2P7TC

Crystal structure of kcsa mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVSTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
molecule tags Membrane protein
source organism Streptomyces lividans
publication title Crystal Structure of KcsA mutant
rcsb
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p7tC00
4WFHA 3OUSA 4GX2A 4R7CA 1LNQA 2R9RB 3HPLC 4MSWC 4I9WA 4JTAB 3IGAC 3ABMC 3LDDA 5CBFA 3K0GA 4LP8A 3RVZA 4JTDB 1J95A 2WLJA 4MVOA 2QTOA 2ITCC 5EBMC 3WG7C 1K4DC 3IFXA 1S5HC 3E8BA 4PA9A 1QLEC 5EBWC 1OCRC 4RO2A 2Q6AA 4EKWA 1OCZC 1G4YB 4GX5A 1OCCC 2DYRC 3SYOA 2HVJC 4MVRA 3FB6C 3GB7C 5EC2C 3AG4C 5EBLC 3AG3C 4GX1A 2EIKC 1V54C 4WFGA 2YEVA 4WFEA 2WLIA 2ATKC 2Y69C 1XL4A 3AG1C 1M56C 3UM7A 4HZ3A 4PDRA 4KFMA 2WLLB 4X8AA 3LNMB 3EFFK 3F7VC 3LDCA 3X2QC 1R3JC 2JK5C 3SYPA 2DWEC 3T4DA 3OR7C 2NLJC 3TCUA 2HVKC 5B1BC 4XDJA 5IY5C 4X88A 3E83A 3FB5C 5CBHA 2HJFC 4H37A 1BL8A 2BOBC 3F5WC 2WLMA 2EILC 3K06A 2Q67A 3VOUA 2X6CA 4MTFA 4PDVA 3SPIA 2WLIB 4JTCB 3SPHA 3FB7C 4QNHB 3ASOC 5B1AC 4R6ZA 2DWDC 2WLHA 2WLLA 3E86A 3SYCA 5BZBA 1P7BA 3BEHA 4MVZA 4RAIA 4X89A 4DXWA 1R3LC 3ABKC 2AHYA 1K4CC 4QE7A 5KUKA 3E89A 3E8FA 3R65A 4P30A 3SPJA 1R3KC 4MVQA 4J9YB 4J9ZB 3K04A 5EC1C 1KKDA 2HG5C 3JYCA 1XL6A 3T1CA 4R8CA 3LUTB 4ZBMA 2Q69A 2KB1A 4TWKA 3E8GA 4RUFA 2A9HA 3UKMA 4MW3A 1OCOC 2EINC 2WLNA 2P7TC 4G27B 1V55C 4H33A 4QE9A 4P9OA 4MS2A 2ZXWC 3PJSK 3RVYA 3RW0A 3F7YC 1ZWIC 3SPCA 1ORQC 2OCCC 4MVSA 2QKSA 3ZJZA 4PA4A 2A79B 3K08A 4RUEA 2EIJC 3SJQC 2IH3C 3OUFA 3SPGA 1M57C 4MTOA 2WLKA 2DYSC 2Q68A 2A0LA 4WFFA 3ZRSA 3ASNC 3FB8C 2ITDC 3LDEA 4BW5A 3OGCC 3TETA 3K03A 3E8HA 3OR6C 2K1EA 3ABLC 2X6AA 4PA7A 2BOCC 4P9PA 5CBGA 1JVMA 2X6BA 3SYQA 2ZD9A 4PA3A 5B3SC 3RBZA 3T4ZA 4OXSA 4PDLA 4MW8A 2AHZA 4R50A 2IH1C 2H8PC 2W0FC 5E1AC 4XDLA 3AG2C 4PA6A 4XDKA 3STLC 4MTGA 5EK0A 3T2MA 4CBCA 2HFEC 2EIMC 4MVUA 4LCUC 4MVMA 5J9PC 4LBEC 3SYAA 1R3IC 4UUJC 4GX0A 3K0DA 5KUMA 4HYOA 4G28B 3KG2A 3STZC 4F4LA 4P2ZA 4PDMA
chains in the Genus database with same CATH superfamily
1AR1B 5IE9A 3CCSV 1N34B 3LDDA 3ABMC 5CBFA 5LOVB 4B3RO 1CXZB 3AK3A 4J10A 5GONB 4OPHA 4DV6B 1SZTA 4YXWG 3UO3A 2V4DA 4WF9V 3FYIB 4MVRA 2ZQMA 2ZT9B 3IC9A 2JVDA 4X64B 2ETNA 5L3GA 2AGAA 1YIJV 1WN7A 2Q9LA 4FLXA 1R3JC 2JK5C 5CB4A 3ZX6A 3ZHUA 4FZ1A 2CGNA 3FB5C 3OM3B 2QE7G 1GM7A 3ZHQA 4YIOA 2VQFB 1XNQO 3JALA 4X89A 4DXWA 3A0RA 5KA6A 2ZNIA 1K4CC 5LYJB 4MVQA 2YIBD 1JFFA 2Q69A 1OCRB 3E22A 3MHSC 4YHHB 4MW3A 1M93A 3FD9A 1TAEA 3BY6A 3P30A 1B06A 2A79B 2EIJC 2L6LA 1N0JA 3IC7A 4AQYO 4N23A 3SYQA 2CH7A 1P7GA 2AHZA 4J42A 3QO8A 5E1AC 1Q3EA 4UV8A 4PA6A 4RQFA 4I7ZB 2HFEC 4CZZA 1EZVH 4FK5C 5KMGA 1SQPH 4B3SO 4F4LA 3WG7B 4UCRA 1VF7A 3OTOB 2UUAO 3JCUZ 1VQLV 5KAFZ 1YEWA 1K5SA 4EFBA 4JI8B 2OCCB 2Z3YA 5EC2C 1FXKB 4FLTA 1U96A 4Q6GA 2LJ2A 2Y69C 1Y76B 2E76B 4CH6A 4JV5B 3RYIB 2Z5UA 3G80A 4FM2A 4X66O 2JEUA 3T4DA 2EULA 3A8TA 4GKJB 1EFRG 4ICGA 1RM1B 1WA8A 5B1BB 2XTAA 2WLIB 4DV6O 5J2TB 3FB7C 1N8RW 2DWDC 4JYAO 1IZ3A 2GHYA 1W0KG 3E86A 3OGIB 5BZBA 1BHAA 3OT7A 2AHYA 4TV8A 3ABMB 5L3DA 1KKDA 2ZIMA 1ZUQA 4HBNA 2LO1A 3D3IA 1MZEA 2EINC 4J41A 4LFAB 3N2GA 4IIJA 3CJHB 5JH7B 2GTSA 3F7YC 4DV0B 5EIBD 4TV9A 3FAVA 2DYSC 2A0LA 2WSSG 4YJ3B 3X2QB 5KLVH 2X6BA 3K9AA 3ETDA 4Q20A 4MW8A 2OIGA 2UXXA 3ZMSA 4WBNA 4DR5B 5LGUA 1M9NA 4YIPA 3VQVA 1FS0G 2YICA 3JATB 2EZOA 1XI1A 3HB3B 2Q4PA 3SPJA 4TSFG 5J2UB 4TT3G 4FLUA 2R9RB 4LH7A 1F51A 2CUGA 3N2KA 4JTDB 5EBMC 1PV0A 3O9OA 1S5HC 4RO2A 3LNNA 1XILA 1G4YB 2BSKA 1PPJH 1K7DA 2JDIG 4I4TB 3CRAA 4NXMO 4WFEA 2EIKC 1V54C 3G67A 2ATKC 2N05A 3CXHF 3CCEV 2Q0AA 3CYOA 1I94O 1ZLZA 5KHKA 2NN4A 2ZXWB 2P90A 1WAZA 2Y69B 1WNSA 3CB2A 1R6TA 1THZA 2EIMB 1XHXA 2CE4A 2FMLA 2YSUB 1VQ8V 4NB5A 3CCUV 1F7YA 3H9VA 3BA9A 5B1AC 1XBLA 4MVZA 4GLXA 4PD4F 1X4TA 2P22C 2GSMB 4TV8B 4IHJA 4IL6Z 1NR7A 1NBMG 4CH3A 1Q5OA 4O4JA 2F66C 4UB6Z 2IJKA 4O4LB 4P9OA 5H6RA 1QVGU 4MTXA 1ORQC 1JQ0A 1B3QA 2AZ0A 4K0KB 4KL1A 4N21A 3OTOO 1VMGA 1LR1A 3P3PA 1XUQA 2GBOA 3OR6C 2YIBA 3NXSA 3N27A 4PDLA 4R50A 2A7WA 3JAMN 4LNUB 2XT9A 3STLC 1EN6A 5EK0A 4FLZA 1YZBA 1BSMA 2X0LA 3AK1A 5CA3A 1S77D 2Y4UA 5KUMA 1TGOA 3ZN1A 4HYOA 2UXDB 1Y74B 1H2MA 1NVPD 1VQOV 4FZ0A 2BTQA 2XHBA 4MVOA 2IM9A 1SRYA 3IFXA 1HR0O 1GM9A 5LA6A 2ZKOA 1NI8A 5H5NA 1SQGA 1FXKA 4I4TA 1GH6A 1JPXA 1KD1W 5EZYB 4DR1B 1IBMB 4YJ2A 4X8AA 3HKDA 1N32B 2R9IA 3CMAV 4NTYA 1D5AA 4JGSA 1PNKA 3E83A 4TOIA 2VQFO 1ZL8B 3ETQA 1D5NA 3K5OA 3SPIA 4LC1A 1X59A 3JARA 5LXTA 3CWBH 5CA1B 3JASB 2OYQA 5EYPA 1XHZA 5LHHA 5E79Z 4FM1A 1Q86W 1QVFU 1XL6A 4K0KO 1AR4A 2A06H 2A9HA 4GZRB 2AXTZ 4PI2A 4LF5B 4I50A 4IIJB 1OHHG 3K08A 4BIOA 3ICXA 3OUFA 5JJJB 2EIKB 3I56V 3K57A 2DMXA 3FB8C 3TETA 3K03A 1VQ4V 1K5QA 1GN2A 3RGBA 3K58A 5HFLA 4UV9A 1XMQO 4CC5A 2CK3G 1RM1C 4FLVA 4DR2B 3A2FA 5IJ0A 1FXHA 2EX3A 4JYCA 3TK1A 1MSDA 3H1IH 2F1MA 3J80N 2JGUA 2ZINA 4L8JA 5A2QN 1JMKC 3OUSA 2CAZC 1HNXO 2PGGA 4LF8O 4MT8A 1J5EO 4CH4A 3RVZA 3WG7C 1KP3A 4OPAA 1DLBA 5C93A 1SQVH 4NXMB 5K1PA 1VP7A 3ZMZA 4JI2B 2Q6AA 2KQXA 1N33B 4BIUA 5F2VO 4DV1B 2M6YA 3I55V 1P4RA 3ZHRA 1QQCA 3DSQA 4UVBA 1HNZO 3CJHA 5JH7A 3RYCB 4HZ3A 3HR0A 5EZYA 2LGQA 2ODMA 3EFFK 4CH5A 3CCLV 2ZR3A 3FAVB 1GAXA 2JRIA 3VQXA 5LP6A 5IYBO 3BCCH 3G71V 4BAYA 1B6QA 2JJ2G 3ASOB 3OTFA 1FAFA 3K06A 5B1OA 2KG7A 1MABG 4O2BB 1VIBA 4B3MB 3FX7A 3B8MA 1FYJA 4R6ZA 1WP8A 3MD0A 2P4KA 2UXCB 2ZE8A 1R6NA 3JASA 2XNDG 1SERA 4UCVA 3G6BA 3CCQV 4DUYO 5LGNA 4IT5A 4UCSA 1V55C 1Q81W 1Q90D 1QBZA 3CRRA 2QKSA 4MVSA 3U10A 4EFEA 1NJIW 3BPZA 3SJQC 1DF5A 4JI4B 3WB2A 3U11A 3DTUB 5JQGA 4HNAB 1JFFB 2EJRA 3W7UA 4BW5A 1URFA 1QU7A 3D36A 3JAWA 4ZHQB 4JYAB 2B5UA 3QO7A 1M90W 2UXDO 3RYIA 1NH2B 1BQ0A 2ZDIC 3KCYA 4DW0A 4JI7B 4J7JA 5B1AB 1R3IC 2YXLA 2CTWA 3OEEG 2PY5A 1Y74A 3SPCA 1IVSA 4GX2A 