2P7TC

Crystal structure of kcsa mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVSTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p7tC00
4MSWC 3GB7C 4MVZA 4MTFA 4MVOA 3SYAA 2EIJC 5KUMA 2WLLB 2QKSA 3SPHA 1V55C 2HJFC 1OCRC 1M57C 1G4YB 2HVJC 2Y69C 4JTDB 2KB1A 3AG3C 3BEHA 4DXWA 2NLJC 4BW5A 4PA7A 2WLKA 1JVMA 3LDDA 2WLIA 4MVSA 3E86A 3LDCA 3F5WC 4HYOA 4PA6A 2A9HA 3ZRSA 2BOBC 5B1AC 3SJQC 5KUKA 1K4CC 4J9ZB 3RW0A 4R50A 4QNHB 2IH3C 4MTOA 4G28B 4ZBMA 4JTCB 4LBEC 2ITCC 4P9OA 3OGCC 4X88A 1ORQC 1K4DC 1LNQA 4LP8A 1XL6A 2X6AA 4XDJA 5EBLC 2WLIB 3TCUA 4MW3A 4RAIA 2ZXWC 2A79B 2ZD9A 2JK5C 1V54C 2Q6AA 3RVYA 2Q68A 3T1CA 4P9PA 3T4DA 3K08A 4P30A 1XL4A 4X89A 3UM7A 3VOUA 4F4LA 1OCOC 1OCZC 3AG1C 5E1AC 2EIMC 1BL8A 2WLJA 2DYRC 3FB5C 4PA4A 4EKWA 2AHZA 3IFXA 4OXSA 1R3JC 2EINC 4GX0A 4J9YB 4WFGA 5J9PC 2WLMA 3E89A 1M56C 1OCCC 4PDMA 3E83A 1ZWIC 4MTGA 2ATKC 3R65A 4XDLA 2A0LA 3T4ZA 3FB6C 5B3SC 1P7BA 5EBMC 2DWDC 5EC2C 5IY5C 3SYOA 3ZJZA 4MVMA 4GX5A 2QTOA 3EFFK 4MVQA 4CBCA 4H33A 2EILC 4PA3A 4MVUA 3OR6C 3SPIA 4GX1A 2DYSC 3ABLC 4PDLA 4RO2A 4RUEA 4PA9A 4TWKA 4MVRA 3F7YC 4WFHA 2AHYA 2IH1C 3LDEA 4R6ZA 4R7CA 1QLEC 2H8PC 3STZC 3K04A 1R3IC 3UKMA 4WFFA 4X8AA 3SYPA 3K03A 5CBGA 2HG5C 3TETA 3FB7C 3T2MA 3JYCA 3STLC 3K0DA 2EIKC 3K06A 5B1BC 2R9RB 5CBFA 3OUSA 4JTAB 3ASOC 3OUFA 3ASNC 3PJSK 4QE9A 3X2QC 2Q67A 3E8BA 1KKDA 2OCCC 2W0FC 5BZBA 5EBWC 3KG2A 4H37A 4I9WA 3LNMB 3E8FA 4MW8A 1J95A 2BOCC 3SPJA 3F7VC 2DWEC 4MS2A 3ABMC 3AG4C 3HPLC 2X6CA 4PDRA 3SYCA 4QE7A 3K0GA 2P7TC 5CBHA 5EC1C 2HVKC 3ABKC 2YEVA 4G27B 2ITDC 4XDKA 3RVZA 3SPGA 4PDVA 3E8GA 1R3KC 4HZ3A 1S5HC 5EK0A 2X6BA 4R8CA 4P2ZA 4RUFA 3WG7C 1R3LC 3E8HA 3AG2C 4LCUC 3SYQA 4WFEA 3SPCA 2Q69A 3OR7C 2WLLA 3IGAC 2WLNA 2K1EA 4GX2A 2HFEC 3FB8C 4KFMA 3LUTB 3RBZA 4UUJC 2WLHA
chains in the Genus database with same CATH superfamily
2HHHO 4MTFA 2P5OA 4CC5A 2YXYA 3AK1A 2WLLB 3G80A 3J80N 4DR2B 4JAAA 1V9PA 4J11A 4LF6B 1O9HA 4BW5A 1LUWA 4JI7O 3K59A 3KZIZ 1QU7A 2YUAA 3ABKB 1YTFD 1IXBA 2DQ0A 4LF8B 4X88A 2PI5A 4FIPC 4X62B 2QWNB 4CH3A 1L0NH 2JK5C 3RVYA 4P30A 4Z1VA 4JYYA 3QG5A 5E79Z 2QE7G 1KQSU 2F93B 1Y67A 4JI8O 5JJJB 2OCHA 4DR7O 1VQNV 1TVKB 1VMGA 3CCUV 4JYBA 2QTSA 1EBOA 1FXKC 5JVDB 1N8RW 4KHPB 1JR9A 5LYJB 3ABTA 3K04A 2LFRA 4I4TA 4GKJB 1F23A 2ZQMA 1MZFA 3JSNA 2VQEB 1QVGU 1XOUA 1BHBA 4JI0O 2EIKC 5KX5B 1VEWA 3OTOB 1YI2V 2DYRB 4IGGA 3X2QC 1RPOA 1EM1A 1M56B 1OCCB 2E5LB 3JD4A 4MS2A 2HR3A 3WU2Z 1MSDA 4F6RB 2A3QA 4HAMA 1G1XB 4FLXA 3O9OA 5A2QN 2XHBA 3WG7C 3A0BZ 2PYLA 3RN4A 3D36A 3ETGA 1IZ3A 1SA0B 4LFAO 3L75H 5CA0A 5JWPA 4IHJA 2UUAO 1BT8A 2WLHA 2E74B 3B09A 3B4SA 4X1IA 3K58A 2W6IG 3JASA 3VQVA 4K35A 4DR5B 2LFSA 4MVSA 4DV2O 4DV7O 1WP7A 2LGQA 5CA1B 2QWOB 2YSUB 3JAKA 1FYJA 1E1RG 2G38A 4X66O 1K4DC 5BR8B 2XAFA 2ZXWC 3NR7A 2EZOA 5JCOA 5JJNB 1QQCA 5IDJA 4LFBB 4KL1A 4GX0A 1Q90D 3FX7A 4JAVA 4B3MB 1N32B 1NR1A 1UFIA 4YHHO 3RYHB 3T1HO 2GDSA 3SDLA 1N34O 3JALA 3U0ZA 1VF7A 3L9DA 4AI8A 3CCLV 3DXRA 4H33A 2P4VA 4TT3G 4MVUA 4DV5B 1NKDA 3ABLC 3ZRXA 4O4HA 3RWRD 3ETEA 3DGEA 1THZA 2Y0PA 3K57A 1QBZA 1EN5A 4J7JA 3NXSA 2OT5A 4TUYB 2OYQA 4JV5B 3TETA 3N2GA 2XASA 1HNXO 3K0DA 4LR3A 4WCEV 5LP6C 4QE9A 4JI1B 4RQFA 2HP8A 2OCCC 2W0FC 3CCVV 4I7ZB 4B3TB 4YIOA 1SKVA 3WB0A 4DV6B 2DWEC 4C7UA 4DRXB 3T1YO 3ZHQA 2ZM6B 1GH6A 2UU9B 2IJKA 2OTJV 2JEUA 4B08A 3W7XA 1EN4A 5IYZA 3TK1A 3CD6V 1SQFA 1QLEB 5DEDA 5KHJA 4DR1B 1H2LA 1ENVA 4DV4B 4TQFA 3VQYA 3MD0A 1SQQH 1FS0G 1G4YB 1JJ2U 5LGUA 3AG3C 3BEHA 3K3WA 4BIZA 3QO7A 1XMOO 1P84F 5LHHA 4DR2O 2ETNA 3E22A 2XAJA 4QGPA 1U96A 1PNMA 3B2EE 1Y76A 3P3PA 1NU1H 1VQ8V 2WLIB 4FVMA 3ML0A 1BHAA 1GAXA 3QVNA 4ICGA 1AI7A 2Q6AA 2P67A 1XL4A 1TGOA 4LF8O 2PZSA 2WA4A 2LO1A 2IM9A 3OGIB 4WFGA 3E89A 3CYOA 2M6YA 3C3TA 2YIAA 3GWOA 1S5JA 3OMAB 4YJ3B 3OM3B 1XNQO 2Q5ZA 3FAVA 1KKCA 4KP4A 4I55B 5LOVA 4OGQB 3Q4HB 2IH1C 1WA8B 5JQGB 4FZ1A 5KHGA 1ZX3A 2DE0X 5K1XA 3CXCU 4X8AA 3GWKC 2MW2B 4DK1A 1XBLA 4IT5A 4LH7A 3OUSA 4JTAB 4GKJO 4I50A 3B8MA 2EINB 4CH6A 4I9WA 4DV0O 1K8AW 4DUYB 3TXSA 1XNRO 1KC8W 4X20A 3HPLC 2JDIG 2V1DA 3ZMVA 5CBHA 2IJIA 4GT1A 2CGOA 1KP2A 1CP9A 4K8ZA 3RYFB 1XMQO 3BY6A 1IBLO 1SF9A 2F66C 2RNBA 1YJ9V 1Q5OA 3ZBHA 3MHHC 1AROP 4LWSA 3JD0A 2H94A 1IDSA 4FLTA 5JCOC 1VQMV 1M5IA 1AR5A 2ZT9B 1S72V 1US6A 1VQLV 3G71V 3ZS8C 3HKDA 3JD1A 5H5NA 1R73A 2HHHB 2UUCO 3QO8A 4R50A 3APQA 4UB8Z 2V4DA 1I0HA 5LA6A 2ITCC 1G6UA 1YVWA 5LXTB 2RJZA 2X6AA 1R1BA 5HFMA 2ZD9A 4H13B 1V54C 1R6NA 4JI7B 4PI2A 4ZI7B 4UVBA 2FL4A 1N33O 1YEWA 4O2BA 4LFCO 1COWG 3E83A 1FXHA 2YI9A 4Q20A 4B3SB 1D2DA 4PV1B 2UXXA 1IBKO 2JGDA 2ZDIA 4NXNB 4DO2A 1PM9A 3SPIA 2DYSC 2Q7GA 5KAFZ 3N2KA 3H1IH 4PELA 1MG1A 1N4CA 1JFFB 4JI8B 4DR7B 3FYIB 1SQPH 1B04A 1OCOB 3OUFA 1N0NA 2ZINA 1B3QA 1IVSA 4TV9A 1K34A 1KYOF 4MW8A 1JX9A 4DV1O 2X6CA 3OMIB 3E2EA 4XDKA 5ITZA 1Y6XA 4B3TO 4WFEA 3SPCA 1S77D 2UXNA 5IWAO 3JCZA 2UU9O 4FZ0A 4ZOLA 4TV8B 3RT3C 1P49A 3BA9A 2H3OA 4XBFA 1ZSPA 1NH2D 3CCMV 1FXKA 5L3GA 3CJHA 4U7NA 4DUZO 1NTKH 3JATB 2KSDA 4WFBV 1AR1B 3K9SA 5EIBC 1YZBA 1NVPD 5L3BA 1EN6A 2QM7A 3ZIAG 4XDJA 3ICXA 1NQTA 1MA1A 4X1KA 3CSXA 1OV9A 4DV2B 4AQYO 2EIMC 3L73H 1F7YA 1AJNA 1XDCA 4PDMA 1SERA 4B7EA 4X66B 3VQWA 4LF9O 1L8DA 3FB6C 3L72H 2Y69B 1WLEA 3ZJZA 1YJNV 5IYCO 1NT2B 2WSSG 1CPYA 2XAGA 2CTRA 4PA9A 2UXCB 4R6ZA 1D5NA 4J80A 2BTOA 3T1HB 2QEXV 1DGSA 3CCSV 1OZ0A 3JARA 2UXBB 2OTLV 1PP9H 1ZTEA 1RP3B 2QWQB 4BIUA 1K92A 2RCVA 2PUSA 3AG1B 5H2FZ 4A5UB 2YICA 3DC6A 3CXHF 1L1FA 3TJTA 5J2TA 2BOCC 4NVPA 4JYAO 3SYCA 1AILA 5LHGA 5IYBO 1NR7A 3SPGA 3ZN0A 2QWPB 1TA8A 4GKKO 4JI2O 5EYPB 1S5HC 3HKCB 2C2AA 1SETA 4UXNA 3D3QA 1N36O 3AK3A 2WLLA 4U3JB 4KXRA 1JA8A 3UCSC 1ZL8B 2VQFB 3K79A 4DXWA 2ILMA 4QPJA 1M4UA 5L3FA 3P3NA 3S3WA 3ZHRA 2KB1A 2Q7HA 4K3AA 