZA 3TIEB 5FYLH 1MLCB 3TYGL 1CT8A 2EE3A 3D39E 3ILPB 4HLZG 4U7KA 1RULL 5BVPL 3D9AL 4JFZH 5CUSL 4F58L 1G7MA 5KANG 5DRWA 3QA3A 5HHOE 3TCLA 5IIEB 1IAOA 1A9BB 3AB0C 1NANH 1C1EH 3NIGF 1I7RA 2AERT 1S3KH 3OB8A 1KEMH 4FQJL 4RZCA 2OZ4A 5IW1B 1FSKB 1J1PH 2J6EA 5LGJB 3QEGH 4HIJA 2NY0D 2WSKA 3GUTB 3QEUA 1EO8L 4NRZB 4YHKH 3C6LD 3RRQA 5M94B 4G9FB 2HLAB 4MQTB 4KAQH 2EDXA 1UB6B 4JFFD 1REIA 5AUMB 2DQCL 2XN9A 4B7LA 1KNOA 4R6UA 3RIFK 1TQCB 3QUKB 1H3PL 1FFOA 4Y5XB 4IOFC 5F7FA 1XCQA 4AEHH 3QUZA 3FFCE 2YPVL 4RAUB 4OJFH 1U3HD 5I19L 4EDWH 1DBML 1EEUA 5F89A 5IQ9B 4TVPL 4PBVC 1I1AB 3ZHLA 2VDKH 3JSSA 4PJFE 4EDXB 3DI2B 4GMTL 3IFPA 4OLYH 3S8WA 1AHWA 1MCEA 1PDKA 3PWUB 3NACH 3VFGL 1AGDB 4MQXD 1YPZF 5CIPB 3L3KB 1MFDH 1KIQA 5I1IL 5JA9A 4OUOA 5CWSA 1KLGB 3GIVA 4QTIL 3DRQA 3HNSH 4FZ8H 2HA1A 4CADB 5TH2B 5ITBL 4ACPA 1LE5B 2WUBL 1A1OA 2D03H 2EDOA 2XPGB 3KPNB 3DIFA 3RPIB 3CU7A 1OVZA 1QSEA 1N3NA 2C4FT 2J7LA 3QUMA 4Y2OA 4YR6A 5T3XH 1YY8B 3HZVB 3LS5H 3QFJB 5FYLD 1MVFA 5F7EH 2EH8L 4HXAH 1M71A 1T2JA 3PGCA 5EU7C 1U92A 1BEYL 3K1KC 4UV7L 2LAAA 1BFOB 5F1SA 5KVFH 4M5YH 4N8PA 5E8EA 3ALWA 4TSAH 2FHCA 5GRJH 4MVBD 4M7LH 3SQOH 2HVKA 4KRNA 3QFDB 3RA7L 2JCCA 1XGQB 2Y23A 3WFHA 3KLHC 3W0WB 3PP4L 1X7QB 5BOZG 3QNYA 1IC7H 5HYJD 4ZO7A 2WP3O 1WIOA 2EXWD 3CNKA 5SX4H 1N6QH 1IEHA 4P3DA 5GRVK 4HDIA 2FH8A 1VPOH 3MRQB 4F15B 1HCFX 1WC7B 2VXSL 3IDUA 1OAZH 3SE8L 4HWEH 4WFFD 1CL7H 5HGAB 1CS6A 3DPBA 4NFBA 4ZUVA 3DURB 5ANME 5E2UH 4BFIA 4PRPA 3IDNA 1KLUA 1OSZB 2MCPL 4XBPB 4BFGA 1YQ2A 3MRIA 3SGDI 3IRPX 4JKMA 5TQ2L 4XMLL 3L5JA 4YBLB 1A4KA 4KJWD 4ODHL 5C0IB 3IJHB 3ARQA 3D0LA 2VXUL 2VR4A 4CVZB 5E00A 2NY3B 2OQJA 1UEYA 3PGFL 3ILQD 3V5HA 1MJ7H 2IBBA 4J3UA 4HIEB 2OI9B 3KLDA 3F12B 3HI5L 3WNLA 4PJXA 3UZVB 5MI0B 3UTSE 1YMHB 1JWSA 3BH8A 5HHMB 5C1MB 4GG6E 7FABL 5C7XL 2PUQT 25C8L 4XCNB 4X8JA 5I1EL 4R2GB 4MNQD 3FQTB 4ETQB 1C7TA 2CK0H 4UBDD 1MRDL 1HSBB 3WD5H 2AK4A 2FGWH 3VFTA 2FWOA 3O2VH 1IJ9A 5T3XD 2ED8A 1PX3A 1LO4L 3GIZL 4OV5B 