3CD6V 1UJWB 4JTAB 3IGAC 3MAQA 4NXNB 1IBLB 2E5LO 2YUAA 3ZMVA 1S5JA 2Q7EA 3ETGA 5EBWC 1OCCC 4B7EA 3SYOA 1ZTEA 3AG4C 4GX1A 3VQYA 1JJ2U 3W7SA 3AG1C 2UUBO 2YI9A 4O4LA 1FKAO 4NXNO 4GKKO 1F4NA 2ADQB 5CMUA 5B1BC 2L35A 4UB8Z 1WPBA 2CTPA 2RN9A 1V9PA 4PDVA 2QDOA 4JTCB 4NYKA 4ZIBA 2QEXV 5IY5B 1S3JA 2KKWA 5L3FA 1WLEA 1K73W 1KC8W 2PYLA 4O4HB 1PNLA 2NNUA 3R65A 4X65B 2LFRA 1IDSA 4ZBMA 2R9AA 3L9DA 1EN5A 2KSDA 2XAHA 3VBBA 4LH6A 4PA4A 4QPKA 1HNWB 2DQ3A 5IYCO 4DUZB 4GCZA 3ASNC 1UPGA 2OIEA 3SDLA 3A0BZ 2E74B 5IYZA 3HKEB 3T4ZA 5FL7G 3CC2V 2Q7GA 3AG4B 2VQEB 4RWUA 4OX9B 2Y0PA 2VRZA 2EILB 4DR6B 4F6RA 4MVUA 1XQ8A 4LBEC 1XEQA 4UUJC 2FB5A 4GX0A 1BS3A 5JJNB 1K33A 1TUBA 4CS4A 5CA1A 1H8HG 4X64O 2LGWA 4DV2B 4DV1O 1OCRC 5B3SB 5JVDB 2ZE7A 4YY3B 1E1QG 3T1HB 2PZSA 4DV0O 1GTOA 2K9PA 3M7MX 4KP4A 1OCZB 1BHBA 5LMNO 4AILC 1VQPV 3H01A 4KFMA 4X9QA 1SA0A 2DWEC 3A0HZ 1XREA 2HVKC 2JS3A 4NR1A 3APQA 1AJQA 4UCUA 4H37A 1BL8A 1R73A 2UU9O 1XMOB 1KQSU 1VARA 1R6KA 1EZJA 1XMQB 2YS8A 3OEHG 2LFSA 3B40A 4DUYB 1US6A 5KA5A 2FYUH 3ABKC 3UT5A 1JJOA 4JV5O 1VQNV 3JYCA 1SF9A 1YCIA 4PELA 2HKOA 1OCOC 4RQEA 5IJ9A 4DR4B 2WLNA 2P7TC 1KYOF 1OV9A 1VQ6V 4KHPO 3RT3C 3L75H 3P3NA 1NTKH 1XOUA 4NKGB 2QKCA 4JI5B 3FKSG 1MSWD 4QGPA 4J11A 3T1YB 3QO5A 3G4SV 4ABMA 3RFRA 3T1YO 2K1EA 3DXRA 1K3EA 3RBZA 3IAYA 4FLWA 5LHGA 4XDLA 1AJNA 3CMEV 4NTXA 1DTOA 1PD3A 3HKBB 3AG7A 4MVMA 4F6RB 3OW2U 5FNVB 5KHGA 4NTWA 4O4IB 1BMFG 1Y66A 5DEDA 4DR1O 1J5EB 1IBMO 4AQYB 1YI2V 1J95A 2WLJA 4I55B 1NQTA 4LFBB 4QJFB 3TGUH 3BA8A 3JD1A 2QR4A 4JYBA 4U7OA 4X20B 2OCHA 4WFGA 1S76D 4DR2O 2BTQB 1ZSPA 1M57B 3JD3A 2IJIA 4DRXA 1WB8A 4U3JB 3X2QC 2BE3A 5LBQA 2HHHB 1S72V 5LMNB 5JQGB 4FFKA 4G2KA 4UVAA 1OJHA 3T1HO 3FFQA 2VS0A 2Q5ZA 3VOUA 3ZHSA 1AROP 5BR8O 3H1KH 3L72H 2WA4A 2XOKG 3ASOC 4IYIA 3BEHA 4ASUG 3BHPA 4QE7A 2JJ1G 2AZ2A 1N4CA 3J81N 3UT5B 3E35A 3T1CA 4JI6B 3JARB 3RVYA 4MS2A 2Y48A 3PJSK 1ZWIC 3CCRV 2Z0AA 1VQMV 1VF6C 2QWRB 4U3FH 1DK1A 4PJ0Z 3M99B 2ILMA 3OGCC 4GUNA 1B04A 1U97A 3ZIAG 3ABLC 2ZM6O 4DUZO 5IYZB 1HNWO 3ZMUA 3B09A 2F23A 2QWOB 5H9CA 1K97A 1M5IA 1MMMA 3S3WA 1Q6UA 5GONA 2YDEA 3EHBB 2QTSA 2NR5A 3CP1A 1H2GA 2EIJB 3GWKC 2OTLV 5GTIZ 4I9WA 2P4VA 1I94B 3K0GA 2JGDA 3OD4A 2YIDA 1V54B 2DYRC 5JVDA 2EJ7A 3ZRXA 1VEWA 5H2FZ 4FM0A 3K5NA 1W0JG 3ZBHA 2WLLB 4UCOA 4GKKB 3F7VC 4K35A 4TQDA 3H1LH 2CGOA 1Q8IA 3OR7C 4XDJA 4DV5B 1YXBA 3ML0A 3ZHTA 5LYJA 3S3XA 2QA4V 3ZS8C 3MHHC 2XAGA 4ZKIA 3F5WC 1SQQH 1IXBA 1YJNV 4LFCB 2V1DA 3NR7A 1UFIA 4DR4O 1O9HA 1IBLO 1YJ9V 1KU9A 2QSAA 5TISZ 2XUMA 1S0VA 2O57A 1K92A 1HW7A 3W7TA 3B77A 5FPRA 5EC1C 2HG5C 2KG7B 2DQ0A 1FJGO 1MOFA 3E8GA 3L71H 1JX9A 4FPPA 1IXMA 4G27B 3ZRVA 1QR8A 1ZX3A 4DR7B 4JI1O 4B7KA 2D3OW 1G6UA 2IH3C 2QM8A 1PNMA 2RJZA 2PI4A 2ZD9A 1NTZH 2DJVA 2W6IG 4PV1B 2H8PC 1Q6IA 1NR1A 4YJ2B 2LW7A 4J7ZA 5GW7A 1SZXA 5B5EZ 2CTQA 4GKJO 1QLEB 4ZI7B 2HEPA 4R7CA 4D7TA 2PF4E 1PP9H 2PUSA 2Q8VA 4LP8A 5B66Z 4WCEV 3CPWU 5ITZB 1K4DC 4WFAV 5CB4B 1NS1A 4LFCO 4PHZA 5KHHA 1AI7A 3TXSA 3AG3C 4DR6O 1S5LZ 3KZIZ 2UUAB 1SS3A 3W7XA 1I5XA 2VQEO 1Q82W 3MDSA 3UM7A 2CDYA 2CTRA 2P67A 5CN0A 2NLJC 2RDCA 2Q73A 5C8YB 2BSKB 3WU2Z 1QCEA 3E22B 4UXNA 1Z5WA 2Q67A 1KMIZ 2PTMA 2X6CA 3K59A 2ZNJA 5FPOA 1GN6A 4JI2O 2X7RB 4LFAO 1LUVA 1QR9A 2IJJA 2QWNB 3K9SA 4JZ2A 4UVCA 1FFXB 3LSUA 1HNXB 1D2DA 5KUKA 1VF6A 4X1KB 1SQXH 3WB1A 3K79A 3Q4HA 3LSQA 4JAAA 1L0NH 3SYAA 3L70H 5J2TA 4WBNB 2R70A 2OCCC 1K9MW 3F5TA 4RUEA 4OGQB 2HJDA 2DOSA 1JA8A 3W7WA 2C2AA 1XNQB 2BOCC 3J7AU 2UUCO 5B3SC 1WP7A 4UFZA 2UXBB 5IT9N 1O9GA 2UUBB 3ZCCA 3AG2C 3SJBC 3LSSA 1CP9A 1PM9A 3HKCA 3BABA 4TV9B 2OWOA 1VQ9V 3JD0A 1Q43A 3BRCA 3JAKB 5LMUB 1YTFB 2E75B 1NZ6A 3STZC 1NTMH 2UXBO 4ZI7A 2BTOA 2W0XA 2B1GA 2QTOA 1MNGA 4E2LA 1YITV 3L73H 2FKXA 4B3SB 1QLEC 1OCZC 1KP2A 3JATA 4LF9O 2YEVB 3H1JH 5FLXN 4W4LA 1GK9A 1AB3A 4QPJA 2WLIA 5IJ9B 1XL4A 2HHHO 2PYJA 4K8XA 3N2KB 4IGGA 4NVPA 2ZE5A 4JF3A 4PDRA 1N32O 5AG2A 4DK0A 1VQKV 3SYPA 3C90A 2YI8A 5KX5B 1YSCA 1H2NA 1N36O 1Q7YW 1L8DA 5K1XA 3EVKA 1YTFD 4K3AA 3RN4A 5KAIZ 5EIBC 4JYYA 1Q6HA 3JSNA 1RPOA 1TUEB 3HKDB 4YHHO 4PI0A 4GYCB 1W2BU 3TJTA 3CCMV 3CS5A 5JJEB 3D8CA 1AI5A 3OE7G 4FLYA 2GDSA 2UXCO 3APOA 3B4SA 1G8MA 3RW0A 4B3MO 4I55A 2JGDB 3PN1A 5LXTB 1CPYA 2EINB 3SR2C 1AI6A 4I0XB 1AR5A 3SGIA 1G1XB 1IBKO 4J7KA 2D2CB 3E8HA 1QNMA 1KBHA 2MW2B 3JD2A 4PA7A 5CBGA 3CRQA 2DE0X 2W6JG 1WPXA 2B9ZA 2N74A 4MTGA 4CBCA 5LA6B 5J9PC 1N33O 3K0DA 1TVKB 4JZGA 4BR6A 1CEZA 4P2ZA 4CS2A 4O2AB 1OCCB 3HPLC 5CA0B 3QTCA 4B3RB 1RSOB 4WFBV 3ZN0A 4PA9A 1BZKA 4GX5A 1SQFA 5IWAO 1XNRO 4I9QA 1Z2GA 1ZL8A 3FB6C 3FYEB 3GB7C 1RP3B 2FTKA 2WAMA 2YEVA 3BVOA 1BGYH 5L3EA 1KKCA 3LNMB 4X1IB 4JI3O 5DM6V 1IX9A 2XAQA 5KX5A 4H13B 2QM4A 4X88A 1SQBH 4QIWF 1Y4MA 2G38A 2ARHA 2WLMA 4BW9A 1LUWA 3ZHVA 4DV2O 5BXZA 4LF5O 1YJWV 4U3JA 3ABTA 3SYCA 3R66A 4DV5O 4RAIA 3BAAA 1ROPA 1FFXA 1H2KA 2DN9A 3E89A 4LWSB 3QG5A 4LF4O 2RMKB 3ETEA 1HP8A 3QF7A 1I08A 1Y76A 1AP6A 3RYHA 4IYHA 2ZE6A 1NU1H 4I5SA 3K5LA 4B3TO 2DYRB 5LP6C 2ZXWC 1M1KW 3ZJZA 1K8AW 1XDCA 4DR5O 3CRCA 1H8EG 1NT2B 3OMIB 1YF2A 1WA8B 3CSXA 3LDEA 5JWPA 3O65A 2EBOA 2X6AA 4DV7B 1JVMA 2GUZB 2RCVA 1I7FA 4I50B 4LF6B 2QWQB 2LW1A 2F43G 4X62O 3T2MA 3ZRWB 1L0LH 4X62B 4JI0B 1IURA 1ZAUA 1N36B 1MG1A 4HAMA 4U7NA 4AI8A 4X65O 1HR0B 3N2GB 3OMAB 4PDMA 3K3WA 1LNQA 1MA1A 4FJCC 3RYCA 1F23A 3ASNB 1BT8A 1M56B 4JASA 4JAUA 4EB6B 5DECA 5BMVA 3CEIA 1W59A 2AW9A 4X1YA 2HVJC 4F6EA 4DR3B 1JOYA 3B2EE 4DV4O 1QHTA 4ZOLB 2DYSB 1GO3F 1BE3H 4TUYA 3AG3B 2XAJA 5EYPB 3JALB 4FFBA 5CBHA 2ZDIA 5J2UA 2QGNA 1COWG 2P6JA 2EILC 5BR8B 2YXHA 4Z1MG 1GRJA 2YIAA 2E5LB 3D36C 3L74H 2UUCB 3HKCB 2MK3A 4DO2A 4D6TH 4FVMA 1R3LC 3JSLA 2E3CA 2VWKA 3DC6A 4J9YB 3M8AA 2BCCH 4LWSA 4R8CA 4L87A 3DC5A 4O2BA 2JEXA 1JR9A 4JI7O 1QLNA 4H33A 2Y4TA 5B1NA 2IJHA 