2E76B 1E1QG 3E86A 4O2AB 2RQ6A 4LF7B 4HNAB 1I94O 2JGUA 4FPPA 1LNQA 4J42A 1PPJH 1NS1A 1ZAUA 1SQGA 4GYCB 1YITV 2K9PA 3CHXA 1H2MA 1H2KA 1S5LZ 3M8AA 5KUKA 3ZEDA 1XMOB 2CAZC 1TVKA 1RSOB 4OXSA 2UXDO 4J9YB 1XILA 3H01A 2AW9A 4NXMO 5JVDA 3A0HZ 5CN0A 5LYJA 1QNMA 2FYUH 5EBMC 1W0JG 4I5SA 3ETDA 4G2KA 2JJ1G 3C90A 2F43G 1I08A 1AP5A 1AJPA 1MABG 4O4IB 4PDLA 4X1YB 5KX5A 4B3SO 3CCEV 3JAWB 1FD9A 4NXNO 3JCUZ 1P7GA 1DK1A 3CCRV 1XNQB 2GTSA 2L6LA 1Q8IA 4F6RA 3ASNC 4FK5C 3THOA 1M57B 2Q9LA 1CXZB 3N27A 2X0LA 3HKBB 1RM1C 1GN6A 2BE3A 5IE9A 1DTOA 2ZE7A 3I56V 3AG2C 2ZE6A 4LCUC 4O4JB 4DV0B 5H6RA 5GW7A 1XNRB 4H44B 4JGSA 2YEVB 5K1PA 3FB8C 1ZUQA 4BW9A 1FXVA 4KFMA 1J5EO 2CTPA 2ZIOA 1AI4A 3SJQC 5KHKA 3GB7C 3IC7A 3UO3A 5BY1A 5CA1A 1JMKC 2W6JG 3M7MX 1XMQB 1XQ8A 1IBLB 4I0XB 5IY5B 2Y0IA 5HFLA 1AR4A 2VRZA 5GTHZ 1KBHA 4HYOA 5KA6A 1GTOA 4QNHB 4G28B 3JD2A 4N21A 2Q7EA 3ABUA 4LF4O 4E4EA 5B66Z 3RYHA 3O65A 3ZMZA 1X4TA 3VOUA 1O9GA 2ZR2A 2UUCB 2AGAA 2QKAA 5D5PA 2XOKG 3FYEB 2O57A 3ZHSA 4YJ2B 3A8TA 5KHIA 1SS3A 3RGBA 1Y74B 4MVMA 4TUYA 3RFRA 4CBCA 2ZE8A 3CRRA 1LR1A 4GX1A 5J2UB 3CP1A 3B77A 1CEZA 1N33B 4RUEA 1IBMO 4MVRA 4WFHA 4LFCB 3ZRWB 4DYLA 2HLDG 4IYIA 1M9NA 1SQXH 3EXAA 2UXCO 1YTFB 3H9VA 1IBKB 1VF6C 1TAEA 1P4RA 4DRXA 4DR6O 3H1LH 4OPHA 2UXBO 4E2LA 3TXQA 3HKEB 3ZRVA 5B1AB 2P7TC 3ABKC 2RMKB 1VQKV 2EILB 3QTCA 1K97A 5L3DA 1A32A 4Q6GA 4X1IB 1URFA 3IGAC 4DV1B 4LC1A 1FFXA 5FPOA 4L87A 3SYAA 4IIJB 4OX9O 3WFVA 1M57C 2VQFO 5EIBD 2QA4V 5DM6V 5IWAB 1XI1A 2WLIA 2CH7B 4CS3A 3ABMB 2WAMA 2XT9A 3UO2A 2AXTZ 4B3RO 3OGCC 5CB4B 5IJ9B 4DUZB 1B06A 2Y4TA 3TCUA 3SJBC 3JALB 4LF7O 3G67A 3UM7A 1AP6A 4YJ3A 5JH7B 2DYRC 2WPDG 3IFXA 5DN6G 4I55A 4CS4A 1R3JC 2XNDG 1M56C 1PV0A 1H8EG 1OCCC 3Q4HA 1OJHA 2ATKC 3R65A 1P7BA 5IY5C 1H8HG 3IAYA 2DJVA 4PA3A 1YHQV 4AQYB 4FM1A 3L70H 2QWRB 2LQTA 3KKYA 2DMXA 4JF3A 1Q81W 4LF9B 1Y4MA 3T2MA 1AI5A 4EFEA 5GONB 1NJIW 3E35A 4IL6Z 5BZBA 2DOSA 3SGIA 3ZHTA 2FMLA 3RYFA 5IJ0B 1Z5VA 4AHCA 5C8YB 2GTAA 2YIDA 2DN9A 4ZHQB 1K9MW 2CE4A 2IBZH 2JEXA 3R66A 4HZ3A 2ADPA 1TUBB 4NYKA 4RUFA 1FAFA 3LSQA 1EZVH 3CC7V 1X59A 2XAQA 1H2GA 2P22C 3ZHUA 2ZR3A 4JYAB 4GKKB 4JI2B 5JJEB 5KUMA 5B1BB 3ASOB 3SPHA 5C93A 3U10A 2QKCA 1XUQA 1N36B 3UQ8A 1HNWO 1XHXA 5LXTA 1JVMA 5H9CA 2FKXA 3LDCA 3AG4B 4DR4O 4PA6A 5B1AC 4ZI7A 4LBEC 1IXMA 3G6EV 4FLWA 3CMEV 4DW0A 1ORQC 3ZMTA 5LMUB 1VARA 1H38A 2E3CA 4UCOA 3BABA 1W0KG 3L74H 4PA4A 1VQ5V 2B1IA 2Y4UA 3L71H 3D8CA 1I94B 1WPBA 4N23A 4UVCA 2EIJB 2EULA 4AILC 5CMUA 1XREA 3OAAG 1V55B 1Z5WA 1OCRB 3LNNA 3UT5A 1F4MA 4MVQA 2PTMA 1JFFA 3QNEA 1ZLZA 1R6TA 1FKAO 1NBMG 4ABMA 2LW7A 2LW1A 1IURA 5LL6Y 2UXDB 3CRCA 3F7YC 3G6BA 1QLEC 1QVFU 3K5OA 3J7AU 5KMGB 4NXMB 3UKMA 4OPAA 4UCTA 2BSKB 1Q6UA 2X7RB 2WA3A 1GN2A 1I5YA 5L3CA 3F5TA 3A0RA 2N05A 3TGUH 4BR6A 1SESA 1WNSA 5BMVB 1K5SA 3CEIA 5EBWC 1PD3A 3ZMSA 3F7VC 4PDRA 1EFRG 4BIOA 3BRCA 4PDVA 5EK0A 1BGYH 3CS5A 1HDJA 4K0KO 3SJAC 4GLXA 2BTQB 3JATA 2KKWA 4D7SA 4MSWC 4MVZA 4UV8A 4FLVA 5F2VO 3LSSA 1NI8A 4WBNB 5FL7G 2WLKA 4J7ZA 2N74A 3CPWU 1J5EB 4PHZA 1K4CC 2IH3C 3ZMUA 3DC5A 4O2BB 2JS5A 3OEEG 1XL6A 5EBLC 1HW7A 4O4LB 1T5EA 1BL8A 1FJGO 4DV3O 3ZHVA 2EBOA 4GZRB 2EINC 5J9PC 2WLMA 1JOYA 5KLVH 4MTGA 4LF4B 3T4ZA 4XDLA 3LSUA 2L35A 5EC2C 2D2CB 3SYOA 2FB5A 2B1GA 2KG7A 3BCCH 3QO5A 2HJDA 2E75B 3CX5F 3EHBB 1PL4A 2MK3A 2Z3YA 4WFAV 4WFFA 1YCIA 3CRAA 2FTKA 1GN4A 1WP8A 3STLC 3K5MA 1NZ6A 1IBMB 5ITZB 4PJ0Z 3I55V 1K73W 5EYPA 3HKCA 2W0XA 3SPJA 4UVAA 3VQXA 3K0GA 2LJ2A 4U3JA 4EB6B 1U97A 2HVKC 4G27B 4LH6A 4DR6B 2ADQB 4J41A 1MMMA 1ZL8A 4R8CA 2AZ0A 3E8HA 1W2BU 1FXKB 3CJHB 1HWYA 4JI5O 4FFBB 3OW2U 2HFEC 3OE7G 1SQVH 2VS0A 3RBZA 1QR8A 1PNKA 2EIKB 3OFNG 2Q4PA 3X2QB 4HNAA 2JJ2G 1OHHG 3RYCB 1Q43A 4PI0A 4W4LA 1VF6A 1F4NA 4J9ZB 3CCJV 2ZE5A 1LUVA 1VQ6V 1RSOA 3WG7B 4OX9B 4FFKA 5A9GA 4B7KA 4RAIA 1Q82W 1XEQA 3W7TA 4JAUA 2Q68A 3T1CA 4P9PA 1OCOC 1FPOA 4CZZA 3FB5C 1SRYA 5LMUO 3H1HH 2A06H 4JI3O 4B3RB 4X1YA 4UCSA 3JAWA 2DWDC 1NH2B 5FLXN 4GX5A 3EFFK 3JARB 2GHYA 4TWKA 1YIJV 1XHZA 1JCHA 2H8PC 3STZC 1GMGA 1HP8A 1MNGA 5B5EZ 2RDCA 3AG7A 5CBGA 3FB7C 2ZXWB 2NN4A 3HKBA 2R9RB 3OMNB 2Q67A 3E8BA 2GUZB 2Y48A 1RPRA 3LNMB 4O4JA 3WB2A 3ZX6A 1H2SB 4QE7A 2KQXA 2B9ZA 4TSFG 5EZYB 2YEVA 3RVZA 1BE3H 4DK0A 1S76D 3ABLB 5FNVB 4D7TA 4LNUB 4I0XA 1OCZB 2EX3A 1JPXA 5DECA 2IJJA 2QM8A 1BS3A 2JS3A 5LP6B 1SA0A 4JTDB 2Y69C 2OCCB 5AG2A 2PYJA 3BHPA 3RYIB 4JI4O 1Q6HA 2A9HA 1KU9A 3IJ4A 5KAIZ 5FPRA 1HNWB 1F51A 4YJ2A 1WN7A 3T4DA 3AG1C 2WLJA 4DR4B 3U11A 1Y74A 2AHZA 1G8MA 2OIEA 4IYHA 1GO3F 5J2UA 4YY3O 5TISZ 1D5AA 1BCCH 2EJRA 3ZRWA 1KP3A 2Q73A 4NTWA 3AG3B 2XTAA 1KD1W 3OT7A 4R7CA 2R9IA 5B1NA 2RN9A 5LGTA 1SQBH 4Z1MG 1DF4A 4QPKA 4X64B 4X65O 3H1KH 3JYCA 3AK2A 2JVDA 3HKEA 2N04A 1FFTB 3AEIA 1UJWB 2ZNJA 4I4TB 4NTYA 2LGWA 1RFYA 1AJQA 2ZCEA 3K9AA 2IU0A 3PN1A 4DW1A 2PF4E 1VIBA 2DW4A 1R3KC 2QM4A 2X6BA 3BA8A 2ODMA 2IU3A 4IIJA 2WLNA 4GX2A 1NTZH 2P6JA 3CWBH 2QDOA 1GM7A 3H1JH 4CS2A 2CH7A 1KMIZ 2F95B 1TUEB 2D3OW 5LMNO 5CA0B 2HJFC 1L0LH 1R6KA 4IHJB 2WWWA 3W7UA 4YIPA 2QGNA 1Q6IA 4K0KB 2P06A 5CB4A 5IJ9A 2PGGA 3EVKA 4JPRA 3CE2A 3P30A 1QR9A 1JQ0A 2BOBC 2YI8A 2A7WA 1BZKA 5JH7A 4JTCB 2IJHA 4LF5B 3JASB 4LP8A 1YXBA 2PI4A 3K08A 4X89A 3JAMN 3JAKB 1OCZC 3FKSG 2ZKOA 1WAZA 1Q7YW 1HR0O 4PD4F 1E79G 3KCYA 1VF5B 1GRJA 2OWOA 1K5QA 2OIGA 5LHIA 3K5NA 1FJGB 4DV3B 4RO2A 1GKFA 3BFRA 4CC6A 5GONA 2GV9A 1M1KW 4UV9A 1GK9A 2B5UA 1HNZO 3DXRB 2CTQA 3SYPA 4FM2A 5IJ0A 1IX9A 2HG5C 4CH4A 5C8YA 1M90W 4FLZA 1V54B 4O4HB 4ZHQA 5KHHA 1WA8A 5JQGA 3WB1A 1TUBA 4GUNA 2BCCH 3KG2A 3CRMA 3N2GB 4DR3O 1AB3A 3GVMA 2R9AA 4J10A 4EEQA 4JI6O 1YF2A 1Z2GA 2ITDC 4Z2WA 4YXWG 2F1MA 3E8GA 3VBBA 2UUBB 1B6QA 1FFXB 2DYSB 4JYCA 4UFZA 2Q69A 4LF6O 4UCRA 3CC2V 4GCZA 4ZKIA 2Q0OC 4RWUA 1K7DA 