2P80D

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80D00
2XV2A 3FU7A 4AKOA 4UF7C 5I6KA 4NAJA 1QHQA 1CURA 5B1JA 1CYXA 1IBZA 2A3TA 3EHBB 1SF5A 1WA1X 2EIJB 3FU7B 4DP2X 1AG0A 3FYIB 1AZNA 3NSCA 2XX1A 1QNIA 5IY5B 2AANA 5E9NA 1L9QA 2QT6A 3NT0A 3TU6A 4BXVA 4KO9A 4X4KA 4GP8B 2BP0A 2I85A 3S3BB 1I53A 1AG6A 3T6ZA 2VW7A 3BVDB 2CAKA 1V10A 3PAVA 5A7EA 3NJGA 2HRHA 4AI7A 1OCZB 4BWWA 2IWFA 4E9TA 1JZGA 5TK4A 6PCYA 2HRGA 5I26A 2NRDA 4FA7B 2IDSA 2IDFA 2CALA 1NINA 4NB7A 4BK5C 2YAMA 5B7MA 1SHWA 2BHFA 4RH4A 3X1NA 2VSKB 3V9EA 2GSMB 3TBBA 1GR7A 2FWLB 1OE1A 3RYMA 4A2FA 2HX9A 1SJMA 4A67A 2VM4A 1X9RA 3OMIB 1KGYE 2YXVA 1JZJA 2BWIA 3QPKA 2Y69B 4M4RB 5B7EA 3FSVA 4YVNA 1F56A 2XUWA 2AZAA 2XVBA 4JKNA 2XYBA 2FQDA 2YAFA 4W9ZA 3FS9A 4HALA 4F7KA 1TEFA 1BYPA 5EHFA 4DP5X 1ASPA 2PLTA 3ABKB 1PZBA 1B3IA 1NIFA 1ZIBA 1ZPUA 2GHZA 4G70B 4DPCX 1ZV2A 5ANHA 1YLBB 1CUOA 2AVFA 3IE9A 4E9QA 4A66A 3IBOA 3NSYA 2VSMB 1L9PA 3IN0A 1JXFA 3WKQA 2XU9A 2EILB 2YAPA 2OJ1A 4HIPA 1RCYA 2QDVA 3NSDA 3HEIB 2IWKA 3AZUA 1PF3A 1JVOA 1JVLA 4KNTA 4Q8BA 2BZCA 1WS8A 2Q9OA 1NWOA 3H56A 4W1TA 3SQRA 1XB3A 1TEGA 2J56A 3JT2A 1AR1B 2FQEA 3SBPA 3BQVA 2JKWA 3FPXA 1N68A 1E30A 1OV8A 1IC0A 1M9WA 3WKPA 3UADA 1ET5A 4HZ1A 3S8FB 4UAHA 4TXVB 3ABLB 5I28A 4YSTA 1NDTA 3UGEA 3FSAA 5PAZA 4E9RA 3OMAB 3S3CB 4E9SA 1BQ5A 1GS7A 1CC3A 3ZIYA 3FT0A 2B3IA 3QJVB 3NP4A 3UAAA 5AFAA 1XB6A 3AY2A 3FSWA 5I6NA 4WTQA 3HB3B 2PPCA 2QPDB 1IUZA 2EIKB 3CDZB 2HX7A 1NICA 1OCCB 1AZRA 5B7FA 2N0MA 2DYRB 2I7OA 1BAWA 2MRYA 2ZONA 2IWEA 4G7SB 5AKRA 2QPEB 3TA4D 1V54B 2JXMA 4QKTA 4YSOA 3CVCA 5I5IA 1ETJA 3CZUB 1NIAA 1ZDSA 4G72B 5LDUA 5B1KA 3SBQA 1J9QA 3QJUB 1A65A 3C75A 2WO2B 3ZBMA 3CDZA 1HAWA 2PP8A 4HCGA 1J5CA 1ILUA 2HX8A 4M3HA 4YSEA 2HLEB 4A2GA 1ADWA 1BXUA 4BXSV 2IDUA 3JTBA 1PAZA 1MZZA 