2CUIA 4GXVH 2B7DT 3O4LB 2HFFB 3DV6A 1JGEB 2J3SA 4D9RD 5L2KE 4QHNB 4R7DA 2ATPB 1AGEB 1CIDA 4R3SB 3VXRB 1K4CA 5FUCE 3QDJD 3CSBA 2R69L 5KVMC 1RJYA 4KK9D 4WI3A 1OTUD 4PD4J 3O0RH 4NCC2 4XTRD 1GIGH 4B5EA 4OD3L 3MR9A 2P4AB 1I3UA 1U58B 3UBXB 1MHEA 3LN9A 5DI8B 3ULSA 3VJ6B 4BQCA 5I18L 2AEIT 1VENA 3VWJB 5I8KH 4HJ0C 4MXQD 1A22B 3QULA 3ZSSA 1XF2B 1N64L 3F8UB 4GXUN 3MRNB 3GHBH 3GB7A 1EFXD 4JLRB 4PLJC 5KVGL 3OKEA 2GJ6D 3PP3K 1NCWL 1NC2A 4LCWB 4TUJA 2VC2H 2VN7A 3SKMA 2P5WB 5D7JD 1MCOH 1U95A 3I75B 1FPTH 1MAKA 5ILTL 1PAMA 5EFIB 5IB4B 2CO6B 3D2UA 3L3GA 4MJIA 5HHNB 4AEIH 3SJVB 2JTDA 2NXZD 1ERNA 1KIPA 3NZ8A 4JGMA 1IC5L 1WWWX 2Y36L 4NZUH 4I0PB 5IVZA 1G6RL 1KOAA 2QQKH 5IBLD 4FZEH 4Y2DA 4FS0A 1EGJH 3GMNB 2A6KA 2UWEF 1AXTH 1HH9B 2IALA 2X89D 2AQ1A 5DMGD 4NT6A 4QOKE 1BF8A 2CKBH 3VXMB 2X4UB 4J23A 3ZKNC 4YE4L 4HS6A 4GFTB 3QUYA 4NWTL 1K5NA 1Q1JH 3STZB 1MFAH 1KB5H 3RWGA 3T8XA 5KS9B 1H15A 2IFGA 2YS4A 4WHTB 2R9HD 4OIBA 1QFOA 3ZKXB 4NKOA 3BDYL 5JUEL 2DQEL 5TJWK 3BPLB 3MV9D 1HKLH 2AJYH 1FFRA 4QHKI 1T5WA 3QHZL 3RZCC 1DQJB 3N9GL 2P43B 5DURB 1L6ZA 1JPGA 3FN0L 4YXLL 5I8CA 3MRCB 3GSVB 4XXDA 3FONA 4BSWA 3AS2A 1JI2A 5JHDB 1FFNB 1Q9LA 4K94C 1I75A 2HFTA 4LBEB 1CDHA 2W9LA 3RVXC 1KXTB 3BN3B 2DOCA 3IF1B 4A6YL 4OIAA 2QQNL 2GTWA 4EZMA 1A3LH 3S4SB 5ADOH 4ONFL 3LVEA 1NMBH 3S5LA 5IP4A 4M6OL 2BOBA 1C5BH 2RHEA 3T0DA 3KYNB 3G6JA 1FQ9C 2I60L 4AJ0A 2DMCA 2DQUH 1ONQB 3K2UH 4KI5F 3DTXA 3T2NL 3MRJA 5GRUL 1V8HA 5IT2H 4LHJB 1F4XL 5GZNC 5E5MB 3L95A 3MA7A 3OR6A 5DUPL 2CDEA 5JOFA 2W07A 5CEXA 3SDXB 3WN5A 5ID1B 2AEQH 3VG9B 1DQLL 3UPCA 3CH1B 4NZTH 2I27N 3P4MA 2HRPL 3H9SB 2M2DA 4U6YB 3QXWA 2YD4A 2BNQD 3QXAB 5KSBB 4JZJC 1W8NA 4WO4D 1MIML 2YD2A 5TQ0H 1CGSH 4IOSD 5CBEB 2A9NL 1GGIL 3V6BR 4M9OA 3DX6B 3CU1A 3TPKA 3SO3C 3C8DA 3FJTA 4Y8AA 3RWIA 1PLGL 3VFOA 2ZOLB 1N6VA 1TQBB 2XA8H 4KTDH 3MV7B 4I1NB 3VW3L 1OCWH 2VLJD 4IRJC 3M1BB 4HCRH 4OZGE 3ZMRA 4U6XA 5FYKU 3MOBH 3VFPA 5ICZA 5I74C 1F4AA 3FO2B 1UXWB 2F54D 4V2CB 4BSVB 