2ARHA 2YDEA 2CGNA 4NKGB 5IYZB 2M7WA 4RQEA 2P90A 4ZIBA 2QKSA 2Z0AA 4JI5B 4W4KA 4X62O 3HB3B 1Q3EA 2CK3G 1WB8A 3F5WC 3BAAA 1BMFG 1Q86W 1NTMH 4ZBMA 3CC4V 1M93A 3D3IA 4P9OA 3IC9A 1EZJA 3K5LA 2EZPA 2A79B 2XAHA 3P32A 1QLNA 4KUMA 3E22B 5E1AC 1DF5A 3OTFA 4BAYA 2DQ3A 4QIWF 2F4VB 1Y76B 4KHPO 3D36C 2QSAA 3ETQA 3ZN1A 1DLBA 2A0LA 2CDYA 4FJCC 2YS8A 5IYDO 4EFBA 5KMGA 2VQEO 2QTOA 2EILC 2BSKA 1SZTA 3MHSC 3OTOO 5D5QA 2NR5A 2CTWA 4JI3B 5BMVA 3FAVB 1VQ9V 4MTXA 2HEPA 4FMTA 2E5LO 5LOVB 2Q8VA 3I5DA 1GM9A 3W7WA 2PY5A 3B40A 2EIMB 3PJSK 4X64O 4H37A 3ABMC 1PL0A 3A2FA 5B1OA 5L3EA 2IW5A 2VWJA 5EC1C 2BTQA 4I50B 4K8XA 5H6QA 1QCEA 4TQDA 1WJZA 4X20B 3OR7C 4QJFB 4FLUA 5B3SB 4WBNA 4DR5O 2K1EA 2Z5UA 2GSMB 4MVOA 2R70A 3HR0A 4BWAA 1YDXA 2HVJC 5BR8O 4TV8A 1MSWD 2Q0AA 4WF9V 4ASUG 4MT8A 4LWSB 4LFBO 4O4LA 2JIZG 3RW0A 4MTOA 4B3MO 1N32O 2P4KA 3HKDB 1S3JA 3UT5B 4JI4B 2YIBD 1QHTA 4LF5O 4X9QA 4DV5O 5LA6B 3MAQA 1PKXA 2YC0A 3JSLA 4NTXA 2ZNIA 1ZWIC 2QR4A 1BQZA 4JV5O 1AVMA 4UCUA 2AZ2A 1VQ4V 1S0VA 3APOA 3OR6C 1SZXA 4JI1O 4YY3B 4JI0B 3FD9A 4I9QA 4DV6O 2JGDB 4JZ2A 1ROPA 3CRQA 2XUMA 1JJOA 4JZGA 4NR1A 2ZM6O 3K06A 5B1BC 3N2KB 4EB6A 3BPZA 1MZEA 3ASOC 1AI6A 5BXZA 3KCXA 5LBQA 3AG4C 2CUGA 4FFBA 4X65B 4DR1O 4CH5A 4H0LB 3FFQA 4DV4O 4FM0A 4LFAB 4NB5A 4TV9B 1K33A 1BQ0A 4P2ZA 2UUAB 2YIBA 3SR2C 1KB9F 2JRIA 2UUBO 3DTUB 3MDSA 1W59A 3RYCA 3LUTB 3B8NA 4UUJC 1KECA 4UCVA 2EIJC 4DV7B 3ASNB 1V55C 3CMAV 1OCRC 2HKOA 4ZOLB 1VQPV 2NLJC 4PA7A 3DSQA 3LDDA 4J7KA 3J81N 2NNUA 3G4SV 3ZRSA 1RM1B 1I5XA 5GTIZ 4FLYA 5LMNB 3SJCC 3AG2B 1VQOV 1I7FA 3BVOA 4MW3A 4U3FH 3QF7A 4O2AA 1YSCA 5B3SC 4YHHB 1VP7A 2YXLA 4F4LA 4EKWA 1N34B 1YJWV 2R72A 2GBOA 4UB6Z 3CB2A 2KG7B 2V7QG 2F23A 4X1KB 4HBNA 1KUQA 3ZCCA 1K3EA 2F4VO 5KA5A 1WB7A 4U7OA 1HR0B 4TOIA 2AHYA 3LDEA 5IT9N 1MOFA 1HNXB 2LP7A 3CCQV 3JD3A 4DUYO 4D6TH 1R3IC 2GUZA 3K03A 1WPXA 4O4IA 2VWKA 3C3SA 1Y66A 5CBFA 3M99B 5EZYA 3OEHG 3T1YB 1KKDA 2ZIMA 3OD4A 4JASA 4L8JA 3E8FA 1J95A 1HNZB 3S3XA 1H2NA 5FNVA 4LNUA 1PNLA 1NVPB 1GM8A 1BSMA 1R3LC 5J2TB 1VQ7V 3W7SA 3SYQA 4F6EA 1UPGA 2QJ1A 4DR3B 5LP6A 1GN3A 2EJ7A 1SC5B 2ZDIC 1N0JA 4JI6B 3RYIA 5CA3A 5LGNA 2YXHA
chains in the Genus database with same CATH topology
4MTFA 1NH2D 1TUEB 2D3OW 3CCMV 1FXKA 5L3GA 5KUMA 5B1BB 2WLLB 3ASOB 3SPHA 5C93A 2HJFC 1R6KA 4U7NA 3W7UA 2WWWA 4WFBV 1AR1B 4BW5A 1JVMA 5H9CA 4JPRA 3LDCA 3AG4B 3P30A 4PA6A 1QR9A 1JQ0A 1NVPD 2BOBC 5B1AC 5L3BA 3ABKB 1YTFD 2QM7A 2IJHA 4JTCB 4LBEC 1IXMA 3G6EV 2DQ0A 3CMEV 4X88A 3ZIAG 1ORQC 3ZMTA 4LP8A 2PI5A 4XDJA 4FIPC 1H38A 1NQTA 2JK5C 3RVYA 2PI4A 3K08A 4P30A 4X89A 1OCZC 3FKSG 1W0KG 2EIMC 4PA4A 1Q7YW 1VQ5V 1AJNA 2B1IA 1E79G 2QE7G 4PDMA 1SERA 4N23A 4UVCA 2EIJB 1KQSU 3FB6C 5CMUA 3OAAG 1V55B 1OCRB 2Y69B 1K5QA 1WLEA 3ZJZA 1YJNV 1VQNV 1F4MA 4MVQA 5IYCO 5LHIA 3QNEA 3CCUV 4JYBA 2WSSG 1NBMG 4RO2A 1CPYA 1GKFA 2XAGA 4PA9A 1EBOA 1FXKC 3F7YC 1N8RW 4R6ZA 1QLEC 3ABTA 1QVFU 1M1KW 4UV9A 3K04A 2LFRA 1GK9A 2B5UA 3UKMA 1F23A 2QEXV 2ZQMA 3SYPA 3CCSV 1OZ0A 2X7RB 2HG5C 2OTLV 1QVGU 1I5YA 1M90W 5L3CA 1BHBA 1V54B 3A0RA 2EIKC 4BIUA 1K92A 3AG1B 1SESA 1YI2V 2DYRB 3X2QC 1K5SA 1L1FA 5EBWC 1RPOA 3KG2A 1M56B 1PD3A 1OCCB 2BOCC 3ZMSA 3F7VC 3JD4A 4MS2A 2HR3A 4PDRA 3SYCA 1EFRG 5LHGA 4HAMA 5IYBO 1NR7A 3SPGA 3ZN0A 2ITDC 4PDVA 4YXWG 3E8GA 3VBBA 1B6QA 1S5HC 2C2AA 5EK0A 1SETA 3WG7C 2DYSB 4UXNA 3D36A 4JYCA 2Q69A 3ETGA 2WLLA 3CC2V 4GCZA 4ZKIA 5LGNA 1K7DA 3K79A 4DXWA 2WLHA 4MSWC 4MVZA 4UV8A 4QPJA 2M7WA 3LSSA 2P90A 5L3FA 4RQEA 2QKSA 2KB1A 5FL7G 3HB3B 2W6IG 2WLKA 2LFSA 1E1QG 4MVSA 3E86A 2CK3G 3F5WC 3CPWU 1BMFG 1K4CC 2YSUB 2IH3C 3ZMUA 1Q86W 1E1RG 4ZBMA 3CC4V 3D3IA 4FPPA 4P9OA 1LNQA 1K4DC 3OEEG 1XL6A 1EZJA 5EBLC 1YITV 2EZPA 2XAFA 2ZXWC 2A79B 2XAHA 3P32A 1QLNA 2EZOA 5KUKA 4KUMA 5E1AC 1BL8A 5IDJA 1DF5A 4BAYA 4OXSA 2DQ3A 2EBOA 4QIWF 2EINC 4J9YB 4GX0A 5J9PC 3H01A 2WLMA 4JAVA 1JOYA 1NR1A 3ZN1A 4MTGA 1DLBA 4XDLA 2A0LA 3T4ZA 4FJCC 5CN0A 5EBMC 5EC2C 5IYDO 1W0JG 4I5SA 3SYOA 3ETDA 4G2KA 2QTOA 3CCLV 2JJ1G 2F43G 4H33A 2B1GA 4TT3G 1MABG 1AJPA 2EILC 4MVUA 1SZTA 3MHSC 1NKDA 3ABLC 4PDLA 3ZRXA 3QO5A 3ETEA 3DGEA 1THZA 3EHBB 3CCEV 1QBZA 3NXSA 2MK3A 2OT5A 2Z3YA 1VQ9V 4MTXA 4FMTA 4WFAV 4WFFA 2FTKA 3TETA 3CCRV 1GM9A 3W7WA 2XASA 3STLC 3K0DA 4WCEV 2EIMB 3ASNC 3PJSK 4FK5C 4QE9A 1M57B 4RQFA 3I55V 2OCCC 1K73W 2W0FC 4H37A 3CCVV 2X0LA 3SPJA 2DWEC 3ABMC 1PL0A 5B1OA 4UVAA 5L3EA 2IW5A 3K0GA 1RM1C 5EC1C 2HVKC 4G27B 1DTOA 2IJKA 2OTJV 4R8CA 5H6QA 3I56V 2JEUA 1QCEA 3E8HA 1W2BU 3AG2C 3W7XA 4LCUC 1FXKB 3TK1A 3CD6V 1HWYA 3OR7C 4QJFB 5H6RA 5GW7A 5B3SB 1QLEB 4JGSA 3OW2U 2YEVB 2K1EA 2HFEC 3FB8C 1FXVA 3OE7G 4KFMA 1ENVA 2Z5UA 2GSMB 3RBZA 3SJQC 1AI4A 1QR8A 3GB7C 3IC7A 4MVOA 3MD0A 1PNKA 2EIKB 2W6JG 3OFNG 1FS0G 3X2QB 1G4YB 2HVJC 5IY5B 1JJ2U 2JJ2G 1OHHG 3AG3C 5LGUA 3BEHA 1MSWD 3K3WA 4WF9V 5HFLA 4BIZA 3QO7A 4ASUG 4MT8A 4HYOA 5KA6A 5LHHA 1F4NA 2JIZG 1GTOA 3RW0A 4J9ZB 4QNHB 2XAJA 4MTOA 4G28B 3CCJV 1VQ6V 3JD2A 4N21A 3WG7B 1PNMA 3ABUA 1VQ8V 2WLIB 3ML0A 1BHAA 4RAIA 1Q82W 3ZMZA 3W7TA 1AI7A 2Q6AA 2P67A 4JAUA 2Q68A 3T1CA 4P9PA 3VOUA 1S3JA 1XL4A 2ZR2A 1OCOC 4CZZA 3FB5C 1SRYA 4WFGA 3E89A 1PKXA 2XOKG 3CYOA 3FYEB 1ZWIC 3GWOA 3OMAB 3OM3B 2DWDC 1NH2B 4MVMA 4GX5A 4KP4A 3EFFK 4CBCA 1VQ4V 1S0VA 3OR6C 2GHYA 4GX1A 3CP1A 3B77A 1CEZA 4RUEA 4TWKA 4MVRA 4WFHA 1YIJV 2IH1C 1JCHA 3ZRWB 2H8PC 3STZC 1GMGA 2HLDG 1M9NA 3CXCU 4X8AA 1ROPA 5CBGA 3FB7C 1YTFB 2ZXWB 1P4RA 3K06A 5B1BC 2R9RB 3OMNB 3OUSA 4JTAB 3ASOC 3B8MA 1AI6A 2Q67A 3E8BA 2EINB 2Y48A 4E2LA 4I9WA 1K8AW 1RPRA 3LNMB 1KC8W 5LBQA 3AG4C 3HPLC 2JDIG 2V1DA 3ZRVA 4QE7A 5B1AB 2P7TC 3ZMVA 5CBHA 4TSFG 2IJIA 2YEVA 3ABKC 4GT1A 3RVZA 1KP2A 1K33A 1VQKV 2EILB 1CP9A 4P2ZA 1S76D 3ABLB 1K97A 3BY6A 5L3DA 3DTUB 3IGAC 1OCZB 1YJ9V 