1M57B 2UXGA 3TBCA 3WI9A 1KCBA 3L45A 3PAUA 4HAKA 2XXGA 1J9TA 2RACA 1AS6A 1JERA 1NIBA 1PY0A 2XV0A 2CBPA 2BO0A 3OD3A 4PCYA 1NPJA 2GB2A 1A4AA 1ET8A 2AZUA 3NJLA 4KO7A 1ILSA 5D4JA 5FC9A 4BWUA 2QDWA 3N55A 1BYOA 1E5YA 3X1FA 4KNSA 3AW5A 4GYBA 4P5SA 3AG4B 2YXWA 3QQXA 4GY4A 1W8EA 2XV3A 2HXAA 1KYAA 4HCFA 2J5WA 4DP4X 1GS8A 1E65A 2UX7A 2FJSA 1NWPA 3GDCA 3NYKA 4YSDA 2FQGA 4ZK8A 4DP6X 4A68A 4KOBA 3FU9A 3N2JA 5PCYA 3X1BA 4GP5B 1ID2A 3NJMA 5F7AA 4KO5A 1BQRA 2YARA 3WIAA 3PAZA 3CVBA 1PMYA 4FAAB 1WAEA 4CSZA 1PNDA 3ERXA 2CUAA 2W88A 3OM3B 2OCCB 4HHGA 2FTAA 1AACA 4AKQA 2H3XC 2TSAA 1GY1A 4HHWA 4F2EA 1OF0A 3FPYA 2Q5BA 2PPEA 4DP0X 1JXGA 2WO3B 4A2HA 1AS8A 3T6VA 1QLEB 3IN2A 1ET7A 1XB8A 3T9WA 3CG8A 3DIVA 4E9VA 1SDDB 3FQYA 2XLLA 1L9SA 2R7EB 1MG2C 4K9JA 2PCFA 3H4HA 3U25A 1AZCA 4Q89A 1R1CA 1L9TA 3T71A 3D12B 2EINB 1E67A 2BZ7A 3EH5B 1A4BA 3FYEB 4A2DA 4YSQA 1PNCA 2PP9A 3PPSA 1KDJA 3X1GA 4YSPA 5D4HA 1HAUA 4BDVA 2XX0A 1RZQA 4KO6A 4DP9X 1L9RA 5I6LA 5I5JA 2IAAC 1J5DA 3H4FA 2ZXWB 3KW8A 1VLXA 2R7EA 3V9CA 2BW5A 1J9RA 2IDQA 1AZBA 2W8CA 2XXFA 4DPAX 2B08A 3KW7A 2DV6A 3QJRB 1J9SA 1NZRA 4UANA 2UX6A 4YSUA 3AG3B 1KBWA 1FWXA 4MFHA 4WKXA 2GC7C 3PCYA 3FQ2A 1SDDA 2GBAA 2FQFA 3ASNB 2IDTA 2YAHA 4BDVB 1SF3A 2OV0A 1SNRA 2DY2A 3ABMB 3WNJA 2H5UA 1L9OA 3QJSB 1SFHA 1HFUA 2VW6A 2ZOOA 1OCOB 3UABA 3NJNA 4YSSA 4ENZA 1DYZA 1ASQA 1UATA 1AZUA 2PPDA 1AQ8A 1GYCA 3WNIA 3EF4A 3UACA 3SBRA 2VMJA 1BXAA 4L0PB 1EHKB 4JHVA 3NSFA 4YL4A 2VM3A 4DP7X 4G71B 2PPAA 9PCYA 1DZ0A 1AAJA 4NERA 4AX3A 1ZIAA 2GI0A 2CCWA 3EH4B 4E9XA 1KDIA 5I6OA 1OE3A 1A3ZA 1GW0A 2DYSB 2J55A 5I6PA 3FSZA 4G7RB 1IBYA 1W6LA 4DPBX 1RZPA 2VN3A 2IH9A 1N70A 2TSBA 3GXUB 7PAZA 1NTDA 1NPNA 1IKOP 2MTAA 2XWZA 3NJJA 2I7SA 8PAZA 1TKWA 4BWTA 1NIDA 2FT8A 4YSRA 1GSKA 1GY2A 1WA2X 2FNWA 3CVDA 