2P7TC

Crystal structure of kcsa mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVSTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords FAB-A
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p7tC00
4R8CA 2HVJC 5B1BC 4QNHB 3F7VC 3SYAA 3OUSA 5CBGA 3AG4C 3OUFA 3SPJA 3K06A 4PA7A 5EBMC 3ZRSA 4WFHA 3IGAC 1P7BA 4P2ZA 3SPCA 3SPHA 3T4DA 3K0GA 3T1CA 1J95A 3K08A 4MW8A 4UUJC 4ZBMA 2X6BA 3FB6C 2W0FC 2A9HA 3K0DA 2EINC 4MVSA 3SJQC 4MTOA 1JVMA 1R3IC 3BEHA 3ABLC 4EKWA 4JTCB 1KKDA 3OR7C 5KUMA 3UKMA 4PA9A 4PDRA 3E83A 2WLIB 3T2MA 3LDDA 4QE9A 3SPIA 2WLLA 3AG3C 1OCZC 4RUEA 4OXSA 4PDMA 3AG1C 1R3LC 5J9PC 4HYOA 2P7TC 4J9YB 5IY5C 5EK0A 2DYSC 2IH1C 2X6CA 3SYQA 4PDVA 1G4YB 2Q68A 1ZWIC 5EC1C 2NLJC 3PJSK 4QE7A 5EBWC 1M56C 2ZD9A 3RVZA 5KUKA 4RO2A 3ZJZA 2R9RB 3ASOC 4RUFA 2A0LA 3LUTB 3K04A 2Q69A 4RAIA 2EILC 2KB1A 2X6AA 3E8HA 3HPLC 4LCUC 2WLJA 1R3KC 2HG5C 2WLIA 2AHZA 3E86A 1S5HC 4PA3A 4PA6A 3STZC 3SYPA 3LDCA 3K03A 2AHYA 3GB7C 2JK5C 5EC2C 4R7CA 3SYCA 2IH3C 3WG7C 3FB7C 3T4ZA 3F7YC 2HJFC 2DYRC 4JTAB 4PA4A 1V55C 2Y69C 3IFXA 2OCCC 4HZ3A 4XDJA 2H8PC 3LDEA 4H33A 4JTDB 2ITCC 2ZXWC 3OR6C 2A79B 2YEVA 2EIJC 3RBZA 1OCCC 4X89A 4G27B 3TETA 4GX2A 2WLLB 3AG2C 1XL6A 3E8GA 2HVKC 4MVOA 4BW5A 1OCRC 3JYCA 3ASNC 2Q67A 2ATKC 4LBEC 4TWKA 4X8AA 4F4LA 2HFEC 2QKSA 1OCOC 3E89A 4P30A 3X2QC 2BOCC 2DWDC 2QTOA 1K4DC 3FB8C 4XDLA 4R6ZA 3RW0A 3STLC 2ITDC 2WLHA 5E1AC 5B1AC 1K4CC 4J9ZB 4DXWA 4P9OA 2Q6AA 3FB5C 4MVUA 3SPGA 3KG2A 3LNMB 5EBLC 4LP8A 4H37A 3TCUA 4R50A 5BZBA 4X88A 3EFFK 3ABMC 4MSWC 1ORQC 4GX1A 3UM7A 3VOUA 3SYOA 2WLKA 3OGCC 4G28B 1R3JC 4GX0A 3ABKC 3E8BA 1BL8A 4GX5A 4MVRA 4MVMA 4PDLA 2WLMA 2EIKC 4MS2A 4KFMA 5CBFA 4MTFA 4WFEA 4WFFA 4XDKA 1V54C 1M57C 4I9WA 4MVQA 4MTGA 4CBCA 4WFGA 3F5WC 3RVYA 2K1EA 1QLEC 4MVZA 3E8FA 2WLNA 4MW3A 1XL4A 2BOBC 5B3SC 3R65A 2DWEC 2EIMC 5CBHA 1LNQA 4P9PA
chains in the Genus database with same CATH superfamily
4AQYB 1QBZA 3OFNG 4X62O 3CC2V 3AK3A 4LF8B 4UUJC 2W0FC 5B5EZ 4FLWA 1XUQA 2Q7EA 3JATA 3T2MA 2E75B 3JARA 3LDDA 4U7NA 3C3SA 1AR1B 4X1YA 2LQTA 1PV0A 2EZPA 3R66A 3JSNA 1YHQV 2XAHA 4GUNA 4Q6GA 1YEWA 4LF5O 2Q68A 4LWSB 2PTMA 4X65B 1T5EA 2RCVA 1KC8W 3O9OA 2HJDA 1S5HC 2ZDIA 3CS5A 3BABA 3ZRXA 1N32B 4W4LA 5EC2C 3SJBC 4JI6O 3MD0A 5JVDA 2HJFC 1XILA 2LGWA 4GT1A 3QG5A 3THOA 2H8PC 3FFQA 3LDEA 1FXHA 1Z5WA 2QWRB 3TXQA 1BMFG 2PYJA 5IYDO 1BHAA 1HR0B 1WA8A 1XL6A 1XNQB 4CH5A 3LSSA 4J7KA 2RN9A 1Y4MA 4BWAA 5KA6A 3RW0A 1OHHG 4L87A 1H2KA 4Z2WA 4X65O 4N23A 3KG2A 1FS0G 3OT7A 2AGAA 2ZR3A 3H1IH 3HB3B 1CP9A 4TV9B 2OYQA 2ZE7A 3CCQV 4X1KA 1K3EA 4BAYA 4TSFG 5BMVA 5CBFA 2ODMA 4JI7O 4WFFA 1G1XB 2QSAA 1M57C 5LP6C 1MG1A 4IIJB 2LFRA 4JI1O 2XT9A 4JI4B 4ZI7B 2JDIG 5GTIZ 5B1NA 1M4UA 1Q86W 3OGIB 5IYZB 1OCZB 1A32A 2B5UA 3SPJA 3RYCB 1HWYA 5FPRA 1QNMA 4CH3A 2F4VO 2QDOA 3OR7C 5KUMA 4PA9A 4JZGA 3FD9A 1YZBA 2WLLA 4O4JB 2RJZA 4J9YB 4JI5B 1M56B 2AXTZ 3WG7B 5EC1C 5C93A 3SR2C 1HNZB 1IXMA 3HKBA 3CC7V 2CH7B 3ZN1A 2WLJA 1R3KC 2HG5C 2JEUA 4B3TO 5JCOA 1PNMA 4JV5B 4X62B 1GM7A 4I5SA 2DYRC 3I5DA 2Y69C 3G71V 5EYPB 2ZXWC 5JWPA 1ZLZA 3AG2C 2YDEA 4FFKA 1E79G 2FL4A 2GV9A 1YJWV 2HFEC 1TVKB 2IM9A 1MMMA 1LUWA 2QTOA 4R6ZA 5LBQA 3G4SV 1AJQA 3H1HH 1H2NA 4DR1O 2IJKA 4DV4O 2XAFA 4YJ2A 1P84F 4CC5A 1P49A 3KKYA 3RN4A 4FLTA 2B1IA 3E22A 3VQYA 5B1AB 4G2KA 4YY3O 4DV3O 1K34A 1KQSU 4B7KA 4LH7A 1HW7A 2MW2B 1F7YA 3ZHTA 5LP6B 1ZUQA 3H01A 5B1BC 4B08A 3J7AU 1N36B 3FYEB 1Y74A 2Z5UA 3K0GA 1AJPA 2FYUH 3T1YO 1IZ3A 3OMAB 2DW4A 2PY5A 1AILA 2E76B 2Q0AA 3JD4A 5LXTB 3K5LA 4OXSA 4PDMA 3JCUZ 2ZIOA 2WSSG 1SF9A 4LNUB 4TV8B 1XBLA 3ZMSA 3D36A 1S3JA 2XOKG 1QR9A 4E4EA 5JCOC 1HDJA 4UV9A 2G38A 5JVDB 1NZ6A 1R1BA 2IJJA 4YJ3B 3ZJZA 3LUTB 4TQDA 2Q69A 4TUYB 5IJ9A 3CCEV 1WLEA 4DO2A 2QGNA 3UT5B 3LDCA 4UCOA 1D5NA 3OTFA 2EULA 1YCIA 1N36O 1K33A 3CRAA 1IDSA 5LHGA 5IYZA 2ITCC 1H2SB 2UUAB 4TV8A 1NQTA 1QU7A 3AK1A 5KLVH 1GRJA 3F5TA 5BR8O 1OCRC 4X8AA 4JPRA 4LBEC 3JAWA 2LW1A 1BSMA 4DV1O 2ITDC 5E1AC 2Q73A 1B6QA 4YIOA 5L3GA 3RFRA 2EIKB 5D5QA 2WWWA 5LYJA 4JI2B 1I7FA 4U7OA 3BY6A 2CTPA 4I4TA 1Q6IA 3RYHB 4E2LA 1BQ0A 3B4SA 5JQGB 4DR6O 1NU1H 3ZHVA 1FYJA 2GTAA 4DV6B 1XREA 2P67A 3EHBB 4DRXA 2GTSA 4UCUA 2ZNIA 2XASA 5CBGA 4ASUG 4AILC 2X6BA 4I0XB 2QKAA 4KUMA 5B66Z 2EZOA 4PD4F 2YI8A 1KP3A 3CJHA 1TUEB 1IBLB 2F23A 2MK3A 1QR8A 5J9PC 3QO7A 1VQPV 2ZDIC 1L8DA 5IE9A 4DV3B 3CB2A 1Y6XA 1FAFA 3OMNB 3UCSC 5C8YA 2F1MA 3UQ8A 4DV5O 2D2CB 3MDSA 4IL6Z 2W6IG 1FFXA 4CS2A 5A9GA 1NBMG 4JYCA 2Q5ZA 1FD9A 1WP8A 1AP6A 2ZE8A 3U0ZA 4JI3O 1SESA 1R73A 4DR3O 4KHPB 5FNVA 4PJ0Z 3K3WA 4FIPC 3ABMB 4OX9O 4FLYA 2QKSA 3X2QC 2P90A 4JZ2A 1Y66A 2WLHA 2A06H 1V9PA 3FB5C 2ZNJA 2YXHA 2W0XA 2YXYA 3I56V 2ZM6O 1JOYA 2N05A 4DW1A 1TVKA 2DOSA 2VQFO 3CCRV 3ZS8C 1XQ8A 1M93A 3B8NA 4B3MB 3HKDB 1Q82W 1XL4A 5B3SC 5CBHA 4DR5B 2QE7G 1L1FA 1FXKB 4YJ2B 3OE7G 1IBKO 2EINB 1K97A 3IGAC 4HAMA 3CCSV 4GKJB 1JFFB 4MVSA 5B3SB 2E3CA 2CE4A 2M7WA 4FFBA 4H13B 4QE9A 4TUYA 3SDLA 5IJ9B 4HNAA 1KU9A 1YVWA 3IC9A 1K73W 3Q4HA 5IY5C 2HR3A 2IH1C 1WN7A 4NXNO 5GW7A 1UFIA 5EBWC 3TXSA 4JF3A 2QWPB 4RO2A 2XUMA 5LMNO 4RUFA 1NS1A 2D3OW 4DR5O 2AHZA 2JIZG 2QM7A 2EIJB 1XHXA 2DYRB 2OIGA 3RYFB 5EZYA 1NTKH 3D36C 2AW9A 5L3BA 1M1KW 3F7YC 3L75H 3N27A 2YIAA 3ABTA 4QGPA 4D7SA 1NR7A 3BHPA 2YEVA 4ZHQB 1GAXA 4X1YB 3L9DA 4Z1MG 1EZVH 3OAAG 1MOFA 2ZINA 3B77A 5JQGA 1QVFU 5AG2A 4F4LA 1TAEA 3E89A 4P30A 3RYHA 4LFBO 4NXNB 5LOVA 4GKKO 5B1OA 4OPAA 1AVMA 3N2GB 4OGQB 2IJHA 3EFFK 1EN6A 1ORQC 3UM7A 1N32O 2EIMB 1G8MA 5IYCO 3W7UA 1XDCA 3CCVV 3CX5F 3ICXA 4UFZA 4CH4A 1QLEC 1XMQO 1WA8B 1SQXH 1NKDA 2YEVB 4QNHB 1UPGA 5CA1A 4JV5O 4BIOA 2ZCEA 3M99B 4PA7A 1FXKC 1P7BA 2L6LA 4WBNB 4NR1A 3T4DA 3CCLV 1AP5A 1QLEB 2OCHA 3SJQC 4MTOA 1US6A 3IC7A 5TISZ 2WLIB 3DGEA 2L35A 