5BOPA 2YMXL 3H9YA 1CDJA 3O11A 1T21B 5FGRA 3TFKD 1XR9B 3VG0H 1P9MC 1DDHB 2CD0A 1UH4A 4L9LA 1MOEA 5I71C 5HHPA 1S7SB 5D5MF 3MYJA 3SKJL 4C55A 3V7AG 1TZHA 5GGVH 2YPLA 3RVWD 4EBQL 4P4KB 2V7HA 4N0FA 4LKCB 1W2KT 1GCFA 4XCEB 5BMFH 3I50L 1JV5A 1T1WB 3JTTA 4YLQT 3QZWG 5E99H 1ZVSA 2A1WH 1KENL 1JPST 3V4VH 1BOGA 1UEMA 5FCUH 1KN2L 1F6LL 2ESVB 4NQSB 3ESVF 1CFNB 3BEWA 2NR6C 2EEBA 3CXHJ 3S96B 4QF1B 1KYOJ 1IEAA 1FNGA 3LKSB 4Y0GA 5AG9A 3GGWA 1YJDC 5EZLA 3KPOB 3PDGA 4X6DF 5K9KA 4RFEB 3FB6B 1DVFC 1IT9L 2ORBH 4D8PA 2Z9TA 4HPYL 3OGOE 4IRSB 5ENWB 1AQDB 1ZTXH 3QSKB 2XZQL 1JNJA 4GKNB 2DDQH 3ARDC 2YRLA 1A21A 4P2RD 1U8MB 2F74B 4WTXA 3H8NA 5DT1H 1UKQA 2FEDC 1I9IH 2KZWA 4OM1H 4YHOL 1UM5H 1MCJA 4MMXC 3GBNL 5FV1L 1EHXA 2W9EL 3BHBA 4IIQB 2B39A 3O6ML 1BX2B 4S1DD 2XZCH 1JRHI 1OQXA 3QUXA 2QSCL 1LP9F 3LPGA 4Y5VA 3KPMB 4Z18A 4ZO8A 4LLYA 2PO6A 2DWEA 2P8LB 4ZQKA 4X9GA 1YNKH 1NGYA 1HZHH 2VABB 3FB7A 1UA6L 4KV5F 4YDIL 2ZUUA 4U1JB 3TO4B 5J6GA 3Q6GH 4XAWL 4F7TB 3BQUD 4UILH 2PW2A 4JRXB 1YNLL 4MXWL 1BD2E 3U36A 4Q0XH 4J4PD 4K71C 2BY0A 2YD8A 4RGNC 4WJ5B 2KDGA 5HYQB 3KPSA 3HR6A 3RU8L 5DWUH 1XGRA 4G9DB 3MV8D 1ZT1A 1FYTE 1NFDE 4CW1B 3JTSB 5HD8C 2QADC 4L29A 4LSRH 3DYMA 5DRNA 3MLXL 4HXBH 5CKAA 4G6JL 1KULA 1S5IL 4OFPA 4NIKB 1JGVL 3VU2A 5C2BL 3AROA 3IAGC 3MBED 3KG5A 3HMXL 3H3PL 4QNPF 5JXAL 5AWNL 4PJEB 3MLVH 4XZUB 4QRRA 3MLSH 3REWB 4J3OC 5HGGS 6FABH 4PJIB 2FIKB 4L4TD 2OJEB 4NO3A 5J7CC 3QIBB 1CK0L 3QRGL 5D1XD 5DJYA 3RVVC 4KRPC 5EBWA 3DJ9A 4R97B 1OAKL 5E6IB 4BK5A 4ZFZB 3VH8B 1JZ8A 4JPWL 5EIQA 3EO0A 4MA7H 2E9BA 4H8WL 4PPTA 4LCUB 1I1YB 1LNUA 3MJ8A 3QO0A 1CD1A 4XP5L 1KT2B 3VXPB 1N5AA 4ZG1A 3CLFL 4G8FB 5EU3B 1NC4D 4WWID 4RMVA 3PV6A 2MHAA 3A6OA 3GSQA 4ELKA 5GSRA 4PY7A 4FFZL 1LEKB 1S9WB 3TIDA 1VFBA 3HLAB 5MP6H 1RZFL 3LKOA 5MEOB 1T0NB 4PJ5D 5AZEL 5IVXB 4NKMA 1OB1B 4UINL 5GGTL 5DR5L 1SMAA 1LO3L 3PIQA 1ZK9A 4HK0A 2J88L 3DMMA 2CGRL 2UVEA 3WFZA 3UPRB 3NIFE 2EXYC 4CMMB 4JHWL 2HJKA 3KJ6L 3MODL 3HB3C 1NGXB 