5B1BB 3FU8A 4KOCA 1FFTB 3X2QB 1JZFA 2GIMA 1NIEA 1MZYA 1OE2A 2JFCA 2Y1AA 2BW4A 3T6WA 3ASOB 5I6MA 4CSPA 4YVUA 2GC4C 2UXVA 2X88A 4F2FA 2DWTA 1WS7A 7PCYA 3NJFA 2UXFA 3AG2B 3UAEA 4P5RA 1A4CA 2AFNA 2BP8B 1PLCA 2YAQA 4E9YA 3FQ1A 1X9UA 1ZDQA 1ASOA 3QJQB 3ABGA 5AZUA 4AKPA 3IEAA 3PLYA 1WA0X 2BP8A 2YAOA 4N8UA 1A8ZA 3OQRA 4QLWA 1JZEA 2CJ3A 1PCSA 1CYWA 2WSDA 1MG3C 5TK2A 3S3DB 2PP7A 1FA4A 1PZAA 5F7BA 1EZLA 4AZUA 4KNUA 1BQKA 3G5WA 3MBWB 1AOZA 2DWSA 1BEXA 1RKRA 2UXTA 3NP3A 2PCYA 2YQBA 4GP4B 2FT6A 1V55B 1XMEB 4HCIA 1GS6X 1PLAA 6PAZA 4EF3A 3PXLA 2P80A 1JOIA 3NJKA 4JHUA 4E9WA 5B1JC 2VW4A 3QJTB 1E5ZA 2IH8A 3T6XA 2EIMB 5I5MA 1AANA 5D4IA 1MDAA 2E86A 1AIZA 1BXVA 3DKHA 1OOWA 2H47C 4N4YB 2HZHA 4PAZA 3ZDWA 2PPFA 1TU2A 1JXDA 1SHXA 1OCRB 4G7QB 3DTUB 3OMNB 1PLBA 4YSCA 1JZHA 1T5KA 2P80D 3TASA 1KCWA 4DP8X 1KBVA 1URIA 2ZWNA 3S8GB 5B3SB 2YAEA 4DP1X 5B1AB 2BP0B 2X87A 3GYRA 3NJHA 1KV7A 2J57A 4GXFA 3WG7B 3NJIA 3X1EA 1JZIA 3MX0B 4YSAA 3ZX1A 2FT7A 2BWDA 3EH3B 1AS7A 1SFDA 1M56B 3AG1B 2LLNA 4A2EA 1PZCA 1W6WA
chains in the Genus database with same CATH superfamily
1NC4D 3H9SA 4UF7C 1IC5H 4GEIA 3S37L 5E9DE 3MLWL 3DHPA 4E68A 1G9MH 4B97A 5HJGA 1YEIL 4JFFA 2R69L 3RU8H 1AG0A 1JDDA 2E9BA 2Z7YA 1Q9LA 4UOJA 3V4VA 2OTWA 4D9QD 2IALA 3FZUC 2BRRL 1GYWA 5DJ0B 4OFDA 5F88B 1CT8B 2H8PA 4YAQB 2O30A 4N2GA 3BVTA 2F7QA 2EKSB 3T3MF 1U8CA 4RMWA 4N5UA 1A7OH 2JK5A 2RFXA 4QHUA 1XAUA 2Y36H 2ZX5A 2YD4A 2V2WA 3T6ZA 5E8DH 4MZRA 4AQZA 3I02B 2Q3XA 3OR7B 4TUJA 2K1MA 2YAMA 1ECYA 4FFZA 5E0QA 1TJGH 3NK4A 1BIIB 5FB8B 3O3EB 2ZCZA 3EXLA 1F4YH 4FLQA 3LN9A 1DBAL 2QJDA 4HJIA 5F3BA 4PP2A 3V6FA 5CHNA 1BM3L 3R4RA 4MYPA 3TN0A 3WGUB 5A2JH 4H25B 1C8PA 5DRWB 4PSRA 2X2UA 1T22A 1P5UC 1QASA 1ZHNB 4E36A 1NMBH 1AVAA 1JWMA 4JLRA 1TFHA 4HFUH 1ZT7B 2VJ8A 