4UVBA 3SPIA 1VF5B 3AG3C 4X9QA 3DC6A 5D5PA 1SQFA 2Q9LA 1VQNV 2P7TC 4U3JA 2WPDG 4QE7A 2QR4A 2VRZA 3DXRA 5L3CA 4CC6A 2P4VA 3JD3A 1YJNV 1S77D 1WPBA 4DV2O 3ZX6A 2BE3A 1Q90D 1P4RA 2DYSB 4DYLA 1PL0A 1Q8IA 4DUYB 2P6JA 4LF6B 1PNKA 2F4VB 2QKCA 1RM1C 4AI8A 5CA1B 5BY1A 2A79B 1SQVH 2XHBA 5J2UB 3H1JH 1G6UA 2E5LO 4ZOLA 2F66C 3JALB 3NXSA 3TJTA 1TUBB 1S76D 4JI5O 2EJRA 1VQ8V 1ENVA 3G67A 2FB5A 1K4DC 3CSXA 4H0LB 5F2VO 1XHZA 3RYCA 3LSUA 2P4KA 4LP8A 4UCSA 3CP1A 1WNSA 1OCOB 3OGCC 3P3PA 2GBOA 1JMKC 1N33B 1NVPD 2V7QG 2YS8A 3GVMA 2BOBC 1BT8A 3VQVA 1LNQA 4P9PA 1F51A 1PNLA 1TA8A 1AB3A 2ILMA 2V1DA 3OUFA 2VWJA 2FKXA 2Z0AA 2A9HA 4EFBA 1PKXA 5KAIZ 4FZ1A 5J2TB 4JTCB 3VQXA 2DQ3A 1HNXO 4QPJA 4RUEA 2CUGA 3CPWU 3WFVA 5BR8B 2PZSA 2JVDA 2ADPA 2NLJC 1MSWD 1JQ0A 1WAZA 3OEEG 1WB7A 5CA0A 3RYFA 4JASA 3P3NA 4J80A 4FFBB 2WA4A 3OTOB 1ZAUA 2JGDA 3CJHB 2OTLV 2UXNA 4QPKA 3L70H 4R7CA 1QQCA 2YI9A 5KHHA 3KZIZ 4IGGA 1YI2V 2UXCO 5DECA 4O4JA 4LF7O 4GX2A 1HNXB 1XNRB 5ITZB 1Y67A 3CMAV 1JJ2U 1NT2B 1THZA 1VQ6V 2M6YA 4K0KB 4EEQA 1Q5OA 1SS3A 4J11A 3STLC 1OCCB 1I0HA 3K9AA 1EN5A 3L73H 3SPGA 4LFCO 2B9ZA 3ABKB 4BIZA 5CB4B 2O57A 3WU2Z 4GX1A 5DEDA 2JS5A 2A3QA 1YXBA 4NTXA 3MHHC 3OW2U 4I9WA 5LMNB 1VEWA 1VMGA 1LUVA 3BVOA 1XMOO 2QM8A 1BS3A 5K1XA 1DLBA 1KKCA 2LGQA 2XAJA 2QWOB 4PHZA 4MW8A 1B3QA 4DV1B 1SZTA 1E1QG 3JAWB 2GDSA 5IJ0B 1ZX3A 1ROPA 4DR3B 2X7RB 3CWBH 3E83A 2AZ2A 4I50A 1VIBA 2GUZB 2Y4UA 1R3LC 2QWQB 3TGUH 1O9HA 3ZMVA 1AI7A 5EIBD 3PJSK 4K35A 2DMXA 3Q4HB 2Q8VA 1O9GA 2OCCB 1Q7YW 3LNNA 2WLIA 1AI5A 3JAMN 4PA3A 5LGNA 1MABG 5C8YB 3ZMUA 3CCUV 1K5SA 3GB7C 4DW0A 3SJAC 3AG7A 1V55C 3X2QB 5A2QN 3FX7A 3T1YB 4B3MO 3RBZA 1AJNA 4Z1VA 3CYOA 4G27B 1FJGB 2NN4A 1ZTEA 4YXWG 3W7SA 2WLLB 4I50B 4TWKA 4PI0A 5LGTA 5FPOA 5IJ0A 3WB0A 3VQWA 1Y74B 3H1KH 4ZKIA 1K4CC 4DXWA 4P9OA 1GM8A 5LMUO 1IURA 1K7DA 1CEZA 1NH2B 4X88A 3SYOA 1M57B 4MS2A 4KFMA 4X66O 1Q3EA 4IHJA 4X64O 5BXZA 4B3RO 1VF6A 1BCCH 3UO2A 1ZL8B 1OZ0A 3S3WA 3AEIA 2UUAO 4NKGB 2QM4A 3ZHSA 1COWG 1FKAO 4NTWA 3OUSA 3ABUA 2UXDB 4EB6A 4ZBMA 3ZEDA 3BEHA 4FZ0A 2BTOA 2VQEB 4J7ZA 5KHGA 2CH7A 1R6TA 4JI0O 1U96A 5LGUA 2ZM6B 5EYPA 2ARHA 4LWSA 3IAYA 4GKKB 2JJ2G 3A0HZ 3G6EV 4EFEA 3HR0A 1IBMB 5H5NA 2JJ1G 3B8MA 3QO5A 5L3EA 3J81N 2Y69B 3K03A 4UCRA 4AQYO 1IBKB 3J80N 1JJOA 5KA5A 4IT5A 1N33O 3ZRWB 5LHHA 1RSOB 1VQ5V 2F43G 4QJFB 4UCTA 1VQLV 3W7TA 4D7TA 3E8GA 5LXTA 4DV0O 1CPYA 4JYBA 1BQZA 1PD3A 1VF7A 4JI0B 4DR2O 2ATKC 2K9PA 3RT3C 4FK5C 3SJCC 3FAVA 2Y4TA 3FKSG 4LF5B 2DWDC 5L3FA 2YXLA 1BZKA 3JD0A 2YSUB 2KG7B 1AI4A 5EIBC 5LP6A 4PELA 2YIBA 2QWNB 1GO3F 3W7XA 1S72V 2IJIA 3JASB 4X20A 1HNZO 3RVYA 4NXMB 4GZRB 1GMGA 3D8CA 1S0VA 3APOA 5LL6Y 5J2UA 4DUZO 3JAKA 4FLZA 5CB4A 2HP8A 3FYIB 3F7VC 2KKWA 1YF2A 3N2GA 5E79Z 1JCHA 2C2AA 5EBMC 3ZRSA 3P30A 3ZRWA 2JS3A 1XEQA 5LOVB 2VS0A 3VBBA 2EINC 1AI6A 1QHTA 5JJJB 1R3IC 4KXRA 3GWKC 5K1PA 4YIPA 1OCZC 5FNVB 3AG1C 4JI8B 1RP3B 2DYSC 4LF4B 1EFRG 1ZWIC 3T1HB 2HKOA 2OTJV 4LFCB 4DV4B 1W59A 1I94O 5DM6V 2KB1A 1Z2GA 5H6RA 1NR1A 4I55A 4YHHB 1K5QA 5CA0B 3WG7C 2IH3C 3FB7C 3ETGA 2LO1A 4F6RB 4H33A 4U3JB 1U97A 2PYLA 4O4LA 1FXKA 3D3IA 1GN6A 3HKDA 1XMOB 5JJNB 1W0KG 3ZCCA 2IU0A 4O4IB 2JEXA 4JI8O 3JASA 2WA3A 2EJ7A 3K79A 2VWKA 1J5EB 2RDCA 1RM1B 1W2BU 1JFFA 4IHJB 4CH6A 2BOCC 5DN6G 3ZN0A 1Q43A 1SA0B 1DGSA 3K58A 5EBLC 5GTHZ 4UVCA 1SZXA 1I5XA 4MSWC 1KP2A 1JR9A 4TT3G 4XBFA 2UXXA 3E8BA 3CE2A 4GX5A 4GYCB 1JX9A 3OMIB 5KX5A 1ZL8A 2EX3A 4JI6B 2H3OA 4I4TB 1PM9A 4B3SB 3F5WC 3QF7A 3HKCB 4O4HA 3BA8A 4ZOLB 1V54B 1URFA 2DE0X 3OTOO 5GONA 2E5LB 1HP8A 1YTFD 3SYAA 4LH6A 2HHHB 3AG4C 4DR7B 4UCVA 1J5EO 5H6QA 3T1CA 2Y0IA 4O2BA 2UXCB 1H2LA 4NTYA 1FFXB 3O65A 4EKWA 1L0NH 1AR5A 3SGIA 1I5YA 4DV7B 4KHPO 5B1BB 2UUCB 1F4MA 3AG4B 1R6NA 4HYOA 4CS4A 4DR4O 2N74A 1QCEA 4NYKA 4FLVA 1M56C 1TGOA 1KD1W 4JI4O 2A0LA 2CAZC 3HKEB 3CHXA 4WFBV 3CRMA 4CS3A 5J2TA 4D6TH 4JAAA 5KMGB 4DR7O 1MZEA 1NTZH 3OEHG 4X1IA 3RYIA 3GWOA 3L71H 1D5AA 3CEIA 2UUBO 1IXBA 1L0LH 1HNWO 1OCCC 1WJZA 1JPXA 3ZMZA 1GM9A 3HKCA 4O4HB 2LP7A 1EN4A 4BW5A 1MSDA 2R70A 2XAGA 4UXNA 2Q67A 4X20B 2UXBO 4LF8O 3ETDA 3BPZA 2ZIMA 1QVGU 3W7WA 1Q6UA 1ZSPA 1SKVA 4WFAV 1I94B 3B09A 1VQ7V 2KG7A 4DRXB 2WLKA 4YHHO 1SC5B 3A0BZ 2CDYA 1AR4A 2Z3YA 2WLMA 3A2FA 4PDLA 4MTFA 1I08A 3WB1A 4MVQA 1H8EG 1XOUA 4UB6Z 4BR6A 2EBOA 1IBMO 4MVZA 2UUBB 3JALA 5ITZA 3RGBA 1HNWB 2DWEC 4ZHQA 4DV5B 4A5UB 2QJ1A 2BSKB 2XNDG 2E74B 2W6JG 3BAAA 5LA6A 3RYIB 2UXBB 4I7ZB 1D2DA 1X59A 2JGUA 4NB5A 2RQ6A 3PN1A 1RPOA 4J7JA 4K3AA 1PPJH 1B04A 1VARA 2N04A 1K9MW 3JSLA 3DC5A 3KCXA 2KQXA 3HKEA 1GN3A 2EILB 5FLXN 2YIDA 5EK0A 4LF9B 4JYAB 2YICA 3A0RA 4TOIA 4PDVA 3MHSC 3UO3A 4B7EA 4DR6B 4N21A 2LFSA 5IWAB 3JD2A 1P7GA 3EXAA 3H1LH 4FVMA 4I9QA 4TQFA 4UB8Z 4OPHA 2HHHO 4U3FH 4X66B 3T4ZA 3E35A 4XDJA 4NXMO 4JTDB 5LA6B 2GUZA 1OV9A 2YUAA 2Y0PA 2HVKC 4J10A 1YITV 1F23A 1SRYA 4JYAO 4IYIA 3ZHQA 1EBOA 3CCMV 2R72A 2Q6AA 4MVUA 3M7MX 2BTQA 3U10A 3ABMC 1VF6C 2Y48A 4ZI7A 1R3JC 3CCJV 2OIEA 2EIKC 4W4KA 1PL4A 4MTGA 4JI3B 1M9NA 3C90A 1SETA 2K1EA 4O2AB 4R8CA 1WPXA 1VQOV 4FLXA 3K06A 1H8HG 4KL1A 3CRRA 3SPHA 3K08A 1NTMH 2ETNA 3QNEA 1JA8A 4WF9V 3K5NA 2Q7HA 1F4NA 3HKBB 2WAMA 3ML0A 3G80A 1M90W 4MTXA 4NVPA 3TK1A 1KYOF 1Q81W 1Y76B 2VQFB 3EVKA 3ETQA 5KMGA 2Q7GA 2R9AA 3E2EA 3ASOB 4HBNA 3E86A 4FPPA 3STZC 1M5IA 3K5MA 2AHYA 5JH7B 1PP9H 2JK5C 2B1GA 1DK1A 1KUQA 2YC0A 3ZIAG 4YY3B 2PGGA 4GKJO 3ZRVA 4JI1B 1XMQB 4KP4A 1IVSA 2EIJC 5H9CA 3C3TA 1N34O 1BE3H 2ZQMA 1IX9A 3JYCA 3ASNC 4IIJA 1UJWB 4LF9O 2DN9A 1E1RG 4I0XA 5BMVB 4JAVA 3K57A 3AK2A 1K92A 5IWAO 4DV7O 1EM1A 3KCYA 3TCUA 1VQMV 5GONB 4RQFA 2BSKA 3B40A 5JJEB 4DR4B 4LF4O 4XDKA 1V54C 3L74H 3FAVB 3T1HO 4O4IA 5KX5B 3K5OA 4AHCA 4DV2B 2WLNA 2FMLA 3R65A 4FM2A 2EIMC 4J41A 1HR0O 4DV0B 4LR3A 4B3TB 2PI5A 