1T5EA 1JCHA 1HWYA 2LP7A 1P49A 1NKDA 2Q68A 5D5PA 2ZIOA 3E2EA 5KHIA 3C3TA 4FMTA 5KMGB 4CC6A 4X20A 1AVMA 4LR3A 1KECA 2W0FC 5JCOC 2YC0A 5LGTA 3CX5F 1I5YA 5KHJA 4LCUC 3KKYA 1NH2D 2QJ1A 1H38A 1OCOB 2RQ6A 3AEIA 3OAAG 1GM8A 4G28B 2N04A 3KG2A 1FXVA 2JS5A 4WFHA 3UQ8A 3CCVV 4O2AA 3ABKB 1E1RG 1RSOA 4H44B 4W4KA 2P5OA 3E8BA 5A9GA 5JCOA 5BMVB 1Y6XA 4X1YB 1A32A 2OT5A 5EBLC 3UO2A 1NVPB 4KHPB 2M7WA 4BWAA 2Y0IA 2RNBA 5ITZA 2OTJV 1WJZA 4ZOLA 5L3CA 1VF5B 1TUBB 3ABLB 2A3QA 3ABUA 2LQTA 3CE2A 3CCJV 2Q7HA 2IU0A 4A5UB 5LL6Y 1TA8A 3B8NA 2DW4A 3GVMA 2HR3A 5LOVA 1E79G 2UU9B 2QWPB 1AI4A 1GKFA 4B08A 1N34O 4Z1VA 1VQ5V 3C3SA 4HNAA 3JAKA 3AG2B 3SJCC 1TVKA 2ZR2A 3JAWB 3SJAC 5IDJA 1EBOA 5CA0A 3D3QA 3THOA 4JI1B 2GV9A 3GWOA 3U0ZA 4LF9B 4YY3O 1K34A 4MTOA 4O4HA 3ZRSA 2ZCEA 3TXQA 4X1KA 5D5QA 3H1HH 3ZEDA 4X66B 4PA3A 4OXSA 2GUZA 1FPOA 4CS3A 2IW5A 2R72A 1WB7A 1SETA 5LMUO 2H94A 5L3BA 3WFVA 2EIMC 2QM7A 1GN3A 3IJ4A 3QVNA 3ZRWA 4JI8O 1YDXA 2F95B 4OX9O 3RYFB 1N0NA 3JCZA 3HKEA 1R1BA 2JIZG 2WA3A 2ITCC 4XBFA 5BY1A 1H2SB 5H6QA 4EB6A 1H2LA 1RPRA 4JAVA 3I5DA 2CH7B 1M56C 1ENVA 3CRMA 3LDCA 1DGSA 1I0HA 1FD9A 4DV3O 3TCUA 5IY5C 1GMGA 2HJFC 3AK2A 1Z5VA 5HFMA 4UCTA 1PL4A 3SPHA 1RFYA 2QKAA 5LHIA 1SA0B 2WLHA 2ZM6B 2VWJA 1HDJA 1P7BA 4DV7O 2FL4A 1PKXA 2HLDG 3AG1B 5GTHZ 2ADPA 1YHQV 4C7UA 2KB1A 3UKMA 4QE9A 1EM1A 2YXYA 4B3TB 4LNUA 4JI6O 3SPGA 5LP6B 2WLKA 2V7QG 4WFFA 4LF4B 2XASA 2HP8A 2ITDC 4LF7O 3OMNB 1AP5A 4LF7B 4P9PA 1F4MA 1P84F 2Q0OC 4TUYB 2IH1C 4X1IA 1AILA 4I0XA 4DV4B 5DN6G 4DR3O 2IU3A 1KB9F 1L1FA 4IHJB 5C8YA 1AJPA 2GTAA 2XAFA 3RYFA 4MSWC 2P06A 3EXAA 4KXRA 1BCCH 2IBZH 2EZPA 3DGEA 4EKWA 4JI4O 1FXKC 4K8ZA 4E4EA 2PI5A 5IWAB 1V55B 4JI0O 1OZ0A 4KUMA 4GT1A 4ZHQA 4DR7O 4LFBO 1MZFA 4BIZA 4LF6O 3G6EV 4DV3B 3Q4HB 1SC5B 2UXNA 1FJGB 2WWWA 3JD4A 1GN4A 1YVWA 1M4UA 4AHCA 1SKVA 3UCSC 2BOBC 4DYLA 1KUQA 4DW1A 2F93B 4MTFA 4QNHB 4DRXB 2WLLA 2F4VO 3BFRA 4JPRA 3K5MA 1IBKB 3WB0A 3E8FA 4P30A 1R3KC 1SESA 4J9ZB 1EN4A 3K04A 3DXRB 4Z2WA 4JI5O 3CHXA 3LUTB 3OFNG 4TWKA 2F4VB 4RUFA 1VQ7V 1HNZB 3P32A 3RWRD 4TQFA 1FFTB 2H3OA 3HKBA 4EEQA 4FIPC 1M57C 1Y67A 5IJ0B 4YJ3A 3CC4V 5FNVA 3CXCU 4H0LB 3RYHB 4D7SA 4O4IA 4JI3B 4LF8B 3KCXA 2WPDG 3ZMTA 5IYDO 4XDKA 1DF4A 1XMOO 3CC7V 4J80A 1XNRB 4FFBB 1PL0A 2B1IA 3QNEA 3VQWA 4DK1A 1BQZA 4O4JB
chains in the Genus database with same CATH topology
2EIJB 3OUSA 1AR1B 1LNQA 3CCSV 2OTLV 4MT8A 4I9WA 3LDDA 3ABMC 4FJCC 5CBFA 3K0GA 3RVZA 1F23A 3WG7C 3ASNB 1KP3A 1DLBA 5C93A 1M56B 4JASA 3ZMZA 4JAUA 1SZTA 2Q6AA 4YXWG 1V54B 2DYRC 4BIUA 4WF9V 3FYIB 2HVJC 4MVRA 2ZQMA 3ZRXA 3I55V 1JOYA 1P4RA 5L3GA 1YIJV 4UVBA 1W0JG 2DYSB 1GO3F 3AG3B 4HZ3A 2WLLB 3EFFK 3F7VC 1R3JC 2JK5C 3CCLV 2XAJA 3OR7C 2ZR3A 4XDJA 3ML0A 5IYBO 3G71V 3FB5C 3OM3B 5CBHA 2ZDIA 2QA4V 3MHHC 2QE7G 2XAGA 1GM7A 4BAYA 4ZKIA 3F5WC 1B6QA 1COWG 2JJ2G 3ASOB 2P6JA 2EILC 3K06A 5B1OA 1YJNV 1MABG 2V1DA 3B8MA 4Z1MG 4R6ZA 3MD0A 1YJ9V 2MK3A 4DO2A 1R6NA 4X89A 2XNDG 3A0RA 1R3LC 4DXWA 1SERA 1S0VA 5KA6A 1K92A 1K4CC 3W7TA 3B77A 4MVQA 4J9YB 5EC1C 2HG5C 3CCQV 2DQ0A 4R8CA 5LGNA 1MOFA 2Q69A 1OCRB 3MHSC 4L87A 3E8GA 1JX9A 4FPPA 4MW3A 1IXMA 2JEXA 4G27B 1QLNA 1V55C 4H33A 1QR8A 3ZRVA 1Q81W 5B1NA 3BY6A 1QBZA 4MVSA 2IJHA 2QKSA 3P30A 1NJIW 2A79B 1JCHA 2EIJC 3SJQC 2IH3C 2D3OW 1HWYA 2QM8A 1DF5A 2LP7A 1NKDA 2Q68A 3DTUB 1PNMA 2EJRA 3W7UA 4BW5A 3E2EA 2PI4A 3D36A 3IC7A 4FMTA 4N23A 3SYQA 2ZD9A 2W6IG 2AHZA 1KECA 2B5UA 3QO7A 3QO8A 1M90W 2H8PC 2W0FC 5E1AC 1NH2B 5LGTA 4UV8A 1NR1A 4PA6A 5GW7A 2ZDIC 4RQFA 1I5YA 2HFEC 4CZZA 4LCUC 1NH2D 4FK5C 1H38A 1OCOB 5B1AB 1R3IC 3AEIA 3OAAG 1GM8A 3OEEG 1QLEB 4G28B 3KG2A 4F4LA 1FXVA 3SPCA 3WG7B 4WFHA 4R7CA 4GX2A 3CD6V 3CCVV 1UJWB 4JTAB 3IGAC 3ABKB 4LP8A 3CPWU 1E1RG 4WCEV 3ZMVA 1K4DC 4WFAV 3E8BA 1VQLV 3ETGA 5EBWC 1K5SA 1OCCC 2OCCB 1AI7A 3SYOA 2Z3YA 5EC2C 3AG4C 5EBLC 1FXKB 2OT5A 3AG3C 1NVPB 4GX1A 2M7WA 1JJ2U 3W7XA 2Y69C 3W7SA 1I5XA 3AG1C 1Q82W 2OTJV 3UM7A 5L3CA 3ABLB 2Z5UA 3ABUA 2P67A 2JEUA 1F4NA 5CN0A 3T4DA 3CCJV 5CMUA 2NLJC 2IU0A 5B1BC 1EFRG 1RM1B 1QCEA 5B1BB 3B8NA 4UXNA 2Q67A 2DW4A 2X6CA 4PDVA 2WLIB 4JTCB 2X7RB 2HR3A 2QEXV 3FB7C 5IY5B 1E79G 1N8RW 2DWDC 1S3JA 1QR9A 2GHYA 1W0KG 2IJJA 3E86A 5BZBA 5L3FA 1WLEA 1AI4A 1K73W 1BHAA 1KC8W 4UVCA 1GKFA 1VQ5V 2AHYA 1PNLA 5KUKA 3AG2B 2NNUA 3R65A 3ABMB 5L3DA 2LFRA 2ZR2A 1KKDA 4ZBMA 3K79A 5IDJA 3LSQA 3D3IA 1EBOA 2EINC 3SYAA 3F7YC 3GWOA 2OCCC 2XAHA 3VBBA 1K9MW 4PA4A 4QPKA 4RUEA 1K34A 4MTOA 2DQ3A 5IYCO 2DYSC 2A0LA 3ZRSA 4GCZA 3W7WA 3ASNC 2WSSG 2C2AA 3X2QB 2BOCC 2X6BA 3K9AA 3ETDA 4PA3A 5B3SC 3T4ZA 4OXSA 4Q20A 4MW8A 5FL7G 3CC2V 2IW5A 2UXXA 3ZMSA 3AG4B 3ZCCA 5LGUA 1SETA 3AG2C 3LSSA 1CP9A 2H94A 2EILB 1M9NA 5L3BA 3WFVA 2EIMC 4MVUA 2QM7A 1FS0G 3ZRWA 1VQ9V 3JD0A 4LBEC 4UUJC 2EZOA 4GX0A 1YTFB 3HB3B 3STZC 3SPJA 3JCZA 4TSFG 4TT3G 2R9RB 1F51A 2JIZG 1K33A 2B1GA 4JTDB 2QTOA 2ITCC 5EBMC 4E2LA 1YITV 4XBFA 1H8HG 1S5HC 1QLEC 1OCRC 4RO2A 5H6QA 1OCZC 1G4YB 5B3SB 1RPRA 1KP2A 1K7DA 1E1QG 4JAVA 2JDIG 1GTOA 2YEVB 4KP4A 1OCZB 1GK9A 4WFEA 2EIKC 1V54C 1BHBA 4QPJA 2WLIA 2ATKC 1XL4A 1M56C 1ENVA 3CCEV 3CYOA 1VQPV 4PDRA 4JF3A 3H01A 4KFMA 3LDCA 1VQKV 3SYPA 2DWEC 1YSCA 2ZXWB 3TCUA 2HVKC 5IY5C 1GMGA 2P90A 1Q7YW 2Y69B 1YTFD 1AJQA 2HJFC 4H37A 1BL8A 1R73A 1THZA 5HFMA 1KQSU 2EIMB 1R6KA 1EZJA 2YSUB 1VQ8V 3SPHA 3CCUV 1RPOA 5B1AC 1TUEB 3OEHG 5LHIA 2LFSA 2WLHA 1P7BA 4MVZA 1W2BU 5KA5A 3ABKC 1PKXA 2HLDG 3CCMV 2GSMB 3AG1B 1VQNV 1NR7A 1AI5A 3JYCA 1NBMG 3OE7G 1YHQV 2KB1A 4PELA 2HKOA 1OCOC 4RQEA 2WLNA 2P7TC 4QE9A 3UKMA 1G8MA 2IJKA 4P9OA 1VQ6V 3RW0A 5H6RA 1QVGU 4MTXA 1ORQC 1JQ0A 1CPYA 2EINB 3SPGA 1AI6A 3FKSG 2WLKA 4N21A 2V7QG 1MSWD 4WFFA 2XASA 2ITDC 3OMNB 3QO5A 3G4SV 3NXSA 3E8HA 3OR6C 2K1EA 3JD2A 4PA7A 4P9PA 5CBGA 1F4MA 1K3EA 3RBZA 4PDLA 5LHGA 