2P7TC

Crystal structure of kcsa mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVSTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p7tC00
4LP8A 3LDEA 4MS2A 2EIKC 5EBMC 4G27B 3BEHA 4P9PA 5EC1C 1G4YB 3GB7C 1XL6A 2H8PC 3OUFA 4PA6A 3LDCA 3STLC 3SYOA 5KUKA 4P9OA 2BOBC 5CBHA 1ORQC 2X6CA 3ABKC 4QE9A 4RAIA 5EK0A 2IH1C 3LNMB 3AG3C 2DYRC 2HVKC 2Q6AA 5E1AC 1R3LC 3STZC 2WLLA 3RW0A 3E83A 3AG2C 4MVZA 4PA9A 4WFHA 3K03A 3AG4C 2Y69C 3E8BA 3LUTB 4MTGA 3SYCA 2ZXWC 2AHZA 1S5HC 2W0FC 2R9RB 4J9YB 5CBFA 3F7VC 4RO2A 4GX0A 3SPHA 3KG2A 1K4DC 4HZ3A 4OXSA 4QE7A 3K0DA 5B3SC 4XDJA 4WFFA 3OGCC 3SYAA 4MVOA 5EBLC 4X89A 4EKWA 1BL8A 2OCCC 3SJQC 3OR7C 4MTOA 1J95A 4JTCB 4PA3A 3T1CA 5EC2C 2AHYA 1OCCC 3OR6C 2Q68A 4MVUA 2Q69A 1JVMA 4MVRA 2WLLB 4MVMA 4BW5A 1R3IC 1OCOC 2ITDC 4R7CA 3FB7C 4PA7A 4XDLA 4QNHB 4P2ZA 4TWKA 1OCRC 2BOCC 3E86A 3VOUA 3ZRSA 2QKSA 4WFGA 3IFXA 2WLHA 2WLIA 4R8CA 3E8GA 1V54C 1ZWIC 2EINC 2QTOA 2ITCC 2WLNA 5EBWC 3PJSK 3K04A 4H33A 2WLMA 4XDKA 4ZBMA 2DWDC 4I9WA 3E8HA 5BZBA 2X6BA 5KUMA 3RVYA 3RVZA 2K1EA 1M56C 5B1AC 4X8AA 4J9ZB 4PDRA 3RBZA 3K0GA 5J9PC 1R3JC 4R6ZA 1LNQA 3FB5C 3T4ZA 3SYQA 3ABLC 4LBEC 4RUFA 4GX2A 2WLKA 4PDMA 2A79B 3K06A 5CBGA 4JTAB 3SPIA 2ZD9A 2Q67A 3AG1C 1XL4A 2DYSC 1QLEC 2WLIB 2JK5C 3JYCA 2HFEC 2KB1A 3FB8C 3ABMC 3IGAC 4GX5A 3EFFK 2NLJC 4MTFA 3ZJZA 4CBCA 3LDDA 5IY5C 3HPLC 4GX1A 4KFMA 3FB6C 4UUJC 2HJFC 3SYPA 2A0LA 2DWEC 3SPCA 3SPJA 3TETA 3UKMA 3T4DA 3TCUA 4G28B 2EIMC 4PDLA 4PA4A 3F7YC 2HG5C 3R65A 1P7BA 4R50A 4MW8A 4PDVA 4HYOA 4WFEA 3SPGA 3F5WC 4MSWC 2IH3C 4X88A 2X6AA 1R3KC 3X2QC 3T2MA 3K08A 3E89A 2P7TC 3E8FA 3OUSA 1KKDA 1OCZC 4LCUC 5B1BC 2HVJC 2EILC 1M57C 4MW3A 3ASOC 1K4CC 4P30A 1V55C 4JTDB 3ASNC 4DXWA 2EIJC 2ATKC 4RUEA 4H37A 4MVQA 3WG7C 4F4LA 2YEVA 2A9HA 2WLJA 3UM7A 4MVSA
chains in the Genus database with same CATH superfamily
3K3WA 2JDIG 4ZHQA 4JI7B 1O9GA 3LDCA 2XAQA 4ASUG 4P9OA 1AJQA 1AI4A 4JAAA 3E2EA 4GKJO 1OCZB 2F1MA 4B08A 1H38A 1GM8A 3DTUB 1M57B 3QTCA 1H2SB 3MDSA 2B1GA 4LF5O 2CUGA 4EKWA 3FX7A 2PUSA 5JJEB 4TUYA 5KA6A 3VBBA 3OR6C 1KB9F 1N34B 4U7NA 4PA7A 2HHHO 3IFXA 4ZIBA 4JI2B 4H33A 3E8HA 3P30A 2P06A 3RVZA 1QR9A 1BS3A 2A3QA 1EN5A 5LP6A 4CZZA 3G6BA 4I55B 4FM0A 4PDMA 2W6JG 2WSSG 4LFAB 1BGYH 3AG1C 2BTOA 4RWUA 3CPWU 1EZVH 1EN6A 5B1NA 5BMVB 4UVBA 1NH2B 1IBKB 1JX9A 1SA0A 1NT2B 5DM6V 2GSMB 4O2BB 1PPJH 1N36B 2DQ0A 4PDVA 3SPGA 1M5IA 4X88A 3BHPA 4EFBA 3X2QC 2DYSB 3JAKB 5E79Z 2P7TC 2ZM6O 1B06A 5IY5B 1Q90D 2CE4A 5IE9A 4DXWA 3B4SA 4BW9A 2UUBB 1ZL8A 1BZKA 5B66Z 1S5LZ 3ZIAG 4X66B 2H8PC 1QVFU 3JARB 5BR8O 3I5DA 1NQTA 4NXNO 1KUQA 3H01A 3CCUV 3G71V 3M8AA 5E1AC 4J7JA 1BMFG 1ZUQA 3WG7B 4BIUA 4X20A 1SZTA 3SPHA 3U11A 1Z5VA 2R70A 1Q82W 3HKDB 1J95A 3T1YO 4JI5B 2DYRB 5CMUA 4K0KO 5LL6Y 4DK0A 2YDEA 1Q8IA 3CCVV 5EYPA 2JGDA 3JCZA 1GMGA 4R8CA 5A9GA 1R6NA 1YI2V 2L6LA 1HDJA 4IHJA 4YIOA 1NJIW 1U97A 3TJTA 4B7KA 3JAWB 3L73H 1LNQA 1WPXA 1OCOB 1DK1A 5JJJB 1ROPA 4A5UB 1Q6HA 1WB7A 1M90W 2MW2B 4OX9O 1ZTEA 5EZYA 4O4IB 3T1HB 1K9MW 2JJ2G 3ZJZA 2NLJC 4JI6B 1U96A 3JSNA 1VQ9V 3LNNA 3SPJA 1KYOF 1NU1H 1VQ6V 1S77D 1QNMA 2R9AA 4JAVA 3SJBC 1P7BA 4UVAA 3ZRXA 2DQ3A 4UCTA 4LF9O 4WBNB 1H2LA 2VWKA 5B1BC 4YJ2A 1KBHA 4UCUA 4RUEA 1TVKB 3K58A 5H6RA 2W6IG 4MVSA 4DO2A 1AJPA 2YXYA 2QWQB 2PZSA 4D6TH 3WFVA 1G4YB 3OUFA 3JASA 2Y0IA 5LA6B 4RAIA 4NTWA 4DR4B 3LNMB 2HVKC 3K59A 2KQXA 4GKJB 3AG4C 3CCQV 1I94O 2YEVB 4GX0A 4Z1MG 3CSXA 3DXRB 5B1OA 4IL6Z 2EIKB 1V9PA 1GO3F 3W7TA 5GTIZ 4ZHQB 1GAXA 1F51A 3H9VA 4IIJB 4IGGA 4PD4F 2AHYA 3EVKA 3R66A 4U7OA 1S76D 3ABTA 1V54C 4HAMA 4TV9B 3QVNA 1PNLA 4LWSB 3HKEB 4ZOLA 4TUYB 2FMLA 4JI1O 3OMAB 2ZD9A 4YHHO 3FB8C 3TGUH 4DV3O 4NTXA 3WB0A 2PY5A 5IJ9A 3UKMA 1MZFA 3ZHRA 5LP6B 4DV5O 3B2EE 4X1KA 1ZSPA 4HYOA 5LYJA 1FJGO 4MSWC 2X6AA 2RDCA 5B1BB 5CN0A 4GKKB 3T2MA 2DOSA 2RJZA 3ZHVA 3FFQA 2UXBO 5ITZA 1XNQO 2V7QG 5EIBD 2CTRA 2KKWA 2ZM6B 4BR6A 3OFNG 1SA0B 4DV1O 4JV5O 2EIMB 3FD9A 2GDSA 2UUCB 2QDOA 4G27B 2K9PA 1RPOA 4LH7A 1IX9A 3CS5A 5CBHA 2X6CA 3ABKC 1YVWA 2LFSA 3AG3C 5BR8B 4FLZA 3AG4B 3OEEG 2OTJV 1R3LC 2QR4A 1V55B 3ASNB 3ETGA 1VQNV 1NZ6A 1ZL8B 1TA8A 1Z5WA 1AP5A 3CRQA 1UFIA 4J7KA 4O2AA 1SKVA 1HR0O 1VQPV 3H1IH 1N32B 1OCCC 4J7ZA 1AB3A 1Q43A 2E74B 1V54B 1RPRA 1OCRC 4RQFA 3A8TA 1VF6C 5EBWC 5LGNA 1IURA 2EJRA 4XDKA 2DWDC 2C2AA 2K1EA 1N34O 1M4UA 1P4RA 1VEWA 4JZ2A 3AEIA 3K06A 1GH6A 2LQTA 2Q8VA 1A32A 4JI4B 5K1XA 1CP9A 3D3IA 3N27A 1PNMA 3CWBH 1XILA 4JI2O 4UCRA 3UT5A 2P90A 2GBOA 1NBMG 3BVOA 4OX9B 2IW5A 4FLXA 1AP6A 1B6QA 4FLTA 3F7YC 3R65A 2OIGA 3RYIA 4WFEA 4NVPA 4LFAO 1G8MA 2HR3A 5EZYB 3ZBHA 4DUZO 3CMAV 1K33A 1KECA 1IBKO 3DSQA 3ZMSA 3SGIA 2IJHA 4TT3G 1XL6A 4ABMA 2CDYA 5L3EA 2ZKOA 1HNZB 1AJNA 1K3EA 3ABKB 1YHQV 2LP7A 2BOBC 1R6TA 2Q6AA 1NR7A 3AK2A 3ASOB 3E83A 1G1XB 2UUBO 1H8EG 4QE7A 3Q4HA 5CB4A 4X66O 3H1JH 4X89A 1I94B 1H2MA 4GZRB 2IBZH 3MHSC 2OCHA 4BAYA 4CC6A 2VQEB 4J41A 1SQGA 2D3OW 3BRCA 2EINC 1E79G 1D2DA 1NI8A 4OGQB 4WF9V 5BZBA 4N21A 3K5OA 1AI7A 2WA3A 5FLXN 4JI5O 3B09A 1NVPD 3K0GA 1SQPH 2GUZA 1TAEA 4DRXA 4CS4A 3J7AU 4I5SA 3RT3C 4X9QA 2Q5ZA 4DYLA 4H0LB 5KLVH 4X65O 5KMGA 1XNRB 3D3QA 2M6YA 1Q3EA 3ABMC 1NH2D 2QM7A 5LHGA 1SQVH 3G4SV 4YHHB 4ZOLB 5IYDO 2JS3A 1IZ3A 4G28B 4K8XA 2YIAA 2CTWA 2Q0AA 3E22A 4D7SA 2YI9A 3JD4A 1GKFA 3S3XA 1SRYA 4JI6O 4J11A 1FJGB 1KKDA 4LCUC 2EILC 2KG7A 4P30A 1KP3A 5JJNB 3WU2Z 1FXKA 1XNQB 2JRIA 1FXVA 5BXZA 1FS0G 5C8YA 1I5YA 1S5JA 4X1KB 4BWAA 2UU9O 3QG5A 2F43G 2EULA 5JVDA 4F6EA 2B5UA 2CH7B 5ITZB 2OTLV 4FK5C 1SC5B 3AG2C 4EB6B 3FAVB 4X1YA 4PJ0Z 5CA0A 1FFTB 2Y69C 3LUTB 3GVMA 2ZXWC 5IT9N 4O4JA 2QJ1A 2PF4E 5IYBO 3TXSA 1I5XA 2EJ7A 2ZE7A 3BAAA 5AG2A 5CA1B 3MAQA 1HR0B 4DR4O 2YS8A 3QF7A 4ICGA 4FZ1A 1VMGA 2YUAA 4R7CA 3IAYA 3VOUA 2AZ2A 1W59A 