1X4TA 2NNUA 4P2ZA 3SPCA 1GKFA 4QIWF 4LF6O 4LFBB 2HLDG 2V4DA 1KKDA 2JGDB 3IJ4A 4IYHA 4DK0A 1H38A 4LF7B 3ZHRA 1MZFA 5KHJA 1QLNA 1DF5A 3CC4V 3RWRD 4X1IB 2PF4E 1OJHA 1H2MA 1EZJA 1VQ4V 4X64B 1GN4A 1KECA 2ZR2A 3AG3B 4I55B 3E8HA 3HPLC 3AG1B 4LCUC 2PI4A 3QVNA 1N0NA 2BCCH 3N2KB 1N8RW 5IT9N 5H2FZ 1RFYA 3CXHF 3G6BA 4JTAB 4WBNA 3BFRA 2DJVA 1GN2A 2Q0OC 4DV6O 2VQEO 4X89A 4HNAB 3TETA 5IYBO 2KSDA 2ZE5A 5KAFZ 2P06A 1MA1A 5IDJA 4JYYA 1OCOC 2IU3A 2GSMB 1AROP 3FB8C 4ICGA 3JCZA 2ZXWB 3ASNB 4EB6B 4X1KB 5B1AC 4F6EA 1VQKV 1YJ9V 1XI1A 3AG2B 3LNMB 5BZBA 4H37A 4R50A 2RMKB 3APQA 2BTQB 2QTSA 4O2AA 3BCCH 3H9VA 3VOUA 4FM0A 4PV1B 4G28B 4UVAA 4DUYO 1BL8A 1KMIZ 3OM3B 3OD4A 4WCEV 3MAQA 3QO8A 4FMTA 4RWUA 2YIBD 3E22B 1TUBA 1FXVA 3CMEV 3ZMTA 4O4LB 1N34B 4JGSA 1FPOA 4J42A 1RSOA 1GH6A 4WFHA 4BIUA 4JAUA 1J95A 3FB6C 3K0DA 1JVMA 2LW7A 1Z5VA 3N2KA 1FJGO 2F93B 3L72H 5L3DA 1CXZB 4K8ZA 2H94A 2NR5A 1BGYH 5KHKA 2P22C 4OX9B 2Q4PA 1Y76A 1VQ9V 4FJCC 2X6CA 4K0KO 3SYQA 4JI7B 4LFAO 3RVZA 5KUKA 4L8JA 2XAQA 2R9RB 1Q6HA 2CGOA 5LMUB 2UU9O 4RAIA 2OT5A 4BW9A 4UV8A 4DK1A 3SYPA 2DQ0A 3DTUB 3SYCA 3DXRB 1OCRB 1RPRA 3K59A 1DF4A 4B3RB 1VP7A 4HZ3A 1NI8A 1KB9F 3OR6C 4GLXA 1NH2D 3JAKB 2AZ0A 3WB2A 1S5LZ 2UUCO 5CMUA 4CZZA 3P32A 3CXCU 1N0JA 3JATB 2CTRA 5FL7G 4LFAB 1MNGA 4C7UA 3NR7A 2IBZH 4J9ZB 1IBLO 2IW5A 2ADQB 2A7WA 3QTCA 1SA0A 3U11A 1NJIW 1SQBH 1LR1A 4CBCA 2F95B 4Q20A 4FM1A 3E8FA 4ABMA 3ABLB 1K8AW 2X0LA 3ETEA 1XNRO 2HVJC 5KHIA 3JD1A 1B06A 2CTQA 1GK9A 3UT5A 3ABLC 3UKMA 4PDRA 2OWOA 4DR1B 2R9IA 4LC1A 5IY5B 1NVPB 1FFTB 1XNQO 1YSCA 1KBHA 4JI2O 2CK3G 4DR2B 4YJ3A 3CRCA 1N4CA 2PUSA 4F6RA 1G4YB 3BA9A 2QEXV 1YIJV 4ZIBA 2ZD9A 4MT8A 1H2GA 5EZYB 4FLUA 4LNUA 3ASOC 4B3SO 5JH7A 3K04A 2LJ2A 1SERA 3M8AA 2EILC 2X6AA 3D3QA 2XTAA 1W0JG 3DSQA 1SQPH 4PA6A 3ZHUA 3B2EE 3I55V 1YTFB 4O2BB 1BHBA 2CTWA 2HEPA 1S5JA 4PA4A 3IFXA 2OCCC 3LSQA 2JRIA 4GCZA 4K8XA 2CGNA 4DUZB 2RNBA 3S3XA 3A8TA 3BRCA 3JARB 5CN0A 4MVOA 3ZBHA 5CA3A 2UXDO 4H44B 1V55B 2ZE6A 5HFMA 4XDLA 1DTOA 2FTKA 5LHIA 5LYJB 3K9SA 1SQQH 1WB8A 2UU9B 5HFLA 2ZKOA 1R6KA 1YDXA 4RQEA 1WP7A 4MVRA 1GTOA 4GX0A 3ABKC 4MVMA 2GHYA 4WFEA 2QA4V 3CRQA 2ZT9B 4PI2A 4WFGA 3CD6V 2P5OA 4MW3A 4TV9A 1SQGA
chains in the Genus database with same CATH topology
4R8CA 1WPXA 3OE7G 3OUSA 1QBZA 1VQOV 3OFNG 2EINB 3ABUA 3K06A 1H8HG 1K97A 3CC2V 3IGAC 4HAMA 3SPHA 3CCSV 3K08A 4UUJC 4ZBMA 2W0FC 3QNEA 4MVSA 3BEHA 5B3SB 2M7WA 4WF9V 3T2MA 3LDDA 4QE9A 4U7NA 1AR1B 1F4NA 2WAMA 2EZPA 3ML0A 5LGUA 1K73W 5IY5C 1YHQV 2HR3A 2IH1C 2XAHA 1M90W 4MTXA 5GW7A 2Q68A 3TK1A 1Q81W 5EBWC 4JF3A 4RO2A 2JJ2G 3G6EV 4RUFA 2JJ1G 1KC8W 2D3OW 3B8MA 3QO5A 3E2EA 2AHZA 2JIZG 2QM7A 3ASOB 2EIJB 3E86A 4FPPA 2ZDIA 1S5HC 3STZC 2DYRB 3ZRXA 5L3EA 2Y69B 3K03A 2AHYA 2JK5C 5EC2C 3ZN1A 5L3BA 2B1GA 1M1KW 3F7YC 3MD0A 3ZIAG 5KA5A 2HJFC 4GT1A 3ABTA 3ZRVA 3ZRWB 5LHHA 1NR7A 1VQ5V 2H8PC 3LDEA 4KP4A 1FXHA 2F43G 2YEVA 4QJFB 2EIJC 1VQLV 1BMFG 3ZRSA 5IYDO 5H9CA 1BHAA 3W7TA 3E8GA 1XL6A 4Z1MG 1CPYA 4JYBA 3OAAG 1MOFA 1PD3A 2ZQMA 3LSSA 3B77A 3ASNC 3JYCA 2ATKC 1UJWB 4F4LA 4FK5C 1QVFU 1Y4MA 1E1RG 3E89A 4P30A 5KA6A 3FKSG 2DWDC 3RW0A 4JAVA 5B1OA 5L3FA 1OHHG 4L87A 1K92A 3JD0A 4N23A 3KG2A 2YSUB 1FS0G 3TCUA 1AI4A 1VQMV 4RQFA 2IJHA 3EFFK 2ZR3A 1ORQC 3HB3B 1CP9A 3UM7A 4PELA 2EIMB 3CCQV 1G8MA 5IYCO 3W7UA 1K3EA 4BAYA 3CCVV 4TSFG 5CBFA 1GO3F 4WFFA 4XDKA 1V54C 1M57C 2IJIA 3W7XA 1MG1A 1S72V 2LFRA 3RVYA 1QLEC 1GMGA 2WLNA 2JDIG 1S0VA 3R65A 2EIMC 1NKDA 2YEVB 5B1NA 4QNHB 3FYIB 3F7VC 1Q86W 1OCZB 2B5UA 2PI5A 3SPJA 3M99B 2NNUA 1JCHA 2C2AA 4PA7A 5EBMC 3P30A 3ZRWA 1FXKC 1HWYA 1P7BA 4P2ZA 1GKFA 3SPCA 4QIWF 3T4DA 3CCLV 2HLDG 1QLEB 3VBBA 2EINC 1AI6A 3SJQC 4MTOA 1R3IC 1KKDA 3OR7C 5KUMA 3IC7A 4PA9A 2WLIB 1H38A 3DGEA 4UVBA 3SPIA 2WLLA 3AG3C 1OCZC 3AG1C 1VQNV 2P7TC 4J9YB 1M56B 2DYSC 1QLNA 1DF5A 3CC4V 1EFRG 1ZWIC 2WPDG 1EZJA 5EC1C 3WG7B 4QE7A 5C93A 1VQ4V 5L3CA 1KECA 2ZR2A 3JD3A 1YJNV 1IXMA 2HKOA 1S77D 2OTJV 3AG3B 3CC7V 5DM6V 2KB1A 3E8HA 3HPLC 5H6RA 1P4RA 3AG1B 2WLJA 1R3KC 1NR1A 2HG5C 2JEUA 4LCUC 2PI4A 2DYSB 1N8RW 1PL0A 1PNMA 1K5QA 3WG7C 2IH3C 3FB7C 1GM7A 4I5SA 2P6JA 2DYRC 1PNKA 3ETGA 4JTAB 2Y69C 3G71V 1RM1C 4H33A 2ZXWC 2A79B 1FXKA 4X89A 3TETA 3D3IA 5IYBO 3AG2C 3NXSA 1W0KG 3ZCCA 2IU0A 1S76D 2JEXA 1E79G 2EJRA 5IDJA 1VQ8V 1YJWV 3K79A 2HFEC 1RM1B 1OCOC 2IU3A 2GSMB 1W2BU 2BOCC 1ENVA 1AROP 2QTOA 3FB8C 1K4DC 3JCZA 2ZXWB 3ASNB 4R6ZA 5DN6G 3ZN0A 5LBQA 5B1AC 3G4SV 1VQKV 1AJQA 1YJ9V 3AG2B 2IJKA 3LNMB 5EBLC 2XAFA 4H37A 4LP8A 4R50A 5BZBA 4UVCA 1I5XA 3CP1A 4MSWC 1KP2A 4TT3G 3VOUA 4XBFA 1OCOB 3OGCC 4G28B 4UVAA 2UXXA 3E8BA 1BL8A 4GX5A 1JX9A 3OM3B 2B1IA 3OMIB 4WCEV 5B1AB 3QO8A 4G2KA 4FMTA 1NVPD 2V7QG 1K34A 1KQSU 3F5WC 1FXVA 3CMEV 1V54B 2BOBC 3ZMTA 1LNQA 4P9PA 1F51A 1PNLA 3H01A 5B1BC 1YTFD 3SYAA 4JGSA 3AG4C 2V1DA 3OUFA 3FYEB 4WFHA 4BIUA 4JAUA 5H6QA 2Z5UA 3K0GA 3T1CA 1J95A 1AJPA 3FB6C 2A9HA 3K0DA 1PKXA 3OMAB 1JVMA 2DW4A 4EKWA 4JTCB 1I5YA 2DQ3A 5B1BB 3JD4A 1F4MA 5L3DA 3AG4B 4QPJA 4RUEA 4OXSA 2H94A 4PDMA 1R6NA 3ZMSA 2WSSG 3WFVA 3CPWU 4HYOA 1VQ9V 3D36A 4FJCC 1QCEA 1S3JA 2X6CA 2XOKG 1QR9A 3SYQA 2NLJC 4UV9A 1JQ0A 3RVZA 1M56C 5KUKA 1MSWD 2IJJA 1KD1W 2XAQA 3ZJZA 2R9RB 3OEEG 2A0LA 3LUTB 2Q69A 4JASA 4RAIA 4WFBV 3CCEV 1WLEA 2OT5A 4DO2A 4UV8A 3SYPA 2DQ0A 2OTLV 3LDCA 3DTUB 2UXNA 3SYCA 4QPKA 4R7CA 1K33A 1OCRB 1RPRA 5LHGA 3OEHG 1DF4A 1YI2V 4HZ3A 3GWOA 2ITCC 3OR6C 1NH2D 1NQTA 1OCCC 1JPXA 4GX2A 5CMUA 4CZZA 3ZMZA 3CMAV 3P32A 1GM9A 2LP7A 3CXCU 1JJ2U 4BW5A 1OCRC 2XAGA 4UXNA 2Q67A 4X8AA 4JPRA 4LBEC 1THZA 1VQ6V 3ETDA 3STLC 5FL7G 2ITDC 1QVGU 5E1AC 3W7WA 1OCCB 4J9ZB 3K9AA 1B6QA 3SPGA 2IW5A 4WFAV 3ABKB 4BIZA 1VQ7V 5L3GA 2EIKB 2WWWA 4GX1A 2WLKA 4U7OA 2Z3YA 2WLMA 3BY6A 4PDLA 1NJIW 4MTFA 3MHHC 