4JFXA 1F11B 3SDDA 2VDPH 1TTGA 3GSRA 3QDGD 1X5IA 3O9WD 4N9GB 1N5YH 2V5TA 2XFXB 2Y06L 3MROB 2QHLA 2BSRA 3KS0J 5HVWA 2HJFB 3IFNL 3FN3A 4OCYL 4YX2H 2HMIC 4IRSC 1WCQA 4Q6IB 2CDGA 4M4PA 2W60B 3OPZL 3MRRB 5I8OH 3HFMH 2HFEB 2ZZUT 1MFCL 2HTKD 1DCLA 3IU3A 3PV7A 2IFFL 3OTTA 3X3GH 4M8QA 2G75B 4G8GD 3O6FC 3RNKB 2VO5A 2NW3B 3NCFB 3W9DA 2EDEA 4PJ9A 2UYLA 4GKSB 3O3BA 4Y4KC 3VCLA 3TBSB 5GGQH 1BECA 1H3XA 5HHVH 5I75B 5D1ZC 1B4JH 4X7SH 1C5DB 5FO9A 4HC1H 4UTAH 4WWKA 1GAFL 2B20A 2F15A 2WWKT 4XVUD 1M7IB 5B39A 5L2JA 1A6AA 5ERWB 8FABB 4UDUB 5I9QB 4PREA 5CD5D 1JYVA 3WXWL 1Z0NA 1BQUA 4E42B 2FR4B 4TUOB 2FX7H 4RQQA 5GIRB 1KG0B 3DO7B 1QOKA 4LASH 4MDJB 4XNXH 1A9EA 1F13A 2H2SC 2ZJSL 3ARZA 1HSAB 1N4XL 2YPKB 2DLIA 3QJHA 3VI3E 1HDMA 1DN0B 4RRPA 4MLIA 2GUOA 4ZS7L 4XT1C 2CIIB 2AV1B 3EZJB 1BM3L 1HIML 4WHCA 2D9CA 1BWMA 3BT2H 1FE8H 2V9RA 1AGCA 4ZUWA 2G9HB 1UWXH 1F5WA 2LTQC 1Z9MA 3VFSB 1QLEH 1DQQB 3EDEA 4IHOA 2BFVH 4OZHE 1N0LA 4I4WA 4O02L 5I73B 1VB9A 3HE6A 4NSKB 3VGDA 5FYLE 3WIFB 2QHRL 3KYMA 5FA4A 3B2VL 4I5BB 4IDJH 1QEWA 1G6RB 3U7YL 3X3FL 2X4TA 3BUTA 2J4WL 3HKFA 4BZ2H 4XHJD 2H2PD 2ADIA 4LNRA 4L8SA 1QP1A 3ETBF 4M02A 1HHJB 5CJQH 1CQYA 5JQ6L 5J06A 2VL5B 4PV9B 1F3JA 1K3ZA 3MGOA 4WI9A 2A0LD 4GBXC 4NHUB 4BH8B 1JYWA 4KDTA 5HYJE 4BKLB 3FB5B 4ERSL 4WI7A 5L7XL 4P4RA 3S36X 2DYPA 1FAIH 2R2BA 3EYSH 1S7XB 4OFYA 4WFFE 1KCLA 4P23D 3CMOL 4LCCC 3S97C 1JP5A 1K9TA 2XV6B 3DWTA 3CFCH 1E0OB 1CXHA 1NMAH 4LHUG 1A6TB 4GXUM 5DMJB 3TIEA 1MLCA 3N0PB 2QR0B 4KJQD 3ARFD 1WBXB 5FHBH 3WFBL 1UWGL 1X5GA 3L3DB 5BXFB 4HKXB 4KQ4H 4LIQL 3CXDL 5IIEA 1CE6B 3F6IA 3OX8B 3R1GL 1A9BA 4A6YB 1SJHB 3QWRA 1FDLL 2HYMA 4ZFOL 2Q3ZA 4I0CC 5IW1A 5KSUB 3VD9A 5LGJA 1KV3A 2Y4SA 1I3GH 5D70H 3GUTA 2YD5A 2YR3A 1OOAA 1UJ3B 5JW4N 2VZVA 3BE1L 1KPRB 4NRZA 4AYFA 3WO4B 4G9FA 4PJ7F 2HLAA 1G9NL 4RA0C 1J0HA 1VGEH 1UB6A 4UMGA 5AUMA 1YPZE 4JANB 3TH4T 3GI8L 2DQGH 1QHPA 3QUKA 3LV3A 3F7VB 3V6FB 4FQXB 3WHXB 2B2XL 4OCRL 4Y5XA 3PHOB 5JZ7D 5T3XE 3WKNA 3WXVL 