2W0XA 1K5QA 4O2AB 2Y4TA 2LW1A 3P3NA 5KUMA 2ZIOA 4JYCA 1R3JC 2XAHA 4LF6B 1IVSA 3ZHQA 5TISZ 1Z2GA 2VS0A 1YTFB 2JK5C 3ML0A 2G38A 4CBCA 2A0LA 4LF4O 3BFRA 2FL4A 4HNAA 5B1AB 3TK1A 4UB8Z 1L8DA 3J81N 1Y74A 2YXLA 5GONB 3S3WA 4R50A 3CCEV 2JS5A 2Q7GA 1J5EB 1VIBA 3GWKC 4DW0A 2EILB 2HLDG 3OUSA 1S0VA 4DUZB 4DV7O 1FXHA 1N0JA 1Q6IA 3QO7A 1Q81W 5L3FA 4MTFA 1SZXA 5BY1A 1PP9H 2P5OA 3B40A 1D5NA 3SYOA 4GKKO 2ZNIA 2LFRA 2H94A 4NB5A 4LH6A 1AVMA 3ZRVA 4TV8A 4MVZA 3IJ4A 5CBFA 2UUCO 1DF4A 3HKBB 3HKCB 5J2TA 3O65A 1LUVA 1FXKC 4GYCB 1COWG 1QR8A 2BE3A 1BL8A 4PI0A 2OCCC 3CMEV 1XDCA 4FVMA 1MSDA 4PA3A 2JVDA 2UUAO 1N33O 4U3JA 3I55V 3ETEA 1BHAA 2YIBA 2HEPA 2B1IA 1H2GA 3ZMZA 3UO3A 3VQXA 4WFGA 2ZE8A 1JJOA 2QWOB 5LXTA 5LGUA 1N4CA 3K04A 2PTMA 4ZBMA 1PL4A 4IYHA 5FPRA 4ZI7A 1N32O 1WA8B 3OAAG 4GT1A 5H5NA 1MA1A 2BSKA 1DGSA 4TOIA 1IBMO 1MMMA 4BIOA 1SQXH 4R6ZA 5JQGB 3FB5C 1DTOA 1SS3A 4JYYA 3JALA 4X62O 3RN4A 2UXNA 3MHHC 2ZR2A 4GCZA 2JJ1G 4DV2B 1NKDA 3CCLV 2GV9A 4FLVA 1ENVA 4X65B 3BCCH 2ILMA 3FB6C 2DJVA 1HNXB 1RSOB 4DUYO 1TGOA 1FFXA 2GUZB 1Q5OA 4DRXB 4IYIA 4JI4O 2N04A 4AQYO 4Z2WA 3HR0A 3AG1B 5KMGB 3G80A 1AI5A 1R73A 1QHTA 4FZ0A 2HVJC 5FNVB 2XAFA 2EIJC 2E5LB 1YEWA 5IDJA 1O9HA 2WLJA 3CXCU 3AK1A 2DW4A 4UVCA 2P67A 4DR3B 3E22B 2WWWA 5KUKA 4B3TO 1SQFA 2P6JA 3X2QB 1XUQA 3RYFB 3OD4A 5KX5B 2UU9B 4PV1B 2GTAA 4DW1A 4WFBV 1Y76A 3ZCCA 1L0NH 3U10A 1K8AW 3K03A 5JH7B 1FXKB 4I4TA 2E76B 2W0FC 3TETA 4UFZA 4HZ3A 2RCVA 3KCXA 1HNZO 5KHGA 1IDSA 4N23A 3RYCA 4K3AA 5JVDB 4LF7O 3OEHG 4WFAV 4I7ZB 4FLWA 4MVRA 2N05A 3L74H 4BW5A 1AR4A 3CE2A 2QKSA 5IJ0A 3U0ZA 3E8GA 1RP3B 1VF6A 4O4LA 2WLNA 3JD3A 3RYHA 4I50A 3ZX6A 2Q0OC 3CJHA 1S72V 1TUBA 1P7GA 2VQEO 3SYQA 1GN2A 4LR3A 3K57A 1Q7YW 4YJ3A 1XL4A 2F95B 1RM1C 4FFBA 3EFFK 4UV8A 1L0LH 4KFMA 4B3SB 1QVGU 3SYPA 2VRZA 3TCUA 3ZN1A 4LF4B 3OMNB 1HP8A 4O4HA 3C3TA 2ADPA 1VQ7V 4KP4A 1DF5A 1XNRO 3ZS8C 3K08A 1B04A 3APQA 2EIJB 3L72H 5IYZA 1K7DA 4I0XA 3LSUA 5KHIA 4JI8B 1BQZA 1B3QA 4HNAB 4QIWF 4GUNA 4DV7B 1JQ0A 1XMOB 1FYJA 5EBMC 2DMXA 4NKGB 3RWRD 3CCJV 4X1IA 3OE7G 3QO8A 2GHYA 4JAUA 4JI0O 1WN7A 2JEXA 4YY3B 3A0HZ 3G67A 4PA9A 5JCOC 2NR5A 3CRRA 3G6EV 1VQ8V 2AHZA 1D5AA 3BA8A 5J2UA 4CS3A 4OXSA 1N8RW 3K0DA 2VQFO 4KXRA 3ZMUA 3SJQC 4MTOA 4JTCB 3LSSA 2BCCH 2P4VA 3VQYA 1E1QG 4Z1VA 1DLBA 2QWPB 1H8HG 3UO2A 2UUAB 3OTOB 1N33B 3FB7C 4TWKA 1N0NA 3FKSG 2FTKA 1QBZA 4UV9A 4I9WA 3HB3B 2R9IA 3LSQA 1XQ8A 1IBMB 1S3JA 2M7WA 3WB1A 3A0RA 5FPOA 4X20B 1P49A 3LDDA 4X62B 4J80A 2Y0PA 3ZEDA 4ZI7B 5IWAB 5KHHA 1R6KA 4TSFG 2BSKB 4PDLA 1XREA 4PA4A 1BHBA 3M99B 3FYEB 4LF6O 2Y4UA 4DUYB 5L3CA 2IH3C 2PGGA 1IBLB 2HP8A 5EYPB 2JGDB 4AQYB 2WAMA 3ZMTA 4K35A 4MVQA 4IHJB 1PD3A 1FFXB 1YDXA 4UXNA 1MZEA 2RQ6A 1BQ0A 3W7UA 4P9PA 1CXZB 4JYBA 1J5EO 1TUEB 2A06H 1YCIA 1YIJV 4QE9A 3JSLA 4I55A 4B3TB 4G2KA 5GTHZ 3STZC 5LGTA 3SYCA 4MTGA 2N74A 4B3MB 5BMVA 1AI6A 1K4DC 5B3SC 2LW7A 3C3SA 3SYAA 2P4KA 2A7WA 2OWOA 4O2BA 3CRAA 5LHHA 5LMNB 1Y76B 3AG3B 4LF7B 3THOA 3BPZA 3SJAC 3JAKA 1K73W 4YJ2B 5H2FZ 2BOCC 1Y6XA 2DE0X 4IT5A 4GLXA 3CHXA 1FAFA 2WLMA 2CGOA 4LC1A 2ZE6A 1IXMA 1OCCB 1M56C 3JASB 3KZIZ 1NS1A 1VF7A 2AGAA 3JARA 3W7WA 4E4EA 1H2KA 1YTFD 3BY6A 4CH4A 1OCRB 1OHHG 2UXDO 1KD1W 1QLEC 3JD1A 5IJ0B 3JYCA 5K1PA 4LFBB 2HFEC 1QU7A 3BABA 1NTZH 4FM2A 3K5NA 4FFKA 4UUJC 3T4DA 2HJDA 2MK3A 2YI8A 2HG5C 2AXTZ 1L1FA 3OTFA 1GN4A 3A0BZ 4LFCO 4JI3B 5LHIA 1G6UA 4YJ3B 3D36A 1M1KW 4W4LA 4DV2O 1KC8W 4FFBB 1OCZC 2XHBA 5LMUB 4FMTA 1M57C 4MW3A 1HNXO 4JTDB 1YXBA 4J42A 3LDEA 1WP8A 3CRCA 4O4HB 1E1RG 2WA4A 3JAWA 2DN9A 2KSDA 1P84F 1JMKC 4CH3A 4WFHA 2E5LO 1YZBA 3H1KH 2XTAA 4JI0B 4UCOA 1YF2A 2R9RB 5KHJA 2XOKG 4RO2A 4BIZA 5IJ9B 4DR3O 2LGWA 2Q73A 3P32A 3N2KA 2X0LA 4X1IB 2VQFB 5LYJB 1WAZA 2RMKB 4DR6B 4WBNA 4XDLA 4DV0B 3H1LH 2IJIA 4YXWG 2QTOA 4OPHA 1XMQB 1T5EA 2X6BA 1PKXA 2IU0A 3NR7A 4PDRA 3CP1A 3ABLC 4OPAA 2QEXV 3DGEA 5LA6A 2WLKA 2ZT9B 4JTAB 2DYSC 2QWNB 2RN9A 3N2GA 4DV4B 2EINB 3JATA 1KKCA 4UCSA 1YJNV 5IY5C 4DR7B 1W2BU 3DXRA 1NTMH 1XEQA 1JFFA 4DR5O 3SR2C 2L35A 3SDLA 1Q86W 4IIJA 4X64O 3L71H 4UB6Z 3JAMN 1F23A 3AK3A 3F5WC 1WP7A 3H1HH 3ABMB 1URFA 1ZLZA 4QGPA 4B3SO 4JYAB 2Q7EA 4H37A 3WG7C 4F4LA 4LF8B 2QA4V 2A9HA 4TV9A 4LWSA 2YICA 3HKEA 5EC1C 2GTSA 4WCEV 3CRMA 3JD2A 2F66C 3CX5F 2VWJA 5LBQA 1PNKA 3D36C 2DYRC 3ZRWA 1Q6UA 2ARHA 4JI8O 1MNGA 1RFYA 3OW2U 3UT5B 3CCMV 3E8BA 2E75B 1KQSU 1XBLA 1XMOO 3OMIB 1XI1A 2ZCEA 4L8JA 3CD6V 1Y66A 1VQMV 3RYIB 1MABG 1YJ9V 4FJCC 1JJ2U 1NVPB 4H44B 1JVMA 4YY3O 2CAZC 2E3CA 4MVMA 2P22C 3AG2B 1HNWO 1OCOC 2Y69B 3ZHUA 2YSUB 1LUWA 2ZXWB 2Q7HA 2ADQB 1JCHA 1VQ5V 3I56V 1ZWIC 2QKAA 1GM9A 3QO5A 2EZOA 2CGNA 3ETQA 1WLEA 1FKAO 3ABLB 2JGUA 2EBOA 2HKOA 5IYCO 1K92A 3T4ZA 4DV6B 4LBEC 3OTOO 1KU9A 2ZDIA 3K5MA 2QM4A 1CPYA 2Q67A 5KHKA 3RFRA 5H9CA 2UXDB 3Q4HB 5CB4B 1JA8A 2Z5UA 4F6RA 2IU3A 4AILC 3VQVA 2PI4A 2ZINA 4KUMA 4QJFB 4LNUA 1R3KC 4DK1A 4L87A 1WB8A 3VQWA 4K8ZA 4LFCB 3DC6A 1ZX3A 1HWYA 1SETA 1VP7A 1US6A 5IWAO 4KHPO 1GN3A 2ATKC 3L75H 1H2NA 1AR1B 1OZ0A 3UM7A 5D5PA 2F23A 4MS2A 2EIKC 1EBOA 3BEHA 4CH6A 3GB7C 3F5TA 2XAJA 3STLC 4B7EA 2Q9LA 5DEDA 1IBLO 1LR1A 2IJKA 5H6QA 3RW0A 5JCOA 3SJCC 4DR1O 3KG2A 1SF9A 1Y67A 3IC7A 1K34A 4PHZA 3T1CA 5EC2C 2FKXA 5F2VO 5KA5A 3AG7A 2JEUA 1R3IC 4NR1A 2OYQA 3ZRSA 2KG7B 3APOA 3CEIA 3E86A 5HFMA 4B3MO 2WLHA 2WLIA 3W7SA 2R72A 5C8YB 1JR9A 2OCCB 1FPOA 2YXHA 3N2KB 3RVYA 5LMNO 1BSMA 4J9ZB 2YIBD 5LP6C 5J9PC 2Y48A 4GX2A 2RNBA 4U3FH 1IXBA 4X1YB 5CA0B 2KB1A 3IGAC 3EXAA 2X7RB 4O4JB 4GX1A 1BT8A 2HJFC 1I08A 2DWEC 3SPCA 4NXMO 1QLNA 4KL1A 1WNSA 2EIMC 2UXCB 3NXSA 4C7UA 4MW8A 4DR5B 1MOFA 3C90A 4LFBO 4X64B 4JF3A 4H13B 5A2QN 3N2GB 5KAIZ 2ZDIC 1F7YA 3JATB 5LOVA 4XBFA 3E8FA 4RQEA 4DR2O 4AHCA 1GRJA 1QQCA 1V55C 3J80N 1MSWD 3ASNC 2B9ZA 1JFFB 