4E2LA 3OW2U 4I9WA 4MVQA 1H8EG 4CBCA 4Q20A 2EBOA 4MVZA 3E8FA 2P67A 3ABLB 2DWEC 3EHBB 1K8AW 2X0LA 3ETEA 2XNDG 2W6JG 2XASA 2HVJC 2QM8A 5CBGA 1DLBA 3JD1A 4ASUG 2XAJA 4MW8A 2X6BA 4KUMA 2EZOA 1RPOA 1SZTA 1GK9A 1E1QG 1KP3A 3ABLC 1TUEB 3UKMA 4PDRA 1ROPA 1K9MW 2X7RB 3E83A 2R9IA 4LC1A 5IY5B 1NVPB 1FFTB 2MK3A 1YSCA 2EILB 1QR8A 1R3LC 3QO7A 2CK3G 5J9PC 1VQPV 3ZMVA 5EK0A 1AI7A 3A0RA 4PDVA 1G4YB 2QEXV 1YIJV 3PJSK 2ZDIC 2ZD9A 4MT8A 3MHSC 1H2GA 4N21A 2LFSA 3ASOC 3JD2A 2OCCB 3OMNB 3K04A 1Q7YW 1SERA 2EILC 2X6AA 1W0JG 2WLIA 1AI5A 4PA6A 4PA3A 5LGNA 1MABG 2W6IG 3ZMUA 3CCUV 1K5SA 3I55V 1NBMG 3GB7C 1YTFB 4JYCA 1BHBA 3T4ZA 4PA4A 1V55C 3IFXA 3E35A 2OCCC 3X2QB 4XDJA 4JTDB 1SESA 1R73A 3LSQA 3RBZA 4GCZA 1AJNA 3CYOA 4G27B 4YXWG 3W7SA 2WLLB 2HVKC 3K3WA 4FIPC 1YITV 5CN0A 1F23A 4MVOA 1SRYA 5CA3A 3ABMB 4TWKA 5LGTA 1V55B 2QKSA 3X2QC 5HFMA 4XDLA 1EBOA 2P90A 1Y66A 3CCMV 2WLHA 1DTOA 4ZKIA 2FTKA 1K4CC 4DXWA 5LHIA 4P9OA 2Q6AA 3FB5C 1GM8A 4MVUA 1K7DA 1CEZA 1NH2B 5HFLA 4X88A 1R6KA 3ABMC 4RQEA 2Y48A 3SYOA 4MVRA 1M57B 1GTOA 1R3JC 3ABKC 4GX0A 3I56V 4MVMA 3CCJV 1JOYA 2EIKC 4MS2A 4KFMA 2GHYA 4WFEA 2QA4V 4MTGA 3CCRV 1M9NA 4WFGA 3CD6V 1SETA 2K1EA 1OZ0A 3B8NA 3AEIA 4MW3A 1Q82W 1XL4A 5B3SC 5CBHA 2QE7G 1L1FA 1COWG 1FXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8C A;  2HVJ C;  5B1B C;  4QNH B;  3F7V C;  3SYA A;  3OUS A;  5CBG A;  3AG4 C;  3OUF A;  3SPJ A;  3K06 A;  4PA7 A;  5EBM C;  3ZRS A;  4WFH A;  3IGA C;  1P7B A;  4P2Z A;  3SPC A;  3SPH A;  3T4D A;  3K0G A;  3T1C A;  1J95 A;  3K08 A;  4MW8 A;  4UUJ C;  4ZBM A;  2X6B A;  3FB6 C;  2W0F C;  2A9H A;  3K0D A;  2EIN C;  4MVS A;  3SJQ C;  4MTO A;  1JVM A;  1R3I C;  3BEH A;  3ABL C;  4EKW A;  4JTC B;  1KKD A;  3OR7 C;  5KUM A;  3UKM A;  4PA9 A;  4PDR A;  3E83 A;  2WLI B;  3T2M A;  3LDD A;  4QE9 A;  3SPI A;  2WLL A;  3AG3 C;  1OCZ C;  4RUE A;  4OXS A;  4PDM A;  3AG1 C;  1R3L C;  5J9P C;  4HYO A;  2P7T C;  4J9Y B;  5IY5 C;  5EK0 A;  2DYS C;  2IH1 C;  2X6C A;  3SYQ A;  4PDV A;  1G4Y B;  2Q68 A;  1ZWI C;  5EC1 C;  2NLJ C;  3PJS K;  4QE7 A;  5EBW C;  1M56 C;  2ZD9 A;  3RVZ A;  5KUK A;  4RO2 A;  3ZJZ A;  2R9R B;  3ASO C;  4RUF A;  2A0L A;  3LUT B;  3K04 A;  2Q69 A;  4RAI A;  2EIL C;  2KB1 A;  2X6A A;  3E8H A;  3HPL C;  4LCU C;  2WLJ A;  1R3K C;  2HG5 C;  2WLI A;  2AHZ A;  3E86 A;  1S5H C;  4PA3 A;  4PA6 A;  3STZ C;  3SYP A;  3LDC A;  3K03 A;  2AHY A;  3GB7 C;  2JK5 C;  5EC2 C;  4R7C A;  3SYC A;  2IH3 C;  3WG7 C;  3FB7 C;  3T4Z A;  3F7Y C;  2HJF C;  2DYR C;  4JTA B;  4PA4 A;  1V55 C;  2Y69 C;  3IFX A;  2OCC C;  4HZ3 A;  4XDJ A;  2H8P C;  3LDE A;  4H33 A;  4JTD B;  2ITC C;  2ZXW C;  3OR6 C;  2A79 B;  2YEV A;  2EIJ C;  3RBZ A;  1OCC C;  4X89 A;  4G27 B;  3TET A;  4GX2 A;  2WLL B;  3AG2 C;  1XL6 A;  3E8G A;  2HVK C;  4MVO A;  4BW5 A;  1OCR C;  3JYC A;  3ASN C;  2Q67 A;  2ATK C;  4LBE C;  4TWK A;  4X8A A;  4F4L A;  2HFE C;  2QKS A;  1OCO C;  3E89 A;  4P30 A;  3X2Q C;  2BOC C;  2DWD C;  2QTO A;  1K4D C;  3FB8 C;  4XDL A;  4R6Z A;  3RW0 A;  3STL C;  2ITD C;  2WLH A;  5E1A C;  5B1A C;  1K4C C;  4J9Z B;  4DXW A;  4P9O A;  2Q6A A;  3FB5 C;  4MVU A;  3SPG A;  3KG2 A;  3LNM B;  5EBL C;  4LP8 A;  4H37 A;  3TCU A;  4R50 A;  5BZB A;  4X88 A;  3EFF K;  3ABM C;  4MSW C;  1ORQ C;  4GX1 A;  3UM7 A;  3VOU A;  3SYO A;  2WLK A;  3OGC C;  4G28 B;  1R3J C;  4GX0 A;  3ABK C;  3E8B A;  1BL8 A;  4GX5 A;  4MVR A;  4MVM A;  4PDL A;  2WLM A;  2EIK C;  4MS2 A;  4KFM A;  5CBF A;  4MTF A;  4WFE A;  4WFF A;  4XDK A;  1V54 C;  1M57 C;  4I9W A;  4MVQ A;  4MTG A;  4CBC A;  4WFG A;  3F5W C;  3RVY A;  2K1E A;  1QLE C;  4MVZ A;  3E8F A;  2WLN A;  4MW3 A;  1XL4 A;  2BOB C;  5B3S C;  3R65 A;  2DWE C;  2EIM C;  5CBH A;  1LNQ A;  4P9P A; 
#chains in the Genus database with same CATH topology
 4AQY B;  1QBZ A;  3OFN G;  4X62 O;  3CC2 V;  3AK3 A;  4LF8 B;  4UUJ C;  2W0F C;  5B5E Z;  4FLW A;  1XUQ A;  2Q7E A;  3JAT A;  3T2M A;  2E75 B;  3JAR A;  3LDD A;  4U7N A;  3C3S A;  1AR1 B;  4X1Y A;  2LQT A;  1PV0 A;  2EZP A;  3R66 A;  3JSN A;  1YHQ V;  2XAH A;  4GUN A;  4Q6G A;  1YEW A;  4LF5 O;  2Q68 A;  4LWS B;  2PTM A;  4X65 B;  1T5E A;  2RCV A;  1KC8 W;  3O9O A;  2HJD A;  1S5H C;  2ZDI A;  3CS5 A;  3BAB A;  3ZRX A;  1N32 B;  4W4L A;  5EC2 C;  3SJB C;  4JI6 O;  3MD0 A;  5JVD A;  2HJF C;  1XIL A;  2LGW A;  4GT1 A;  3QG5 A;  3THO A;  2H8P C;  3FFQ A;  3LDE A;  1FXH A;  1Z5W A;  2QWR B;  3TXQ A;  1BMF G;  2PYJ A;  5IYD O;  1BHA A;  1HR0 B;  1WA8 A;  1XL6 A;  1XNQ B;  4CH5 A;  3LSS A;  4J7K A;  2RN9 A;  1Y4M A;  4BWA A;  5KA6 A;  3RW0 A;  1OHH G;  4L87 A;  1H2K A;  4Z2W A;  4X65 O;  4N23 A;  3KG2 A;  1FS0 G;  3OT7 A;  2AGA A;  2ZR3 A;  3H1I H;  3HB3 B;  1CP9 A;  4TV9 B;  2OYQ A;  2ZE7 A;  3CCQ V;  4X1K A;  1K3E A;  4BAY A;  4TSF G;  5BMV A;  5CBF A;  2ODM A;  4JI7 O;  4WFF A;  1G1X B;  2QSA A;  1M57 C;  5LP6 C;  1MG1 A;  4IIJ B;  2LFR A;  4JI1 O;  2XT9 A;  4JI4 B;  4ZI7 B;  2JDI G;  5GTI Z;  5B1N A;  1M4U A;  1Q86 W;  3OGI B;  5IYZ B;  1OCZ B;  1A32 A;  2B5U A;  3SPJ A;  3RYC B;  1HWY A;  5FPR A;  1QNM A;  4CH3 A;  2F4V O;  2QDO A;  3OR7 C;  5KUM A;  4PA9 A;  4JZG A;  3FD9 A;  1YZB A;  2WLL A;  4O4J B;  2RJZ A;  4J9Y B;  4JI5 B;  1M56 B;  2AXT Z;  3WG7 B;  5EC1 C;  5C93 A;  3SR2 C;  1HNZ B;  1IXM A;  3HKB A;  3CC7 V;  2CH7 B;  3ZN1 A;  2WLJ A;  1R3K C;  2HG5 C;  2JEU A;  4B3T O;  5JCO A;  1PNM A;  4JV5 B;  4X62 B;  1GM7 A;  4I5S A;  2DYR C;  3I5D A;  2Y69 C;  3G71 V;  5EYP B;  2ZXW C;  5JWP A;  1ZLZ A;  3AG2 C;  2YDE A;  4FFK A;  1E79 G;  2FL4 A;  2GV9 A;  1YJW V;  2HFE C;  1TVK B;  2IM9 A;  1MMM A;  1LUW A;  2QTO A;  4R6Z A;  5LBQ A;  3G4S V;  