4R50A 2IH1C 4XDLA 1AJNA 2W6JG 1WPXA 5DN6G 3CMEV 3STLC 1DTOA 1PD3A 4MTGA 5EK0A 4CBCA 4MVMA 2IU3A 2X0LA 5J9PC 3OW2U 5CA3A 1S77D 1L1FA 5KUMA 3K0DA 3ZN1A 4HYOA 1CEZA 1AJPA 1NVPD 1VQOV 4P2ZA 2XAFA 1BMFG 1Y66A 1OCCB 3HPLC 4MSWC 1YI2V 1J95A 2WLJA 4MVOA 1SRYA 4WFBV 3ZN0A 3IFXA 2EZPA 3DGEA 1NQTA 4PA9A 1GM9A 4EKWA 4QJFB 1FXKC 4GX5A 2PI5A 3JD1A 1V55B 4JYBA 4U7OA 1OZ0A 3FB6C 3FYEB 3GB7C 4GT1A 4KUMA 2FTKA 1FXKA 2WAMA 4WFGA 2YEVA 4BIZA 1S76D 3G6EV 1JPXA 1M57B 3JD3A 1KD1W 2UXNA 2IJIA 2WWWA 3JD4A 4X8AA 5L3EA 3LNMB 2R9IA 3X2QC 3CMAV 5DM6V 5LBQA 1S72V 2XAQA 4JGSA 1PNKA 4X88A 3E83A 4QIWF 4G2KA 4UVAA 3K3WA 1Y4MA 2BOBC 2WLMA 3VOUA 4MTFA 4LC1A 3SPIA 1AROP 4QNHB 2XOKG 3ASOC 1YJWV 3ABTA 2WLLA 3SYCA 3BEHA 4JPRA 4RAIA 4ASUG 1ROPA 5LHHA 4QE7A 2JJ1G 3E89A 3E8FA 4P30A 1R3KC 1SESA 3ETEA 4J9ZB 1Q86W 3K04A 1QVFU 3E35A 1XL6A 3T1CA 3LUTB 3OFNG 4TWKA 4RUFA 1VQ7V 2A9HA 3P32A 4I5SA 3RVYA 2DYRB 4MS2A 2Y48A 2ZXWC 3PJSK 1OHHG 1ZWIC 1M1KW 1FFTB 3ZJZA 3K08A 1K8AW 4FIPC 3OUFA 3CCRV 1VQMV 1M57C 2EIKB 3I56V 1H8EG 3OMIB 3M99B 3FB8C 3LDEA 3CC4V 3OGCC 3CXCU 3TETA 3K03A 1VQ4V 3ZIAG 1K5QA 3ABLC 2EBOA 2X6AA 1JVMA 5HFLA 2WPDG 4UV9A 3ZMUA 5H9CA 2CK3G 1RM1C 1K97A 3ZMTA 5IYDO 2F43G 4XDKA 1DF4A 3T2MA 3ZRWB 3CC7V 1FXHA 4JYCA 3TK1A 1PL0A 2B1IA 3EHBB 3QNEA 1MG1A 3CP1A 4HAMA 4U7NA 3OMAB 4PDMA 1H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFH A;  3OUS A;  4GX2 A;  4R7C A;  1LNQ A;  2R9R B;  3HPL C;  4MSW C;  4I9W A;  4JTA B;  3IGA C;  3ABM C;  3LDD A;  5CBF A;  3K0G A;  4LP8 A;  3RVZ A;  4JTD B;  1J95 A;  2WLJ A;  4MVO A;  2QTO A;  2ITC C;  5EBM C;  3WG7 C;  1K4D C;  3IFX A;  1S5H C;  3E8B A;  4PA9 A;  1QLE C;  5EBW C;  1OCR C;  4RO2 A;  2Q6A A;  4EKW A;  1OCZ C;  1G4Y B;  4GX5 A;  1OCC C;  2DYR C;  3SYO A;  2HVJ C;  4MVR A;  3FB6 C;  3GB7 C;  5EC2 C;  3AG4 C;  5EBL C;  3AG3 C;  4GX1 A;  2EIK C;  1V54 C;  4WFG A;  2YEV A;  4WFE A;  2WLI A;  2ATK C;  2Y69 C;  1XL4 A;  3AG1 C;  1M56 C;  3UM7 A;  4HZ3 A;  4PDR A;  4KFM A;  2WLL B;  4X8A A;  3LNM B;  3EFF K;  3F7V C;  3LDC A;  3X2Q C;  1R3J C;  2JK5 C;  3SYP A;  2DWE C;  3T4D A;  3OR7 C;  2NLJ C;  3TCU A;  2HVK C;  5B1B C;  4XDJ A;  5IY5 C;  4X88 A;  3E83 A;  3FB5 C;  5CBH A;  2HJF C;  4H37 A;  1BL8 A;  2BOB C;  3F5W C;  2WLM A;  2EIL C;  3K06 A;  2Q67 A;  3VOU A;  2X6C A;  4MTF A;  4PDV A;  3SPI A;  2WLI B;  4JTC B;  3SPH A;  3FB7 C;  4QNH B;  3ASO C;  5B1A C;  4R6Z A;  2DWD C;  2WLH A;  2WLL A;  3E86 A;  3SYC A;  5BZB A;  1P7B A;  3BEH A;  4MVZ A;  4RAI A;  4X89 A;  4DXW A;  1R3L C;  3ABK C;  2AHY A;  1K4C C;  4QE7 A;  5KUK A;  3E89 A;  3E8F A;  3R65 A;  4P30 A;  3SPJ A;  1R3K C;  4MVQ A;  4J9Y B;  4J9Z B;  3K04 A;  5EC1 C;  1KKD A;  2HG5 C;  3JYC A;  1XL6 A;  3T1C A;  4R8C A;  3LUT B;  4ZBM A;  2Q69 A;  2KB1 A;  4TWK A;  3E8G A;  4RUF A;  2A9H A;  3UKM A;  4MW3 A;  1OCO C;  2EIN C;  2WLN A;  2P7T C;  4G27 B;  1V55 C;  4H33 A;  4QE9 A;  4P9O A;  4MS2 A;  2ZXW C;  3PJS K;  3RVY A;  3RW0 A;  3F7Y C;  1ZWI C;  3SPC A;  1ORQ C;  2OCC C;  4MVS A;  2QKS A;  3ZJZ A;  4PA4 A;  2A79 B;  3K08 A;  4RUE A;  2EIJ C;  3SJQ C;  2IH3 C;  3OUF A;  3SPG A;  1M57 C;  4MTO A;  2WLK A;  2DYS C;  2Q68 A;  2A0L A;  4WFF A;  3ZRS A;  3ASN C;  3FB8 C;  2ITD C;  3LDE A;  4BW5 A;  3OGC C;  3TET A;  3K03 A;  3E8H A;  3OR6 C;  2K1E A;  3ABL C;  2X6A A;  4PA7 A;  2BOC C;  4P9P A;  5CBG A;  1JVM A;  2X6B A;  3SYQ A;  2ZD9 A;  4PA3 A;  5B3S C;  3RBZ A;  3T4Z A;  4OXS A;  4PDL A;  4MW8 A;  2AHZ A;  4R50 A;  2IH1 C;  2H8P C;  2W0F C;  5E1A C;  4XDL A;  3AG2 C;  4PA6 A;  4XDK A;  3STL C;  4MTG A;  5EK0 A;  3T2M A;  4CBC A;  2HFE C;  2EIM C;  4MVU A;  4LCU C;  4MVM A;  5J9P C;  4LBE C;  3SYA A;  1R3I C;  4UUJ C;  4GX0 A;  3K0D A;  5KUM A;  4HYO A;  4G28 B;  3KG2 A;  3STZ C;  4F4L A;  4P2Z A;  4PDM A; 
#chains in the Genus database with same CATH topology
 1AR1 B;  5IE9 A;  3CCS V;  1N34 B;  3LDD A;  3ABM C;  5CBF A;  5LOV B;  4B3R O;  1CXZ B;  3AK3 A;  4J10 A;  5GON B;  4OPH A;  4DV6 B;  1SZT A;  4YXW G;  3UO3 A;  2V4D A;  4WF9 V;  3FYI B;  4MVR A;  2ZQM A;  2ZT9 B;  3IC9 A;  2JVD A;  4X64 B;  2ETN A;  5L3G A;  2AGA A;  1YIJ V;  1WN7 A;  2Q9L A;  4FLX A;  1R3J C;  2JK5 C;  5CB4 A;  3ZX6 A;  3ZHU A;  4FZ1 A;  2CGN A;  3FB5 C;  3OM3 B;  2QE7 G;  1GM7 A;  3ZHQ A;  4YIO A;  2VQF B;  1XNQ O;  3JAL A;  4X89 A;  4DXW A;  3A0R A;  5KA6 A;  2ZNI A;  1K4C C;  5LYJ B;  4MVQ A;  2YIB D;  1JFF A;  2Q69 A;  1OCR B;  3E22 A;  3MHS C;  4YHH B;  4MW3 A;  1M93 A;  3FD9 A;  1TAE A;  3BY6 A;  3P30 A;  1B06 A;  2A79 B;  2EIJ C;  2L6L A;  1N0J A;  3IC7 A;  4AQY O;  4N23 A;  3SYQ A;  2CH7 A;  1P7G A;  2AHZ A;  4J42 A;  3QO8 A;  5E1A C;  1Q3E A;  4UV8 A;  4PA6 A;  4RQF A;  4I7Z B;  2HFE C;  4CZZ A;  1EZV H;  4FK5 C;  5KMG A;  1SQP H;  4B3S O;  4F4L A;  3WG7 B;  4UCR A;  1VF7 A;  3OTO B;  2UUA O;  3JCU Z;  1VQL V;  5KAF Z;  1YEW A;  1K5S A;  4EFB A;  4JI8 B;  2OCC B;  2Z3Y A;  5EC2 C;  1FXK B;  4FLT A;  1U96 A;  4Q6G A;  2LJ2 A;  2Y69 C;  1Y76 B;  2E76 B;  4CH6 A;  4JV5 B;  3RYI B;  2Z5U A;  3G80 A;  4FM2 A;  4X66 O;  2JEU A;  3T4D A;  2EUL A;  3A8T A;  4GKJ B;  1EFR G;  4ICG A;  1RM1 B;  1WA8 A;  5B1B B;  2XTA A;  2WLI B;  4DV6 O;  5J2T B;  3FB7 C;  1N8R W;  2DWD C;  4JYA O;  1IZ3 A;  2GHY A;  1W0K G;  3E86 A;  3OGI B;  5BZB A;  1BHA A;  3OT7 A;  2AHY A;  4TV8 A;  3ABM B;  5L3D A;  1KKD A;  2ZIM A;  1ZUQ A;  4HBN A;  2LO1 A;  3D3I A;  1MZE A;  2EIN C;  4J41 A;  4LFA B;  3N2G A;  4IIJ A;  3CJH B;  5JH7 B;  2GTS A;  3F7Y C;  4DV0 B;  5EIB D;  4TV9 A;  3FAV A;  2DYS C;  2A0L A;  2WSS G;  4YJ3 B;  3X2Q B;  5KLV H;  2X6B A;  3K9A A;  3ETD A;  4Q20 A;  4MW8 A;  2OIG