1AROP 4NYKA 2FB5A 4LF5B 3CXHF 4JI3O 4PELA 4PA6A 4JASA 1QCEA 3OGIB 2O57A 3GWOA 3P3PA 5LMUO 2AW9A 2IH1C 1BE3H 3OT7A 2WLLA 1YITV 3OM3B 1MG1A 1PM9A 4ZKIA 5L3BA 2HHHB 5HFLA 1JOYA 3DC5A 1X4TA 1UJWB 4FLUA 4WFFA 3OGCC 1Y74B 1M93A 4W4KA 3RGBA 2PYLA 3K79A 2Q68A 1NTKH 2Z0AA 3E35A 2Z3YA 3L70H 2Q69A 4FM1A 3ZRWB 2ZQMA 4FPPA 5B5EZ 1VQKV 4EEQA 1HNWB 4JGSA 1AILA 1I7FA 5L3DA 2F4VO 2NN4A 3KKYA 4EFEA 2XT9A 4JPRA 2ZIMA 4QPJA 4DR6O 4RUFA 4DV0O 2BTQA 5CBGA 2CH7A 4TV8B 3SPIA 3K9SA 2NNUA 1XHZA 3B8MA 1R1BA 4GX5A 4EB6A 3FAVA 3HPLC 1VARA 3CCSV 4MTXA 1XMQO 5J2TB 2QGNA 1THZA 1XOUA 4Q6GA 1FD9A 1YJWV 5CA3A 2OIEA 2ETNA 5FL7G 1VF5B 4U3JB 5CA1A 3CC7V 4J10A 2Q4PA 4DV4O 4NXNB 1RM1B 2IM9A 3WB2A 2EX3A 1W0JG 2XUMA 1SQBH 4B3RO 4DR7O 1SQQH 3ASOC 2QE7G 5LXTB 2OT5A 1K97A 4F6RB 4Q20A 5L3GA 1VQLV 1EZJA 4JI7O 4E2LA 5EIBC 4KHPB 1W0KG 4LP8A 3PN1A 3FYIB 4LNUB 1BCCH 2AZ0A 5C93A 4TQDA 1ORQC 3T1YB 3JALB 4JYAO 2EZPA 2QSAA 4K0KB 3CC4V 4LF8O 4YIPA 3F7VC 2ZR3A 4DR1B 1EFRG 1VQOV 2CK3G 5EBLC 4HBNA 1YSCA 3K5LA 1GTOA 3OR7C 3L9DA 3M7MX 5GONA 4MVUA 3ZMVA 3UQ8A 3B77A 2ITDC 4MT8A 4P2ZA 1XHXA 4CH5A 1WPBA 3D8CA 2QWRB 2YC0A 4FLYA 2CTQA 2XNDG 1KP2A 1GN6A 4X8AA 2QM8A 3RBZA 2WPDG 2F93B 4LF9B 2WLIB 1ZAUA 5KAFZ 2ODMA 4I4TB 1I0HA 2QKCA 1NR1A 3RYCB 3HKBA 3HKCA 1N36O 3CCRV 2ZNJA 4NTYA 2XAGA 3CYOA 4DV6O 4NXMB 3TXQA 3W7XA 3ZN0A 3O9OA 4O4LB 1K4CC 5D5QA 2V4DA 5GW7A 1HW7A 4DR2B 4TQFA 3RYHB 4I50B 3CJHB 3QNEA 1TUBB 1WA8A 2ZE5A 3IC9A 1SERA 2XASA 3HKDA 2YIDA 1VQ4V 1PV0A 2JIZG 5JQGA 5LOVB 5EK0A 1EN4A 1PL0A 3ZHTA 1SESA 3ICXA 4CS2A 1UPGA 1S5HC 4J9YB 3JCUZ 1OV9A 3ZHSA 4XDJA 1RSOA 4MVOA 4AI8A 4JZGA 1Y4MA 3BA9A 1K5SA 3ABUA 3A2FA 1M9NA 2WLLB 4JI1B 2UXXA 5IYZB 3B8NA 4QNHB 4I0XB 5DECA 2LGQA 4UCVA 4O4IA 5FNVA 5B3SB 2D2CB 2ITCC 3PJSK 1F4NA 2LO1A 4DV3B 2F4VB 1KMIZ 5B1AC 2CTPA 4QPKA 5JWPA 4DV5B 1JPXA 3T1HO 4I9QA 2PI5A 3RYFA 2LJ2A 5KX5A 2A79B 2PYJA 4PI2A 3EHBB 4D7TA 1X59A 3MD0A 5J2UB 4FIPC 3UCSC 5JH7A 2UXBB 3CC2V 2V1DA 1EM1A 2FYUH 1OJHA 1TVKA 3JD0A 1M56B 4DV1B 1CEZA 3KCYA 1F4MA 4JV5B 1WJZA 1GM7A 3K9AA 2BTQB 1AR5A 2IJJA 4CC5A 1QLEB 3E89A 3ETDA 3CB2A 2H3OA 1GK9A 2QTSA 4B3RB 2UXCO 2YEVA 5DN6G
chains in the Genus database with same CATH topology
1JQ0A 5L3EA 4MS2A 2EIKC 5EBMC 1EBOA 3BEHA 3K3WA 2JDIG 3GB7C 1AJNA 1K3EA 3LDCA 2XAJA 2XAQA 3ABKB 3STLC 4ASUG 1YHQV 3CCJV 4P9OA 3OE7G 2LP7A 2BOBC 1AJQA 3QO8A 1AI4A 3E2EA 2GHYA 1OCZB 1H38A 2IJKA 2Q6AA 4JAUA 1GM8A 3DTUB 1NR7A 5H6QA 2JEXA 1M57B 3RW0A 3ASOB 3E83A 4PA9A 3G6EV 1VQ8V 2AHZA 1H8EG 2B1GA 3KG2A 4OXSA 4QE7A 1N8RW 3K0DA 3IC7A 4EKWA 4X89A 3ZMUA 1K34A 3SJQC 4MTOA 4JTCB 3T1CA 5KA6A 3LSSA 5EC2C 3VBBA 3OR6C 1E1QG 3MHSC 4BAYA 1DLBA 5KA5A 4U7NA 1H8HG 2JEUA 1R3IC 3FB7C 4PA7A 4TWKA 3ZRSA 3E86A 5HFMA 3IFXA 2WLHA 2WLIA 3FKSG 2FTKA 2D3OW 3W7SA 2EINC 1QBZA 1E79G 4UV9A 2OCCB 4H33A 4I9WA 4WF9V 3E8HA 3HB3B 4N21A 3P30A 5BZBA 1AI7A 3RVYA 3RVZA 1QR9A 4J9ZB 1NVPD 3K0GA 5J9PC 2R9IA 2Y48A 4CZZA 3LSQA 4I5SA 4GX2A 4PDMA 2W6JG 2WSSG 3AG1C 1S3JA 2M7WA 3CPWU 2KB1A 3IGAC 3ABMC 3A0RA 1NH2D 2QM7A 5LHGA 2X7RB 3LDDA 5B1NA 4GX1A 3G4SV 4UVBA 1NH2B 1JX9A 2HJFC 5IYDO 2DWEC 3SPCA 1R6KA 4TSFG 4G28B 5DM6V 2GSMB 2EIMC 4PDLA 1QLNA 4PA4A 1BHBA 3M99B 3FYEB 3NXSA 2DQ0A 4MW8A 4PDVA 3SPGA 3JD4A 5L3CA 2IH3C 1MOFA 4X88A 4JF3A 3X2QC 1GKFA 2DYSB 1SRYA 2ZDIC 2P7TC 4XBFA 3E8FA 1KKDA 4LCUC 4RQEA 5IY5B 2EILC 2WAMA 4P30A 3ZMTA 1KP3A 1V55C 1MSWD 3ASNC 4DXWA 4MVQA 1FXKA 1FXVA 1PD3A 1FS0G 1I5YA 4UXNA 1AROP 3W7UA 3ZIAG 4P9PA 2H8PC 4JYBA 4PELA 2F43G 4PA6A 1QVFU 1TUEB 1NQTA 4JASA 1QCEA 2B5UA 3H01A 1YIJV 3GWOA 4QE9A 3CCUV 3G71V 2IH1C 5E1AC 4G2KA 3STZC 2OTLV 2WLLA 4FK5C 5LGTA 1YITV 3AG2C 3OM3B 1MG1A 1BMFG 4ZKIA 5L3BA 1FFTB 2Y69C 3LUTB 3SYCA 4MTGA 3WG7B 4BIUA 2ZXWC 5HFLA 1JOYA 1UJWB 1SZTA 3SPHA 1AI6A 1K4DC 5IYBO 5B3SC 4WFFA 3OGCC 3SYAA 1I5XA 1Q82W 1J95A 3K79A 5LHHA 2Q68A 3E35A 2Z3YA 2Q69A 2DYRB 3AG3B 5CMUA 3ZRWB 2ZQMA 4FPPA 4R7CA 1K73W 1VQKV 3CCVV 2BOCC 3VOUA 3JCZA 1GMGA 4JGSA 4R8CA 1R6NA 5L3DA 1YI2V 1K5QA 1NJIW 2WLMA 4JPRA 4LC1A 5KUMA 1IXMA 1OCCB 1M56C 4QPJA 4JYCA 1R3JC 2XAHA 1LNQA 4RUFA 1WPXA 3W7WA 1OCOB 1YTFD 1ROPA 3BY6A 1OCRB 1OHHG 5CBGA 3SPIA 1M90W 1YTFB 2NNUA 1KD1W 1QLEC 3JD1A 2JK5C 3JYCA 2HFEC 3B8MA 3ML0A 1K9MW 2JJ2G 4GX5A 2NLJC 3ZJZA 4CBCA 3HPLC 3CCSV 4MTXA 1VQ9V 4UUJC 2A0LA 1THZA 3SPJA 1YJWV 5B1AB 3T4DA 3TK1A 5CA3A 2MK3A 1VQ6V 2HG5C 5FL7G 1S77D 1L1FA 4JAVA 1P7BA 4R50A 3CCEV 4UVAA 3ZRXA 3CC7V 2DQ3A 5LHIA 3D36A 1M1KW 1RM1B 2EILB 2HLDG 1W0JG 1KC8W 3OUSA 1OCZC 5B1BC 4FMTA 1M57C 4MW3A 3ASOC 2QE7G 1S0VA 2OT5A 4JTDB 1FXHA 1K97A 4RUEA 4Q20A 3QO7A 5H6RA 5L3GA 2W6IG 1VQLV 1EZJA 1Q81W 5L3FA 4E2LA 4MVSA 4MTFA 1AJPA 1W0KG 4LP8A 3LDEA 4DO2A 3WFVA 1G4YB 3OUFA 3FYIB 1E1RG 3SYOA 2LFRA 5C93A 1ORQC 4RAIA 2H94A 3LNMB 2HVKC 2EZPA 3ZRVA 3CC4V 4MVZA 4WFHA 3AG4C 3CCQV 5CBFA 2R9RB 2YEVB 1DF4A 2XOKG 3F7VC 2ZR3A 4GX0A 4RO2A 5B1OA 4Z1MG 1EFRG 4BIZA 1FXKC 1VQOV 2EIKB 2CK3G 1GO3F 1COWG 1QR8A 5EBLC 1YSCA 1BL8A 3W7TA 2OCCC 3CMEV 1F51A 1GTOA 3P32A 3OR7C 4PA3A 2X0LA 2AHYA 4MVUA 3I55V 3ETEA 1BHAA 3ZMVA 4U7OA 2B1IA 1H2GA 3ZMZA 3B77A 2ITDC 4XDLA 4MT8A 4P2ZA 1S76D 3ABTA 4WFGA 1V54C 2IJIA 4YXWG 2QTOA 4HAMA 5LGUA 3K04A 1PNLA 4ZBMA 2XNDG 1KP2A 2X6BA 1PKXA 3OAAG 4GT1A 2IU0A 4X8AA 2QM8A 4PDRA 3CP1A 3RBZA 4R6ZA 2WPDG 3FB5C 1DTOA 3ABLC 2QEXV 3OMAB 3DGEA 2WLKA 4JTAB 2ZD9A 2DYSC 2WLIB 2UXNA 3MHHC 2ZR2A 3FB8C 4GCZA 2EINB 2JJ1G 1NKDA 3CCLV 1YJNV 5IY5C 1ENVA 1NR1A 3FB6C 1W2BU 3CCRV 3UKMA 2XAGA 3CYOA 1Q86W 1F23A 4HYOA 3F5WC 4MSWC 2X6AA 3W7XA 5B1BB 3AG1B 5CN0A 3T2MA 3ZN0A 3ABMB 1AI5A 1R73A 2V7QG 2HVJC 1K4CC 5GW7A 2XAFA 2EIJC 3OFNG 4H37A 3WG7C 4F4LA 5IDJA 2QA4V 2EIMB 2A9HA 2WLJA 3CXCU 2DW4A 4UVCA 3QNEA 5EC1C 4G27B 2P67A 4WCEV 2WWWA 1SERA 