1JPXA 3LUTB 3MHHC 1AROP 3B8NA 4LC1A 4UUJC 2IJJA 1KECA 2QM8A 3JD0A 4L87A 2EIJC 2H94A 3SYAA 1VQMV 3ASNB 1V55C 3WFVA 1OCRC 1M57C 2HKOA 2Y69C 4JTDB 3CMAV 2QA4V 2OCCB 1S72V 1VQPV 5DM6V 1VQLV 2NLJC 4PA7A 3G71V 3LDDA 2WLIA 3JD1A 3ABMB 2NNUA 3G4SV 2A9HA 1R73A 3ZRSA 1I5XA 1RM1B 3QO8A 2WAMA 4R50A 2ITCC 3OGCC 2X6AA 3AG2B 1VQOV 3TCUA 4MW3A 1F51A 5HFMA 2ZD9A 1YSCA 1V54C 5B3SC 3T4DA 3UM7A 4F4LA 1R6NA 3AG1C 4EKWA 2WLJA 1YJWV 2DYRC 2WPDG 2AHZA 1G8MA 3IFXA 4UVBA 5DN6G 1GO3F 1R3JC 2V7QG 2XNDG 1COWG 1M56C 1H8EG 1OCCC 3E83A 1FXHA 2ATKC 3R65A 2EJRA 1P7BA 3ZRWA 1KP3A 4Q20A 3ZCCA 5IY5C 1H8HG 1K3EA 3AG3B 5KA5A 4U7OA 2UXXA 2ZDIA 4PA3A 1YHQV 4DO2A 3SPIA 1KD1W 2DYSC 2AHYA 3LDEA 4R7CA 1MOFA 2LP7A 2R9IA 3CCQV 3JD3A 5B1NA 4JF3A 1R3IC 1Q81W 4PELA 5LGTA 4Z1MG 1MG1A 1DF4A 4QPKA 3K03A 1Y4MA 3FYIB 3T2MA 1AI5A 1WPXA 3JYCA 1FFTB 3AEIA 1Y66A 1NJIW 5CBFA 1OCOB 3M99B 1UJWB 3OUFA 3E35A 3OEHG 1KKDA 1K34A 5BZBA 4JASA 1AJQA 3E8FA 4MW8A 1J95A 1JX9A 3K9AA 2X6CA 3OMIB 2IU0A 3E2EA 1K9MW 1PNLA 4XDKA 2JEXA 2DW4A 1R3KC 4HZ3A 2X6BA 1NVPB 4RUFA 1GM8A 1VQ7V 1R3LC 3LSQA 3W7SA 3SYQA 3CC7V 4WFEA 3SPCA 1S77D 2XAQA 1H2GA 2IU3A 2UXNA 3JCZA 2ZR3A 2WLNA 4GX2A 2P6JA 2ZDIC 5CA3A 1GM7A 4XBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSW C;  3GB7 C;  4MVZ A;  4MTF A;  4MVO A;  3SYA A;  2EIJ C;  5KUM A;  2WLL B;  2QKS A;  3SPH A;  1V55 C;  2HJF C;  1OCR C;  1M57 C;  1G4Y B;  2HVJ C;  2Y69 C;  4JTD B;  2KB1 A;  3AG3 C;  3BEH A;  4DXW A;  2NLJ C;  4BW5 A;  4PA7 A;  2WLK A;  1JVM A;  3LDD A;  2WLI A;  4MVS A;  3E86 A;  3LDC A;  3F5W C;  4HYO A;  4PA6 A;  2A9H A;  3ZRS A;  2BOB C;  5B1A C;  3SJQ C;  5KUK A;  1K4C C;  4J9Z B;  3RW0 A;  4R50 A;  4QNH B;  2IH3 C;  4MTO A;  4G28 B;  4ZBM A;  4JTC B;  4LBE C;  2ITC C;  4P9O A;  3OGC C;  4X88 A;  1ORQ C;  1K4D C;  1LNQ A;  4LP8 A;  1XL6 A;  2X6A A;  4XDJ A;  5EBL C;  2WLI B;  3TCU A;  4MW3 A;  4RAI A;  2ZXW C;  2A79 B;  2ZD9 A;  2JK5 C;  1V54 C;  2Q6A A;  3RVY A;  2Q68 A;  3T1C A;  4P9P A;  3T4D A;  3K08 A;  4P30 A;  1XL4 A;  4X89 A;  3UM7 A;  3VOU A;  4F4L A;  1OCO C;  1OCZ C;  3AG1 C;  5E1A C;  2EIM C;  1BL8 A;  2WLJ A;  2DYR C;  3FB5 C;  4PA4 A;  4EKW A;  2AHZ A;  3IFX A;  4OXS A;  1R3J C;  2EIN C;  4GX0 A;  4J9Y B;  4WFG A;  5J9P C;  2WLM A;  3E89 A;  1M56 C;  1OCC C;  4PDM A;  3E83 A;  1ZWI C;  4MTG A;  2ATK C;  3R65 A;  4XDL A;  2A0L A;  3T4Z A;  3FB6 C;  5B3S C;  1P7B A;  5EBM C;  2DWD C;  5EC2 C;  5IY5 C;  3SYO A;  3ZJZ A;  4MVM A;  4GX5 A;  2QTO A;  3EFF K;  4MVQ A;  4CBC A;  4H33 A;  2EIL C;  4PA3 A;  4MVU A;  3OR6 C;  3SPI A;  4GX1 A;  2DYS C;  3ABL C;  4PDL A;  4RO2 A;  4RUE A;  4PA9 A;  4TWK A;  4MVR A;  3F7Y C;  4WFH A;  2AHY A;  2IH1 C;  3LDE A;  4R6Z A;  4R7C A;  1QLE C;  2H8P C;  3STZ C;  3K04 A;  1R3I C;  3UKM A;  4WFF A;  4X8A A;  3SYP A;  3K03 A;  5CBG A;  2HG5 C;  3TET A;  3FB7 C;  3T2M A;  3JYC A;  3STL C;  3K0D A;  2EIK C;  3K06 A;  5B1B C;  2R9R B;  5CBF A;  3OUS A;  4JTA B;  3ASO C;  3OUF A;  3ASN C;  3PJS K;  4QE9 A;  3X2Q C;  2Q67 A;  3E8B A;  1KKD A;  2OCC C;  2W0F C;  5BZB A;  5EBW C;  3KG2 A;  4H37 A;  4I9W A;  3LNM B;  3E8F A;  4MW8 A;  1J95 A;  2BOC C;  3SPJ A;  3F7V C;  2DWE C;  4MS2 A;  3ABM C;  3AG4 C;  3HPL C;  2X6C A;  4PDR A;  3SYC A;  4QE7 A;  3K0G A;  2P7T C;  5CBH A;  5EC1 C;  2HVK C;  3ABK C;  2YEV A;  4G27 B;  2ITD C;  4XDK A;  3RVZ A;  3SPG A;  4PDV A;  3E8G A;  1R3K C;  4HZ3 A;  1S5H C;  5EK0 A;  2X6B A;  4R8C A;  4P2Z A;  4RUF A;  3WG7 C;  1R3L C;  3E8H A;  3AG2 C;  4LCU C;  3SYQ A;  4WFE A;  3SPC A;  2Q69 A;  3OR7 C;  2WLL A;  3IGA C;  2WLN A;  2K1E A;  4GX2 A;  2HFE C;  3FB8 C;  4KFM A;  3LUT B;  3RBZ A;  4UUJ C;  2WLH A; 
#chains in the Genus database with same CATH topology
 2HHH O;  4MTF A;  2P5O A;  4CC5 A;  2YXY A;  3AK1 A;  2WLL B;  3G80 A;  3J80 N;  4DR2 B;  4JAA A;  1V9P A;  4J11 A;  4LF6 B;  1O9H A;  4BW5 A;  1LUW A;  4JI7 O;  3K59 A;  3KZI Z;  1QU7 A;  2YUA A;  3ABK B;  1YTF D;  1IXB A;  2DQ0 A;  4LF8 B;  4X88 A;  2PI5 A;  4FIP C;  4X62 B;  2QWN B;  4CH3 A;  1L0N H;  2JK5 C;  3RVY A;  4P30 A;  4Z1V A;  4JYY A;  3QG5 A;  5E79 Z;  2QE7 G;  1KQS U;  2F93 B;  1Y67 A;  4JI8 O;  5JJJ B;  2OCH A;  4DR7 O;  1VQN V;  1TVK B;  1VMG A;  3CCU V;  4JYB A;  2QTS A;  1EBO A;  1FXK C;  5JVD B;  1N8R W;  4KHP B;  1JR9 A;  5LYJ B;  3ABT A;  3K04 A;  2LFR A;  4I4T A;  4GKJ B;  1F23 A;  2ZQM A;  1MZF A;  3JSN A;  2VQE B;  1QVG U;  1XOU A;  1BHB A;  4JI0 O;  2EIK C;  5KX5 B;  1VEW A;  3OTO B;  1YI2 V;  2DYR B;  4IGG A;  3X2Q C;  1RPO A;  1EM1 A;  1M56 B;  1OCC B;  2E5L B;  3JD4 A;  4MS2 A;  2HR3 A;  3WU2 Z;  1MSD A;  4F6R B;  2A3Q A;  4HAM A;  1G1X B;  4FLX A;  3O9O A;  5A2Q N;  2XHB A;  3WG7 C;  3A0B Z;  2PYL A;  3RN4 A;  3D36 A;  3ETG A;  1IZ3 A;  1SA0 B;  4LFA O;  3L75 H;  5CA0 A;  5JWP A;  4IHJ A;  2UUA O;  1BT8 A;  2WLH A;  2E74 B;  3B09 A;  3B4S A;  4X1I A;  3K58 A;  2W6I G;  3JAS A;  3VQV A;  4K35 A;  4DR5 B;  2LFS A;  4MVS A;  4DV2 O;  4DV7 O;  1WP7 A;  2LGQ A;  5CA1 B;  2QWO B;  2YSU B;  3JAK A;  1FYJ A;  1E1R G;  2G38 A;  4X66 O;  1K4D C;  5BR8 B;  2XAF A;  2ZXW C;  3NR7 A;  2EZO A;  5JCO A;  5JJN B;  1QQC A;  5IDJ A;  4LFB B;  4KL1 A;  4GX0 A;  1Q90 D;  3FX7 A;  4JAV A;  4B3M B;  1N32 B;  1NR1 A;  1UFI A;  4YHH O;  3RYH B;  3T1H O;  2GDS A;  3SDL A;  1N34 O;  3JAL A;  3U0Z A;  1VF7 A;  3L9D A;  4AI8 A;  3CCL V;  3DXR A;  4H33 A;  2P4V A;  4TT3 G;  4MVU A;  4DV5 B;  1NKD A;  3ABL C;  3ZRX A;  4O4H A;  3RWR D;  3ETE A;  3DGE A;  1THZ A;  2Y0P A;  3K57 A;  1QBZ A;  1EN5 A;  4J7J A;  3NXS A;  2OT5 A;  4TUY B;  2OYQ A;  4JV5 B;  3TET A;  3N2G A;  2XAS