3WEXB 1J8SA 1V3KA 3TNNA 3SO3C 3OKDB 3VXUD 5ABDE 4F1ZA 4QTFA 3JYCA 3O6FC 2ARJQ 3B6SB 3L08A 4AM0A 2CJUL 3PWUB 4YQXL 2HMIC 3RX5A 3GSOA 5T3ZE 1WWWX 2X1XR 4DK5A 1PD6A 3SDAA 2PLTA 4B41A 2Y6TE 3KAAA 3UZVB 4PBDA 1A7RH 4MAYD 3Q1SH 4K8RH 2B5IB 4HPYL 3KLKA 1CUOA 5E2UH 2BK8A 4F57H 3HI5L 4AH2A 2QADC 1AGBA 5F1KC 1WBXA 1LDPH 4GSRA 2PETA 1MJUL 1CGUA 2CO3A 4JK0D 3ROOA 1A1OA 3H2QA 4FNSA 3BGAA 1LO5A 4UMSA 2JJTC 2A9NL 3MREA 3LPFA 4FQXC 2H26B 1KGCE 4LLVA 3RVWD 2WQSA 2WQWA 1UWEL 4HMCA 4LCVA 4HKZA 4BZ2H 1NCIA 4W9DC 4MD0B 5D6CA 1SPDA 3CSYB 4HK0A 2F54A 2Z7WA 1H5BB 2BVTA 3CLFL 3PWLA 4AGLA 2ZX7A 3DX1A 4CAGA 5T3XH 1BA9A 1JPGB 4F8PA 1XV8A 2NYKA 3GSQB 1C7SA 2C9AA 3WJLA 1HOCA 2JELL 3VG9B 2FE0A 5DJAB 3ABLB 4KZEL 3BAYA 3MRBA 4S0SD 4Z77A 2J43A 5A3ID 5EO0A 2I27N 2ZG3A 3FJTA 4EI5B 4R7NA 4I7ZC 3LNHA 5ICZB 2HPTA 1FC2D 3VDAA 2R56L 1G9NH 3L81A 3BH9B 2ITDA 3DK0A 4HIIA 2CHDA 2YD5A 1H3UA 2VAAB 1MCRA 4XWGL 3UAAA 2VWEC 3RTLA 1DQLL 4M7ZB 2B9BA 4AENB 4O5LL 2XWEA 2EEFA 1BZ7B 4FZ8H 4UNVA 4HGMA 3VWJA 3GHBL 3QIWD 1VEOA 3FBKA 2I07A 1ZVNA 1MJ7L 1CVRA 1IGYB 1KGWA 4HBCH 3GUTA 1BAWA 4XPGH 3U79A 5A2BA 3QUMA 1MW2A 4MA1C 2J72A 2Z92A 3FC8A 3GLEA 2Y5TA 3V0WL 1PZ3A 3ZE2B 5H2BA 4JRXA 2CWRA 2EEBA 1J9QA 3BYTA 3TBWA 1EUUA 1ZHLB 2R0WH 1RZFH 2ATKA 2GY7B 3VD0A 1QMUA 2COVD 1E3ZA 3MRKB 2VDLB 1J1XL 1IB5A 2VRKA 2RCSH 3M7OA 5AZ2H 2ALAA 3QYCA 5CAYB 3Q6FA 4IGBA 4P2RD 4GKSB 4L4TB 4LLYB 1UA6L 3WJJC 3X11A 4I1PA 2E59A 1L0QA 5EU6A 3DBXB 3IJ9A 1JFQL 3BWZA 3D51A 5JHDD 1G9NL 4YHZL 2G9KA 2Q3ZA 2RACA 4P3DB 3ZYIA 4GRLD 3QUXA 2GB2A 1LK2A 5ALBH 4PHXA 1AR1D 3T0EC 4H8QA 4XP1H 1KEGH 5KVGH 1MY5A 2K3HA 2XIDA 1BD2A 4KNSA 3BQUB 4JE4B 1HOCB 3COOA 4MMXB 5A1AA 5EDSA 4GY4A 5FA3A 2WTRB 4PCSA 5AAMA 4ZG1A 4JW3A 1O0VA 2YSSA 1DQDL 4R6UA 3PAYA 4LHUB 5I6XB 3L8QA 3NBNA 