3JD2A 2XASA 5KUKA 1VQ4V 1RPOA 2P6JA 3X2QB 2JIZG 5LBQA 5CBHA 2X6CA 5EK0A 3ABKC 4WFBV 1PNKA 2LFSA 3AG3C 2DYRC 3ZCCA 3AG4B 3OEEG 1PL0A 1R3LC 3ZRWA 2OTJV 1V55B 3OW2U 3ASNB 3ETGA 1SESA 1VQNV 1K8AW 3K03A 3CCMV 3E8BA 1FXKB 1S5HC 2W0FC 4J9YB 1KQSU 3TETA 4HZ3A 3OMIB 4XDJA 4N23A 4MVOA 3CD6V 1Y66A 1VQMV 1Y4MA 1VQPV 1MABG 3OEHG 1YJ9V 4FJCC 1JJ2U 1OCCC 4WFAV 1K5SA 3ABUA 1NVPB 1JVMA 4MVRA 1M9NA 2WLLB 4MVMA 3AG2B 2UXXA 4BW5A 1OCOC 1V54B 3B8NA 2Y69B 4QNHB 1RPRA 1OCRC 2YSUB 4RQFA 2ZXWB 2QKSA 1JCHA 3E8GA 1VQ5V 3I56V 1ZWIC 5B3SB 2ITCC 2WLNA 5EBWC 3PJSK 1F4NA 1GM9A 5LGNA 2EJRA 3QO5A 4XDKA 2DWDC 2C2AA 2EZOA 3JD3A 2K1EA 1WLEA 3ABLB 1P4RA 5B1AC 1S72V 2EBOA 4QPKA 2HKOA 5IYCO 1K92A 3T4ZA 3SYQA 1JPXA 4LBEC 2PI5A 3AEIA 2ZDIA 2A79B 3K06A 1Q7YW 1CPYA 2Q67A 3EHBB 1CP9A 1XL4A 3D3IA 1RM1C 1PNMA 4UV8A 3EFFK 3MD0A 5H9CA 2P90A 1NBMG 4FIPC 4KFMA 3CC2V 2V1DA 2IW5A 1QVGU 3SYPA 1B6QA 2Z5UA 3JD0A 1M56B 1CEZA 2IU3A 3TCUA 1F4MA 3F7YC 3R65A 3ZN1A 1GM7A 2PI4A 3K9AA 3OMNB 4KUMA 4WFEA 4QJFB 1VQ7V 4KP4A 1DF5A 1G8MA 1R3KC 2HR3A 2IJJA 4L87A 1QLEB 3K08A 3E89A 3CMAV 1K33A 1KECA 3ETDA 1HWYA 2EIJB 1K7DA 1SETA 3ZMSA 2ATKC 2IJHA 1GK9A 4TT3G 1AR1B 1OZ0A 1XL6A 2YEVA 4QIWF 5DN6G 3UM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LP8 A;  3LDE A;  4MS2 A;  2EIK C;  5EBM C;  4G27 B;  3BEH A;  4P9P A;  5EC1 C;  1G4Y B;  3GB7 C;  1XL6 A;  2H8P C;  3OUF A;  4PA6 A;  3LDC A;  3STL C;  3SYO A;  5KUK A;  4P9O A;  2BOB C;  5CBH A;  1ORQ C;  2X6C A;  3ABK C;  4QE9 A;  4RAI A;  5EK0 A;  2IH1 C;  3LNM B;  3AG3 C;  2DYR C;  2HVK C;  2Q6A A;  5E1A C;  1R3L C;  3STZ C;  2WLL A;  3RW0 A;  3E83 A;  3AG2 C;  4MVZ A;  4PA9 A;  4WFH A;  3K03 A;  3AG4 C;  2Y69 C;  3E8B A;  3LUT B;  4MTG A;  3SYC A;  2ZXW C;  2AHZ A;  1S5H C;  2W0F C;  2R9R B;  4J9Y B;  5CBF A;  3F7V C;  4RO2 A;  4GX0 A;  3SPH A;  3KG2 A;  1K4D C;  4HZ3 A;  4OXS A;  4QE7 A;  3K0D A;  5B3S C;  4XDJ A;  4WFF A;  3OGC C;  3SYA A;  4MVO A;  5EBL C;  4X89 A;  4EKW A;  1BL8 A;  2OCC C;  3SJQ C;  3OR7 C;  4MTO A;  1J95 A;  4JTC B;  4PA3 A;  3T1C A;  5EC2 C;  2AHY A;  1OCC C;  3OR6 C;  2Q68 A;  4MVU A;  2Q69 A;  1JVM A;  4MVR A;  2WLL B;  4MVM A;  4BW5 A;  1R3I C;  1OCO C;  2ITD C;  4R7C A;  3FB7 C;  4PA7 A;  4XDL A;  4QNH B;  4P2Z A;  4TWK A;  1OCR C;  2BOC C;  3E86 A;  3VOU A;  3ZRS A;  2QKS A;  4WFG A;  3IFX A;  2WLH A;  2WLI A;  4R8C A;  3E8G A;  1V54 C;  1ZWI C;  2EIN C;  2QTO A;  2ITC C;  2WLN A;  5EBW C;  3PJS K;  3K04 A;  4H33 A;  2WLM A;  4XDK A;  4ZBM A;  2DWD C;  4I9W A;  3E8H A;  5BZB A;  2X6B A;  5KUM A;  3RVY A;  3RVZ A;  2K1E A;  1M56 C;  5B1A C;  4X8A A;  4J9Z B;  4PDR A;  3RBZ A;  3K0G A;  5J9P C;  1R3J C;  4R6Z A;  1LNQ A;  3FB5 C;  3T4Z A;  3SYQ A;  3ABL C;  4LBE C;  4RUF A;  4GX2 A;  2WLK A;  4PDM A;  2A79 B;  3K06 A;  5CBG A;  4JTA B;  3SPI A;  2ZD9 A;  2Q67 A;  3AG1 C;  1XL4 A;  2DYS C;  1QLE C;  2WLI B;  2JK5 C;  3JYC A;  2HFE C;  2KB1 A;  3FB8 C;  3ABM C;  3IGA C;  4GX5 A;  3EFF K;  2NLJ C;  4MTF A;  3ZJZ A;  4CBC A;  3LDD A;  5IY5 C;  3HPL C;  4GX1 A;  4KFM A;  3FB6 C;  4UUJ C;  2HJF C;  3SYP A;  2A0L A;  2DWE C;  3SPC A;  3SPJ A;  3TET A;  3UKM A;  3T4D A;  3TCU A;  4G28 B;  2EIM C;  4PDL A;  4PA4 A;  3F7Y C;  2HG5 C;  3R65 A;  1P7B A;  4R50 A;  4MW8 A;  4PDV A;  4HYO A;  4WFE A;  3SPG A;  3F5W C;  4MSW C;  2IH3 C;  4X88 A;  2X6A A;  1R3K C;  3X2Q C;  3T2M A;  3K08 A;  3E89 A;  2P7T C;  3E8F A;  3OUS A;  1KKD A;  1OCZ C;  4LCU C;  5B1B C;  2HVJ C;  2EIL C;  1M57 C;  4MW3 A;  3ASO C;  1K4C C;  4P30 A;  1V55 C;  4JTD B;  3ASN C;  4DXW A;  2EIJ C;  2ATK C;  4RUE A;  4H37 A;  4MVQ A;  3WG7 C;  4F4L A;  2YEV A;  2A9H A;  2WLJ A;  3UM7 A;  4MVS A; 
#chains in the Genus database with same CATH topology
 3K3W A;  2JDI G;  4ZHQ A;  4JI7 B;  1O9G A;  3LDC A;  2XAQ A;  4ASU G;  4P9O A;  1AJQ A;  1AI4 A;  4JAA A;  3E2E A;  4GKJ O;  1OCZ B;  2F1M A;  4B08 A;  1H38 A;  1GM8 A;  3DTU B;  1M57 B;  3QTC A;  1H2S B;  3MDS A;  2B1G A;  4LF5 O;  2CUG A;  4EKW A;  3FX7 A;  2PUS A;  5JJE B;  4TUY A;  5KA6 A;  3VBB A;  3OR6 C;  1KB9 F;  1N34 B;  4U7N A;  4PA7 A;  2HHH O;  3IFX A;  4ZIB A;  4JI2 B;  4H33 A;  3E8H A;  3P30 A;  2P06 A;  3RVZ A;  1QR9 A;  1BS3 A;  2A3Q A;  1EN5 A;  5LP6 A;  4CZZ A;  3G6B A;  4I55 B;  4FM0 A;  4PDM A;  2W6J G;  2WSS G;  4LFA B;  1BGY H;  3AG1 C;  2BTO A;  4RWU A;  3CPW U;  1EZV H;  1EN6 A;  5B1N A;  5BMV B;  4UVB A;  1NH2 B;  1IBK B;  1JX9 A;  1SA0 A;  1NT2 B;  5DM6 V;  2GSM B;  4O2B B;  1PPJ H;  1N36 B;  2DQ0 A;  4PDV A;  3SPG A;  1M5I A;  4X88 A;  3BHP A;  4EFB A;  3X2Q C;  2DYS B;  3JAK B;  5E79 Z;  2P7T C;  2ZM6 O;  1B06 A;  5IY5 B;  1Q90 D;  2CE4 A;  5IE9 A;  4DXW A;  3B4S A;  4BW9 A;  2UUB B;  1ZL8 A;  1BZK A;  5B66 Z;  1S5L Z;  3ZIA G;  4X66 B;  2H8P C;  1QVF U;  3JAR B;  5BR8 O;  3I5D A;  1NQT A;  4NXN O;  1KUQ A;  3H01 A;  3CCU V;  3G71 V;  3M8A A;  5E1A C;  4J7J A;  1BMF G;  1ZUQ A;  3WG7 B;  4BIU A;  4X20 A;  1SZT A;  3SPH A;  3U11 A;  1Z5V A;  2R70 A;  1Q82 W;  3HKD B;  1J95 A;  3T1Y O;  4JI5 B;  2DYR B;  5CMU A;  4K0K O;  5LL6 Y;  4DK0 A;  2YDE A;  1Q8I A;  3CCV V;  5EYP A;  2JGD A;  3JCZ A;  1GMG A;  4R8C A;  5A9G A;  1R6N A;  1YI2 V;  2L6L A;  1HDJ A;  4IHJ A;  4YIO A;  1NJI W;  1U97 A;  3TJT A;  4B7K A;  3JAW B;  3L73 H;  1LNQ A;  1WPX A;  1OCO B;  1DK1 A;  5JJJ B;  1ROP A;  4A5U B;  1Q6H A;  1WB7 A;  1M90 W;  2MW2 B;  4OX9 O;  1ZTE A;  5EZY A;  4O4I B;  3T1H B;  1K9M W;  2JJ2 G;  3ZJZ A;  2NLJ C;  4JI6 B;  1U96 A;  3JSN A;  1VQ9 V;  3LNN A;  3SPJ A;  1KYO F;  1NU1 H;  1VQ6 V;  1S77 D;  1QNM A;  2R9A A;  4JAV A;  3SJB C;  1P7B A;  4UVA A;  3ZRX