A;  1HNX O;  3K0D A;  4LR3 A;  4WCE V;  5LP6 C;  4QE9 A;  4JI1 B;  4RQF A;  2HP8 A;  2OCC C;  2W0F C;  3CCV V;  4I7Z B;  4B3T B;  4YIO A;  1SKV A;  3WB0 A;  4DV6 B;  2DWE C;  4C7U A;  4DRX B;  3T1Y O;  3ZHQ A;  2ZM6 B;  1GH6 A;  2UU9 B;  2IJK A;  2OTJ V;  2JEU A;  4B08 A;  3W7X A;  1EN4 A;  5IYZ A;  3TK1 A;  3CD6 V;  1SQF A;  1QLE B;  5DED A;  5KHJ A;  4DR1 B;  1H2L A;  1ENV A;  4DV4 B;  4TQF A;  3VQY A;  3MD0 A;  1SQQ H;  1FS0 G;  1G4Y B;  1JJ2 U;  5LGU A;  3AG3 C;  3BEH A;  3K3W A;  4BIZ A;  3QO7 A;  1XMO O;  1P84 F;  5LHH A;  4DR2 O;  2ETN A;  3E22 A;  2XAJ A;  4QGP A;  1U96 A;  1PNM A;  3B2E E;  1Y76 A;  3P3P A;  1NU1 H;  1VQ8 V;  2WLI B;  4FVM A;  3ML0 A;  1BHA A;  1GAX A;  3QVN A;  4ICG A;  1AI7 A;  2Q6A A;  2P67 A;  1XL4 A;  1TGO A;  4LF8 O;  2PZS A;  2WA4 A;  2LO1 A;  2IM9 A;  3OGI B;  4WFG A;  3E89 A;  3CYO A;  2M6Y A;  3C3T A;  2YIA A;  3GWO A;  1S5J A;  3OMA B;  4YJ3 B;  3OM3 B;  1XNQ O;  2Q5Z A;  3FAV A;  1KKC A;  4KP4 A;  4I55 B;  5LOV A;  4OGQ B;  3Q4H B;  2IH1 C;  1WA8 B;  5JQG B;  4FZ1 A;  5KHG A;  1ZX3 A;  2DE0 X;  5K1X A;  3CXC U;  4X8A A;  3GWK C;  2MW2 B;  4DK1 A;  1XBL A;  4IT5 A;  4LH7 A;  3OUS A;  4JTA B;  4GKJ O;  4I50 A;  3B8M A;  2EIN B;  4CH6 A;  4I9W A;  4DV0 O;  1K8A W;  4DUY B;  3TXS A;  1XNR O;  1KC8 W;  4X20 A;  3HPL C;  2JDI G;  2V1D A;  3ZMV A;  5CBH A;  2IJI A;  4GT1 A;  2CGO A;  1KP2 A;  1CP9 A;  4K8Z A;  3RYF B;  1XMQ O;  3BY6 A;  1IBL O;  1SF9 A;  2F66 C;  2RNB A;  1YJ9 V;  1Q5O A;  3ZBH A;  3MHH C;  1ARO P;  4LWS A;  3JD0 A;  2H94 A;  1IDS A;  4FLT A;  5JCO C;  1VQM V;  1M5I A;  1AR5 A;  2ZT9 B;  1S72 V;  1US6 A;  1VQL V;  3G71 V;  3ZS8 C;  3HKD A;  3JD1 A;  5H5N A;  1R73 A;  2HHH B;  2UUC O;  3QO8 A;  4R50 A;  3APQ A;  4UB8 Z;  2V4D A;  1I0H A;  5LA6 A;  2ITC C;  1G6U A;  1YVW A;  5LXT B;  2RJZ A;  2X6A A;  1R1B A;  5HFM A;  2ZD9 A;  4H13 B;  1V54 C;  1R6N A;  4JI7 B;  4PI2 A;  4ZI7 B;  4UVB A;  2FL4 A;  1N33 O;  1YEW A;  4O2B A;  4LFC O;  1COW G;  3E83 A;  1FXH A;  2YI9 A;  4Q20 A;  4B3S B;  1D2D A;  4PV1 B;  2UXX A;  1IBK O;  2JGD A;  2ZDI A;  4NXN B;  4DO2 A;  1PM9 A;  3SPI A;  2DYS C;  2Q7G A;  5KAF Z;  3N2K A;  3H1I H;  4PEL A;  1MG1 A;  1N4C A;  1JFF B;  4JI8 B;  4DR7 B;  3FYI B;  1SQP H;  1B04 A;  1OCO B;  3OUF A;  1N0N A;  2ZIN A;  1B3Q A;  1IVS A;  4TV9 A;  1K34 A;  1KYO F;  4MW8 A;  1JX9 A;  4DV1 O;  2X6C A;  3OMI B;  3E2E A;  4XDK A;  5ITZ A;  1Y6X A;  4B3T O;  4WFE A;  3SPC A;  1S77 D;  2UXN A;  5IWA O;  3JCZ A;  2UU9 O;  4FZ0 A;  4ZOL A;  4TV8 B;  3RT3 C;  1P49 A;  3BA9 A;  2H3O A;  4XBF A;  1ZSP A;  1NH2 D;  3CCM V;  1FXK A;  5L3G A;  3CJH A;  4U7N A;  4DUZ O;  1NTK H;  3JAT B;  2KSD A;  4WFB V;  1AR1 B;  3K9S A;  5EIB C;  1YZB A;  1NVP D;  5L3B A;  1EN6 A;  2QM7 A;  3ZIA G;  4XDJ A;  3ICX A;  1NQT A;  1MA1 A;  4X1K A;  3CSX A;  1OV9 A;  4DV2 B;  4AQY O;  2EIM C;  3L73 H;  1F7Y A;  1AJN A;  1XDC A;  4PDM A;  1SER A;  4B7E A;  4X66 B;  3VQW A;  4LF9 O;  1L8D A;  3FB6 C;  3L72 H;  2Y69 B;  1WLE A;  3ZJZ A;  1YJN V;  5IYC O;  1NT2 B;  2WSS G;  1CPY A;  2XAG A;  2CTR A;  4PA9 A;  2UXC B;  4R6Z A;  1D5N A;  4J80 A;  2BTO A;  3T1H B;  2QEX V;  1DGS A;  3CCS V;  1OZ0 A;  3JAR A;  2UXB B;  2OTL V;  1PP9 H;  1ZTE A;  1RP3 B;  2QWQ B;  4BIU A;  1K92 A;  2RCV A;  2PUS A;  3AG1 B;  5H2F Z;  4A5U B;  2YIC A;  3DC6 A;  3CXH F;  1L1F A;  3TJT A;  5J2T A;  2BOC C;  4NVP A;  4JYA O;  3SYC A;  1AIL A;  5LHG A;  5IYB O;  1NR7 A;  3SPG A;  3ZN0 A;  2QWP B;  1TA8 A;  4GKK O;  4JI2 O;  5EYP B;  1S5H C;  3HKC B;  2C2A A;  1SET A;  4UXN A;  3D3Q A;  1N36 O;  3AK3 A;  2WLL A;  4U3J B;  4KXR A;  1JA8 A;  3UCS C;  1ZL8 B;  2VQF B;  3K79 A;  4DXW A;  2ILM A;  4QPJ A;  1M4U A;  5L3F A;  3P3N A;  3S3W A;  3ZHR A;  2KB1 A;  2Q7H A;  4K3A A;  2E76 B;  1E1Q G;  3E86 A;  4O2A B;  2RQ6 A;  4LF7 B;  4HNA B;  1I94 O;  2JGU A;  4FPP A;  1LNQ A;  4J42 A;  1PPJ H;  1NS1 A;  1ZAU A;  1SQG A;  4GYC B;  1YIT V;  2K9P A;  3CHX A;  1H2M A;  1H2K A;  1S5L Z;  3M8A A;  5KUK A;  3ZED A;  1XMO B;  2CAZ C;  1TVK A;  1RSO B;  4OXS A;  2UXD O;  4J9Y B;  1XIL A;  3H01 A;  2AW9 A;  4NXM O;  5JVD A;  3A0H Z;  5CN0 A;  5LYJ A;  1QNM A;  2FYU H;  5EBM C;  1W0J G;  4I5S A;  3ETD A;  4G2K A;  2JJ1 G;  3C90 A;  2F43 G;  1I08 A;  1AP5 A;  1AJP A;  1MAB G;  4O4I B;  4PDL A;  4X1Y B;  5KX5 A;  4B3S O;  3CCE V;  3JAW B;  1FD9 A;  4NXN O;  3JCU Z;  1P7G A;  1DK1 A;  3CCR V;  1XNQ B;  2GTS A;  2L6L A;  1Q8I A;  4F6R A;  3ASN C;  4FK5 C;  3THO A;  1M57 B;  2Q9L A;  1CXZ B;  3N27 A;  2X0L A;  3HKB B;  1RM1 C;  1GN6 A;  2BE3 A;  5IE9 A;  1DTO A;  2ZE7 A;  3I56 V;  3AG2 C;  2ZE6 A;  4LCU C;  4O4J B;  4DV0 B;  5H6R A;  5GW7 A;  1XNR B;  4H44 B;  4JGS A;  2YEV B;  5K1P A;  3FB8 C;  1ZUQ A;  4BW9 A;  1FXV A;  4KFM A;  1J5E O;  2CTP A;  2ZIO A;  1AI4 A;  3SJQ C;  5KHK A;  3GB7 C;  3IC7 A;  3UO3 A;  5BY1 A;  5CA1 A;  1JMK C;  2W6J G;  3M7M X;  1XMQ B;  1XQ8 A;  1IBL B;  4I0X B;  5IY5 B;  2Y0I A;  5HFL A;  1AR4 A;  2VRZ A;  5GTH Z;  1KBH A;  4HYO A;  5KA6 A;  1GTO A;  4QNH B;  4G28 B;  3JD2 A;  4N21 A;  2Q7E A;  3ABU A;  4LF4 O;  4E4E A;  5B66 Z;  3RYH A;  3O65 A;  3ZMZ A;  1X4T A;  3VOU A;  1O9G A;  2ZR2 A;  2UUC B;  2AGA A;  2QKA A;  5D5P A;  2XOK G;  3FYE B;  2O57 A;  3ZHS A;  4YJ2 B;  3A8T A;  5KHI A;  1SS3 A;  3RGB A;  1Y74 B;  4MVM A;  4TUY A;  3RFR A;  4CBC A;  2ZE8 A;  3CRR A;  1LR1 A;  4GX1 A;  5J2U B;  3CP1 A;  3B77 A;  1CEZ A;  1N33 B;  4RUE A;  1IBM O;  4MVR A;  4WFH A;  4LFC B;  3ZRW B;  4DYL A;  2HLD G;  4IYI A;  1M9N A;  1SQX H;  3EXA A;  2UXC O;  1YTF B;  3H9V A;  1IBK B;  1VF6 