1AJQ A;  3H1H H;  1H2N A;  4DR1 O;  2IJK A;  4DV4 O;  2XAF A;  4YJ2 A;  1P84 F;  4CC5 A;  1P49 A;  3KKY A;  3RN4 A;  4FLT A;  2B1I A;  3E22 A;  3VQY A;  5B1A B;  4G2K A;  4YY3 O;  4DV3 O;  1K34 A;  1KQS U;  4B7K A;  4LH7 A;  1HW7 A;  2MW2 B;  1F7Y A;  3ZHT A;  5LP6 B;  1ZUQ A;  3H01 A;  5B1B C;  4B08 A;  3J7A U;  1N36 B;  3FYE B;  1Y74 A;  2Z5U A;  3K0G A;  1AJP A;  2FYU H;  3T1Y O;  1IZ3 A;  3OMA B;  2DW4 A;  2PY5 A;  1AIL A;  2E76 B;  2Q0A A;  3JD4 A;  5LXT B;  3K5L A;  4OXS A;  4PDM A;  3JCU Z;  2ZIO A;  2WSS G;  1SF9 A;  4LNU B;  4TV8 B;  1XBL A;  3ZMS A;  3D36 A;  1S3J A;  2XOK G;  1QR9 A;  4E4E A;  5JCO C;  1HDJ A;  4UV9 A;  2G38 A;  5JVD B;  1NZ6 A;  1R1B A;  2IJJ A;  4YJ3 B;  3ZJZ A;  3LUT B;  4TQD A;  2Q69 A;  4TUY B;  5IJ9 A;  3CCE V;  1WLE A;  4DO2 A;  2QGN A;  3UT5 B;  3LDC A;  4UCO A;  1D5N A;  3OTF A;  2EUL A;  1YCI A;  1N36 O;  1K33 A;  3CRA A;  1IDS A;  5LHG A;  5IYZ A;  2ITC C;  1H2S B;  2UUA B;  4TV8 A;  1NQT A;  1QU7 A;  3AK1 A;  5KLV H;  1GRJ A;  3F5T A;  5BR8 O;  1OCR C;  4X8A A;  4JPR A;  4LBE C;  3JAW A;  2LW1 A;  1BSM A;  4DV1 O;  2ITD C;  5E1A C;  2Q73 A;  1B6Q A;  4YIO A;  5L3G A;  3RFR A;  2EIK B;  5D5Q A;  2WWW A;  5LYJ A;  4JI2 B;  1I7F A;  4U7O A;  3BY6 A;  2CTP A;  4I4T A;  1Q6I A;  3RYH B;  4E2L A;  1BQ0 A;  3B4S A;  5JQG B;  4DR6 O;  1NU1 H;  3ZHV A;  1FYJ A;  2GTA A;  4DV6 B;  1XRE A;  2P67 A;  3EHB B;  4DRX A;  2GTS A;  4UCU A;  2ZNI A;  2XAS A;  5CBG A;  4ASU G;  4AIL C;  2X6B A;  4I0X B;  2QKA A;  4KUM A;  5B66 Z;  2EZO A;  4PD4 F;  2YI8 A;  1KP3 A;  3CJH A;  1TUE B;  1IBL B;  2F23 A;  2MK3 A;  1QR8 A;  5J9P C;  3QO7 A;  1VQP V;  2ZDI C;  1L8D A;  5IE9 A;  4DV3 B;  3CB2 A;  1Y6X A;  1FAF A;  3OMN B;  3UCS C;  5C8Y A;  2F1M A;  3UQ8 A;  4DV5 O;  2D2C B;  3MDS A;  4IL6 Z;  2W6I G;  1FFX A;  4CS2 A;  5A9G A;  1NBM G;  4JYC A;  2Q5Z A;  1FD9 A;  1WP8 A;  1AP6 A;  2ZE8 A;  3U0Z A;  4JI3 O;  1SES A;  1R73 A;  4DR3 O;  4KHP B;  5FNV A;  4PJ0 Z;  3K3W A;  4FIP C;  3ABM B;  4OX9 O;  4FLY A;  2QKS A;  3X2Q C;  2P90 A;  4JZ2 A;  1Y66 A;  2WLH A;  2A06 H;  1V9P A;  3FB5 C;  2ZNJ A;  2YXH A;  2W0X A;  2YXY A;  3I56 V;  2ZM6 O;  1JOY A;  2N05 A;  4DW1 A;  1TVK A;  2DOS A;  2VQF O;  3CCR V;  3ZS8 C;  1XQ8 A;  1M93 A;  3B8N A;  4B3M B;  3HKD B;  1Q82 W;  1XL4 A;  5B3S C;  5CBH A;  4DR5 B;  2QE7 G;  1L1F A;  1FXK B;  4YJ2 B;  3OE7 G;  1IBK O;  2EIN B;  1K97 A;  3IGA C;  4HAM A;  3CCS V;  4GKJ B;  1JFF B;  4MVS A;  5B3S B;  2E3C A;  2CE4 A;  2M7W A;  4FFB A;  4H13 B;  4QE9 A;  4TUY A;  3SDL A;  5IJ9 B;  4HNA A;  1KU9 A;  1YVW A;  3IC9 A;  1K73 W;  3Q4H A;  5IY5 C;  2HR3 A;  2IH1 C;  1WN7 A;  4NXN O;  5GW7 A;  1UFI A;  5EBW C;  3TXS A;  4JF3 A;  2QWP B;  4RO2 A;  2XUM A;  5LMN O;  4RUF A;  1NS1 A;  2D3O W;  4DR5 O;  2AHZ A;  2JIZ G;  2QM7 A;  2EIJ B;  1XHX A;  2DYR B;  2OIG A;  3RYF B;  5EZY A;  1NTK H;  3D36 C;  2AW9 A;  5L3B A;  1M1K W;  3F7Y C;  3L75 H;  3N27 A;  2YIA A;  3ABT A;  4QGP A;  4D7S A;  1NR7 A;  3BHP A;  2YEV A;  4ZHQ B;  1GAX A;  4X1Y B;  3L9D A;  4Z1M G;  1EZV H;  3OAA G;  1MOF A;  2ZIN A;  3B77 A;  5JQG A;  1QVF U;  5AG2 A;  4F4L A;  1TAE A;  3E89 A;  4P30 A;  3RYH A;  4LFB O;  4NXN B;  5LOV A;  4GKK O;  5B1O A;  4OPA A;  1AVM A;  3N2G B;  4OGQ B;  2IJH A;  3EFF K;  1EN6 A;  1ORQ C;  3UM7 A;  1N32 O;  2EIM B;  1G8M A;  5IYC O;  3W7U A;  1XDC A;  3CCV V;  3CX5 F;  3ICX A;  4UFZ A;  4CH4 A;  1QLE C;  1XMQ O;  1WA8 B;  1SQX H;  1NKD A;  2YEV B;  4QNH B;  1UPG A;  5CA1 A;  4JV5 O;  4BIO A;  2ZCE A;  3M99 B;  4PA7 A;  1FXK C;  1P7B A;  2L6L A;  4WBN B;  4NR1 A;  3T4D A;  3CCL V;  1AP5 A;  1QLE B;  2OCH A;  3SJQ C;  4MTO A;  1US6 A;  3IC7 A;  5TIS Z;  2WLI B;  3DGE A;  2L35 A;  4UVB A;  3SPI A;  1VF5 B;  3AG3 C;  4X9Q A;  3DC6 A;  5D5P A;  1SQF A;  2Q9L A;  1VQN V;  2P7T C;  4U3J A;  2WPD G;  4QE7 A;  2QR4 A;  2VRZ A;  3DXR A;  5L3C A;  4CC6 A;  2P4V A;  3JD3 A;  1YJN V;  1S77 D;  1WPB A;  4DV2 O;  3ZX6 A;  2BE3 A;  1Q90 D;  1P4R A;  2DYS B;  4DYL A;  1PL0 A;  1Q8I A;  4DUY B;  2P6J A;  4LF6 B;  1PNK A;  2F4V B;  2QKC A;  1RM1 C;  4AI8 A;  5CA1 B;  5BY1 A;  2A79 B;  1SQV H;  2XHB A;  5J2U B;  3H1J H;  1G6U A;  2E5L O;  4ZOL A;  2F66 C;  3JAL B;  3NXS A;  3TJT A;  1TUB B;  1S76 D;  4JI5 O;  2EJR A;  1VQ8 V;  1ENV A;  3G67 A;  2FB5 A;  1K4D C;  3CSX A;  4H0L B;  5F2V O;  1XHZ A;  3RYC A;  3LSU A;  2P4K A;  4LP8 A;  4UCS A;  3CP1 A;  1WNS A;  1OCO B;  3OGC C;  3P3P A;  2GBO A;  1JMK C;  1N33 B;  1NVP D;  2V7Q G;  2YS8 A;  3GVM A;  2BOB C;  1BT8 A;  3VQV A;  1LNQ A;  4P9P A;  1F51 A;  1PNL A;  1TA8 A;  1AB3 A;  2ILM A;  2V1D A;  3OUF A;  2VWJ A;  2FKX A;  2Z0A A;  2A9H A;  4EFB A;  1PKX A;  5KAI Z;  4FZ1 A;  5J2T B;  4JTC B;  3VQX A;  2DQ3 A;  1HNX O;  4QPJ A;  4RUE A;  2CUG A;  3CPW U;  3WFV A;  5BR8 B;  2PZS A;  2JVD A;  2ADP A;  2NLJ C;  1MSW D;  1JQ0 A;  1WAZ A;  3OEE G;  1WB7 A;  5CA0 A;  3RYF A;  4JAS A;  3P3N A;  4J80 A;  4FFB B;  2WA4 A;  3OTO B;  1ZAU A;  2JGD A;  3CJH B;  2OTL V;  2UXN A;  4QPK A;  3L70 H;  4R7C A;  1QQC A;  2YI9 A;  5KHH A;  3KZI Z;  4IGG A;  1YI2 V;  2UXC O;  5DEC A;  4O4J A;  4LF7 O;  4GX2 A;  1HNX B;  1XNR B;  5ITZ B;  1Y67 A;  3CMA V;  1JJ2 U;  1NT2 B;  1THZ A;  1VQ6 V;  2M6Y A;  4K0K B;  4EEQ A;  1Q5O A;  1SS3 A;  4J11 A;  3STL C;  1OCC B;  1I0H A;  3K9A A;  1EN5 A;  3L73 H;  3SPG A;  4LFC O;  2B9Z A;  3ABK B;  4BIZ A;  5CB4 B;  2O57 A;  3WU2 Z;  4GX1 A;  5DED A;  2JS5 A;  2A3Q A;  1YXB A;  4NTX A;  3MHH C;  3OW2 U;  4I9W A;  5LMN B;  1VEW A;  1VMG A;  1LUV A;  3BVO A;  1XMO O;  2QM8 A;  1BS3 A;  5K1X A;  1DLB A;  1KKC A;  