A;  2UXX A;  3ZMS A;  4WBN A;  4DR5 B;  5LGU A;  1M9N A;  4YIP A;  3VQV A;  1FS0 G;  2YIC A;  3JAT B;  2EZO A;  1XI1 A;  3HB3 B;  2Q4P A;  3SPJ A;  4TSF G;  5J2U B;  4TT3 G;  4FLU A;  2R9R B;  4LH7 A;  1F51 A;  2CUG A;  3N2K A;  4JTD B;  5EBM C;  1PV0 A;  3O9O A;  1S5H C;  4RO2 A;  3LNN A;  1XIL A;  1G4Y B;  2BSK A;  1PPJ H;  1K7D A;  2JDI G;  4I4T B;  3CRA A;  4NXM O;  4WFE A;  2EIK C;  1V54 C;  3G67 A;  2ATK C;  2N05 A;  3CXH F;  3CCE V;  2Q0A A;  3CYO A;  1I94 O;  1ZLZ A;  5KHK A;  2NN4 A;  2ZXW B;  2P90 A;  1WAZ A;  2Y69 B;  1WNS A;  3CB2 A;  1R6T A;  1THZ A;  2EIM B;  1XHX A;  2CE4 A;  2FML A;  2YSU B;  1VQ8 V;  4NB5 A;  3CCU V;  1F7Y A;  3H9V A;  3BA9 A;  5B1A C;  1XBL A;  4MVZ A;  4GLX A;  4PD4 F;  1X4T A;  2P22 C;  2GSM B;  4TV8 B;  4IHJ A;  4IL6 Z;  1NR7 A;  1NBM G;  4CH3 A;  1Q5O A;  4O4J A;  2F66 C;  4UB6 Z;  2IJK A;  4O4L B;  4P9O A;  5H6R A;  1QVG U;  4MTX A;  1ORQ C;  1JQ0 A;  1B3Q A;  2AZ0 A;  4K0K B;  4KL1 A;  4N21 A;  3OTO O;  1VMG A;  1LR1 A;  3P3P A;  1XUQ A;  2GBO A;  3OR6 C;  2YIB A;  3NXS A;  3N27 A;  4PDL A;  4R50 A;  2A7W A;  3JAM N;  4LNU B;  2XT9 A;  3STL C;  1EN6 A;  5EK0 A;  4FLZ A;  1YZB A;  1BSM A;  2X0L A;  3AK1 A;  5CA3 A;  1S77 D;  2Y4U A;  5KUM A;  1TGO A;  3ZN1 A;  4HYO A;  2UXD B;  1Y74 B;  1H2M A;  1NVP D;  1VQO V;  4FZ0 A;  2BTQ A;  2XHB A;  4MVO A;  2IM9 A;  1SRY A;  3IFX A;  1HR0 O;  1GM9 A;  5LA6 A;  2ZKO A;  1NI8 A;  5H5N A;  1SQG A;  1FXK A;  4I4T A;  1GH6 A;  1JPX A;  1KD1 W;  5EZY B;  4DR1 B;  1IBM B;  4YJ2 A;  4X8A A;  3HKD A;  1N32 B;  2R9I A;  3CMA V;  4NTY A;  1D5A A;  4JGS A;  1PNK A;  3E83 A;  4TOI A;  2VQF O;  1ZL8 B;  3ETQ A;  1D5N A;  3K5O A;  3SPI A;  4LC1 A;  1X59 A;  3JAR A;  5LXT A;  3CWB H;  5CA1 B;  3JAS B;  2OYQ A;  5EYP A;  1XHZ A;  5LHH A;  5E79 Z;  4FM1 A;  1Q86 W;  1QVF U;  1XL6 A;  4K0K O;  1AR4 A;  2A06 H;  2A9H A;  4GZR B;  2AXT Z;  4PI2 A;  4LF5 B;  4I50 A;  4IIJ B;  1OHH G;  3K08 A;  4BIO A;  3ICX A;  3OUF A;  5JJJ B;  2EIK B;  3I56 V;  3K57 A;  2DMX A;  3FB8 C;  3TET A;  3K03 A;  1VQ4 V;  1K5Q A;  1GN2 A;  3RGB A;  3K58 A;  5HFL A;  4UV9 A;  1XMQ O;  4CC5 A;  2CK3 G;  1RM1 C;  4FLV A;  4DR2 B;  3A2F A;  5IJ0 A;  1FXH A;  2EX3 A;  4JYC A;  3TK1 A;  1MSD A;  3H1I H;  2F1M A;  3J80 N;  2JGU A;  2ZIN A;  4L8J A;  5A2Q N;  1JMK C;  3OUS A;  2CAZ C;  1HNX O;  2PGG A;  4LF8 O;  4MT8 A;  1J5E O;  4CH4 A;  3RVZ A;  3WG7 C;  1KP3 A;  4OPA A;  1DLB A;  5C93 A;  1SQV H;  4NXM B;  5K1P A;  1VP7 A;  3ZMZ A;  4JI2 B;  2Q6A A;  2KQX A;  1N33 B;  4BIU A;  5F2V O;  4DV1 B;  2M6Y A;  3I55 V;  1P4R A;  3ZHR A;  1QQC A;  3DSQ A;  4UVB A;  1HNZ O;  3CJH A;  5JH7 A;  3RYC B;  4HZ3 A;  3HR0 A;  5EZY A;  2LGQ A;  2ODM A;  3EFF K;  4CH5 A;  3CCL V;  2ZR3 A;  3FAV B;  1GAX A;  2JRI A;  3VQX A;  5LP6 A;  5IYB O;  3BCC H;  3G71 V;  4BAY A;  1B6Q A;  2JJ2 G;  3ASO B;  3OTF A;  1FAF A;  3K06 A;  5B1O A;  2KG7 A;  1MAB G;  4O2B B;  1VIB A;  4B3M B;  3FX7 A;  3B8M A;  1FYJ A;  4R6Z A;  1WP8 A;  3MD0 A;  2P4K A;  2UXC B;  2ZE8 A;  1R6N A;  3JAS A;  2XND G;  1SER A;  4UCV A;  3G6B A;  3CCQ V;  4DUY O;  5LGN A;  4IT5 A;  4UCS A;  1V55 C;  1Q81 W;  1Q90 D;  1QBZ A;  3CRR A;  2QKS A;  4MVS A;  3U10 A;  4EFE A;  1NJI W;  3BPZ A;  3SJQ C;  1DF5 A;  4JI4 B;  3WB2 A;  3U11 A;  3DTU B;  5JQG A;  4HNA B;  1JFF B;  2EJR A;  3W7U A;  4BW5 A;  1URF A;  1QU7 A;  3D36 A;  3JAW A;  4ZHQ B;  4JYA B;  2B5U A;  3QO7 A;  1M90 W;  2UXD O;  3RYI A;  1NH2 B;  1BQ0 A;  2ZDI C;  3KCY A;  4DW0 A;  4JI7 B;  4J7J A;  5B1A B;  1R3I C;  2YXL A;  2CTW A;  3OEE G;  2PY5 A;  1Y74 A;  3SPC A;  1IVS A;  4GX2 A;  3CD6 V;  1UJW B;  4JTA B;  3IGA C;  3MAQ A;  4NXN B;  1IBL B;  2E5L O;  2YUA A;  3ZMV A;  1S5J A;  2Q7E A;  3ETG A;  5EBW C;  1OCC C;  4B7E A;  3SYO A;  1ZTE A;  3AG4 C;  4GX1 A;  3VQY A;  1JJ2 U;  3W7S A;  3AG1 C;  2UUB O;  2YI9 A;  4O4L A;  1FKA O;  4NXN O;  4GKK O;  1F4N A;  2ADQ B;  5CMU A;  5B1B C;  2L35 A;  4UB8 Z;  1WPB A;  2CTP A;  2RN9 A;  1V9P A;  4PDV A;  2QDO A;  4JTC B;  4NYK A;  4ZIB A;  2QEX V;  5IY5 B;  1S3J A;  2KKW A;  5L3F A;  1WLE A;  1K73 W;  1KC8 W;  2PYL A;  4O4H B;  1PNL A;  2NNU A;  3R65 A;  4X65 B;  2LFR A;  1IDS A;  4ZBM A;  2R9A A;  3L9D A;  1EN5 A;  2KSD A;  2XAH A;  3VBB A;  4LH6 A;  4PA4 A;  4QPK A;  1HNW B;  2DQ3 A;  5IYC O;  4DUZ B;  4GCZ A;  3ASN C;  1UPG A;  2OIE A;  3SDL A;  3A0B Z;  2E74 B;  5IYZ A;  3HKE B;  3T4Z A;  5FL7 G;  3CC2 V;  2Q7G A;  3AG4 B;  2VQE B;  4RWU A;  4OX9 B;  2Y0P A;  2VRZ A;  2EIL B;  4DR6 B;  4F6R A;  4MVU A;  1XQ8 A;  4LBE C;  1XEQ A;  4UUJ C;  2FB5 A;  4GX0 A;  1BS3 A;  5JJN B;  1K33 A;  1TUB A;  4CS4 A;  5CA1 A;  1H8H G;  4X64 O;  2LGW A;  4DV2 B;  4DV1 O;  1OCR C;  5B3S B;  5JVD B;  2ZE7 A;  4YY3 B;  1E1Q G;  3T1H B;  2PZS A;  4DV0 O;  1GTO A;  2K9P A;  3M7M X;  4KP4 A;  1OCZ B;  1BHB A;  5LMN O;  4AIL C;  1VQP V;  3H01 A;  4KFM A;  4X9Q A;  1SA0 A;  2DWE C;  3A0H Z;  1XRE A;  2HVK C;  2JS3 A;  4NR1 A;  3APQ A;  1AJQ A;  4UCU A;  4H37 A;  1BL8 A;  1R73 A;  2UU9 O;  1XMO B;  1KQS U;  1VAR A;  1R6K A;  1EZJ A;  1XMQ B;  2YS8 A;  3OEH G;  2LFS A;  3B40 A;  4DUY B;  1US6 A;  5KA5 A;  2FYU H;  3ABK C;  3UT5 A;  1JJO A;  4JV5 O;  1VQN V;  3JYC A;  1SF9 A;  1YCI A;  4PEL A;  2HKO A;  1OCO C;  4RQE A;  5IJ9 A;  4DR4 B;  2WLN A;  2P7T C;  1KYO F;  1OV9 A;  1VQ6 V;  4KHP O;  3RT3 C;  3L75 H;  3P3N A;  1NTK H;  1XOU A;  4NKG B;  2QKC A;  4JI5 B;  3FKS G;  1MSW D;  4QGP A;  4J11 A;  3T1Y B;  3QO5 A;  3G4S V;  4ABM A;  3RFR A;  3T1Y O;  2K1E A;  3DXR A;  1K3E A;  3RBZ A;  3IAY A;  4FLW A;  5LHG A;  4XDL A;  1AJN A;  3CME V;  4NTX A;  