C;  1TAE A;  1P4R A;  4DRX A;  4DR6 O;  3H1L H;  4OPH A;  2UXB O;  4E2L A;  3TXQ A;  3HKE B;  3ZRV A;  5B1A B;  2P7T C;  3ABK C;  2RMK B;  1VQK V;  2EIL B;  3QTC A;  1K97 A;  5L3D A;  1A32 A;  4Q6G A;  4X1I B;  1URF A;  3IGA C;  4DV1 B;  4LC1 A;  1FFX A;  5FPO A;  4L87 A;  3SYA A;  4IIJ B;  4OX9 O;  3WFV A;  1M57 C;  2VQF O;  5EIB D;  2QA4 V;  5DM6 V;  5IWA B;  1XI1 A;  2WLI A;  2CH7 B;  4CS3 A;  3ABM B;  2WAM A;  2XT9 A;  3UO2 A;  2AXT Z;  4B3R O;  3OGC C;  5CB4 B;  5IJ9 B;  4DUZ B;  1B06 A;  2Y4T A;  3TCU A;  3SJB C;  3JAL B;  4LF7 O;  3G67 A;  3UM7 A;  1AP6 A;  4YJ3 A;  5JH7 B;  2DYR C;  2WPD G;  3IFX A;  5DN6 G;  4I55 A;  4CS4 A;  1R3J C;  2XND G;  1M56 C;  1PV0 A;  1H8E G;  1OCC C;  3Q4H A;  1OJH A;  2ATK C;  3R65 A;  1P7B A;  5IY5 C;  1H8H G;  3IAY A;  2DJV A;  4PA3 A;  1YHQ V;  4AQY B;  4FM1 A;  3L70 H;  2QWR B;  2LQT A;  3KKY A;  2DMX A;  4JF3 A;  1Q81 W;  4LF9 B;  1Y4M A;  3T2M A;  1AI5 A;  4EFE A;  5GON B;  1NJI W;  3E35 A;  4IL6 Z;  5BZB A;  2DOS A;  3SGI A;  3ZHT A;  2FML A;  3RYF A;  5IJ0 B;  1Z5V A;  4AHC A;  5C8Y B;  2GTA A;  2YID A;  2DN9 A;  4ZHQ B;  1K9M W;  2CE4 A;  2IBZ H;  2JEX A;  3R66 A;  4HZ3 A;  2ADP A;  1TUB B;  4NYK A;  4RUF A;  1FAF A;  3LSQ A;  1EZV H;  3CC7 V;  1X59 A;  2XAQ A;  1H2G A;  2P22 C;  3ZHU A;  2ZR3 A;  4JYA B;  4GKK B;  4JI2 B;  5JJE B;  5KUM A;  5B1B B;  3ASO B;  3SPH A;  5C93 A;  3U10 A;  2QKC A;  1XUQ A;  1N36 B;  3UQ8 A;  1HNW O;  1XHX A;  5LXT A;  1JVM A;  5H9C A;  2FKX A;  3LDC A;  3AG4 B;  4DR4 O;  4PA6 A;  5B1A C;  4ZI7 A;  4LBE C;  1IXM A;  3G6E V;  4FLW A;  3CME V;  4DW0 A;  1ORQ C;  3ZMT A;  5LMU B;  1VAR A;  1H38 A;  2E3C A;  4UCO A;  3BAB A;  1W0K G;  3L74 H;  4PA4 A;  1VQ5 V;  2B1I A;  2Y4U A;  3L71 H;  3D8C A;  1I94 B;  1WPB A;  4N23 A;  4UVC A;  2EIJ B;  2EUL A;  4AIL C;  5CMU A;  1XRE A;  3OAA G;  1V55 B;  1Z5W A;  1OCR B;  3LNN A;  3UT5 A;  1F4M A;  4MVQ A;  2PTM A;  1JFF A;  3QNE A;  1ZLZ A;  1R6T A;  1FKA O;  1NBM G;  4ABM A;  2LW7 A;  2LW1 A;  1IUR A;  5LL6 Y;  2UXD B;  3CRC A;  3F7Y C;  3G6B A;  1QLE C;  1QVF U;  3K5O A;  3J7A U;  5KMG B;  4NXM B;  3UKM A;  4OPA A;  4UCT A;  2BSK B;  1Q6U A;  2X7R B;  2WA3 A;  1GN2 A;  1I5Y A;  5L3C A;  3F5T A;  3A0R A;  2N05 A;  3TGU H;  4BR6 A;  1SES A;  1WNS A;  5BMV B;  1K5S A;  3CEI A;  5EBW C;  1PD3 A;  3ZMS A;  3F7V C;  4PDR A;  1EFR G;  4BIO A;  3BRC A;  4PDV A;  5EK0 A;  1BGY H;  3CS5 A;  1HDJ A;  4K0K O;  3SJA C;  4GLX A;  2BTQ B;  3JAT A;  2KKW A;  4D7S A;  4MSW C;  4MVZ A;  4UV8 A;  4FLV A;  5F2V O;  3LSS A;  1NI8 A;  4WBN B;  5FL7 G;  2WLK A;  4J7Z A;  2N74 A;  3CPW U;  1J5E B;  4PHZ A;  1K4C C;  2IH3 C;  3ZMU A;  3DC5 A;  4O2B B;  2JS5 A;  3OEE G;  1XL6 A;  5EBL C;  1HW7 A;  4O4L B;  1T5E A;  1BL8 A;  1FJG O;  4DV3 O;  3ZHV A;  2EBO A;  4GZR B;  2EIN C;  5J9P C;  2WLM A;  1JOY A;  5KLV H;  4MTG A;  4LF4 B;  3T4Z A;  4XDL A;  3LSU A;  2L35 A;  5EC2 C;  2D2C B;  3SYO A;  2FB5 A;  2B1G A;  2KG7 A;  3BCC H;  3QO5 A;  2HJD A;  2E75 B;  3CX5 F;  3EHB B;  1PL4 A;  2MK3 A;  2Z3Y A;  4WFA V;  4WFF A;  1YCI A;  3CRA A;  2FTK A;  1GN4 A;  1WP8 A;  3STL C;  3K5M A;  1NZ6 A;  1IBM B;  5ITZ B;  4PJ0 Z;  3I55 V;  1K73 W;  5EYP A;  3HKC A;  2W0X A;  3SPJ A;  4UVA A;  3VQX A;  3K0G A;  2LJ2 A;  4U3J A;  4EB6 B;  1U97 A;  2HVK C;  4G27 B;  4LH6 A;  4DR6 B;  2ADQ B;  4J41 A;  1MMM A;  1ZL8 A;  4R8C A;  2AZ0 A;  3E8H A;  1W2B U;  1FXK B;  3CJH B;  1HWY A;  4JI5 O;  4FFB B;  3OW2 U;  2HFE C;  3OE7 G;  1SQV H;  2VS0 A;  3RBZ A;  1QR8 A;  1PNK A;  2EIK B;  3OFN G;  2Q4P A;  3X2Q B;  4HNA A;  2JJ2 G;  1OHH G;  3RYC B;  1Q43 A;  4PI0 A;  4W4L A;  1VF6 A;  1F4N A;  4J9Z B;  3CCJ V;  2ZE5 A;  1LUV A;  1VQ6 V;  1RSO A;  3WG7 B;  4OX9 B;  4FFK A;  5A9G A;  4B7K A;  4RAI A;  1Q82 W;  1XEQ A;  3W7T A;  4JAU A;  2Q68 A;  3T1C A;  4P9P A;  1OCO C;  1FPO A;  4CZZ A;  3FB5 C;  1SRY A;  5LMU O;  3H1H H;  2A06 H;  4JI3 O;  4B3R B;  4X1Y A;  4UCS A;  3JAW A;  2DWD C;  1NH2 B;  5FLX N;  4GX5 A;  3EFF K;  3JAR B;  2GHY A;  4TWK A;  1YIJ V;  1XHZ A;  1JCH A;  2H8P C;  3STZ C;  1GMG A;  1HP8 A;  1MNG A;  5B5E Z;  2RDC A;  3AG7 A;  5CBG A;  3FB7 C;  2ZXW B;  2NN4 A;  3HKB A;  2R9R B;  3OMN B;  2Q67 A;  3E8B A;  2GUZ B;  2Y48 A;  1RPR A;  3LNM B;  4O4J A;  3WB2 A;  3ZX6 A;  1H2S B;  4QE7 A;  2KQX A;  2B9Z A;  4TSF G;  5EZY B;  2YEV A;  3RVZ A;  1BE3 H;  4DK0 A;  1S76 D;  3ABL B;  5FNV B;  4D7T A;  4LNU B;  4I0X A;  1OCZ B;  2EX3 A;  1JPX A;  5DEC A;  2IJJ A;  2QM8 A;  1BS3 A;  2JS3 A;  5LP6 B;  1SA0 A;  4JTD B;  2Y69 C;  2OCC B;  5AG2 A;  2PYJ A;  3BHP A;  3RYI B;  4JI4 O;  1Q6H A;  2A9H A;  1KU9 A;  3IJ4 A;  5KAI Z;  5FPR A;  1HNW B;  1F51 A;  4YJ2 A;  1WN7 A;  3T4D A;  3AG1 C;  2WLJ A;  4DR4 B;  3U11 A;  1Y74 A;  2AHZ A;  1G8M A;  2OIE A;  4IYH A;  1GO3 F;  5J2U A;  4YY3 O;  5TIS Z;  1D5A A;  1BCC H;  2EJR A;  3ZRW A;  1KP3 A;  2Q73 A;  4NTW A;  3AG3 B;  2XTA A;  1KD1 W;  3OT7 A;  4R7C A;  2R9I A;  5B1N A;  2RN9 A;  5LGT A;  1SQB H;  4Z1M G;  1DF4 A;  4QPK A;  4X64 B;  4X65 O;  3H1K H;  3JYC A;  3AK2 A;  2JVD A;  3HKE A;  2N04 A;  1FFT B;  3AEI A;  1UJW B;  2ZNJ A;  4I4T B;  4NTY A;  2LGW A;  1RFY A;  1AJQ A;  2ZCE A;  3K9A A;  2IU0 A;  3PN1 A;  4DW1 A;  2PF4 E;  1VIB A;  2DW4 A;  1R3K C;  2QM4 A;  2X6B A;  3BA8 A;  2ODM A;  2IU3 A;  4IIJ A;  2WLN A;  4GX2 A;  1NTZ H;  2P6J A;  3CWB H;  2QDO A;  1GM7 A;  3H1J H;  4CS2 A;  2CH7 A;  1KMI Z;  2F95 B;  1TUE B;  2D3O W;  5LMN O;  5CA0 B;  2HJF C;  1L0L H;  1R6K A;  4IHJ B;  2WWW A;  3W7U A;  4YIP A;  2QGN A;  1Q6I A;  4K0K B;  2P06 A;  5CB4 A;  5IJ9 A;  2PGG A;  