A;  2DQ3 A;  4UCT A;  4LF9 O;  4WBN B;  1H2L A;  2VWK A;  5B1B C;  4YJ2 A;  1KBH A;  4UCU A;  4RUE A;  1TVK B;  3K58 A;  5H6R A;  2W6I G;  4MVS A;  4DO2 A;  1AJP A;  2YXY A;  2QWQ B;  2PZS A;  4D6T H;  3WFV A;  1G4Y B;  3OUF A;  3JAS A;  2Y0I A;  5LA6 B;  4RAI A;  4NTW A;  4DR4 B;  3LNM B;  2HVK C;  3K59 A;  2KQX A;  4GKJ B;  3AG4 C;  3CCQ V;  1I94 O;  2YEV B;  4GX0 A;  4Z1M G;  3CSX A;  3DXR B;  5B1O A;  4IL6 Z;  2EIK B;  1V9P A;  1GO3 F;  3W7T A;  5GTI Z;  4ZHQ B;  1GAX A;  1F51 A;  3H9V A;  4IIJ B;  4IGG A;  4PD4 F;  2AHY A;  3EVK A;  3R66 A;  4U7O A;  1S76 D;  3ABT A;  1V54 C;  4HAM A;  4TV9 B;  3QVN A;  1PNL A;  4LWS B;  3HKE B;  4ZOL A;  4TUY B;  2FML A;  4JI1 O;  3OMA B;  2ZD9 A;  4YHH O;  3FB8 C;  3TGU H;  4DV3 O;  4NTX A;  3WB0 A;  2PY5 A;  5IJ9 A;  3UKM A;  1MZF A;  3ZHR A;  5LP6 B;  4DV5 O;  3B2E E;  4X1K A;  1ZSP A;  4HYO A;  5LYJ A;  1FJG O;  4MSW C;  2X6A A;  2RDC A;  5B1B B;  5CN0 A;  4GKK B;  3T2M A;  2DOS A;  2RJZ A;  3ZHV A;  3FFQ A;  2UXB O;  5ITZ A;  1XNQ O;  2V7Q G;  5EIB D;  2CTR A;  2KKW A;  2ZM6 B;  4BR6 A;  3OFN G;  1SA0 B;  4DV1 O;  4JV5 O;  2EIM B;  3FD9 A;  2GDS A;  2UUC B;  2QDO A;  4G27 B;  2K9P A;  1RPO A;  4LH7 A;  1IX9 A;  3CS5 A;  5CBH A;  2X6C A;  3ABK C;  1YVW A;  2LFS A;  3AG3 C;  5BR8 B;  4FLZ A;  3AG4 B;  3OEE G;  2OTJ V;  1R3L C;  2QR4 A;  1V55 B;  3ASN B;  3ETG A;  1VQN V;  1NZ6 A;  1ZL8 B;  1TA8 A;  1Z5W A;  1AP5 A;  3CRQ A;  1UFI A;  4J7K A;  4O2A A;  1SKV A;  1HR0 O;  1VQP V;  3H1I H;  1N32 B;  1OCC C;  4J7Z A;  1AB3 A;  1Q43 A;  2E74 B;  1V54 B;  1RPR A;  1OCR C;  4RQF A;  3A8T A;  1VF6 C;  5EBW C;  5LGN A;  1IUR A;  2EJR A;  4XDK A;  2DWD C;  2C2A A;  2K1E A;  1N34 O;  1M4U A;  1P4R A;  1VEW A;  4JZ2 A;  3AEI A;  3K06 A;  1GH6 A;  2LQT A;  2Q8V A;  1A32 A;  4JI4 B;  5K1X A;  1CP9 A;  3D3I A;  3N27 A;  1PNM A;  3CWB H;  1XIL A;  4JI2 O;  4UCR A;  3UT5 A;  2P90 A;  2GBO A;  1NBM G;  3BVO A;  4OX9 B;  2IW5 A;  4FLX A;  1AP6 A;  1B6Q A;  4FLT A;  3F7Y C;  3R65 A;  2OIG A;  3RYI A;  4WFE A;  4NVP A;  4LFA O;  1G8M A;  2HR3 A;  5EZY B;  3ZBH A;  4DUZ O;  3CMA V;  1K33 A;  1KEC A;  1IBK O;  3DSQ A;  3ZMS A;  3SGI A;  2IJH A;  4TT3 G;  1XL6 A;  4ABM A;  2CDY A;  5L3E A;  2ZKO A;  1HNZ B;  1AJN A;  1K3E A;  3ABK B;  1YHQ V;  2LP7 A;  2BOB C;  1R6T A;  2Q6A A;  1NR7 A;  3AK2 A;  3ASO B;  3E83 A;  1G1X B;  2UUB O;  1H8E G;  4QE7 A;  3Q4H A;  5CB4 A;  4X66 O;  3H1J H;  4X89 A;  1I94 B;  1H2M A;  4GZR B;  2IBZ H;  3MHS C;  2OCH A;  4BAY A;  4CC6 A;  2VQE B;  4J41 A;  1SQG A;  2D3O W;  3BRC A;  2EIN C;  1E79 G;  1D2D A;  1NI8 A;  4OGQ B;  4WF9 V;  5BZB A;  4N21 A;  3K5O A;  1AI7 A;  2WA3 A;  5FLX N;  4JI5 O;  3B09 A;  1NVP D;  3K0G A;  1SQP H;  2GUZ A;  1TAE A;  4DRX A;  4CS4 A;  3J7A U;  4I5S A;  3RT3 C;  4X9Q A;  2Q5Z A;  4DYL A;  4H0L B;  5KLV H;  4X65 O;  5KMG A;  1XNR B;  3D3Q A;  2M6Y A;  1Q3E A;  3ABM C;  1NH2 D;  2QM7 A;  5LHG A;  1SQV H;  3G4S V;  4YHH B;  4ZOL B;  5IYD O;  2JS3 A;  1IZ3 A;  4G28 B;  4K8X A;  2YIA A;  2CTW A;  2Q0A A;  3E22 A;  4D7S A;  2YI9 A;  3JD4 A;  1GKF A;  3S3X A;  1SRY A;  4JI6 O;  4J11 A;  1FJG B;  1KKD A;  4LCU C;  2EIL C;  2KG7 A;  4P30 A;  1KP3 A;  5JJN B;  3WU2 Z;  1FXK A;  1XNQ B;  2JRI A;  1FXV A;  5BXZ A;  1FS0 G;  5C8Y A;  1I5Y A;  1S5J A;  4X1K B;  4BWA A;  2UU9 O;  3QG5 A;  2F43 G;  2EUL A;  5JVD A;  4F6E A;  2B5U A;  2CH7 B;  5ITZ B;  2OTL V;  4FK5 C;  1SC5 B;  3AG2 C;  4EB6 B;  3FAV B;  4X1Y A;  4PJ0 Z;  5CA0 A;  1FFT B;  2Y69 C;  3LUT B;  3GVM A;  2ZXW C;  5IT9 N;  4O4J A;  2QJ1 A;  2PF4 E;  5IYB O;  3TXS A;  1I5X A;  2EJ7 A;  2ZE7 A;  3BAA A;  5AG2 A;  5CA1 B;  3MAQ A;  1HR0 B;  4DR4 O;  2YS8 A;  3QF7 A;  4ICG A;  4FZ1 A;  1VMG A;  2YUA A;  4R7C A;  3IAY A;  3VOU A;  2AZ2 A;  1W59 A;  2W0X A;  1K5Q A;  4O2A B;  2Y4T A;  2LW1 A;  3P3N A;  5KUM A;  2ZIO A;  4JYC A;  1R3J C;  2XAH A;  4LF6 B;  1IVS A;  3ZHQ A;  5TIS Z;  1Z2G A;  2VS0 A;  1YTF B;  2JK5 C;  3ML0 A;  2G38 A;  4CBC A;  2A0L A;  4LF4 O;  3BFR A;  2FL4 A;  4HNA A;  5B1A B;  3TK1 A;  4UB8 Z;  1L8D A;  3J81 N;  1Y74 A;  2YXL A;  5GON B;  3S3W A;  4R50 A;  3CCE V;  2JS5 A;  2Q7G A;  1J5E B;  1VIB A;  3GWK C;  4DW0 A;  2EIL B;  2HLD G;  3OUS A;  1S0V A;  4DUZ B;  4DV7 O;  1FXH A;  1N0J A;  1Q6I A;  3QO7 A;  1Q81 W;  5L3F A;  4MTF A;  1SZX A;  5BY1 A;  1PP9 H;  2P5O A;  3B40 A;  1D5N A;  3SYO A;  4GKK O;  2ZNI A;  2LFR A;  2H94 A;  4NB5 A;  4LH6 A;  1AVM A;  3ZRV A;  4TV8 A;  4MVZ A;  3IJ4 A;  5CBF A;  2UUC O;  1DF4 A;  3HKB B;  3HKC B;  5J2T A;  3O65 A;  1LUV A;  1FXK C;  4GYC B;  1COW G;  1QR8 A;  2BE3 A;  1BL8 A;  4PI0 A;  2OCC C;  3CME V;  1XDC A;  4FVM A;  1MSD A;  4PA3 A;  2JVD A;  2UUA O;  1N33 O;  4U3J A;  3I55 V;  3ETE A;  1BHA A;  2YIB A;  2HEP A;  2B1I A;  1H2G A;  3ZMZ A;  3UO3 A;  3VQX A;  4WFG A;  2ZE8 A;  1JJO A;  2QWO B;  5LXT A;  5LGU A;  1N4C A;  3K04 A;  2PTM A;  4ZBM A;  1PL4 A;  4IYH A;  5FPR A;  4ZI7 A;  1N32 O;  1WA8 B;  3OAA G;  4GT1 A;  5H5N A;  1MA1 A;  2BSK A;  1DGS A;  4TOI A;  1IBM O;  1MMM A;  4BIO A;  1SQX H;  4R6Z A;  5JQG B;  3FB5 C;  1DTO A;  1SS3 A;  4JYY A;  3JAL A;  4X62 O;  3RN4 A;  2UXN A;  3MHH C;  2ZR2 A;  4GCZ A;  2JJ1 G;  4DV2 B;  1NKD A;  3CCL V;  2GV9 A;  4FLV A;  1ENV A;  4X65 B;  3BCC H;  2ILM A;  3FB6 C;  2DJV A;  1HNX B;  1RSO B;  4DUY O;  1TGO A;  1FFX A;  2GUZ B;  1Q5O A;  4DRX B;  4IYI A;  4JI4 O;  2N04 A;  4AQY O;  4Z2W A;  3HR0 A;  3AG1 B;  5KMG B;  3G80 A;  1AI5 A;  1R73 A;  1QHT A;  4FZ0 A;  2HVJ C;  5FNV B;  2XAF A;  2EIJ C;  2E5L B;  1YEW A;  5IDJ A;  1O9H A;  2WLJ A;  3CXC U;  3AK1 