5IQ9A 4DUVA 4X9IA 1I1AA 2DM7A 3LD8C 4RFOH 4PB9L 5E1AB 1MQ8A 5D1QB 2FH6A 2V5SA 4JKPL 1YEFL 5DK0B 4G7YH 3GO1L 3PWUA 3PHSA 4OI9A 3OSKA 4QYOB 4WW2B 1OAQH 1G7PB 1OAXH 2WBKA 2R1WB 4X4ZA 5CIPA 3L3KA 3B8SA 3ZL4L 4K3GA 4H1LG 2IC2A 3ZTJH 3IFLL 5AYUL 4M7ZC 5J0BA 2V9QA 2PXYC 1DQDL 2Q8BH 4CADA 5TH2A 3DXAA 4U1SB 5E4EB 1LE5A 3GKZA 2XPGA 3KPNA 3RPIA 4NZJA 3K8LA 2NTFB 3ZDYE 5DDHA 1YY8A 5MENB 3QDMD 3HZVA 4ZPTB 1GOHA 3UEZA 1ZS8B 3JWNC 2GJ6E 2YZ1A 3U4BL 2DQDL 3TV3H 5IVNA 2OX5A 4H0IA 2DM3A 4PTUB 5GQBA 5FM5O 2OTUB 4EN3B 5I1GH 3GSWB 3KLAB 3LB6D 1BFOA 3UTZB 3SCMB 2MOVA 3WNKA 3B9KC 2BXZA 1KJ3L 3QFDA 4XPHL 3PQYB 3W0WA 4K7PH 4YGAB 4I3RL 5DJXB 3ULVL 4LSPL 2HT4D 1WC7A 3SY0B 5HGAA 1FC2D 5KSAD 1NAMH 4LLQB 3B9VA 3DURA 3BRFA 2XKNB 4RMUA 1TVHB 4O9HL 5GGUB 3BESR 3QAZC 4HUNB 1OSZA 5KZCD 4XBPA 1H0DB 3H42L 1ZLVK 2BNRD 5GS0L 1UM4H 4NP4L 3VXOB 1G9MC 5C0IA 1A3RH 3IJHA 1TETL 2O5YH 5L9DH 1X5JA 4CVZA 5C0GA 3K8MA 3OJVC 3NAAL 4NHCH 2BJMH 4HIEA 5L8LB 2X9WA 1HQ4A 3F12A 1AD9B 5B4MD 2NCMA 4G6FB 2MNUA 3WKMH 1J1OL 4K2UL 5LGKA 4J8RB 1J5OH 5CLWA 3ZHDA 1Y6KR 1YMHA 5EZIH 1IBGL 4APQD 3DVGB 6CGTA 3VRJB 4LSTL 4XCNA 1KACB 4BQBA 2JB5H 3UO1H 3P11H 3HNTH 2R4RH 4OFDA 4UTBL 4ETQA 4LLDB 4W6YB 1GSMA 1HSBA 4U1MB 4JN2B 5IHLB 3CJJA 1ACYH 3CXHK 4X7CC 1KYOK 1AC0A 5E9DB 1EUTA 1W0VB 2J8UE 1LK3L 3VWKC 1INEL 4CVXB 3BZEB 2WWMD 4OV5A 3S35H 3UBXI 3O4LA 1RUMH 4NO2B 4WUUD 1YMMD 2HFFA 1LO0H 1JGEA 2JIXD 4KVCH 5K9QG 1AXIB 4HUXB 4QHNA 5KVEL 2Y07L 1PQZA 4UT7H 2ATPA 4QY8B 1AGEA 3DECA 4R3SA 3VXRA 4MX7A 4NQVB 1I3VA 4GRWH 2EIZB 3OXSB 2RCSH 1QTYT 2VDOH 3LQZB 4WW2C 2VZ1A 4RWYL 4YQXL 5DD0L 4IS6B 2ADFL 5CCKL 1AFVL 3ARGC 1U58A 3UBXA 3VJ6A 4JM2C 1KCUH 5DI8A 5DMKB 5C0CB 4NN7C 5FEBA 4GO6B 4PG9B 5FGCE 2R8SH 4IRJA 3VWJA 4UAOB 1KBGH 2VLJE 1M7XA 2DQJH 2VLMD 2JCCF 3QYCA 1MCSA 3MRNA 4PJDB 2UWEE 5JNYB 4ONGH 4XBGB 4XAKD 2F54E 2C3GA 1FORL 4LCWA 1B9ZA 1FO0H 2C9AA 2P5WA 3I75A 4HMEA 2EYTB 1FV1A 2ZG2A 3MLUH 3TT1H 5GGSB 5IB4A 4E41B 3E6HB 5I17A 4HKZB 