2LGQ A;  2XAJ A;  2QWO B;  4PHZ A;  4MW8 A;  1B3Q A;  4DV1 B;  1SZT A;  1E1Q G;  3JAW B;  2GDS A;  5IJ0 B;  1ZX3 A;  1ROP A;  4DR3 B;  2X7R B;  3CWB H;  3E83 A;  2AZ2 A;  4I50 A;  1VIB A;  2GUZ B;  2Y4U A;  1R3L C;  2QWQ B;  3TGU H;  1O9H A;  3ZMV A;  1AI7 A;  5EIB D;  3PJS K;  4K35 A;  2DMX A;  3Q4H B;  2Q8V A;  1O9G A;  2OCC B;  1Q7Y W;  3LNN A;  2WLI A;  1AI5 A;  3JAM N;  4PA3 A;  5LGN A;  1MAB G;  5C8Y B;  3ZMU A;  3CCU V;  1K5S A;  3GB7 C;  4DW0 A;  3SJA C;  3AG7 A;  1V55 C;  3X2Q B;  5A2Q N;  3FX7 A;  3T1Y B;  4B3M O;  3RBZ A;  1AJN A;  4Z1V A;  3CYO A;  4G27 B;  1FJG B;  2NN4 A;  1ZTE A;  4YXW G;  3W7S A;  2WLL B;  4I50 B;  4TWK A;  4PI0 A;  5LGT A;  5FPO A;  5IJ0 A;  3WB0 A;  3VQW A;  1Y74 B;  3H1K H;  4ZKI A;  1K4C C;  4DXW A;  4P9O A;  1GM8 A;  5LMU O;  1IUR A;  1K7D A;  1CEZ A;  1NH2 B;  4X88 A;  3SYO A;  1M57 B;  4MS2 A;  4KFM A;  4X66 O;  1Q3E A;  4IHJ A;  4X64 O;  5BXZ A;  4B3R O;  1VF6 A;  1BCC H;  3UO2 A;  1ZL8 B;  1OZ0 A;  3S3W A;  3AEI A;  2UUA O;  4NKG B;  2QM4 A;  3ZHS A;  1COW G;  1FKA O;  4NTW A;  3OUS A;  3ABU A;  2UXD B;  4EB6 A;  4ZBM A;  3ZED A;  3BEH A;  4FZ0 A;  2BTO A;  2VQE B;  4J7Z A;  5KHG A;  2CH7 A;  1R6T A;  4JI0 O;  1U96 A;  5LGU A;  2ZM6 B;  5EYP A;  2ARH A;  4LWS A;  3IAY A;  4GKK B;  2JJ2 G;  3A0H Z;  3G6E V;  4EFE A;  3HR0 A;  1IBM B;  5H5N A;  2JJ1 G;  3B8M A;  3QO5 A;  5L3E A;  3J81 N;  2Y69 B;  3K03 A;  4UCR A;  4AQY O;  1IBK B;  3J80 N;  1JJO A;  5KA5 A;  4IT5 A;  1N33 O;  3ZRW B;  5LHH A;  1RSO B;  1VQ5 V;  2F43 G;  4QJF B;  4UCT A;  1VQL V;  3W7T A;  4D7T A;  3E8G A;  5LXT A;  4DV0 O;  1CPY A;  4JYB A;  1BQZ A;  1PD3 A;  1VF7 A;  4JI0 B;  4DR2 O;  2ATK C;  2K9P A;  3RT3 C;  4FK5 C;  3SJC C;  3FAV A;  2Y4T A;  3FKS G;  4LF5 B;  2DWD C;  5L3F A;  2YXL A;  1BZK A;  3JD0 A;  2YSU B;  2KG7 B;  1AI4 A;  5EIB C;  5LP6 A;  4PEL A;  2YIB A;  2QWN B;  1GO3 F;  3W7X A;  1S72 V;  2IJI A;  3JAS B;  4X20 A;  1HNZ O;  3RVY A;  4NXM B;  4GZR B;  1GMG A;  3D8C A;  1S0V A;  3APO A;  5LL6 Y;  5J2U A;  4DUZ O;  3JAK A;  4FLZ A;  5CB4 A;  2HP8 A;  3FYI B;  3F7V C;  2KKW A;  1YF2 A;  3N2G A;  5E79 Z;  1JCH A;  2C2A A;  5EBM C;  3ZRS A;  3P30 A;  3ZRW A;  2JS3 A;  1XEQ A;  5LOV B;  2VS0 A;  3VBB A;  2EIN C;  1AI6 A;  1QHT A;  5JJJ B;  1R3I C;  4KXR A;  3GWK C;  5K1P A;  4YIP A;  1OCZ C;  5FNV B;  3AG1 C;  4JI8 B;  1RP3 B;  2DYS C;  4LF4 B;  1EFR G;  1ZWI C;  3T1H B;  2HKO A;  2OTJ V;  4LFC B;  4DV4 B;  1W59 A;  1I94 O;  5DM6 V;  2KB1 A;  1Z2G A;  5H6R A;  1NR1 A;  4I55 A;  4YHH B;  1K5Q A;  5CA0 B;  3WG7 C;  2IH3 C;  3FB7 C;  3ETG A;  2LO1 A;  4F6R B;  4H33 A;  4U3J B;  1U97 A;  2PYL A;  4O4L A;  1FXK A;  3D3I A;  1GN6 A;  3HKD A;  1XMO B;  5JJN B;  1W0K G;  3ZCC A;  2IU0 A;  4O4I B;  2JEX A;  4JI8 O;  3JAS A;  2WA3 A;  2EJ7 A;  3K79 A;  2VWK A;  1J5E B;  2RDC A;  1RM1 B;  1W2B U;  1JFF A;  4IHJ B;  4CH6 A;  2BOC C;  5DN6 G;  3ZN0 A;  1Q43 A;  1SA0 B;  1DGS A;  3K58 A;  5EBL C;  5GTH Z;  4UVC A;  1SZX A;  1I5X A;  4MSW C;  1KP2 A;  1JR9 A;  4TT3 G;  4XBF A;  2UXX A;  3E8B A;  3CE2 A;  4GX5 A;  4GYC B;  1JX9 A;  3OMI B;  5KX5 A;  1ZL8 A;  2EX3 A;  4JI6 B;  2H3O A;  4I4T B;  1PM9 A;  4B3S B;  3F5W C;  3QF7 A;  3HKC B;  4O4H A;  3BA8 A;  4ZOL B;  1V54 B;  1URF A;  2DE0 X;  3OTO O;  5GON A;  2E5L B;  1HP8 A;  1YTF D;  3SYA A;  4LH6 A;  2HHH B;  3AG4 C;  4DR7 B;  4UCV A;  1J5E O;  5H6Q A;  3T1C A;  2Y0I A;  4O2B A;  2UXC B;  1H2L A;  4NTY A;  1FFX B;  3O65 A;  4EKW A;  1L0N H;  1AR5 A;  3SGI A;  1I5Y A;  4DV7 B;  4KHP O;  5B1B B;  2UUC B;  1F4M A;  3AG4 B;  1R6N A;  4HYO A;  4CS4 A;  4DR4 O;  2N74 A;  1QCE A;  4NYK A;  4FLV A;  1M56 C;  1TGO A;  1KD1 W;  4JI4 O;  2A0L A;  2CAZ C;  3HKE B;  3CHX A;  4WFB V;  3CRM A;  4CS3 A;  5J2T A;  4D6T H;  4JAA A;  5KMG B;  4DR7 O;  1MZE A;  1NTZ H;  3OEH G;  4X1I A;  3RYI A;  3GWO A;  3L71 H;  1D5A A;  3CEI A;  2UUB O;  1IXB A;  1L0L H;  1HNW O;  1OCC C;  1WJZ A;  1JPX A;  3ZMZ A;  1GM9 A;  3HKC A;  4O4H B;  2LP7 A;  1EN4 A;  4BW5 A;  1MSD A;  2R70 A;  2XAG A;  4UXN A;  2Q67 A;  4X20 B;  2UXB O;  4LF8 O;  3ETD A;  3BPZ A;  2ZIM A;  1QVG U;  3W7W A;  1Q6U A;  1ZSP A;  1SKV A;  4WFA V;  1I94 B;  3B09 A;  1VQ7 V;  2KG7 A;  4DRX B;  2WLK A;  4YHH O;  1SC5 B;  3A0B Z;  2CDY A;  1AR4 A;  2Z3Y A;  2WLM A;  3A2F A;  4PDL A;  4MTF A;  1I08 A;  3WB1 A;  4MVQ A;  1H8E G;  1XOU A;  4UB6 Z;  4BR6 A;  2EBO A;  1IBM O;  4MVZ A;  2UUB B;  3JAL A;  5ITZ A;  3RGB A;  1HNW B;  2DWE C;  4ZHQ A;  4DV5 B;  4A5U B;  2QJ1 A;  2BSK B;  2XND G;  2E74 B;  2W6J G;  3BAA A;  5LA6 A;  3RYI B;  2UXB B;  4I7Z B;  1D2D A;  1X59 A;  2JGU A;  4NB5 A;  2RQ6 A;  3PN1 A;  1RPO A;  4J7J A;  4K3A A;  1PPJ H;  1B04 A;  1VAR A;  2N04 A;  1K9M W;  3JSL A;  3DC5 A;  3KCX A;  2KQX A;  3HKE A;  1GN3 A;  2EIL B;  5FLX N;  2YID A;  5EK0 A;  4LF9 B;  4JYA B;  2YIC A;  3A0R A;  4TOI A;  4PDV A;  3MHS C;  3UO3 A;  4B7E A;  4DR6 B;  4N21 A;  2LFS A;  5IWA B;  3JD2 A;  1P7G A;  3EXA A;  3H1L H;  4FVM A;  4I9Q A;  4TQF A;  4UB8 Z;  4OPH A;  2HHH O;  4U3F H;  4X66 B;  3T4Z A;  3E35 A;  4XDJ A;  4NXM O;  4JTD B;  5LA6 B;  2GUZ A;  1OV9 A;  2YUA A;  2Y0P A;  2HVK C;  4J10 A;  1YIT V;  1F23 A;  1SRY A;  4JYA O;  4IYI A;  3ZHQ A;  1EBO A;  3CCM V;  2R72 A;  2Q6A A;  4MVU A;  3M7M X;  2BTQ A;  3U10 A;  3ABM C;  1VF6 C;  2Y48 A;  4ZI7 A;  1R3J C;  3CCJ V;  2OIE A;  2EIK C;  4W4K A;  1PL4 A;  4MTG A;  4JI3 B;  1M9N A;  3C90 A;  1SET A;  2K1E A;  4O2A B;  4R8C A;  1WPX A;  1VQO V;  4FLX A;  3K06 A;  1H8H G;  4KL1 A;  3CRR A;  3SPH A;  3K08 A;  1NTM H;  2ETN A;  3QNE A;  1JA8 A;  4WF9 V;  