3EVK A;  4JPR A;  3CE2 A;  3P30 A;  1QR9 A;  1JQ0 A;  2BOB C;  2YI8 A;  2A7W A;  1BZK A;  5JH7 A;  4JTC B;  2IJH A;  4LF5 B;  3JAS B;  4LP8 A;  1YXB A;  2PI4 A;  3K08 A;  4X89 A;  3JAM N;  3JAK B;  1OCZ C;  3FKS G;  2ZKO A;  1WAZ A;  1Q7Y W;  1HR0 O;  4PD4 F;  1E79 G;  3KCY A;  1VF5 B;  1GRJ A;  2OWO A;  1K5Q A;  2OIG A;  5LHI A;  3K5N A;  1FJG B;  4DV3 B;  4RO2 A;  1GKF A;  3BFR A;  4CC6 A;  5GON A;  2GV9 A;  1M1K W;  4UV9 A;  1GK9 A;  2B5U A;  1HNZ O;  3DXR B;  2CTQ A;  3SYP A;  4FM2 A;  5IJ0 A;  1IX9 A;  2HG5 C;  4CH4 A;  5C8Y A;  1M90 W;  4FLZ A;  1V54 B;  4O4H B;  4ZHQ A;  5KHH A;  1WA8 A;  5JQG A;  3WB1 A;  1TUB A;  4GUN A;  2BCC H;  3KG2 A;  3CRM A;  3N2G B;  4DR3 O;  1AB3 A;  3GVM A;  2R9A A;  4J10 A;  4EEQ A;  4JI6 O;  1YF2 A;  1Z2G A;  2ITD C;  4Z2W A;  4YXW G;  2F1M A;  3E8G A;  3VBB A;  2UUB B;  1B6Q A;  1FFX B;  2DYS B;  4JYC A;  4UFZ A;  2Q69 A;  4LF6 O;  4UCR A;  3CC2 V;  4GCZ A;  4ZKI A;  2Q0O C;  4RWU A;  1K7D A;  2ARH A;  2YDE A;  2CGN A;  4NKG B;  5IYZ B;  2M7W A;  4RQE A;  2P90 A;  4ZIB A;  2QKS A;  2Z0A A;  4JI5 B;  4W4K A;  4X62 O;  3HB3 B;  1Q3E A;  2CK3 G;  1WB8 A;  3F5W C;  3BAA A;  1BMF G;  1Q86 W;  1NTM H;  4ZBM A;  3CC4 V;  1M93 A;  3D3I A;  4P9O A;  3IC9 A;  1EZJ A;  3K5L A;  2EZP A;  2A79 B;  2XAH A;  3P32 A;  1QLN A;  4KUM A;  3E22 B;  5E1A C;  1DF5 A;  3OTF A;  4BAY A;  2DQ3 A;  4QIW F;  2F4V B;  1Y76 B;  4KHP O;  3D36 C;  2QSA A;  3ETQ A;  3ZN1 A;  1DLB A;  2A0L A;  2CDY A;  4FJC C;  2YS8 A;  5IYD O;  4EFB A;  5KMG A;  2VQE O;  2QTO A;  2EIL C;  2BSK A;  1SZT A;  3MHS C;  3OTO O;  5D5Q A;  2NR5 A;  2CTW A;  4JI3 B;  5BMV A;  3FAV B;  1VQ9 V;  4MTX A;  2HEP A;  4FMT A;  2E5L O;  5LOV B;  2Q8V A;  3I5D A;  1GM9 A;  3W7W A;  2PY5 A;  3B40 A;  2EIM B;  3PJS K;  4X64 O;  4H37 A;  3ABM C;  1PL0 A;  3A2F A;  5B1O A;  5L3E A;  2IW5 A;  2VWJ A;  5EC1 C;  2BTQ A;  4I50 B;  4K8X A;  5H6Q A;  1QCE A;  4TQD A;  1WJZ A;  4X20 B;  3OR7 C;  4QJF B;  4FLU A;  5B3S B;  4WBN A;  4DR5 O;  2K1E A;  2Z5U A;  2GSM B;  4MVO A;  2R70 A;  3HR0 A;  4BWA A;  1YDX A;  2HVJ C;  5BR8 O;  4TV8 A;  1MSW D;  2Q0A A;  4WF9 V;  4ASU G;  4MT8 A;  4LWS B;  4LFB O;  4O4L A;  2JIZ G;  3RW0 A;  4MTO A;  4B3M O;  1N32 O;  2P4K A;  3HKD B;  1S3J A;  3UT5 B;  4JI4 B;  2YIB D;  1QHT A;  4LF5 O;  4X9Q A;  4DV5 O;  5LA6 B;  3MAQ A;  1PKX A;  2YC0 A;  3JSL A;  4NTX A;  2ZNI A;  1ZWI C;  2QR4 A;  1BQZ A;  4JV5 O;  1AVM A;  4UCU A;  2AZ2 A;  1VQ4 V;  1S0V A;  3APO A;  3OR6 C;  1SZX A;  4JI1 O;  4YY3 B;  4JI0 B;  3FD9 A;  4I9Q A;  4DV6 O;  2JGD B;  4JZ2 A;  1ROP A;  3CRQ A;  2XUM A;  1JJO A;  4JZG A;  4NR1 A;  2ZM6 O;  3K06 A;  5B1B C;  3N2K B;  4EB6 A;  3BPZ A;  1MZE A;  3ASO C;  1AI6 A;  5BXZ A;  3KCX A;  5LBQ A;  3AG4 C;  2CUG A;  4FFB A;  4X65 B;  4DR1 O;  4CH5 A;  4H0L B;  3FFQ A;  4DV4 O;  4FM0 A;  4LFA B;  4NB5 A;  4TV9 B;  1K33 A;  1BQ0 A;  4P2Z A;  2UUA B;  2YIB A;  3SR2 C;  1KB9 F;  2JRI A;  2UUB O;  3DTU B;  3MDS A;  1W59 A;  3RYC A;  3LUT B;  3B8N A;  4UUJ C;  1KEC A;  4UCV A;  2EIJ C;  4DV7 B;  3ASN B;  1V55 C;  3CMA V;  1OCR C;  2HKO A;  4ZOL B;  1VQP V;  2NLJ C;  4PA7 A;  3DSQ A;  3LDD A;  4J7K A;  3J81 N;  2NNU A;  3G4S V;  3ZRS A;  1RM1 B;  1I5X A;  5GTI Z;  4FLY A;  5LMN B;  3SJC C;  3AG2 B;  1VQO V;  1I7F A;  3BVO A;  4MW3 A;  4U3F H;  3QF7 A;  4O2A A;  1YSC A;  5B3S C;  4YHH B;  1VP7 A;  2YXL A;  4F4L A;  4EKW A;  1N34 B;  1YJW V;  2R72 A;  2GBO A;  4UB6 Z;  3CB2 A;  2KG7 B;  2V7Q G;  2F23 A;  4X1K B;  4HBN A;  1KUQ A;  3ZCC A;  1K3E A;  2F4V O;  5KA5 A;  1WB7 A;  4U7O A;  1HR0 B;  4TOI A;  2AHY A;  3LDE A;  5IT9 N;  1MOF A;  1HNX B;  2LP7 A;  3CCQ V;  3JD3 A;  4DUY O;  4D6T H;  1R3I C;  2GUZ A;  3K03 A;  1WPX A;  4O4I A;  2VWK A;  3C3S A;  1Y66 A;  5CBF A;  3M99 B;  5EZY A;  3OEH G;  3T1Y B;  1KKD A;  2ZIM A;  3OD4 A;  4JAS A;  4L8J A;  3E8F A;  1J95 A;  1HNZ B;  3S3X A;  1H2N A;  5FNV A;  4LNU A;  1PNL A;  1NVP B;  1GM8 A;  1BSM A;  1R3L C;  5J2T B;  1VQ7 V;  3W7S A;  3SYQ A;  4F6E A;  1UPG A;  2QJ1 A;  4DR3 B;  5LP6 A;  1GN3 A;  2EJ7 A;  1SC5 B;  2ZDI C;  1N0J A;  4JI6 B;  3RYI A;  5CA3 A;  5LGN A;  2YXH A; 
#chains in the Genus database with same CATH homology
 4MTF A;  1NH2 D;  1TUE B;  2D3O W;  3CCM V;  1FXK A;  5L3G A;  5KUM A;  5B1B B;  2WLL B;  3ASO B;  3SPH A;  5C93 A;  2HJF C;  1R6K A;  4U7N A;  3W7U A;  2WWW A;  4WFB V;  1AR1 B;  4BW5 A;  1JVM A;  5H9C A;  4JPR A;  3LDC A;  3AG4 B;  3P30 A;  4PA6 A;  1QR9 A;  1JQ0 A;  1NVP D;  2BOB C;  5B1A C;  5L3B A;  3ABK B;  1YTF D;  2QM7 A;  2IJH A;  4JTC B;  4LBE C;  1IXM A;  3G6E V;  2DQ0 A;  3CME V;  4X88 A;  3ZIA G;  1ORQ C;  3ZMT A;  4LP8 A;  2PI5 A;  4XDJ A;  4FIP C;  1H38 A;  1NQT A;  2JK5 C;  3RVY A;  2PI4 A;  3K08 A;  4P30 A;  4X89 A;  1OCZ C;  3FKS G;  1W0K G;  2EIM C;  4PA4 A;  1Q7Y W;  1VQ5 V;  1AJN A;  2B1I A;  1E79 G;  2QE7 G;  4PDM A;  1SER A;  4N23 A;  4UVC A;  2EIJ B;  1KQS U;  3FB6 C;  5CMU A;  3OAA G;  1V55 B;  1OCR B;  2Y69 B;  1K5Q A;  1WLE A;  3ZJZ A;  1YJN V;  1VQN V;  1F4M A;  4MVQ A;  5IYC O;  5LHI A;  3QNE A;  3CCU V;  4JYB A;  2WSS G;  1NBM G;  4RO2 A;  1CPY A;  1GKF A;  2XAG A;  4PA9 A;  1EBO A;  1FXK C;  3F7Y C;  1N8R W;  4R6Z A;  1QLE C;  3ABT A;  1QVF U;  1M1K W;  4UV9 A;  3K04 A;  2LFR A;  1GK9 A;  2B5U A;  3UKM A;  1F23 A;  2QEX V;  2ZQM A;  3SYP A;  3CCS V;  1OZ0 A;  2X7R B;  2HG5 C;  2OTL V;  1QVG U;  1I5Y A;  1M90 W;  5L3C A;  1BHB A;  1V54 B;  3A0R A;  2EIK C;  4BIU A;  1K92 A;  3AG1 B;  1SES A;  1YI2 V;  2DYR B;  3X2Q C;  1K5S A;  1L1F A;  5EBW C;  1RPO A;  3KG2 A;  1M56 B;  1PD3 A;  