1GGTA 5HHNA 4P57B 5KTEL 1NGPL 2H32B 4JQIL 5F96H 3SJVA 3CH8A 3LQAH 3EOYG 4NWUL 4HV8B 3GK8L 3QI9C 5EORL 4I0PA 2BVPB 1QR1B 3S37X 3QXDA 4X0KA 3GMNA 3K81A 1HH9A 3N1FC 2AJVH 4ODBD 4N5UA 1U0QA 3MZGB 4OBSA 1IQDB 1JMZA 5JDJA 3VXMA 4IRZL 4PJCA 5DJ2A 1MI5B 3CPLB 4PJXF 4UOW0 1IGML 4LP5A 5EO9B 4HT1H 3STZA 3EDJA 1QFUH 4HIHB 3ULUF 2RAMA 5KS9A 2NPLX 1DJSA 4N5EC 3MMEB 2FO4B 4WHTA 2BVQB 1EEQA 3ZT7A 4KZDH 4P9HC 2XY2A 4KI5E 3Q1SL 5DHYB 1YEKL 4M6NH 4QWWD 4P2RE 4YAQB 4NJAL 1DQJA 1ZANH 5J56B 4XI5C 5ESVB 2AXHA 5C08B 5D7SH 5JQHC 3GSVA 2H1PH 5E94B 4YWGH 4JZOB 1QZ1A 3WFCL 5JHDA 1FFNA 3JWOL 2Z31B 4Q9QL 3IF1A 3PP3H 3GSNB 4YH6A 3S4SA 1GC1H 5C0JB 1WCBB 2VDLL 4P46D 3R8QA 1RVFH 5IBTL 3KYNA 3N1QC 2L7UA 5D7IB 2DQTL 1HI6B 1SY6L 1FCGA 1P1ZB 1HHHB 2H45A 5EULV 1AE6H 1UYWL 5JORB 2VDRH 4FQIL 5E5MA 4XVSH 5CZXC 4ENEC 4OQTH 4OF0A 3KXFB 1L7IL 5DFWH 2WBJD 3SDXA 5ID1A 3EYQD 3RTQB 4OZFH 3CH1A 3A6CH 1CXKA 1T1ZA 3H9SA 3LKPB 4HIIB 4U6YA 1MVUB 4J1UA 3RGHA 3MRDB 4NNPL 2X9XA 1LMKA 4GJTB 1ZGLM 4GRLB 3FCTB 5D5ME 5BV7H 3QB7C 1NDGB 1YEIH 5EU6B 4KTYA 2VLRA 3HR5B 5IESH 5CBEA 5E2JA 1I1CA 3EHBC 5FECB 3DX6A 3MO1B 2FECI 4G6AD 1H5BB 4L4TE 2ZOLA 4LSUL 4F3FB 4JG0L 5CEYB 4D3CH 3V7MA 1RAMA 3M1BA 5C0ND 2W59A 3G5ZB 1F2QA 4GT7A 3FO2A 4BSVA 1UXWA 4JDVB 4HF5H 2DKMA 3D3VB 1T21A 4JN1L 1QBLH 4XMKH 1XR9A 3SBWC 5FOJA 1DDHA 5HGDB 1V05A 4EIZC 5DSCB 1DUZA 1U3JA 1S7SA 2DKSA 2XTJC 3OF6A 4NNYB 1DBJL 1OSPL 1U6AH 4Q9RL 4P4KA 1NLDL 2VDMH 4LKCA 4X6DE 3T08A 5H94B 3QRFM 1NEUA 3GM0A 5DVKA 1CICD 4XCEA 3IAPA 3UJJH 5D96C 1T1WA 5F9WB 2APXA 1N59B 2FEEL 2NW2B 4BQ6A 5EN2B 4YZFE 5JW4R 1MJUH 1I8LC 1YZZA 4FFYL 4PRBB 1G7HB 4XPAH 3DX8B 4EOWL 2ESVA 3P4OB 4NQSA 1CFNA 1UFUA 2DLEA 3T0EC 3S96A 4QF1A 1IM9D 4NKDB 1EFQA 3L3JB 1ZKAA 3B8YA 1LP9E 3SDYH 3QDGE 3KPOA 3G9VA 1YQVL 3IYLW 4RFEA 3FB6A 4KHXL 4IRSA 5ENWA 4HEME 1AQDA 4KV5E 2F9BT 1TJIL 4GKNA 3UAJC 4DGVL 1CF8L 2D7QA 1NUNB 3T2QA 1YYML 1RZJC 1U8MA 2F74A 1KUMA 2CMRL 3G6JF 2VH5H 5ADPH 5JDSA 1AC6A 