3K5N A;  2Q7H A;  1F4N A;  3HKB B;  2WAM A;  3ML0 A;  3G80 A;  1M90 W;  4MTX A;  4NVP A;  3TK1 A;  1KYO F;  1Q81 W;  1Y76 B;  2VQF B;  3EVK A;  3ETQ A;  5KMG A;  2Q7G A;  2R9A A;  3E2E A;  3ASO B;  4HBN A;  3E86 A;  4FPP A;  3STZ C;  1M5I A;  3K5M A;  2AHY A;  5JH7 B;  1PP9 H;  2JK5 C;  2B1G A;  1DK1 A;  1KUQ A;  2YC0 A;  3ZIA G;  4YY3 B;  2PGG A;  4GKJ O;  3ZRV A;  4JI1 B;  1XMQ B;  4KP4 A;  1IVS A;  2EIJ C;  5H9C A;  3C3T A;  1N34 O;  1BE3 H;  2ZQM A;  1IX9 A;  3JYC A;  3ASN C;  4IIJ A;  1UJW B;  4LF9 O;  2DN9 A;  1E1R G;  4I0X A;  5BMV B;  4JAV A;  3K57 A;  3AK2 A;  1K92 A;  5IWA O;  4DV7 O;  1EM1 A;  3KCY A;  3TCU A;  1VQM V;  5GON B;  4RQF A;  2BSK A;  3B40 A;  5JJE B;  4DR4 B;  4LF4 O;  4XDK A;  1V54 C;  3L74 H;  3FAV B;  3T1H O;  4O4I A;  5KX5 B;  3K5O A;  4AHC A;  4DV2 B;  2WLN A;  2FML A;  3R65 A;  4FM2 A;  2EIM C;  4J41 A;  1HR0 O;  4DV0 B;  4LR3 A;  4B3T B;  2PI5 A;  1X4T A;  2NNU A;  4P2Z A;  3SPC A;  1GKF A;  4QIW F;  4LF6 O;  4LFB B;  2HLD G;  2V4D A;  1KKD A;  2JGD B;  3IJ4 A;  4IYH A;  4DK0 A;  1H38 A;  4LF7 B;  3ZHR A;  1MZF A;  5KHJ A;  1QLN A;  1DF5 A;  3CC4 V;  3RWR D;  4X1I B;  2PF4 E;  1OJH A;  1H2M A;  1EZJ A;  1VQ4 V;  4X64 B;  1GN4 A;  1KEC A;  2ZR2 A;  3AG3 B;  4I55 B;  3E8H A;  3HPL C;  3AG1 B;  4LCU C;  2PI4 A;  3QVN A;  1N0N A;  2BCC H;  3N2K B;  1N8R W;  5IT9 N;  5H2F Z;  1RFY A;  3CXH F;  3G6B A;  4JTA B;  4WBN A;  3BFR A;  2DJV A;  1GN2 A;  2Q0O C;  4DV6 O;  2VQE O;  4X89 A;  4HNA B;  3TET A;  5IYB O;  2KSD A;  2ZE5 A;  5KAF Z;  2P06 A;  1MA1 A;  5IDJ A;  4JYY A;  1OCO C;  2IU3 A;  2GSM B;  1ARO P;  3FB8 C;  4ICG A;  3JCZ A;  2ZXW B;  3ASN B;  4EB6 B;  4X1K B;  5B1A C;  4F6E A;  1VQK V;  1YJ9 V;  1XI1 A;  3AG2 B;  3LNM B;  5BZB A;  4H37 A;  4R50 A;  2RMK B;  3APQ A;  2BTQ B;  2QTS A;  4O2A A;  3BCC H;  3H9V A;  3VOU A;  4FM0 A;  4PV1 B;  4G28 B;  4UVA A;  4DUY O;  1BL8 A;  1KMI Z;  3OM3 B;  3OD4 A;  4WCE V;  3MAQ A;  3QO8 A;  4FMT A;  4RWU A;  2YIB D;  3E22 B;  1TUB A;  1FXV A;  3CME V;  3ZMT A;  4O4L B;  1N34 B;  4JGS A;  1FPO A;  4J42 A;  1RSO A;  1GH6 A;  4WFH A;  4BIU A;  4JAU A;  1J95 A;  3FB6 C;  3K0D A;  1JVM A;  2LW7 A;  1Z5V A;  3N2K A;  1FJG O;  2F93 B;  3L72 H;  5L3D A;  1CXZ B;  4K8Z A;  2H94 A;  2NR5 A;  1BGY H;  5KHK A;  2P22 C;  4OX9 B;  2Q4P A;  1Y76 A;  1VQ9 V;  4FJC C;  2X6C A;  4K0K O;  3SYQ A;  4JI7 B;  4LFA O;  3RVZ A;  5KUK A;  4L8J A;  2XAQ A;  2R9R B;  1Q6H A;  2CGO A;  5LMU B;  2UU9 O;  4RAI A;  2OT5 A;  4BW9 A;  4UV8 A;  4DK1 A;  3SYP A;  2DQ0 A;  3DTU B;  3SYC A;  3DXR B;  1OCR B;  1RPR A;  3K59 A;  1DF4 A;  4B3R B;  1VP7 A;  4HZ3 A;  1NI8 A;  1KB9 F;  3OR6 C;  4GLX A;  1NH2 D;  3JAK B;  2AZ0 A;  3WB2 A;  1S5L Z;  2UUC O;  5CMU A;  4CZZ A;  3P32 A;  3CXC U;  1N0J A;  3JAT B;  2CTR A;  5FL7 G;  4LFA B;  1MNG A;  4C7U A;  3NR7 A;  2IBZ H;  4J9Z B;  1IBL O;  2IW5 A;  2ADQ B;  2A7W A;  3QTC A;  1SA0 A;  3U11 A;  1NJI W;  1SQB H;  1LR1 A;  4CBC A;  2F95 B;  4Q20 A;  4FM1 A;  3E8F A;  4ABM A;  3ABL B;  1K8A W;  2X0L A;  3ETE A;  1XNR O;  2HVJ C;  5KHI A;  3JD1 A;  1B06 A;  2CTQ A;  1GK9 A;  3UT5 A;  3ABL C;  3UKM A;  4PDR A;  2OWO A;  4DR1 B;  2R9I A;  4LC1 A;  5IY5 B;  1NVP B;  1FFT B;  1XNQ O;  1YSC A;  1KBH A;  4JI2 O;  2CK3 G;  4DR2 B;  4YJ3 A;  3CRC A;  1N4C A;  2PUS A;  4F6R A;  1G4Y B;  3BA9 A;  2QEX V;  1YIJ V;  4ZIB A;  2ZD9 A;  4MT8 A;  1H2G A;  5EZY B;  4FLU A;  4LNU A;  3ASO C;  4B3S O;  5JH7 A;  3K04 A;  2LJ2 A;  1SER A;  3M8A A;  2EIL C;  2X6A A;  3D3Q A;  2XTA A;  1W0J G;  3DSQ A;  1SQP H;  4PA6 A;  3ZHU A;  3B2E E;  3I55 V;  1YTF B;  4O2B B;  1BHB A;  2CTW A;  2HEP A;  1S5J A;  4PA4 A;  3IFX A;  2OCC C;  3LSQ A;  2JRI A;  4GCZ A;  4K8X A;  2CGN A;  4DUZ B;  2RNB A;  3S3X A;  3A8T A;  3BRC A;  3JAR B;  5CN0 A;  4MVO A;  3ZBH A;  5CA3 A;  2UXD O;  4H44 B;  1V55 B;  2ZE6 A;  5HFM A;  4XDL A;  1DTO A;  2FTK A;  5LHI A;  5LYJ B;  3K9S A;  1SQQ H;  1WB8 A;  2UU9 B;  5HFL A;  2ZKO A;  1R6K A;  1YDX A;  4RQE A;  1WP7 A;  4MVR A;  1GTO A;  4GX0 A;  3ABK C;  4MVM A;  2GHY A;  4WFE A;  2QA4 V;  3CRQ A;  2ZT9 B;  4PI2 A;  4WFG A;  3CD6 V;  2P5O A;  4MW3 A;  4TV9 A;  1SQG A; 
#chains in the Genus database with same CATH homology
 4R8C A;  1WPX A;  3OE7 G;  3OUS A;  1QBZ A;  1VQO V;  3OFN G;  2EIN B;  3ABU A;  3K06 A;  1H8H G;  1K97 A;  3CC2 V;  3IGA C;  4HAM A;  3SPH A;  3CCS V;  3K08 A;  4UUJ C;  4ZBM A;  2W0F C;  3QNE A;  4MVS A;  3BEH A;  5B3S B;  2M7W A;  4WF9 V;  3T2M A;  3LDD A;  4QE9 A;  4U7N A;  1AR1 B;  1F4N A;  2WAM A;  2EZP A;  3ML0 A;  5LGU A;  1K73 W;  5IY5 C;  1YHQ V;  2HR3 A;  2IH1 C;  2XAH A;  1M90 W;  4MTX A;  5GW7 A;  2Q68 A;  3TK1 A;  1Q81 W;  5EBW C;  4JF3 A;  4RO2 A;  2JJ2 G;  3G6E V;  4RUF A;  2JJ1 G;  1KC8 W;  2D3O W;  3B8M A;  3QO5 A;  3E2E A;  2AHZ A;  2JIZ G;  2QM7 A;  3ASO B;  2EIJ B;  3E86 A;  4FPP A;  2ZDI A;  1S5H C;  3STZ C;  2DYR B;  3ZRX A;  5L3E A;  2Y69 B;  3K03 A;  2AHY A;  2JK5 C;  5EC2 C;  3ZN1 A;  5L3B A;  2B1G A;  1M1K W;  3F7Y C;  3MD0 A;  3ZIA G;  5KA5 A;  2HJF C;  4GT1 A;  3ABT A;  3ZRV A;  3ZRW B;  5LHH A;  1NR7 A;  1VQ5 V;  2H8P C;  3LDE A;  4KP4 A;  1FXH A;  2F43 G;  2YEV A;  4QJF B;  2EIJ C;  1VQL V;  1BMF G;  3ZRS A;  5IYD O;  5H9C A;  1BHA A;  3W7T A;  3E8G A;  1XL6 A;  4Z1M G;  1CPY A;  4JYB A;  3OAA G;  1MOF A;  1PD3 A;  2ZQM A;  3LSS A;  3B77 A;  3ASN C;  3JYC A;  2ATK C;  1UJW B;  4F4L A;  4FK5 C;  1QVF U;  1Y4M A;  1E1R G;  3E89 A;  4P30 A;  5KA6 A;  3FKS G;  2DWD C;  3RW0 A;  4JAV A;  5B1O A;  5L3F A;  1OHH G;  4L87 A;  1K92 A;  3JD0 A;  4N23 A;  3KG2 A;  2YSU B;  1FS0 G;  3TCU