3O11A 2WIIB 1JIBA 2IBZY 2F61A 4ZXBA 1ID2A 1IC1A 5JIHA 3ILEA 4UV7H 5HI3C 3IFNL 2GI7A 3DSNA 2H26A 3CVBA 4Q2ZA 4WVRA 4N1CA 4FFVD 2DM2A 4Z5RB 4P04A 3RDJA 4NSKA 1EAJA 3FDWA 2OCCB 3BQUD 3LTVA 5T3XL 1ZHKA 2YWYA 4S1RH 2Q10A 4AWJC 1UM6H 4NCC2 1JPST 4QXTA 2LW3A 2O1AA 1IFRA 3HG5A 4QHLB 5DQ9A 2BPBA 1ET7A 4LBAA 2VN7A 2XN9D 3QR0A 4R0LA 4Y8DC 3O3EA 4Y1AA 1NCNA 1L9SA 3BT0A 3EO0A 5HJDA 3BIBX 1I85A 3FKUS 1XZ0B 4TPRH 5EUOE 1FYTA 1ZA3A 4AE1A 5CSGA 3DXAB 1DQDH 5F96H 2BSTA 3CZGA 1TYJA 2CRZA 2EDMA 3MOQA 4N87A 3SO3B 4Z3IA 2NXZC 2UZPA 5D2LB 2O26U 2XPYA 5BV7L 4QR7A 2RJMA 4Y4FC 1DVFD 2B59A 4BV1A 3X1GA 4QRUB 2WCSA 2QR0A 4IBLT 2ZOLB 4BDVA 1RZQA 4FMFA 4KO6A 3QXWA 2A4CA 2IAAC 3BGMA 3RL2A 3ILPA 2HLFC 3LDBC 1HHJA 5D93C 4WHTA 3U2SA 5BUPA 3IWUA 1O9VA 3JWNH 4WI5A 4YUEL 2CGRL 1DSFH 2E47A 4PJAA 2UY6A 2EIBA 4BK5A 3CVHB 5IKCB 1SVCP 2X9XA 3I02A 5IZ7A 3IMVA 1K3ZA 1XFPA 1J48A 3O0LA 2YGPA 3PQYA 3V9FA 1X6LA 5FX3A 3RIAF 4X98B 2EYTA 4MX7B 3BH4A 1UZ8B 3FB6B 5KSBB 2RGSA 4CVWA 3D09A 3C5ZA 2VRAA 4P5TC 3TO4A 1CN4A 3D2TA 4P06A 1FVCA 5C09B 5I0ZA 1YMMA 4QHKI 3IXTA 5C08D 4HKJA 3RTQD 3UERA 4A7QA 2HTLD 4MJ2A 2IV9A 4PS7A 1HJBC 1J1PH 2GEQA 3D0LA 3VI4A 3AXLB 2O6FA 1XGRA 1JWUA 1IBHA 2G5RA 1BEYH 1EAOA 3HC0B 4KTYA 5D72H 5JW5A 5ESVA 2XQYG 5CS7A 2ZOWA 3H9SB 1F18A 1NBQA 3EBIA 3NVQA 1DANU 4M8UA 5DD3H 3TX4A 4X9BA 1A3RL 5HJ3A 2FYYA 1JZ4A 4U1HB 4XNQB 3BP4B 3SDYL 4X6CB 2PPDA 1L7IH 2NY4B 5IOPA 4PB0L 4U33A 2AJVL 4P57B 3E8UL 4YL4A 4MJ5B 1DJGA 1JHKH 3ARDD 3QDHA 3PJSA 4JM2C 4XCNA 4E9XA 2HH0H 5E56A 3MGOA 5D7IA 4ZTPH 5I6OA 1HVXA 1Z9SB 4PVMA 5I15H 3CDGA 4EBQH 5IFJB 4XOBA 4JRXD 4OCSH 4UINL 2DQCL 4YLBA 5I8OL 4G7RB 1GJIA 4U1GC 5DURB 4V1DB 5HVHC 1GCYA 2ZCKL 4G1EB 4FHKA 4HKXB 5BMFL 3Q9PA 4R4BB 2EVJA 1T1ZA 4U4BA 1A4KA 3ZZLA 1KB9J 2XN0A 3FQWA 3QA3A 