1DTO A;  1PD3 A;  3HKB B;  3AG7 A;  4MVM A;  4F6R B;  3OW2 U;  5FNV B;  5KHG A;  4NTW A;  4O4I B;  1BMF G;  1Y66 A;  5DED A;  4DR1 O;  1J5E B;  1IBM O;  4AQY B;  1YI2 V;  1J95 A;  2WLJ A;  4I55 B;  1NQT A;  4LFB B;  4QJF B;  3TGU H;  3BA8 A;  3JD1 A;  2QR4 A;  4JYB A;  4U7O A;  4X20 B;  2OCH A;  4WFG A;  1S76 D;  4DR2 O;  2BTQ B;  1ZSP A;  1M57 B;  3JD3 A;  2IJI A;  4DRX A;  1WB8 A;  4U3J B;  3X2Q C;  2BE3 A;  5LBQ A;  2HHH B;  1S72 V;  5LMN B;  5JQG B;  4FFK A;  4G2K A;  4UVA A;  1OJH A;  3T1H O;  3FFQ A;  2VS0 A;  2Q5Z A;  3VOU A;  3ZHS A;  1ARO P;  5BR8 O;  3H1K H;  3L72 H;  2WA4 A;  2XOK G;  3ASO C;  4IYI A;  3BEH A;  4ASU G;  3BHP A;  4QE7 A;  2JJ1 G;  2AZ2 A;  1N4C A;  3J81 N;  3UT5 B;  3E35 A;  3T1C A;  4JI6 B;  3JAR B;  3RVY A;  4MS2 A;  2Y48 A;  3PJS K;  1ZWI C;  3CCR V;  2Z0A A;  1VQM V;  1VF6 C;  2QWR B;  4U3F H;  1DK1 A;  4PJ0 Z;  3M99 B;  2ILM A;  3OGC C;  4GUN A;  1B04 A;  1U97 A;  3ZIA G;  3ABL C;  2ZM6 O;  4DUZ O;  5IYZ B;  1HNW O;  3ZMU A;  3B09 A;  2F23 A;  2QWO B;  5H9C A;  1K97 A;  1M5I A;  1MMM A;  3S3W A;  1Q6U A;  5GON A;  2YDE A;  3EHB B;  2QTS A;  2NR5 A;  3CP1 A;  1H2G A;  2EIJ B;  3GWK C;  2OTL V;  5GTI Z;  4I9W A;  2P4V A;  1I94 B;  3K0G A;  2JGD A;  3OD4 A;  2YID A;  1V54 B;  2DYR C;  5JVD A;  2EJ7 A;  3ZRX A;  1VEW A;  5H2F Z;  4FM0 A;  3K5N A;  1W0J G;  3ZBH A;  2WLL B;  4UCO A;  4GKK B;  3F7V C;  4K35 A;  4TQD A;  3H1L H;  2CGO A;  1Q8I A;  3OR7 C;  4XDJ A;  4DV5 B;  1YXB A;  3ML0 A;  3ZHT A;  5LYJ A;  3S3X A;  2QA4 V;  3ZS8 C;  3MHH C;  2XAG A;  4ZKI A;  3F5W C;  1SQQ H;  1IXB A;  1YJN V;  4LFC B;  2V1D A;  3NR7 A;  1UFI A;  4DR4 O;  1O9H A;  1IBL O;  1YJ9 V;  1KU9 A;  2QSA A;  5TIS Z;  2XUM A;  1S0V A;  2O57 A;  1K92 A;  1HW7 A;  3W7T A;  3B77 A;  5FPR A;  5EC1 C;  2HG5 C;  2KG7 B;  2DQ0 A;  1FJG O;  1MOF A;  3E8G A;  3L71 H;  1JX9 A;  4FPP A;  1IXM A;  4G27 B;  3ZRV A;  1QR8 A;  1ZX3 A;  4DR7 B;  4JI1 O;  4B7K A;  2D3O W;  1G6U A;  2IH3 C;  2QM8 A;  1PNM A;  2RJZ A;  2PI4 A;  2ZD9 A;  1NTZ H;  2DJV A;  2W6I G;  4PV1 B;  2H8P C;  1Q6I A;  1NR1 A;  4YJ2 B;  2LW7 A;  4J7Z A;  5GW7 A;  1SZX A;  5B5E Z;  2CTQ A;  4GKJ O;  1QLE B;  4ZI7 B;  2HEP A;  4R7C A;  4D7T A;  2PF4 E;  1PP9 H;  2PUS A;  2Q8V A;  4LP8 A;  5B66 Z;  4WCE V;  3CPW U;  5ITZ B;  1K4D C;  4WFA V;  5CB4 B;  1NS1 A;  4LFC O;  4PHZ A;  5KHH A;  1AI7 A;  3TXS A;  3AG3 C;  4DR6 O;  1S5L Z;  3KZI Z;  2UUA B;  1SS3 A;  3W7X A;  1I5X A;  2VQE O;  1Q82 W;  3MDS A;  3UM7 A;  2CDY A;  2CTR A;  2P67 A;  5CN0 A;  2NLJ C;  2RDC A;  2Q73 A;  5C8Y B;  2BSK B;  3WU2 Z;  1QCE A;  3E22 B;  4UXN A;  1Z5W A;  2Q67 A;  1KMI Z;  2PTM A;  2X6C A;  3K59 A;  2ZNJ A;  5FPO A;  1GN6 A;  4JI2 O;  2X7R B;  4LFA O;  1LUV A;  1QR9 A;  2IJJ A;  2QWN B;  3K9S A;  4JZ2 A;  4UVC A;  1FFX B;  3LSU A;  1HNX B;  1D2D A;  5KUK A;  1VF6 A;  4X1K B;  1SQX H;  3WB1 A;  3K79 A;  3Q4H A;  3LSQ A;  4JAA A;  1L0N H;  3SYA A;  3L70 H;  5J2T A;  4WBN B;  2R70 A;  2OCC C;  1K9M W;  3F5T A;  4RUE A;  4OGQ B;  2HJD A;  2DOS A;  1JA8 A;  3W7W A;  2C2A A;  1XNQ B;  2BOC C;  3J7A U;  2UUC O;  5B3S C;  1WP7 A;  4UFZ A;  2UXB B;  5IT9 N;  1O9G A;  2UUB B;  3ZCC A;  3AG2 C;  3SJB C;  3LSS A;  1CP9 A;  1PM9 A;  3HKC A;  3BAB A;  4TV9 B;  2OWO A;  1VQ9 V;  3JD0 A;  1Q43 A;  3BRC A;  3JAK B;  5LMU B;  1YTF B;  2E75 B;  1NZ6 A;  3STZ C;  1NTM H;  2UXB O;  4ZI7 A;  2BTO A;  2W0X A;  2B1G A;  2QTO A;  1MNG A;  4E2L A;  1YIT V;  3L73 H;  2FKX A;  4B3S B;  1QLE C;  1OCZ C;  1KP2 A;  3JAT A;  4LF9 O;  2YEV B;  3H1J H;  5FLX N;  4W4L A;  1GK9 A;  1AB3 A;  4QPJ A;  2WLI A;  5IJ9 B;  1XL4 A;  2HHH O;  2PYJ A;  4K8X A;  3N2K B;  4IGG A;  4NVP A;  2ZE5 A;  4JF3 A;  4PDR A;  1N32 O;  5AG2 A;  4DK0 A;  1VQK V;  3SYP A;  3C90 A;  2YI8 A;  5KX5 B;  1YSC A;  1H2N A;  1N36 O;  1Q7Y W;  1L8D A;  5K1X A;  3EVK A;  1YTF D;  4K3A A;  3RN4 A;  5KAI Z;  5EIB C;  4JYY A;  1Q6H A;  3JSN A;  1RPO A;  1TUE B;  3HKD B;  4YHH O;  4PI0 A;  4GYC B;  1W2B U;  3TJT A;  3CCM V;  3CS5 A;  5JJE B;  3D8C A;  1AI5 A;  3OE7 G;  4FLY A;  2GDS A;  2UXC O;  3APO A;  3B4S A;  1G8M A;  3RW0 A;  4B3M O;  4I55 A;  2JGD B;  3PN1 A;  5LXT B;  1CPY A;  2EIN B;  3SR2 C;  1AI6 A;  4I0X B;  1AR5 A;  3SGI A;  1G1X B;  1IBK O;  4J7K A;  2D2C B;  3E8H A;  1QNM A;  1KBH A;  2MW2 B;  3JD2 A;  4PA7 A;  5CBG A;  3CRQ A;  2DE0 X;  2W6J G;  1WPX A;  2B9Z A;  2N74 A;  4MTG A;  4CBC A;  5LA6 B;  5J9P C;  1N33 O;  3K0D A;  1TVK B;  4JZG A;  4BR6 A;  1CEZ A;  4P2Z A;  4CS2 A;  4O2A B;  1OCC B;  3HPL C;  5CA0 B;  3QTC A;  4B3R B;  1RSO B;  4WFB V;  3ZN0 A;  4PA9 A;  1BZK A;  4GX5 A;  1SQF A;  5IWA O;  1XNR O;  4I9Q A;  1Z2G A;  1ZL8 A;  3FB6 C;  3FYE B;  3GB7 C;  1RP3 B;  2FTK A;  2WAM A;  2YEV A;  3BVO A;  1BGY H;  5L3E A;  1KKC A;  3LNM B;  4X1I B;  4JI3 O;  5DM6 V;  1IX9 A;  2XAQ A;  5KX5 A;  4H13 B;  2QM4 A;  4X88 A;  1SQB H;  4QIW F;  1Y4M A;  2G38 A;  2ARH A;  2WLM A;  4BW9 A;  1LUW A;  3ZHV A;  4DV2 O;  5BXZ A;  4LF5 O;  1YJW V;  4U3J A;  3ABT A;  3SYC A;  3R66 A;  4DV5 O;  4RAI A;  3BAA A;  1ROP A;  1FFX A;  1H2K A;  2DN9 A;  3E89 A;  4LWS B;  3QG5 A;  4LF4 O;  2RMK B;  3ETE A;  1HP8 A;  3QF7 A;  1I08 A;  1Y76 A;  1AP6 A;  3RYH A;  4IYH A;  2ZE6 A;  1NU1 H;  4I5S A;  3K5L A;  4B3T O;  2DYR B;  5LP6 C;  2ZXW C;  1M1K W;  3ZJZ A;  1K8A W;  1XDC A;  4DR5 O;  3CRC A;  1H8E G;  1NT2 B;  3OMI B;  1YF2 A;  1WA8 B;  3CSX A;  3LDE A;  5JWP A;  3O65 A;  2EBO A;  2X6A A;  4DV7 B;  1JVM A;  2GUZ B;  2RCV A;  1I7F A;  4I50 B;  4LF6 B;  2QWQ B;  2LW1 A;  2F43 G;  4X62 O;  3T2M A;  3ZRW B;  1L0L H;  4X62 B;  4JI0 B;  1IUR A;  1ZAU A;  