1OCC B;  2BOC C;  3ZMS A;  3F7V C;  3JD4 A;  4MS2 A;  2HR3 A;  4PDR A;  3SYC A;  1EFR G;  5LHG A;  4HAM A;  5IYB O;  1NR7 A;  3SPG A;  3ZN0 A;  2ITD C;  4PDV A;  4YXW G;  3E8G A;  3VBB A;  1B6Q A;  1S5H C;  2C2A A;  5EK0 A;  1SET A;  3WG7 C;  2DYS B;  4UXN A;  3D36 A;  4JYC A;  2Q69 A;  3ETG A;  2WLL A;  3CC2 V;  4GCZ A;  4ZKI A;  5LGN A;  1K7D A;  3K79 A;  4DXW A;  2WLH A;  4MSW C;  4MVZ A;  4UV8 A;  4QPJ A;  2M7W A;  3LSS A;  2P90 A;  5L3F A;  4RQE A;  2QKS A;  2KB1 A;  5FL7 G;  3HB3 B;  2W6I G;  2WLK A;  2LFS A;  1E1Q G;  4MVS A;  3E86 A;  2CK3 G;  3F5W C;  3CPW U;  1BMF G;  1K4C C;  2YSU B;  2IH3 C;  3ZMU A;  1Q86 W;  1E1R G;  4ZBM A;  3CC4 V;  3D3I A;  4FPP A;  4P9O A;  1LNQ A;  1K4D C;  3OEE G;  1XL6 A;  1EZJ A;  5EBL C;  1YIT V;  2EZP A;  2XAF A;  2ZXW C;  2A79 B;  2XAH A;  3P32 A;  1QLN A;  2EZO A;  5KUK A;  4KUM A;  5E1A C;  1BL8 A;  5IDJ A;  1DF5 A;  4BAY A;  4OXS A;  2DQ3 A;  2EBO A;  4QIW F;  2EIN C;  4J9Y B;  4GX0 A;  5J9P C;  3H01 A;  2WLM A;  4JAV A;  1JOY A;  1NR1 A;  3ZN1 A;  4MTG A;  1DLB A;  4XDL A;  2A0L A;  3T4Z A;  4FJC C;  5CN0 A;  5EBM C;  5EC2 C;  5IYD O;  1W0J G;  4I5S A;  3SYO A;  3ETD A;  4G2K A;  2QTO A;  3CCL V;  2JJ1 G;  2F43 G;  4H33 A;  2B1G A;  4TT3 G;  1MAB G;  1AJP A;  2EIL C;  4MVU A;  1SZT A;  3MHS C;  1NKD A;  3ABL C;  4PDL A;  3ZRX A;  3QO5 A;  3ETE A;  3DGE A;  1THZ A;  3EHB B;  3CCE V;  1QBZ A;  3NXS A;  2MK3 A;  2OT5 A;  2Z3Y A;  1VQ9 V;  4MTX A;  4FMT A;  4WFA V;  4WFF A;  2FTK A;  3TET A;  3CCR V;  1GM9 A;  3W7W A;  2XAS A;  3STL C;  3K0D A;  4WCE V;  2EIM B;  3ASN C;  3PJS K;  4FK5 C;  4QE9 A;  1M57 B;  4RQF A;  3I55 V;  2OCC C;  1K73 W;  2W0F C;  4H37 A;  3CCV V;  2X0L A;  3SPJ A;  2DWE C;  3ABM C;  1PL0 A;  5B1O A;  4UVA A;  5L3E A;  2IW5 A;  3K0G A;  1RM1 C;  5EC1 C;  2HVK C;  4G27 B;  1DTO A;  2IJK A;  2OTJ V;  4R8C A;  5H6Q A;  3I56 V;  2JEU A;  1QCE A;  3E8H A;  1W2B U;  3AG2 C;  3W7X A;  4LCU C;  1FXK B;  3TK1 A;  3CD6 V;  1HWY A;  3OR7 C;  4QJF B;  5H6R A;  5GW7 A;  5B3S B;  1QLE B;  4JGS A;  3OW2 U;  2YEV B;  2K1E A;  2HFE C;  3FB8 C;  1FXV A;  3OE7 G;  4KFM A;  1ENV A;  2Z5U A;  2GSM B;  3RBZ A;  3SJQ C;  1AI4 A;  1QR8 A;  3GB7 C;  3IC7 A;  4MVO A;  3MD0 A;  1PNK A;  2EIK B;  2W6J G;  3OFN G;  1FS0 G;  3X2Q B;  1G4Y B;  2HVJ C;  5IY5 B;  1JJ2 U;  2JJ2 G;  1OHH G;  3AG3 C;  5LGU A;  3BEH A;  1MSW D;  3K3W A;  4WF9 V;  5HFL A;  4BIZ A;  3QO7 A;  4ASU G;  4MT8 A;  4HYO A;  5KA6 A;  5LHH A;  1F4N A;  2JIZ G;  1GTO A;  3RW0 A;  4J9Z B;  4QNH B;  2XAJ A;  4MTO A;  4G28 B;  3CCJ V;  1VQ6 V;  3JD2 A;  4N21 A;  3WG7 B;  1PNM A;  3ABU A;  1VQ8 V;  2WLI B;  3ML0 A;  1BHA A;  4RAI A;  1Q82 W;  3ZMZ A;  3W7T A;  1AI7 A;  2Q6A A;  2P67 A;  4JAU A;  2Q68 A;  3T1C A;  4P9P A;  3VOU A;  1S3J A;  1XL4 A;  2ZR2 A;  1OCO C;  4CZZ A;  3FB5 C;  1SRY A;  4WFG A;  3E89 A;  1PKX A;  2XOK G;  3CYO A;  3FYE B;  1ZWI C;  3GWO A;  3OMA B;  3OM3 B;  2DWD C;  1NH2 B;  4MVM A;  4GX5 A;  4KP4 A;  3EFF K;  4CBC A;  1VQ4 V;  1S0V A;  3OR6 C;  2GHY A;  4GX1 A;  3CP1 A;  3B77 A;  1CEZ A;  4RUE A;  4TWK A;  4MVR A;  4WFH A;  1YIJ V;  2IH1 C;  1JCH A;  3ZRW B;  2H8P C;  3STZ C;  1GMG A;  2HLD G;  1M9N A;  3CXC U;  4X8A A;  1ROP A;  5CBG A;  3FB7 C;  1YTF B;  2ZXW B;  1P4R A;  3K06 A;  5B1B C;  2R9R B;  3OMN B;  3OUS A;  4JTA B;  3ASO C;  3B8M A;  1AI6 A;  2Q67 A;  3E8B A;  2EIN B;  2Y48 A;  4E2L A;  4I9W A;  1K8A W;  1RPR A;  3LNM B;  1KC8 W;  5LBQ A;  3AG4 C;  3HPL C;  2JDI G;  2V1D A;  3ZRV A;  4QE7 A;  5B1A B;  2P7T C;  3ZMV A;  5CBH A;  4TSF G;  2IJI A;  2YEV A;  3ABK C;  4GT1 A;  3RVZ A;  1KP2 A;  1K33 A;  1VQK V;  2EIL B;  1CP9 A;  4P2Z A;  1S76 D;  3ABL B;  1K97 A;  3BY6 A;  5L3D A;  3DTU B;  3IGA C;  1OCZ B;  1YJ9 V;  1JPX A;  3LUT B;  3MHH C;  1ARO P;  3B8N A;  4LC1 A;  4UUJ C;  2IJJ A;  1KEC A;  2QM8 A;  3JD0 A;  4L87 A;  2EIJ C;  2H94 A;  3SYA A;  1VQM V;  3ASN B;  1V55 C;  3WFV A;  1OCR C;  1M57 C;  2HKO A;  2Y69 C;  4JTD B;  3CMA V;  2QA4 V;  2OCC B;  1S72 V;  1VQP V;  5DM6 V;  1VQL V;  2NLJ C;  4PA7 A;  3G71 V;  3LDD A;  2WLI A;  3JD1 A;  3ABM B;  2NNU A;  3G4S V;  2A9H A;  1R73 A;  3ZRS A;  1I5X A;  1RM1 B;  3QO8 A;  2WAM A;  4R50 A;  2ITC C;  3OGC C;  2X6A A;  3AG2 B;  1VQO V;  3TCU A;  4MW3 A;  1F51 A;  5HFM A;  2ZD9 A;  1YSC A;  1V54 C;  5B3S C;  3T4D A;  3UM7 A;  4F4L A;  1R6N A;  3AG1 C;  4EKW A;  2WLJ A;  1YJW V;  2DYR C;  2WPD G;  2AHZ A;  1G8M A;  3IFX A;  4UVB A;  5DN6 G;  1GO3 F;  1R3J C;  2V7Q G;  2XND G;  1COW G;  1M56 C;  1H8E G;  1OCC C;  3E83 A;  1FXH A;  2ATK C;  3R65 A;  2EJR A;  1P7B A;  3ZRW A;  1KP3 A;  4Q20 A;  3ZCC A;  5IY5 C;  1H8H G;  1K3E A;  3AG3 B;  5KA5 A;  4U7O A;  2UXX A;  2ZDI A;  4PA3 A;  1YHQ V;  4DO2 A;  3SPI A;  1KD1 W;  2DYS C;  2AHY A;  3LDE A;  4R7C A;  1MOF A;  2LP7 A;  2R9I A;  3CCQ V;  3JD3 A;  5B1N A;  4JF3 A;  1R3I C;  1Q81 W;  4PEL A;  5LGT A;  4Z1M G;  1MG1 A;  1DF4 A;  4QPK A;  3K03 A;  1Y4M A;  3FYI B;  3T2M A;  1AI5 A;  1WPX A;  3JYC A;  1FFT B;  3AEI A;  1Y66 A;  1NJI W;  5CBF A;  1OCO B;  3M99 B;  1UJW B;  3OUF A;  3E35 A;  3OEH G;  1KKD A;  1K34 A;  5BZB A;  4JAS A;  1AJQ A;  3E8F A;  4MW8 A;  1J95 A;  1JX9 A;  3K9A A;  2X6C A;  3OMI B;  2IU0 A;  3E2E A;  1K9M W;  1PNL A;  4XDK A;  2JEX A;  2DW4 A;  1R3K C;  4HZ3 A;  2X6B A;  1NVP B;  4RUF A;  1GM8 A;  1VQ7 V;  1R3L C;  3LSQ A;  3W7S A;  3SYQ A;  3CC7 V;  4WFE A;  3SPC A;  1S77 D;  2XAQ A;  1H2G A;  2IU3 A;  2UXN A;  3JCZ A;  2ZR3 A;  2WLN A;  4GX2 A;  2P6J A;  2ZDI C;  5CA3 A;  1GM7 A;  4XBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...