A;  2DW4 A;  4UVC A;  2P67 A;  4DR3 B;  3E22 B;  2WWW A;  5KUK A;  4B3T O;  1SQF A;  2P6J A;  3X2Q B;  1XUQ A;  3RYF B;  3OD4 A;  5KX5 B;  2UU9 B;  4PV1 B;  2GTA A;  4DW1 A;  4WFB V;  1Y76 A;  3ZCC A;  1L0N H;  3U10 A;  1K8A W;  3K03 A;  5JH7 B;  1FXK B;  4I4T A;  2E76 B;  2W0F C;  3TET A;  4UFZ A;  4HZ3 A;  2RCV A;  3KCX A;  1HNZ O;  5KHG A;  1IDS A;  4N23 A;  3RYC A;  4K3A A;  5JVD B;  4LF7 O;  3OEH G;  4WFA V;  4I7Z B;  4FLW A;  4MVR A;  2N05 A;  3L74 H;  4BW5 A;  1AR4 A;  3CE2 A;  2QKS A;  5IJ0 A;  3U0Z A;  3E8G A;  1RP3 B;  1VF6 A;  4O4L A;  2WLN A;  3JD3 A;  3RYH A;  4I50 A;  3ZX6 A;  2Q0O C;  3CJH A;  1S72 V;  1TUB A;  1P7G A;  2VQE O;  3SYQ A;  1GN2 A;  4LR3 A;  3K57 A;  1Q7Y W;  4YJ3 A;  1XL4 A;  2F95 B;  1RM1 C;  4FFB A;  3EFF K;  4UV8 A;  1L0L H;  4KFM A;  4B3S B;  1QVG U;  3SYP A;  2VRZ A;  3TCU A;  3ZN1 A;  4LF4 B;  3OMN B;  1HP8 A;  4O4H A;  3C3T A;  2ADP A;  1VQ7 V;  4KP4 A;  1DF5 A;  1XNR O;  3ZS8 C;  3K08 A;  1B04 A;  3APQ A;  2EIJ B;  3L72 H;  5IYZ A;  1K7D A;  4I0X A;  3LSU A;  5KHI A;  4JI8 B;  1BQZ A;  1B3Q A;  4HNA B;  4QIW F;  4GUN A;  4DV7 B;  1JQ0 A;  1XMO B;  1FYJ A;  5EBM C;  2DMX A;  4NKG B;  3RWR D;  3CCJ V;  4X1I A;  3OE7 G;  3QO8 A;  2GHY A;  4JAU A;  4JI0 O;  1WN7 A;  2JEX A;  4YY3 B;  3A0H Z;  3G67 A;  4PA9 A;  5JCO C;  2NR5 A;  3CRR A;  3G6E V;  1VQ8 V;  2AHZ A;  1D5A A;  3BA8 A;  5J2U A;  4CS3 A;  4OXS A;  1N8R W;  3K0D A;  2VQF O;  4KXR A;  3ZMU A;  3SJQ C;  4MTO A;  4JTC B;  3LSS A;  2BCC H;  2P4V A;  3VQY A;  1E1Q G;  4Z1V A;  1DLB A;  2QWP B;  1H8H G;  3UO2 A;  2UUA B;  3OTO B;  1N33 B;  3FB7 C;  4TWK A;  1N0N A;  3FKS G;  2FTK A;  1QBZ A;  4UV9 A;  4I9W A;  3HB3 B;  2R9I A;  3LSQ A;  1XQ8 A;  1IBM B;  1S3J A;  2M7W A;  3WB1 A;  3A0R A;  5FPO A;  4X20 B;  1P49 A;  3LDD A;  4X62 B;  4J80 A;  2Y0P A;  3ZED A;  4ZI7 B;  5IWA B;  5KHH A;  1R6K A;  4TSF G;  2BSK B;  4PDL A;  1XRE A;  4PA4 A;  1BHB A;  3M99 B;  3FYE B;  4LF6 O;  2Y4U A;  4DUY B;  5L3C A;  2IH3 C;  2PGG A;  1IBL B;  2HP8 A;  5EYP B;  2JGD B;  4AQY B;  2WAM A;  3ZMT A;  4K35 A;  4MVQ A;  4IHJ B;  1PD3 A;  1FFX B;  1YDX A;  4UXN A;  1MZE A;  2RQ6 A;  1BQ0 A;  3W7U A;  4P9P A;  1CXZ B;  4JYB A;  1J5E O;  1TUE B;  2A06 H;  1YCI A;  1YIJ V;  4QE9 A;  3JSL A;  4I55 A;  4B3T B;  4G2K A;  5GTH Z;  3STZ C;  5LGT A;  3SYC A;  4MTG A;  2N74 A;  4B3M B;  5BMV A;  1AI6 A;  1K4D C;  5B3S C;  2LW7 A;  3C3S A;  3SYA A;  2P4K A;  2A7W A;  2OWO A;  4O2B A;  3CRA A;  5LHH A;  5LMN B;  1Y76 B;  3AG3 B;  4LF7 B;  3THO A;  3BPZ A;  3SJA C;  3JAK A;  1K73 W;  4YJ2 B;  5H2F Z;  2BOC C;  1Y6X A;  2DE0 X;  4IT5 A;  4GLX A;  3CHX A;  1FAF A;  2WLM A;  2CGO A;  4LC1 A;  2ZE6 A;  1IXM A;  1OCC B;  1M56 C;  3JAS B;  3KZI Z;  1NS1 A;  1VF7 A;  2AGA A;  3JAR A;  3W7W A;  4E4E A;  1H2K A;  1YTF D;  3BY6 A;  4CH4 A;  1OCR B;  1OHH G;  2UXD O;  1KD1 W;  1QLE C;  3JD1 A;  5IJ0 B;  3JYC A;  5K1P A;  4LFB B;  2HFE C;  1QU7 A;  3BAB A;  1NTZ H;  4FM2 A;  3K5N A;  4FFK A;  4UUJ C;  3T4D A;  2HJD A;  2MK3 A;  2YI8 A;  2HG5 C;  2AXT Z;  1L1F A;  3OTF A;  1GN4 A;  3A0B Z;  4LFC O;  4JI3 B;  5LHI A;  1G6U A;  4YJ3 B;  3D36 A;  1M1K W;  4W4L A;  4DV2 O;  1KC8 W;  4FFB B;  1OCZ C;  2XHB A;  5LMU B;  4FMT A;  1M57 C;  4MW3 A;  1HNX O;  4JTD B;  1YXB A;  4J42 A;  3LDE A;  1WP8 A;  3CRC A;  4O4H B;  1E1R G;  2WA4 A;  3JAW A;  2DN9 A;  2KSD A;  1P84 F;  1JMK C;  4CH3 A;  4WFH A;  2E5L O;  1YZB A;  3H1K H;  2XTA A;  4JI0 B;  4UCO A;  1YF2 A;  2R9R B;  5KHJ A;  2XOK G;  4RO2 A;  4BIZ A;  5IJ9 B;  4DR3 O;  2LGW A;  2Q73 A;  3P32 A;  3N2K A;  2X0L A;  4X1I B;  2VQF B;  5LYJ B;  1WAZ A;  2RMK B;  4DR6 B;  4WBN A;  4XDL A;  4DV0 B;  3H1L H;  2IJI A;  4YXW G;  2QTO A;  4OPH A;  1XMQ B;  1T5E A;  2X6B A;  1PKX A;  2IU0 A;  3NR7 A;  4PDR A;  3CP1 A;  3ABL C;  4OPA A;  2QEX V;  3DGE A;  5LA6 A;  2WLK A;  2ZT9 B;  4JTA B;  2DYS C;  2QWN B;  2RN9 A;  3N2G A;  4DV4 B;  2EIN B;  3JAT A;  1KKC A;  4UCS A;  1YJN V;  5IY5 C;  4DR7 B;  1W2B U;  3DXR A;  1NTM H;  1XEQ A;  1JFF A;  4DR5 O;  3SR2 C;  2L35 A;  3SDL A;  1Q86 W;  4IIJ A;  4X64 O;  3L71 H;  4UB6 Z;  3JAM N;  1F23 A;  3AK3 A;  3F5W C;  1WP7 A;  3H1H H;  3ABM B;  1URF A;  1ZLZ A;  4QGP A;  4B3S O;  4JYA B;  2Q7E A;  4H37 A;  3WG7 C;  4F4L A;  4LF8 B;  2QA4 V;  2A9H A;  4TV9 A;  4LWS A;  2YIC A;  3HKE A;  5EC1 C;  2GTS A;  4WCE V;  3CRM A;  3JD2 A;  2F66 C;  3CX5 F;  2VWJ A;  5LBQ A;  1PNK A;  3D36 C;  2DYR C;  3ZRW A;  1Q6U A;  2ARH A;  4JI8 O;  1MNG A;  1RFY A;  3OW2 U;  3UT5 B;  3CCM V;  3E8B A;  2E75 B;  1KQS U;  1XBL A;  1XMO O;  3OMI B;  1XI1 A;  2ZCE A;  4L8J A;  3CD6 V;  1Y66 A;  1VQM V;  3RYI B;  1MAB G;  1YJ9 V;  4FJC C;  1JJ2 U;  1NVP B;  4H44 B;  1JVM A;  4YY3 O;  2CAZ C;  2E3C A;  4MVM A;  2P22 C;  3AG2 B;  1HNW O;  1OCO C;  2Y69 B;  3ZHU A;  2YSU B;  1LUW A;  2ZXW B;  2Q7H A;  2ADQ B;  1JCH A;  1VQ5 V;  3I56 V;  1ZWI C;  2QKA A;  1GM9 A;  3QO5 A;  2EZO A;  2CGN A;  3ETQ A;  1WLE A;  1FKA O;  3ABL B;  2JGU A;  2EBO A;  2HKO A;  5IYC O;  1K92 A;  3T4Z A;  4DV6 B;  4LBE C;  3OTO O;  1KU9 A;  2ZDI A;  3K5M A;  2QM4 A;  1CPY A;  2Q67 A;  5KHK A;  3RFR A;  5H9C A;  2UXD B;  3Q4H B;  5CB4 B;  1JA8 A;  2Z5U A;  4F6R A;  2IU3 A;  4AIL C;  3VQV A;  2PI4 A;  2ZIN A;  4KUM A;  4QJF B;  4LNU A;  1R3K C;  4DK1 A;  4L87 A;  1WB8 A;  3VQW A;  4K8Z A;  4LFC B;  3DC6 A;  1ZX3 A;  1HWY A;  1SET A;  1VP7 A;  1US6 A;  5IWA O;  4KHP O;  1GN3 A;  2ATK C;  3L75 H;  1H2N A;  1AR1 B;  1OZ0 A;  3UM7 A;  5D5P A;  2F23 A;  4MS2 A;  2EIK C;  1EBO A;  3BEH A;  4CH6 A;  3GB7 C;  3F5T A;  2XAJ A;  3STL C;  