A;  1AI4 A;  1VQM V;  4RQF A;  2IJH A;  3EFF K;  2ZR3 A;  1ORQ C;  3HB3 B;  1CP9 A;  3UM7 A;  4PEL A;  2EIM B;  3CCQ V;  1G8M A;  5IYC O;  3W7U A;  1K3E A;  4BAY A;  3CCV V;  4TSF G;  5CBF A;  1GO3 F;  4WFF A;  4XDK A;  1V54 C;  1M57 C;  2IJI A;  3W7X A;  1MG1 A;  1S72 V;  2LFR A;  3RVY A;  1QLE C;  1GMG A;  2WLN A;  2JDI G;  1S0V A;  3R65 A;  2EIM C;  1NKD A;  2YEV B;  5B1N A;  4QNH B;  3FYI B;  3F7V C;  1Q86 W;  1OCZ B;  2B5U A;  2PI5 A;  3SPJ A;  3M99 B;  2NNU A;  1JCH A;  2C2A A;  4PA7 A;  5EBM C;  3P30 A;  3ZRW A;  1FXK C;  1HWY A;  1P7B A;  4P2Z A;  1GKF A;  3SPC A;  4QIW F;  3T4D A;  3CCL V;  2HLD G;  1QLE B;  3VBB A;  2EIN C;  1AI6 A;  3SJQ C;  4MTO A;  1R3I C;  1KKD A;  3OR7 C;  5KUM A;  3IC7 A;  4PA9 A;  2WLI B;  1H38 A;  3DGE A;  4UVB A;  3SPI A;  2WLL A;  3AG3 C;  1OCZ C;  3AG1 C;  1VQN V;  2P7T C;  4J9Y B;  1M56 B;  2DYS C;  1QLN A;  1DF5 A;  3CC4 V;  1EFR G;  1ZWI C;  2WPD G;  1EZJ A;  5EC1 C;  3WG7 B;  4QE7 A;  5C93 A;  1VQ4 V;  5L3C A;  1KEC A;  2ZR2 A;  3JD3 A;  1YJN V;  1IXM A;  2HKO A;  1S77 D;  2OTJ V;  3AG3 B;  3CC7 V;  5DM6 V;  2KB1 A;  3E8H A;  3HPL C;  5H6R A;  1P4R A;  3AG1 B;  2WLJ A;  1R3K C;  1NR1 A;  2HG5 C;  2JEU A;  4LCU C;  2PI4 A;  2DYS B;  1N8R W;  1PL0 A;  1PNM A;  1K5Q A;  3WG7 C;  2IH3 C;  3FB7 C;  1GM7 A;  4I5S A;  2P6J A;  2DYR C;  1PNK A;  3ETG A;  4JTA B;  2Y69 C;  3G71 V;  1RM1 C;  4H33 A;  2ZXW C;  2A79 B;  1FXK A;  4X89 A;  3TET A;  3D3I A;  5IYB O;  3AG2 C;  3NXS A;  1W0K G;  3ZCC A;  2IU0 A;  1S76 D;  2JEX A;  1E79 G;  2EJR A;  5IDJ A;  1VQ8 V;  1YJW V;  3K79 A;  2HFE C;  1RM1 B;  1OCO C;  2IU3 A;  2GSM B;  1W2B U;  2BOC C;  1ENV A;  1ARO P;  2QTO A;  3FB8 C;  1K4D C;  3JCZ A;  2ZXW B;  3ASN B;  4R6Z A;  5DN6 G;  3ZN0 A;  5LBQ A;  5B1A C;  3G4S V;  1VQK V;  1AJQ A;  1YJ9 V;  3AG2 B;  2IJK A;  3LNM B;  5EBL C;  2XAF A;  4H37 A;  4LP8 A;  4R50 A;  5BZB A;  4UVC A;  1I5X A;  3CP1 A;  4MSW C;  1KP2 A;  4TT3 G;  3VOU A;  4XBF A;  1OCO B;  3OGC C;  4G28 B;  4UVA A;  2UXX A;  3E8B A;  1BL8 A;  4GX5 A;  1JX9 A;  3OM3 B;  2B1I A;  3OMI B;  4WCE V;  5B1A B;  3QO8 A;  4G2K A;  4FMT A;  1NVP D;  2V7Q G;  1K34 A;  1KQS U;  3F5W C;  1FXV A;  3CME V;  1V54 B;  2BOB C;  3ZMT A;  1LNQ A;  4P9P A;  1F51 A;  1PNL A;  3H01 A;  5B1B C;  1YTF D;  3SYA A;  4JGS A;  3AG4 C;  2V1D A;  3OUF A;  3FYE B;  4WFH A;  4BIU A;  4JAU A;  5H6Q A;  2Z5U A;  3K0G A;  3T1C A;  1J95 A;  1AJP A;  3FB6 C;  2A9H A;  3K0D A;  1PKX A;  3OMA B;  1JVM A;  2DW4 A;  4EKW A;  4JTC B;  1I5Y A;  2DQ3 A;  5B1B B;  3JD4 A;  1F4M A;  5L3D A;  3AG4 B;  4QPJ A;  4RUE A;  4OXS A;  2H94 A;  4PDM A;  1R6N A;  3ZMS A;  2WSS G;  3WFV A;  3CPW U;  4HYO A;  1VQ9 V;  3D36 A;  4FJC C;  1QCE A;  1S3J A;  2X6C A;  2XOK G;  1QR9 A;  3SYQ A;  2NLJ C;  4UV9 A;  1JQ0 A;  3RVZ A;  1M56 C;  5KUK A;  1MSW D;  2IJJ A;  1KD1 W;  2XAQ A;  3ZJZ A;  2R9R B;  3OEE G;  2A0L A;  3LUT B;  2Q69 A;  4JAS A;  4RAI A;  4WFB V;  3CCE V;  1WLE A;  2OT5 A;  4DO2 A;  4UV8 A;  3SYP A;  2DQ0 A;  2OTL V;  3LDC A;  3DTU B;  2UXN A;  3SYC A;  4QPK A;  4R7C A;  1K33 A;  1OCR B;  1RPR A;  5LHG A;  3OEH G;  1DF4 A;  1YI2 V;  4HZ3 A;  3GWO A;  2ITC C;  3OR6 C;  1NH2 D;  1NQT A;  1OCC C;  1JPX A;  4GX2 A;  5CMU A;  4CZZ A;  3ZMZ A;  3CMA V;  3P32 A;  1GM9 A;  2LP7 A;  3CXC U;  1JJ2 U;  4BW5 A;  1OCR C;  2XAG A;  4UXN A;  2Q67 A;  4X8A A;  4JPR A;  4LBE C;  1THZ A;  1VQ6 V;  3ETD A;  3STL C;  5FL7 G;  2ITD C;  1QVG U;  5E1A C;  3W7W A;  1OCC B;  4J9Z B;  3K9A A;  1B6Q A;  3SPG A;  2IW5 A;  4WFA V;  3ABK B;  4BIZ A;  1VQ7 V;  5L3G A;  2EIK B;  2WWW A;  4GX1 A;  2WLK A;  4U7O A;  2Z3Y A;  2WLM A;  3BY6 A;  4PDL A;  1NJI W;  4MTF A;  3MHH C;  4E2L A;  3OW2 U;  4I9W A;  4MVQ A;  1H8E G;  4CBC A;  4Q20 A;  2EBO A;  4MVZ A;  3E8F A;  2P67 A;  3ABL B;  2DWE C;  3EHB B;  1K8A W;  2X0L A;  3ETE A;  2XND G;  2W6J G;  2XAS A;  2HVJ C;  2QM8 A;  5CBG A;  1DLB A;  3JD1 A;  4ASU G;  2XAJ A;  4MW8 A;  2X6B A;  4KUM A;  2EZO A;  1RPO A;  1SZT A;  1GK9 A;  1E1Q G;  1KP3 A;  3ABL C;  1TUE B;  3UKM A;  4PDR A;  1ROP A;  1K9M W;  2X7R B;  3E83 A;  2R9I A;  4LC1 A;  5IY5 B;  1NVP B;  1FFT B;  2MK3 A;  1YSC A;  2EIL B;  1QR8 A;  1R3L C;  3QO7 A;  2CK3 G;  5J9P C;  1VQP V;  3ZMV A;  5EK0 A;  1AI7 A;  3A0R A;  4PDV A;  1G4Y B;  2QEX V;  1YIJ V;  3PJS K;  2ZDI C;  2ZD9 A;  4MT8 A;  3MHS C;  1H2G A;  4N21 A;  2LFS A;  3ASO C;  3JD2 A;  2OCC B;  3OMN B;  3K04 A;  1Q7Y W;  1SER A;  2EIL C;  2X6A A;  1W0J G;  2WLI A;  1AI5 A;  4PA6 A;  4PA3 A;  5LGN A;  1MAB G;  2W6I G;  3ZMU A;  3CCU V;  1K5S A;  3I55 V;  1NBM G;  3GB7 C;  1YTF B;  4JYC A;  1BHB A;  3T4Z A;  4PA4 A;  1V55 C;  3IFX A;  3E35 A;  2OCC C;  3X2Q B;  4XDJ A;  4JTD B;  1SES A;  1R73 A;  3LSQ A;  3RBZ A;  4GCZ A;  1AJN A;  3CYO A;  4G27 B;  4YXW G;  3W7S A;  2WLL B;  2HVK C;  3K3W A;  4FIP C;  1YIT V;  5CN0 A;  1F23 A;  4MVO A;  1SRY A;  5CA3 A;  3ABM B;  4TWK A;  5LGT A;  1V55 B;  2QKS A;  3X2Q C;  5HFM A;  4XDL A;  1EBO A;  2P90 A;  1Y66 A;  3CCM V;  2WLH A;  1DTO A;  4ZKI A;  2FTK A;  1K4C C;  4DXW A;  5LHI A;  4P9O A;  2Q6A A;  3FB5 C;  1GM8 A;  4MVU A;  1K7D A;  1CEZ A;  1NH2 B;  5HFL A;  4X88 A;  1R6K A;  3ABM C;  4RQE A;  2Y48 A;  3SYO A;  4MVR A;  1M57 B;  1GTO A;  1R3J C;  3ABK C;  4GX0 A;  3I56 V;  4MVM A;  3CCJ V;  1JOY A;  2EIK C;  4MS2 A;  4KFM A;  2GHY A;  4WFE A;  2QA4 V;  4MTG A;  3CCR V;  1M9N A;  4WFG A;  3CD6 V;  1SET A;  2K1E A;  1OZ0 A;  3B8N A;  3AEI A;  4MW3 A;  1Q82 W;  1XL4 A;  5B3S C;  5CBH A;  2QE7 G;  1L1F A;  1COW G;  1FXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...