1HYSC 2IJ0C 3WJLC 3MLRL 1NCDH 4GW1B 4EQ2A 4IIQA 4G8GE 5IV2B 5C09E 4DN3L 1I9RH 1T83C 2YKLL 2DM2A 4XP4L 3ROLB 1MNUH 1OGAE 4HUVB 4DVRL 1ZHNB 3E2HB 3O4OC 4HKJB 5DD6A 5J4MA 4QNPE 5FCSH 4K8RL 5C0DA 2P8LA 4PRHB 4KK8D 2E7LC 4MA3A 2AXFB 5EOCJ 2PKDA 3REVB 1OGTB 1N7MH 3SKNB 4U1JA 3TO4A 2GYSA 4F7TA 3CFDB 4P9MH 5KOMC 4JRXA 1QNZH 1SJXA 5HYQA 4WJ5A 2VLKA 4YHMH 4G9DA 3GMRA 5J13C 2P5EE 1WTLA 1JCKA 4E5XA 3MRHB 3JTSA 4CW1A 5MEQB 4CN1A 3HE7B 3HUJB 3MXVH 3LRHA 1GGBH 2CLVB 4WGWB 4F2MB 4PJ8C 4Y1AB 4LLVB 5H2BB 1TVBB 5JW4M 32C2A 2NY2B 2VITB 1JGUL 4PJEA 4NQCE 3MLWL 4XZUA 4QXTB 3GSOA 4EI5C 2HJLB 3EFDH 3UX9B 1I85C 1F02I 3RWHB 3REWA 1OTSD 1J8HB 1YYLH 3F65A 4ZAKC 1MWAL 1ACZA 4P5TB 4LSQH 4PJIA 3ALXA 2FIKA 2N7AA 3D39B 3QIBA 4HZLB 2VQTA 1H5BC 2XWJB 4WU7A 4LPYA 4JRYD 5E6IA 3BYYA 4ZFZA 5C0BE 1RIUH 3VH8A 1KJMA 3ORJA 5HHOB 5CSGA 5GHWL 1B2WL 1XGYH 4JM4L 2PR4L 3C9NB 4LCUA 5JPMA 1I1YA 1XT5A 4I0KA 1NFIB 1KT2A 1Z5LB 4MD5B 2P1YA 3QHFH 2C3XA 4M1DH 3C60D 3UDWC 3VXPA 5DEGA 3D1MC 4G8FA 5ETUB 5EU3A 5LWYL 1FL6B 1UKSA 1S9WA 3QWOB 3HLAA 4D9QE 5MEOA 4Z0BL 1T0NA 2EEAA 1TZGH 3SGKA 5IVXA 2Q1EA 1OB1A 4K3JH 2EC9T 3PXJA 5F9OH 1F8TL 3O8XD 3I6LD 2AQ3A 2Q8AL 3GMMB 3KR3L 1BFVL 3UPRA 5CJ8A 4UT6H 4CMMA 4ODTH 5BO1H 3FFCB 3OHXB 4GS7B 1F11A 4HBCH 3NH7L 3VXUD 4M93C 4XBEL 4M7KH 1BJMA 2F19H 4N9GA 2YWYA 4PJFB 1KF9B 1MPAH 4UIKH 2XFXA 5FDWB 3MROA 1P4BH 2HJFA 5JIPA 4JY5H 4Q6IA 1G9NC 2W60A 1PG7X 2OTWB 4ODXB 3MRRA 4LFHG 3U83A 4PFEA 2HFEA 3ARBB 3KPPA 3HG1D 4LSDA 3O6LL 3U1SL 2X7LB 4HWBL 4PR5B 1EJOL 2G75A 2IGFH 3PDOB 1C5CL 1JHLL 2YUWA 4OLVL 5I6XB 1QRNE 4GKSA 4JGJA 1AO7B 3TA3B 1JFQH 2PW1B 3TBSA 1CU4L 5A43C 1PSKH 3N85H 2DJUA 2AEPH 3TM6A 1C5DA 1YN6B 1M7IA 1OP5H 3K0WA 4JFPB 4JO2L 5ERWA 1GGCH 1RZ7H 1Z6JT 4KQ3H 4PRNB 3L3OB 4UDUA 5HHQA 3U7AA 4E42A 2FR4A 4TUOA 1Q0XH 5GIRA 4R26L 3DO7A 2ARJB 4MDJA 4TTGA 3EUUA 5INDB 5JLZB 2WANA 1EHLH 3PL6C 1HSAA 2M8XA 2YPKA 5IKCB 4YPGB 2R0WL 4L9DA 4LARL 4RX4D 5CZVL 2PXYA 3UMTA 3AUVA 1T0MB 3SDCB 