4B7E A;  2Q9L A;  5DED A;  1IBL O;  1LR1 A;  2IJK A;  5H6Q A;  3RW0 A;  5JCO A;  3SJC C;  4DR1 O;  3KG2 A;  1SF9 A;  1Y67 A;  3IC7 A;  1K34 A;  4PHZ A;  3T1C A;  5EC2 C;  2FKX A;  5F2V O;  5KA5 A;  3AG7 A;  2JEU A;  1R3I C;  4NR1 A;  2OYQ A;  3ZRS A;  2KG7 B;  3APO A;  3CEI A;  3E86 A;  5HFM A;  4B3M O;  2WLH A;  2WLI A;  3W7S A;  2R72 A;  5C8Y B;  1JR9 A;  2OCC B;  1FPO A;  2YXH A;  3N2K B;  3RVY A;  5LMN O;  1BSM A;  4J9Z B;  2YIB D;  5LP6 C;  5J9P C;  2Y48 A;  4GX2 A;  2RNB A;  4U3F H;  1IXB A;  4X1Y B;  5CA0 B;  2KB1 A;  3IGA C;  3EXA A;  2X7R B;  4O4J B;  4GX1 A;  1BT8 A;  2HJF C;  1I08 A;  2DWE C;  3SPC A;  4NXM O;  1QLN A;  4KL1 A;  1WNS A;  2EIM C;  2UXC B;  3NXS A;  4C7U A;  4MW8 A;  4DR5 B;  1MOF A;  3C90 A;  4LFB O;  4X64 B;  4JF3 A;  4H13 B;  5A2Q N;  3N2G B;  5KAI Z;  2ZDI C;  1F7Y A;  3JAT B;  5LOV A;  4XBF A;  3E8F A;  4RQE A;  4DR2 O;  4AHC A;  1GRJ A;  1QQC A;  1V55 C;  3J80 N;  1MSW D;  3ASN C;  2B9Z A;  1JFF B;  1ARO P;  4NYK A;  2FB5 A;  4LF5 B;  3CXH F;  4JI3 O;  4PEL A;  4PA6 A;  4JAS A;  1QCE A;  3OGI B;  2O57 A;  3GWO A;  3P3P A;  5LMU O;  2AW9 A;  2IH1 C;  1BE3 H;  3OT7 A;  2WLL A;  1YIT V;  3OM3 B;  1MG1 A;  1PM9 A;  4ZKI A;  5L3B A;  2HHH B;  5HFL A;  1JOY A;  3DC5 A;  1X4T A;  1UJW B;  4FLU A;  4WFF A;  3OGC C;  1Y74 B;  1M93 A;  4W4K A;  3RGB A;  2PYL A;  3K79 A;  2Q68 A;  1NTK H;  2Z0A A;  3E35 A;  2Z3Y A;  3L70 H;  2Q69 A;  4FM1 A;  3ZRW B;  2ZQM A;  4FPP A;  5B5E Z;  1VQK V;  4EEQ A;  1HNW B;  4JGS A;  1AIL A;  1I7F A;  5L3D A;  2F4V O;  2NN4 A;  3KKY A;  4EFE A;  2XT9 A;  4JPR A;  2ZIM A;  4QPJ A;  4DR6 O;  4RUF A;  4DV0 O;  2BTQ A;  5CBG A;  2CH7 A;  4TV8 B;  3SPI A;  3K9S A;  2NNU A;  1XHZ A;  3B8M A;  1R1B A;  4GX5 A;  4EB6 A;  3FAV A;  3HPL C;  1VAR A;  3CCS V;  4MTX A;  1XMQ O;  5J2T B;  2QGN A;  1THZ A;  1XOU A;  4Q6G A;  1FD9 A;  1YJW V;  5CA3 A;  2OIE A;  2ETN A;  5FL7 G;  1VF5 B;  4U3J B;  5CA1 A;  3CC7 V;  4J10 A;  2Q4P A;  4DV4 O;  4NXN B;  1RM1 B;  2IM9 A;  3WB2 A;  2EX3 A;  1W0J G;  2XUM A;  1SQB H;  4B3R O;  4DR7 O;  1SQQ H;  3ASO C;  2QE7 G;  5LXT B;  2OT5 A;  1K97 A;  4F6R B;  4Q20 A;  5L3G A;  1VQL V;  1EZJ A;  4JI7 O;  4E2L A;  5EIB C;  4KHP B;  1W0K G;  4LP8 A;  3PN1 A;  3FYI B;  4LNU B;  1BCC H;  2AZ0 A;  5C93 A;  4TQD A;  1ORQ C;  3T1Y B;  3JAL B;  4JYA O;  2EZP A;  2QSA A;  4K0K B;  3CC4 V;  4LF8 O;  4YIP A;  3F7V C;  2ZR3 A;  4DR1 B;  1EFR G;  1VQO V;  2CK3 G;  5EBL C;  4HBN A;  1YSC A;  3K5L A;  1GTO A;  3OR7 C;  3L9D A;  3M7M X;  5GON A;  4MVU A;  3ZMV A;  3UQ8 A;  3B77 A;  2ITD C;  4MT8 A;  4P2Z A;  1XHX A;  4CH5 A;  1WPB A;  3D8C A;  2QWR B;  2YC0 A;  4FLY A;  2CTQ A;  2XND G;  1KP2 A;  1GN6 A;  4X8A A;  2QM8 A;  3RBZ A;  2WPD G;  2F93 B;  4LF9 B;  2WLI B;  1ZAU A;  5KAF Z;  2ODM A;  4I4T B;  1I0H A;  2QKC A;  1NR1 A;  3RYC B;  3HKB A;  3HKC A;  1N36 O;  3CCR V;  2ZNJ A;  4NTY A;  2XAG A;  3CYO A;  4DV6 O;  4NXM B;  3TXQ A;  3W7X A;  3ZN0 A;  3O9O A;  4O4L B;  1K4C C;  5D5Q A;  2V4D A;  5GW7 A;  1HW7 A;  4DR2 B;  4TQF A;  3RYH B;  4I50 B;  3CJH B;  3QNE A;  1TUB B;  1WA8 A;  2ZE5 A;  3IC9 A;  1SER A;  2XAS A;  3HKD A;  2YID A;  1VQ4 V;  1PV0 A;  2JIZ G;  5JQG A;  5LOV B;  5EK0 A;  1EN4 A;  1PL0 A;  3ZHT A;  1SES A;  3ICX A;  4CS2 A;  1UPG A;  1S5H C;  4J9Y B;  3JCU Z;  1OV9 A;  3ZHS A;  4XDJ A;  1RSO A;  4MVO A;  4AI8 A;  4JZG A;  1Y4M A;  3BA9 A;  1K5S A;  3ABU A;  3A2F A;  1M9N A;  2WLL B;  4JI1 B;  2UXX A;  5IYZ B;  3B8N A;  4QNH B;  4I0X B;  5DEC A;  2LGQ A;  4UCV A;  4O4I A;  5FNV A;  5B3S B;  2D2C B;  2ITC C;  3PJS K;  1F4N A;  2LO1 A;  4DV3 B;  2F4V B;  1KMI Z;  5B1A C;  2CTP A;  4QPK A;  5JWP A;  4DV5 B;  1JPX A;  3T1H O;  4I9Q A;  2PI5 A;  3RYF A;  2LJ2 A;  5KX5 A;  2A79 B;  2PYJ A;  4PI2 A;  3EHB B;  4D7T A;  1X59 A;  3MD0 A;  5J2U B;  4FIP C;  3UCS C;  5JH7 A;  2UXB B;  3CC2 V;  2V1D A;  1EM1 A;  2FYU H;  1OJH A;  1TVK A;  3JD0 A;  1M56 B;  4DV1 B;  1CEZ A;  3KCY A;  1F4M A;  4JV5 B;  1WJZ A;  1GM7 A;  3K9A A;  2BTQ B;  1AR5 A;  2IJJ A;  4CC5 A;  1QLE B;  3E89 A;  3ETD A;  3CB2 A;  2H3O A;  1GK9 A;  2QTS A;  4B3R B;  2UXC O;  2YEV A;  5DN6 G; 
#chains in the Genus database with same CATH homology
 1JQ0 A;  5L3E A;  4MS2 A;  2EIK C;  5EBM C;  1EBO A;  3BEH A;  3K3W A;  2JDI G;  3GB7 C;  1AJN A;  1K3E A;  3LDC A;  2XAJ A;  2XAQ A;  3ABK B;  3STL C;  4ASU G;  1YHQ V;  3CCJ V;  4P9O A;  3OE7 G;  2LP7 A;  2BOB C;  1AJQ A;  3QO8 A;  1AI4 A;  3E2E A;  2GHY A;  1OCZ B;  1H38 A;  2IJK A;  2Q6A A;  4JAU A;  1GM8 A;  3DTU B;  1NR7 A;  5H6Q A;  2JEX A;  1M57 B;  3RW0 A;  3ASO B;  3E83 A;  4PA9 A;  3G6E V;  1VQ8 V;  2AHZ A;  1H8E G;  2B1G A;  3KG2 A;  4OXS A;  4QE7 A;  1N8R W;  3K0D A;  3IC7 A;  4EKW A;  4X89 A;  3ZMU A;  1K34 A;  3SJQ C;  4MTO A;  4JTC B;  3T1C A;  5KA6 A;  3LSS A;  5EC2 C;  3VBB A;  3OR6 C;  1E1Q G;  3MHS C;  4BAY A;  1DLB A;  5KA5 A;  4U7N A;  1H8H G;  2JEU A;  1R3I C;  3FB7 C;  4PA7 A;  4TWK A;  3ZRS A;  3E86 A;  5HFM A;  3IFX A;  2WLH A;  2WLI A;  3FKS G;  2FTK A;  2D3O W;  3W7S A;  2EIN C;  1QBZ A;  1E79 G;  4UV9 A;  2OCC B;  4H33 A;  4I9W A;  4WF9 V;  3E8H A;  3HB3 B;  4N21 A;  3P30 A;  5BZB A;  1AI7 A;  3RVY A;  3RVZ A;  1QR9 A;  4J9Z B;  1NVP D;  3K0G A;  5J9P C;  2R9I A;  2Y48 A;  4CZZ A;  3LSQ A;  4I5S A;  4GX2 A;  4PDM A;  2W6J G;  2WSS G;  3AG1 C;  1S3J A;  2M7W A;  3CPW U;  2KB1 A;  3IGA C;  3ABM C;  3A0R A;  1NH2 D;  2QM7 A;  5LHG A;  2X7R B;  3LDD A;  5B1N A;  4GX1 A;  3G4S V;  4UVB A;  1NH2 B;  1JX9 A;  2HJF C;  5IYD O;  2DWE C;  3SPC A;  1R6K A;  4TSF G;  4G28 B;  5DM6 V;  2GSM B;  