3Q8EA 4LKCB 4BINA 3APMA 5DT1L 3THMH 1VZIA 4FQXA 2X4RB 1K5NB 5EUOB 4PJDA 4FTDA 2WQVA 2W95A 1PX8A 5G5DA 4YHNB 4MD4B 1Q9KA 5FYJD 3S2CA 4YHLL 5ALCH 3MRRA 1SUHA 4KRPD 4F7PB 3AXHA 3NCCB 4PVLA 1AZZC 1I75A 2XWCA 2Y23A 4N0CD 3O2WL 2ZUYA 4PUBH 1HHIB 3UJJL 1C08B 4JG1H 4KKRA 4YEEA 1DJXA 2NW3B 5MI0B 5JPNB 4X4XA 2X89D 3K5SA 4LU5L 1LEIA 2AXFB 4TM9A 4FP8H 4LASL 2XKNA 3EJZC 4ENED 2LFEA 2A6IA 6CGTA 3ZKND 3E9TA 3UMTA 2WSDA 4FG0A 1OGTB 4NPYA 1I9RH 4LPYA 4P2QB 2ESVE 3SKMB 1UA7A 1UQSB 4HUXB 1FA4A 2ARJA 1DLHA 4JFHD 2HG0A 3B9VA 1JD7A 2FZ3A 4P59H 1EJOL 4X5XB 3VXSD 4E2OA 1GS6X 1PLAA 2ADIB 4PJ9D 3DUSB 4EF3A 2P80A 5L9DL 4YBLC 3FK3A 4B27A 3CLEH 1UJ3C 4KNQA 4OLXH 3DGCR 3T6XA 2MCPL 5CGMA 2XN1A 1D6EA 3MJ6A 2X1OA 3HUJE 1Z32X 1WDAA 5IIEB 2O93L 4F24A 2NUTA 1ZWIB 2OMBA 1DQQA 3TFBA 3NESA 5TH2A 4GSUA 3VNZA 4LGSB 1S7VB 2ADFH 3K8MA 3N0AA 3CFUA 3QJFA 4PI0A 4Z78A 3FONA 3ZMNA 1F90H 1SOKA 5I19L 4ODSH 3FB6A 1DDTA 1Y6NR 4HUXA 4KUZL 3CDCA 1NGPL 4V33A 4I3GA 1KZYA 4LEXH 3A22A 3DTUB 3Q8CA 4FMVA 1P9MC 1KELH 1GZQA 1T4KA 2LLLA 3NACL 3ZXAC 4FLHA 4EBQL 1J5IA 4MQ7A 5B1AB 2DQCH 3Q44A 4B9GA 1JXJA 1KBBA 5EUKB 3BKJH 4ENEC 4KPHH 1UFUA 3IFLL 4XE5B 3BEVB 3CLWA 1AP2B 1L4IA 3UJTL 2R69A 1E6JH 4YBHA 1SLUA 2ZOLA 2X4RA 4S11A 3V4UL 4OCXH 4YHYB 3FU7A 3S9DB 3BAWA 5DT1H 2WQXA 4CN1A 4WI2A 1VADB 5BCAA 1IL1B 3P11H 1G7QA 1S9WA 4CN4A 3F7KA 2L7JA 4QTHA 4QRRA 4CL7A 4N25A 1GOFA 2EIJB 2V2XB 2F8VA 2K78A 5TF1H 1ZY9A 4NRZA 5J1TC 2AJXL 2GUOA 1RIUH 3RB7A 4PM1A 2I9TA 2EEDA 3H7BB 3MNZB 5G5DB 1P53A 2WBJB 3ULVE 3A47A 5DHYA 2Y24A 3VI3F 5IMMB 2RALA 3VXME 4FKKA 3VI4E 1OF2B 3N41B 4UDUA 1G1YA 1IM9B 4PIBA 3W81A 1T21B 5DMKA 1DE4A 4NLHA 4ZO7A 3ARTA 5K9OA 3EYUL 5KG9B 5GGRB 4MXVE 3BMVA 2AEIT 4XC1L 5KJRL 3CFKA 4OCRH 5HYJD 2AERT 5C3TA 2WVVA 1HSAA 1S7XB 2KZBA 3MNVB 