1N36 B;  1MG1 A;  4HAM A;  4U7N A;  4AI8 A;  4X65 O;  1HR0 B;  3N2G B;  3OMA B;  4PDM A;  3K3W A;  1LNQ A;  1MA1 A;  4FJC C;  3RYC A;  1F23 A;  3ASN B;  1BT8 A;  1M56 B;  4JAS A;  4JAU A;  4EB6 B;  5DEC A;  5BMV A;  3CEI A;  1W59 A;  2AW9 A;  4X1Y A;  2HVJ C;  4F6E A;  4DR3 B;  1JOY A;  3B2E E;  4DV4 O;  1QHT A;  4ZOL B;  2DYS B;  1GO3 F;  1BE3 H;  4TUY A;  3AG3 B;  2XAJ A;  5EYP B;  3JAL B;  4FFB A;  5CBH A;  2ZDI A;  5J2U A;  2QGN A;  1COW G;  2P6J A;  2EIL C;  5BR8 B;  2YXH A;  4Z1M G;  1GRJ A;  2YIA A;  2E5L B;  3D36 C;  3L74 H;  2UUC B;  3HKC B;  2MK3 A;  4DO2 A;  4D6T H;  4FVM A;  1R3L C;  3JSL A;  2E3C A;  2VWK A;  3DC6 A;  4J9Y B;  3M8A A;  2BCC H;  4LWS A;  4R8C A;  4L87 A;  3DC5 A;  4O2B A;  2JEX A;  1JR9 A;  4JI7 O;  1QLN A;  4H33 A;  2Y4T A;  5B1N A;  2IJH A;  1T5E A;  1JCH A;  1HWY A;  2LP7 A;  1P49 A;  1NKD A;  2Q68 A;  5D5P A;  2ZIO A;  3E2E A;  5KHI A;  3C3T A;  4FMT A;  5KMG B;  4CC6 A;  4X20 A;  1AVM A;  4LR3 A;  1KEC A;  2W0F C;  5JCO C;  2YC0 A;  5LGT A;  3CX5 F;  1I5Y A;  5KHJ A;  4LCU C;  3KKY A;  1NH2 D;  2QJ1 A;  1H38 A;  1OCO B;  2RQ6 A;  3AEI A;  3OAA G;  1GM8 A;  4G28 B;  2N04 A;  3KG2 A;  1FXV A;  2JS5 A;  4WFH A;  3UQ8 A;  3CCV V;  4O2A A;  3ABK B;  1E1R G;  1RSO A;  4H44 B;  4W4K A;  2P5O A;  3E8B A;  5A9G A;  5JCO A;  5BMV B;  1Y6X A;  4X1Y B;  1A32 A;  2OT5 A;  5EBL C;  3UO2 A;  1NVP B;  4KHP B;  2M7W A;  4BWA A;  2Y0I A;  2RNB A;  5ITZ A;  2OTJ V;  1WJZ A;  4ZOL A;  5L3C A;  1VF5 B;  1TUB B;  3ABL B;  2A3Q A;  3ABU A;  2LQT A;  3CE2 A;  3CCJ V;  2Q7H A;  2IU0 A;  4A5U B;  5LL6 Y;  1TA8 A;  3B8N A;  2DW4 A;  3GVM A;  2HR3 A;  5LOV A;  1E79 G;  2UU9 B;  2QWP B;  1AI4 A;  1GKF A;  4B08 A;  1N34 O;  4Z1V A;  1VQ5 V;  3C3S A;  4HNA A;  3JAK A;  3AG2 B;  3SJC C;  1TVK A;  2ZR2 A;  3JAW B;  3SJA C;  5IDJ A;  1EBO A;  5CA0 A;  3D3Q A;  3THO A;  4JI1 B;  2GV9 A;  3GWO A;  3U0Z A;  4LF9 B;  4YY3 O;  1K34 A;  4MTO A;  4O4H A;  3ZRS A;  2ZCE A;  3TXQ A;  4X1K A;  5D5Q A;  3H1H H;  3ZED A;  4X66 B;  4PA3 A;  4OXS A;  2GUZ A;  1FPO A;  4CS3 A;  2IW5 A;  2R72 A;  1WB7 A;  1SET A;  5LMU O;  2H94 A;  5L3B A;  3WFV A;  2EIM C;  2QM7 A;  1GN3 A;  3IJ4 A;  3QVN A;  3ZRW A;  4JI8 O;  1YDX A;  2F95 B;  4OX9 O;  3RYF B;  1N0N A;  3JCZ A;  3HKE A;  1R1B A;  2JIZ G;  2WA3 A;  2ITC C;  4XBF A;  5BY1 A;  1H2S B;  5H6Q A;  4EB6 A;  1H2L A;  1RPR A;  4JAV A;  3I5D A;  2CH7 B;  1M56 C;  1ENV A;  3CRM A;  3LDC A;  1DGS A;  1I0H A;  1FD9 A;  4DV3 O;  3TCU A;  5IY5 C;  1GMG A;  2HJF C;  3AK2 A;  1Z5V A;  5HFM A;  4UCT A;  1PL4 A;  3SPH A;  1RFY A;  2QKA A;  5LHI A;  1SA0 B;  2WLH A;  2ZM6 B;  2VWJ A;  1HDJ A;  1P7B A;  4DV7 O;  2FL4 A;  1PKX A;  2HLD G;  3AG1 B;  5GTH Z;  2ADP A;  1YHQ V;  4C7U A;  2KB1 A;  3UKM A;  4QE9 A;  1EM1 A;  2YXY A;  4B3T B;  4LNU A;  4JI6 O;  3SPG A;  5LP6 B;  2WLK A;  2V7Q G;  4WFF A;  4LF4 B;  2XAS A;  2HP8 A;  2ITD C;  4LF7 O;  3OMN B;  1AP5 A;  4LF7 B;  4P9P A;  1F4M A;  1P84 F;  2Q0O C;  4TUY B;  2IH1 C;  4X1I A;  1AIL A;  4I0X A;  4DV4 B;  5DN6 G;  4DR3 O;  2IU3 A;  1KB9 F;  1L1F A;  4IHJ B;  5C8Y A;  1AJP A;  2GTA A;  2XAF A;  3RYF A;  4MSW C;  2P06 A;  3EXA A;  4KXR A;  1BCC H;  2IBZ H;  2EZP A;  3DGE A;  4EKW A;  4JI4 O;  1FXK C;  4K8Z A;  4E4E A;  2PI5 A;  5IWA B;  1V55 B;  4JI0 O;  1OZ0 A;  4KUM A;  4GT1 A;  4ZHQ A;  4DR7 O;  4LFB O;  1MZF A;  4BIZ A;  4LF6 O;  3G6E V;  4DV3 B;  3Q4H B;  1SC5 B;  2UXN A;  1FJG B;  2WWW A;  3JD4 A;  1GN4 A;  1YVW A;  1M4U A;  4AHC A;  1SKV A;  3UCS C;  2BOB C;  4DYL A;  1KUQ A;  4DW1 A;  2F93 B;  4MTF A;  4QNH B;  4DRX B;  2WLL A;  2F4V O;  3BFR A;  4JPR A;  3K5M A;  1IBK B;  3WB0 A;  3E8F A;  4P30 A;  1R3K C;  1SES A;  4J9Z B;  1EN4 A;  3K04 A;  3DXR B;  4Z2W A;  4JI5 O;  3CHX A;  3LUT B;  3OFN G;  4TWK A;  2F4V B;  4RUF A;  1VQ7 V;  1HNZ B;  3P32 A;  3RWR D;  4TQF A;  1FFT B;  2H3O A;  3HKB A;  4EEQ A;  4FIP C;  1M57 C;  1Y67 A;  5IJ0 B;  4YJ3 A;  3CC4 V;  5FNV A;  3CXC U;  4H0L B;  3RYH B;  4D7S A;  4O4I A;  4JI3 B;  4LF8 B;  3KCX A;  2WPD G;  3ZMT A;  5IYD O;  4XDK A;  1DF4 A;  1XMO O;  3CC7 V;  4J80 A;  1XNR B;  4FFB B;  1PL0 A;  2B1I A;  3QNE A;  3VQW A;  4DK1 A;  1BQZ A;  4O4J B; 
#chains in the Genus database with same CATH homology
 2EIJ B;  3OUS A;  1AR1 B;  1LNQ A;  3CCS V;  2OTL V;  4MT8 A;  4I9W A;  3LDD A;  3ABM C;  4FJC C;  5CBF A;  3K0G A;  3RVZ A;  1F23 A;  3WG7 C;  3ASN B;  1KP3 A;  1DLB A;  5C93 A;  1M56 B;  4JAS A;  3ZMZ A;  4JAU A;  1SZT A;  2Q6A A;  4YXW G;  1V54 B;  2DYR C;  4BIU A;  4WF9 V;  3FYI B;  2HVJ C;  4MVR A;  2ZQM A;  3ZRX A;  3I55 V;  1JOY A;  1P4R A;  5L3G A;  1YIJ V;  4UVB A;  1W0J G;  2DYS B;  1GO3 F;  3AG3 B;  4HZ3 A;  2WLL B;  3EFF K;  3F7V C;  1R3J C;  2JK5 C;  3CCL V;  2XAJ A;  3OR7 C;  2ZR3 A;  4XDJ A;  3ML0 A;  5IYB O;  3G71 V;  3FB5 C;  3OM3 B;  5CBH A;  2ZDI A;  2QA4 V;  3MHH C;  2QE7 G;  2XAG A;  1GM7 A;  4BAY A;  4ZKI A;  3F5W C;  1B6Q A;  1COW G;  2JJ2 G;  3ASO B;  2P6J A;  2EIL C;  3K06 A;  5B1O A;  1YJN V;  1MAB G;  2V1D A;  3B8M A;  4Z1M G;  4R6Z A;  3MD0 A;  1YJ9 V;  2MK3 A;  4DO2 A;  1R6N A;  4X89 A;  2XND G;  3A0R A;  1R3L C;  4DXW A;  1SER A;  1S0V A;  5KA6 A;  1K92 A;  1K4C C;  3W7T A;  3B77 A;  4MVQ A;  4J9Y B;  5EC1 C;  2HG5 C;  3CCQ V;  2DQ0 A;  4R8C A;  5LGN A;  1MOF A;  2Q69 A;  1OCR B;  3MHS C;  4L87 A;  3E8G A;  1JX9 A;  4FPP A;  4MW3 A;  1IXM A;  2JEX A;  4G27 B;  1QLN A;  1V55 C;  4H33 A;  1QR8 A;  3ZRV A;  1Q81 W;  5B1N A;  3BY6 A;  1QBZ A;  4MVS A;  2IJH A;  2QKS A;  3P30 A;  1NJI W;  2A79 B;  1JCH A;  2EIJ C;  3SJQ C;  2IH3 C;  2D3O W;  1HWY A;  2QM8 A;  1DF5 