1E6OH 2X9YA 1UXSB 3E3QE 5C92A 2CIIA 4XPGH 2AV1A 3RHWK 2IG2H 5F88B 3VRLE 4HMDA 1CXIA 2G9HA 5ANMB 3GHEL 1WWBX 2Q86A 1DQQA 2BDNL 3TN0C 3RDTC 4Y4HC 4JQVC 1WWAX 3I3BA 3QDME 4NSKA 3WIFA 1ZLSH 3ZTNL 1F3DH 2JELL 4I5BA 5FGBC 4P2QB 2X6MA 1ITCA 1DZBA 1G6RA 1E27B 4RGOL 4E0RB 4K3EH 3P4LA 1X6NA 2C26A 3OJ2C 5TPWH 1DE4B 2ILLA 5B21A 3ULVC 3MBXH 1H3VA 2IPUG 4XC1L 1XZ0B 1HHJA 1Y6NR 3KVQA 1IQWL 2FYYA 3PWPD 4BH8A 3FT2B 1QSFD 4GSDL 4JO4H 3UTSB 3FB5A 4BKLA 3B9AA 1XF4A 3R06B 4GG6B 1KB9J 4XP6H 3MUZ1 4WDIB 5IHUH 1IEBB 3AREB 5A16B 4YBQC 5GS0C 2CUHA 3VRIA 1YECL 2KQMA 3RX7A 1A6VH 1GPOL 1A6TA 2MQCA 2NXYB 1UACH 3LKRB 2BVEA 4KJPC 5HBBA 3N50A 2DLFL 3O81A 3QIUC 2QR0A 1WBXA 3FZUD 3D5OF 1CE1H 5J1TC 2BNRE 3L3DA 5BXFA 4HKXA 4K9EC 1CE6A 4NQDD 3QPQD 3OX8A 2ZKHH 5L2KB 1JZ5A 1D5ZB 5ESAB 1NMCB 3TCXA 1C08B 2VIRB 1SJHA 3VDCA 4A6YA 4R4BB 3DX7A 2MFNA 2VKWA 4Z78A 5KSUA 4EUPG 1I9EA 4HUMB 3QJFB 5ABDE 1U8HB 3TVMB 1ZGLP 5F1KC 1UJ3A 2GFBB 1KPRA 4U6VH 3RGVB 3ZYOA 2ZCLH 5EWIH 1DANT 2E6JA 5JW5A 1NCCH 4JANA 2ICEB 4QTHA 4UZGA 4X5LA 5EOTB 3FRPA 2NY1D 1SJEB 3KPRB 4TULH 3F7VA 3V6FA 4L3CB 3MUJA 4FQXA 3WHXA 5DD5H 1JBJA 2AK1L 3O3UN 3PHOA 4NFDA 4ZXBD 3OJDB 5EOCL 3MNVB 3BZFA 1A1MB 4MNHB 5E1AA 5D1QA 4WUUE 4QXGH 1YMME 4L5FH 4R8WH 5ALCH 2ZOKB 5LJYH 2VXVL 2V17H 5IB5B 2GAZB 4Y4FC 4LK4A 5FYLL 5LQBH 3QEQD 5I1JH 4CDGC 4QYOA 4MCYA 4WW2A 1MFEL 1G7PA 2R1WA 1UM6H 4JFZL 3RVTD 1VACB 5IROA 1U8OB 4G6MH 1XCTB 2ID5A 2E7HA 3SCMD 1YEHH 2IADB 5EC2B 3VD3A 2W9DL 1VKXB 3BPOB 3MV01 3U0WH 1C1EL 3SDCC 4X4MA 1S3KL 4U1SA 5CEZE 2F53D 2BRRH 1KEML 2WLZA 2K7PA 5HDBE 2L4OA 5BZDB 2X40A 3BUYB 3QEGL 5D2LE 1M6OA 5IBUG 5LKNA 1ZA6B 1RUKH 4I18B 4L1DA 5MENA 1IFHH 5JR1H 4ZPTA 1ZS8A 4XAKE 5SWSA 3CVHH 4RMSA 3MXWH 2GY7B 4LPCA 4YHKL 3CFKA 1ES0B 4X6EB 2NY4C 4OB5H 3C2SA 3PDDA 4PTUA 3TYFB 3ULUL 3VXQB 2OTUA 1R3LB 4EN3A 1Q9WA 3GSWA 3KLAA 1GL4B 3UTZA 3PWNB 3B43A 2EH7H 4AEHL 3PQYA 1UGNA 4OJFL 1UVQB 4GH7B 3RBGA 2XN9E 4S1QH 4EDWL 2P8PB 5GSVB 5B3JF 5DJXA 5DJDB