2IH1A 1WBYA 6FABH 3ZTCC 3GMOB 3VFOB 1UCBH 5D8JH 3MRIB 1AQKL 3ARDC 4G82A 3DV6B 2PYED 1T89C 1JNNH 3S88H 4FQPA 4BFJA 3ZTJH 5TE7H 1S9YA 4A7SA 5KSBA 3GT6A 4TRPL 4R96B 1RUKL 1E4HA 1NSNL 4JFXB 4LBEB 5BXFB 3MUY1 4IBZA 1IC7H 4UQAA 5GGSY 3FOLA 1UWGH 2EEXA 3VE0B 4D7BA 3TEYA 4XVOA 4YJZL 2IFFL 4L4VA 4NYLA 4G70B 4M7LT 4L2YA 4UOW0 2ZUTA 4BZ1L 1RVFL 5I23A 2Z8WC 3EYFB 1A8JH 3MOBL 3NIFE 1YNKH 4HSCX 5JR1L 1ZLVK 1RI8A 2ZPKH 5AB0A 2NY4C 4D7PA 3K81A 3FTGB 1LEGA 3D6GA 1GZQB 1T4KB 4U3HA 5TQ2H 2JTDA 1HHKA 3BPOB 4YHPA 1TJHH 3FB7A 2P5WA 1S7SA 1MRFH 3BKML 4OLZH 3AZUA 1TQTA 4Y4FB 1J86A 3FFCB 3N44B 4LFHG 4JAMB 4B7LA 3B4NA 1IGML 4MASA 3SQBA 1AQKH 4ZPTB 5E8OA 3KLSA 3LKOA 3GIVB 1J5OL 2J56A 5FM8A 5TH2B 3ES6A 3B9KA 2EIEA 1BFTA 3PNRB 1FVEB 3BT2H 3NAAL 4RNRA 4YDKH 1RD6A 1HILB 2ZKXA 2I9LB 5JHDA 1PGRB 1U8PA 4UAHA 1GJUA 3MROB 4GPVA 4J3SA 1KTKE 2R29A 4ACPA 3HS0A 3STZB 2ROXA 2I24N 1Y1UA 2AP2A 2UZIL 1ZT1B 1ETA1 2E7LC 1SXBA 3OG6B 5C92A 3GTTA 1YEFH 1DR9A 1MH5A 3MZGB 3D06A 1A21A 3KYNA 5ENWA 5EMYA 2DBLH 3TV3H 3FT0A 3X3GL 4ERSL 5FO8A 5F21B 3WY4A 3WUWG 5F6HI 4KAQH 5EBGA 1BF2A 1P7HL 3ARGB 2BSRB 1L0XA 2DMHA 3AITA 4HC1A 4OCNC 4WSKA 5GRXG 1Y07A 1KULA 3ME0B 4G8AC 4ZFGH 1HQ4B 3ECBA 2BH0A 4K94H 5A2AA 1BJ1H 2I7OA 3RGVA 5FK9B 1F3JA 4G7SB 2QGDA 1OHQA 5F7LB 3TA4D 4N8VG 2XNAA 4JRYD 4Y16B 4JFSA 4OT1L 2YOAA 4PQXA 5FYKU 2NW3A 1NIAA 5CCKL 3CH1B 5E2WL 4ZUVB 3U7YL 3MXWL 4P46D 3CPLB 1UOVA 1N10A 4PS4L 1BW8A 3WN6A 2JF1A 4YR6B 2WKLA 4A63A 1RK1B 3WNOA 1QPXA 3MRPB 5DK2A 1S7QB 4OV5B 3KYOA 4M3HA 3QHZL 4XPFH 4OM1H 1OIOA 2Q8BL 4J39A 1FJ1B 4EN3A 4UQDA 5DEFA 4W9JC 4YDIH 5IV2A 2HUHA 1F3JB 1TPXC 3UZQB 5JIIA 1T1YA 2XV0A 2C3VA 3QRFM 1KMGA 1R6VA 1RFDL 4L5FH 4QD2E 5CZXC 1AOHA 5D2NB 2FJFA 1NPJA 3QNXB 5KAQF 4RSVA 5IVOA 2B1OA 3ZL4H 4N90E 4J8RA 1V7NH 