A;  2LP7 A;  1NKD A;  2Q68 A;  3DTU B;  1PNM A;  2EJR A;  3W7U A;  4BW5 A;  3E2E A;  2PI4 A;  3D36 A;  3IC7 A;  4FMT A;  4N23 A;  3SYQ A;  2ZD9 A;  2W6I G;  2AHZ A;  1KEC A;  2B5U A;  3QO7 A;  3QO8 A;  1M90 W;  2H8P C;  2W0F C;  5E1A C;  1NH2 B;  5LGT A;  4UV8 A;  1NR1 A;  4PA6 A;  5GW7 A;  2ZDI C;  4RQF A;  1I5Y A;  2HFE C;  4CZZ A;  4LCU C;  1NH2 D;  4FK5 C;  1H38 A;  1OCO B;  5B1A B;  1R3I C;  3AEI A;  3OAA G;  1GM8 A;  3OEE G;  1QLE B;  4G28 B;  3KG2 A;  4F4L A;  1FXV A;  3SPC A;  3WG7 B;  4WFH A;  4R7C A;  4GX2 A;  3CD6 V;  3CCV V;  1UJW B;  4JTA B;  3IGA C;  3ABK B;  4LP8 A;  3CPW U;  1E1R G;  4WCE V;  3ZMV A;  1K4D C;  4WFA V;  3E8B A;  1VQL V;  3ETG A;  5EBW C;  1K5S A;  1OCC C;  2OCC B;  1AI7 A;  3SYO A;  2Z3Y A;  5EC2 C;  3AG4 C;  5EBL C;  1FXK B;  2OT5 A;  3AG3 C;  1NVP B;  4GX1 A;  2M7W A;  1JJ2 U;  3W7X A;  2Y69 C;  3W7S A;  1I5X A;  3AG1 C;  1Q82 W;  2OTJ V;  3UM7 A;  5L3C A;  3ABL B;  2Z5U A;  3ABU A;  2P67 A;  2JEU A;  1F4N A;  5CN0 A;  3T4D A;  3CCJ V;  5CMU A;  2NLJ C;  2IU0 A;  5B1B C;  1EFR G;  1RM1 B;  1QCE A;  5B1B B;  3B8N A;  4UXN A;  2Q67 A;  2DW4 A;  2X6C A;  4PDV A;  2WLI B;  4JTC B;  2X7R B;  2HR3 A;  2QEX V;  3FB7 C;  5IY5 B;  1E79 G;  1N8R W;  2DWD C;  1S3J A;  1QR9 A;  2GHY A;  1W0K G;  2IJJ A;  3E86 A;  5BZB A;  5L3F A;  1WLE A;  1AI4 A;  1K73 W;  1BHA A;  1KC8 W;  4UVC A;  1GKF A;  1VQ5 V;  2AHY A;  1PNL A;  5KUK A;  3AG2 B;  2NNU A;  3R65 A;  3ABM B;  5L3D A;  2LFR A;  2ZR2 A;  1KKD A;  4ZBM A;  3K79 A;  5IDJ A;  3LSQ A;  3D3I A;  1EBO A;  2EIN C;  3SYA A;  3F7Y C;  3GWO A;  2OCC C;  2XAH A;  3VBB A;  1K9M W;  4PA4 A;  4QPK A;  4RUE A;  1K34 A;  4MTO A;  2DQ3 A;  5IYC O;  2DYS C;  2A0L A;  3ZRS A;  4GCZ A;  3W7W A;  3ASN C;  2WSS G;  2C2A A;  3X2Q B;  2BOC C;  2X6B A;  3K9A A;  3ETD A;  4PA3 A;  5B3S C;  3T4Z A;  4OXS A;  4Q20 A;  4MW8 A;  5FL7 G;  3CC2 V;  2IW5 A;  2UXX A;  3ZMS A;  3AG4 B;  3ZCC A;  5LGU A;  1SET A;  3AG2 C;  3LSS A;  1CP9 A;  2H94 A;  2EIL B;  1M9N A;  5L3B A;  3WFV A;  2EIM C;  4MVU A;  2QM7 A;  1FS0 G;  3ZRW A;  1VQ9 V;  3JD0 A;  4LBE C;  4UUJ C;  2EZO A;  4GX0 A;  1YTF B;  3HB3 B;  3STZ C;  3SPJ A;  3JCZ A;  4TSF G;  4TT3 G;  2R9R B;  1F51 A;  2JIZ G;  1K33 A;  2B1G A;  4JTD B;  2QTO A;  2ITC C;  5EBM C;  4E2L A;  1YIT V;  4XBF A;  1H8H G;  1S5H C;  1QLE C;  1OCR C;  4RO2 A;  5H6Q A;  1OCZ C;  1G4Y B;  5B3S B;  1RPR A;  1KP2 A;  1K7D A;  1E1Q G;  4JAV A;  2JDI G;  1GTO A;  2YEV B;  4KP4 A;  1OCZ B;  1GK9 A;  4WFE A;  2EIK C;  1V54 C;  1BHB A;  4QPJ A;  2WLI A;  2ATK C;  1XL4 A;  1M56 C;  1ENV A;  3CCE V;  3CYO A;  1VQP V;  4PDR A;  4JF3 A;  3H01 A;  4KFM A;  3LDC A;  1VQK V;  3SYP A;  2DWE C;  1YSC A;  2ZXW B;  3TCU A;  2HVK C;  5IY5 C;  1GMG A;  2P90 A;  1Q7Y W;  2Y69 B;  1YTF D;  1AJQ A;  2HJF C;  4H37 A;  1BL8 A;  1R73 A;  1THZ A;  5HFM A;  1KQS U;  2EIM B;  1R6K A;  1EZJ A;  2YSU B;  1VQ8 V;  3SPH A;  3CCU V;  1RPO A;  5B1A C;  1TUE B;  3OEH G;  5LHI A;  2LFS A;  2WLH A;  1P7B A;  4MVZ A;  1W2B U;  5KA5 A;  3ABK C;  1PKX A;  2HLD G;  3CCM V;  2GSM B;  3AG1 B;  1VQN V;  1NR7 A;  1AI5 A;  3JYC A;  1NBM G;  3OE7 G;  1YHQ V;  2KB1 A;  4PEL A;  2HKO A;  1OCO C;  4RQE A;  2WLN A;  2P7T C;  4QE9 A;  3UKM A;  1G8M A;  2IJK A;  4P9O A;  1VQ6 V;  3RW0 A;  5H6R A;  1QVG U;  4MTX A;  1ORQ C;  1JQ0 A;  1CPY A;  2EIN B;  3SPG A;  1AI6 A;  3FKS G;  2WLK A;  4N21 A;  2V7Q G;  1MSW D;  4WFF A;  2XAS A;  2ITD C;  3OMN B;  3QO5 A;  3G4S V;  3NXS A;  3E8H A;  3OR6 C;  2K1E A;  3JD2 A;  4PA7 A;  4P9P A;  5CBG A;  1F4M A;  1K3E A;  3RBZ A;  4PDL A;  5LHG A;  4R50 A;  2IH1 C;  4XDL A;  1AJN A;  2W6J G;  1WPX A;  5DN6 G;  3CME V;  3STL C;  1DTO A;  1PD3 A;  4MTG A;  5EK0 A;  4CBC A;  4MVM A;  2IU3 A;  2X0L A;  5J9P C;  3OW2 U;  5CA3 A;  1S77 D;  1L1F A;  5KUM A;  3K0D A;  3ZN1 A;  4HYO A;  1CEZ A;  1AJP A;  1NVP D;  1VQO V;  4P2Z A;  2XAF A;  1BMF G;  1Y66 A;  1OCC B;  3HPL C;  4MSW C;  1YI2 V;  1J95 A;  2WLJ A;  4MVO A;  1SRY A;  4WFB V;  3ZN0 A;  3IFX A;  2EZP A;  3DGE A;  1NQT A;  4PA9 A;  1GM9 A;  4EKW A;  4QJF B;  1FXK C;  4GX5 A;  2PI5 A;  3JD1 A;  1V55 B;  4JYB A;  4U7O A;  1OZ0 A;  3FB6 C;  3FYE B;  3GB7 C;  4GT1 A;  4KUM A;  2FTK A;  1FXK A;  2WAM A;  4WFG A;  2YEV A;  4BIZ A;  1S76 D;  3G6E V;  1JPX A;  1M57 B;  3JD3 A;  1KD1 W;  2UXN A;  2IJI A;  2WWW A;  3JD4 A;  4X8A A;  5L3E A;  3LNM B;  2R9I A;  3X2Q C;  3CMA V;  5DM6 V;  5LBQ A;  1S72 V;  2XAQ A;  4JGS A;  1PNK A;  4X88 A;  3E83 A;  4QIW F;  4G2K A;  4UVA A;  3K3W A;  1Y4M A;  2BOB C;  2WLM A;  3VOU A;  4MTF A;  4LC1 A;  3SPI A;  1ARO P;  4QNH B;  2XOK G;  3ASO C;  1YJW V;  3ABT A;  2WLL A;  3SYC A;  3BEH A;  4JPR A;  4RAI A;  4ASU G;  1ROP A;  5LHH A;  4QE7 A;  2JJ1 G;  3E89 A;  3E8F A;  4P30 A;  1R3K C;  1SES A;  3ETE A;  4J9Z B;  1Q86 W;  3K04 A;  1QVF U;  3E35 A;  1XL6 A;  3T1C A;  3LUT B;  3OFN G;  4TWK A;  4RUF A;  1VQ7 V;  2A9H A;  3P32 A;  4I5S A;  3RVY A;  2DYR B;  4MS2 A;  2Y48 A;  2ZXW C;  3PJS K;  1OHH G;  1ZWI C;  1M1K W;  1FFT B;  3ZJZ A;  3K08 A;  1K8A W;  4FIP C;  3OUF A;  3CCR V;  1VQM V;  1M57 C;  2EIK B;  3I56 V;  1H8E G;  3OMI B;  3M99 B;  3FB8 C;  3LDE A;  3CC4 V;  3OGC C;  3CXC U;  3TET A;  3K03 A;  1VQ4 V;  3ZIA G;  1K5Q A;  3ABL C;  2EBO A;  2X6A A;  1JVM A;  5HFL A;  2WPD G;  4UV9 A;  3ZMU A;  5H9C A;  2CK3 G;  1RM1 C;  1K97 A;  3ZMT A;  5IYD O;  2F43 G;  4XDK A;  1DF4 A;  3T2M A;  3ZRW B;  3CC7 V;  1FXH A;  4JYC A;  3TK1 A;  1PL0 A;  2B1I A;  3EHB B;  3QNE A;  1MG1 A;  3CP1 A;  4HAM A;  4U7N A;  3OMA B;  4PDM A;  1H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...