2EIM C;  4PDL A;  1QLN A;  4PA4 A;  1BHB A;  3M99 B;  3FYE B;  3NXS A;  2DQ0 A;  4MW8 A;  4PDV A;  3SPG A;  3JD4 A;  5L3C A;  2IH3 C;  1MOF A;  4X88 A;  4JF3 A;  3X2Q C;  1GKF A;  2DYS B;  1SRY A;  2ZDI C;  2P7T C;  4XBF A;  3E8F A;  1KKD A;  4LCU C;  4RQE A;  5IY5 B;  2EIL C;  2WAM A;  4P30 A;  3ZMT A;  1KP3 A;  1V55 C;  1MSW D;  3ASN C;  4DXW A;  4MVQ A;  1FXK A;  1FXV A;  1PD3 A;  1FS0 G;  1I5Y A;  4UXN A;  1ARO P;  3W7U A;  3ZIA G;  4P9P A;  2H8P C;  4JYB A;  4PEL A;  2F43 G;  4PA6 A;  1QVF U;  1TUE B;  1NQT A;  4JAS A;  1QCE A;  2B5U A;  3H01 A;  1YIJ V;  3GWO A;  4QE9 A;  3CCU V;  3G71 V;  2IH1 C;  5E1A C;  4G2K A;  3STZ C;  2OTL V;  2WLL A;  4FK5 C;  5LGT A;  1YIT V;  3AG2 C;  3OM3 B;  1MG1 A;  1BMF G;  4ZKI A;  5L3B A;  1FFT B;  2Y69 C;  3LUT B;  3SYC A;  4MTG A;  3WG7 B;  4BIU A;  2ZXW C;  5HFL A;  1JOY A;  1UJW B;  1SZT A;  3SPH A;  1AI6 A;  1K4D C;  5IYB O;  5B3S C;  4WFF A;  3OGC C;  3SYA A;  1I5X A;  1Q82 W;  1J95 A;  3K79 A;  5LHH A;  2Q68 A;  3E35 A;  2Z3Y A;  2Q69 A;  2DYR B;  3AG3 B;  5CMU A;  3ZRW B;  2ZQM A;  4FPP A;  4R7C A;  1K73 W;  1VQK V;  3CCV V;  2BOC C;  3VOU A;  3JCZ A;  1GMG A;  4JGS A;  4R8C A;  1R6N A;  5L3D A;  1YI2 V;  1K5Q A;  1NJI W;  2WLM A;  4JPR A;  4LC1 A;  5KUM A;  1IXM A;  1OCC B;  1M56 C;  4QPJ A;  4JYC A;  1R3J C;  2XAH A;  1LNQ A;  4RUF A;  1WPX A;  3W7W A;  1OCO B;  1YTF D;  1ROP A;  3BY6 A;  1OCR B;  1OHH G;  5CBG A;  3SPI A;  1M90 W;  1YTF B;  2NNU A;  1KD1 W;  1QLE C;  3JD1 A;  2JK5 C;  3JYC A;  2HFE C;  3B8M A;  3ML0 A;  1K9M W;  2JJ2 G;  4GX5 A;  2NLJ C;  3ZJZ A;  4CBC A;  3HPL C;  3CCS V;  4MTX A;  1VQ9 V;  4UUJ C;  2A0L A;  1THZ A;  3SPJ A;  1YJW V;  5B1A B;  3T4D A;  3TK1 A;  5CA3 A;  2MK3 A;  1VQ6 V;  2HG5 C;  5FL7 G;  1S77 D;  1L1F A;  4JAV A;  1P7B A;  4R50 A;  3CCE V;  4UVA A;  3ZRX A;  3CC7 V;  2DQ3 A;  5LHI A;  3D36 A;  1M1K W;  1RM1 B;  2EIL B;  2HLD G;  1W0J G;  1KC8 W;  3OUS A;  1OCZ C;  5B1B C;  4FMT A;  1M57 C;  4MW3 A;  3ASO C;  2QE7 G;  1S0V A;  2OT5 A;  4JTD B;  1FXH A;  1K97 A;  4RUE A;  4Q20 A;  3QO7 A;  5H6R A;  5L3G A;  2W6I G;  1VQL V;  1EZJ A;  1Q81 W;  5L3F A;  4E2L A;  4MVS A;  4MTF A;  1AJP A;  1W0K G;  4LP8 A;  3LDE A;  4DO2 A;  3WFV A;  1G4Y B;  3OUF A;  3FYI B;  1E1R G;  3SYO A;  2LFR A;  5C93 A;  1ORQ C;  4RAI A;  2H94 A;  3LNM B;  2HVK C;  2EZP A;  3ZRV A;  3CC4 V;  4MVZ A;  4WFH A;  3AG4 C;  3CCQ V;  5CBF A;  2R9R B;  2YEV B;  1DF4 A;  2XOK G;  3F7V C;  2ZR3 A;  4GX0 A;  4RO2 A;  5B1O A;  4Z1M G;  1EFR G;  4BIZ A;  1FXK C;  1VQO V;  2EIK B;  2CK3 G;  1GO3 F;  1COW G;  1QR8 A;  5EBL C;  1YSC A;  1BL8 A;  3W7T A;  2OCC C;  3CME V;  1F51 A;  1GTO A;  3P32 A;  3OR7 C;  4PA3 A;  2X0L A;  2AHY A;  4MVU A;  3I55 V;  3ETE A;  1BHA A;  3ZMV A;  4U7O A;  2B1I A;  1H2G A;  3ZMZ A;  3B77 A;  2ITD C;  4XDL A;  4MT8 A;  4P2Z A;  1S76 D;  3ABT A;  4WFG A;  1V54 C;  2IJI A;  4YXW G;  2QTO A;  4HAM A;  5LGU A;  3K04 A;  1PNL A;  4ZBM A;  2XND G;  1KP2 A;  2X6B A;  1PKX A;  3OAA G;  4GT1 A;  2IU0 A;  4X8A A;  2QM8 A;  4PDR A;  3CP1 A;  3RBZ A;  4R6Z A;  2WPD G;  3FB5 C;  1DTO A;  3ABL C;  2QEX V;  3OMA B;  3DGE A;  2WLK A;  4JTA B;  2ZD9 A;  2DYS C;  2WLI B;  2UXN A;  3MHH C;  2ZR2 A;  3FB8 C;  4GCZ A;  2EIN B;  2JJ1 G;  1NKD A;  3CCL V;  1YJN V;  5IY5 C;  1ENV A;  1NR1 A;  3FB6 C;  1W2B U;  3CCR V;  3UKM A;  2XAG A;  3CYO A;  1Q86 W;  1F23 A;  4HYO A;  3F5W C;  4MSW C;  2X6A A;  3W7X A;  5B1B B;  3AG1 B;  5CN0 A;  3T2M A;  3ZN0 A;  3ABM B;  1AI5 A;  1R73 A;  2V7Q G;  2HVJ C;  1K4C C;  5GW7 A;  2XAF A;  2EIJ C;  3OFN G;  4H37 A;  3WG7 C;  4F4L A;  5IDJ A;  2QA4 V;  2EIM B;  2A9H A;  2WLJ A;  3CXC U;  2DW4 A;  4UVC A;  3QNE A;  5EC1 C;  4G27 B;  2P67 A;  4WCE V;  2WWW A;  1SER A;  3JD2 A;  2XAS A;  5KUK A;  1VQ4 V;  1RPO A;  2P6J A;  3X2Q B;  2JIZ G;  5LBQ A;  5CBH A;  2X6C A;  5EK0 A;  3ABK C;  4WFB V;  1PNK A;  2LFS A;  3AG3 C;  2DYR C;  3ZCC A;  3AG4 B;  3OEE G;  1PL0 A;  1R3L C;  3ZRW A;  2OTJ V;  1V55 B;  3OW2 U;  3ASN B;  3ETG A;  1SES A;  1VQN V;  1K8A W;  3K03 A;  3CCM V;  3E8B A;  1FXK B;  1S5H C;  2W0F C;  4J9Y B;  1KQS U;  3TET A;  4HZ3 A;  3OMI B;  4XDJ A;  4N23 A;  4MVO A;  3CD6 V;  1Y66 A;  1VQM V;  1Y4M A;  1VQP V;  1MAB G;  3OEH G;  1YJ9 V;  4FJC C;  1JJ2 U;  1OCC C;  4WFA V;  1K5S A;  3ABU A;  1NVP B;  1JVM A;  4MVR A;  1M9N A;  2WLL B;  4MVM A;  3AG2 B;  2UXX A;  4BW5 A;  1OCO C;  1V54 B;  3B8N A;  2Y69 B;  4QNH B;  1RPR A;  1OCR C;  2YSU B;  4RQF A;  2ZXW B;  2QKS A;  1JCH A;  3E8G A;  1VQ5 V;  3I56 V;  1ZWI C;  5B3S B;  2ITC C;  2WLN A;  5EBW C;  3PJS K;  1F4N A;  1GM9 A;  5LGN A;  2EJR A;  3QO5 A;  4XDK A;  2DWD C;  2C2A A;  2EZO A;  3JD3 A;  2K1E A;  1WLE A;  3ABL B;  1P4R A;  5B1A C;  1S72 V;  2EBO A;  4QPK A;  2HKO A;  5IYC O;  1K92 A;  3T4Z A;  3SYQ A;  1JPX A;  4LBE C;  2PI5 A;  3AEI A;  2ZDI A;  2A79 B;  3K06 A;  1Q7Y W;  1CPY A;  2Q67 A;  3EHB B;  1CP9 A;  1XL4 A;  3D3I A;  1RM1 C;  1PNM A;  4UV8 A;  3EFF K;  3MD0 A;  5H9C A;  2P90 A;  1NBM G;  4FIP C;  4KFM A;  3CC2 V;  2V1D A;  2IW5 A;  1QVG U;  3SYP A;  1B6Q A;  2Z5U A;  3JD0 A;  1M56 B;  1CEZ A;  2IU3 A;  3TCU A;  1F4M A;  3F7Y C;  3R65 A;  3ZN1 A;  1GM7 A;  2PI4 A;  3K9A A;  3OMN B;  4KUM A;  4WFE A;  4QJF B;  1VQ7 V;  4KP4 A;  1DF5 A;  1G8M A;  1R3K C;  2HR3 A;  2IJJ A;  4L87 A;  1QLE B;  3K08 A;  3E89 A;  3CMA V;  1K33 A;  1KEC A;  3ETD A;  1HWY A;  2EIJ B;  1K7D A;  1SET A;  3ZMS A;  2ATK C;  2IJH A;  1GK9 A;  4TT3 G;  1AR1 B;  1OZ0 A;  1XL6 A;  2YEV A;  4QIW F;  5DN6 G;  3UM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...