2FJUB 4UIKH 2UWEA 3H8NA 3BYYA 4P5SA 3B9KC 3HLAB 4O2EA 1TCMA 3ARWA 4ZX5A 2OXGA 4HU8A 2YA2A 5MEPB 3CX5K 4GRLC 3NZSA 4UNUA 4CSSA 1GS8A 2UX7A 4F57L 3T2PA 2P8LA 3WV0A 3U6RA 4OZFH 4JAMA 5M95B 3B1UA 3DETC 4A68A 2QELA 3IDIB 4LZKA 5D7LE 1SVBA 5DJCB 1QFOA 3TNMB 3WE6A 4PVBA 3WFZA 35C8H 3MRDB 1HL8A 4RSYA 4PRID 3IMWA 1MXGA 4NQED 4X9YA 1PNDA 4U1HA 3QUMB 2AI0H 2MOVA 1E3FA 3C08L 1JYNA 2FTAA 1DSWA 2YQ2A 1SHMA 4AKQA 2ENQA 3MRCB 3ARSA 2P24A 1IMHC 3D50A 4RVBA 2CHWA 1ORSA 2OMTB 5IW1B 3Q05A 4JZNB 1B6UA 3T6VA 4A6YB 4F8TA 1W15A 1N5YL 3HAEA 2P5WB 4WCYL 3QYNA 3K72B 3QE5A 2YJQA 2IWGA 1HHKB 3IJSA 4UT7H 1VERA 5D1ZC 4DKEH 4DVBA 5BPPA 1OVZA 4OKDA 3KXFD 3AMLA 4OJEH 1UEMA 4XXWC 4PJBF 3LN4A 4GSDL 3ARDA 3FU6A 2F54B 5H4YA 4G6FD 3EYQD 5F7EH 1UZ8A 2FIKB 3D12B 3W3BA 4N28A 3RWJB 3EH5B 1A4BA 1ZKAA 1PFCA 4Q97A 4YSQA 4NPKA 1U9KA 3OGCB 4X0NA 3IS1X 1ZXQA 4FS0A 3S0PA 5DHVA 5F9OL 3S4SA 5MENA 3NCFB 4RFEA 5JLZB 5E2UL 3MRCA 1DJHA 3U9WA 3PWPE 4NAMA 1QA9A 5AKVA 4ODHH 1PLGL 4UT6A 4HIHA 5EBWB 5T1JA 3CHSA 1OKEA 2XWJB 3G6JF 4DOHB 2B1HH 4D8PB 1U36A 1QACA 4LPXA 1D5IH 1L6ZA 1K72A 5EC1A 5D1QB 5D2LA 3H3BC 2JQMA 4EVNA 3ULUF 2VLKE 4AITA 4POUB 4XMZA 1XHHA 1Z5HA 4JO8A 4OGXH 2MNWA 1CXLA 4K5NA 1ZT7A 1CLZH 4FQXD 3T8XA 1YO4A 3D85A 8FABB 2WWOA 1Z6JT 3TT1L 5IQMA 4HUUB 4P4KB 2BY0A 1KIPB 1MVYA 2IDTA 3BEWB 2HKFH 2QADD 3BP6A 4AC4A 3FO0H 4U49A 2OV0A 4LAJH 4UIKL 5E5UB 3OX8B 3ULSB 3ZW3A 1QR4A 2AQPA 1HFUA 1TZOA 2VLJE 5C6TH 3U6RB 1UWXK 2XTLA 2ZOOA 2R56H 4OJCA 5DS8A 3T0VA 1MCKA 3V4PH 5DEFB 3QJHB 3VA6A 4U1KB 4EI6B 2VMJA 3K7UA 4KBPA 4ABVA 3VB8A 2YKKA 2B16A 5IBUG 2EDTA 3WEBA 3QQ4B 2JK5B 2RFXB 5D6DC 5HHPB 1KTDA 1OANA 4XVUD 5LAXA 1GYAA 4KX7A 2R51A 5C2BH 4HETA 1ZIAA 4P99A 5HDLA 2VQ1A 4ZYKB 3ATFA 3IVKB 1CLOH 2G0KA 3QXDA 4ZW6A 1GW0A 1B4LA 3S97C 1ZWIA 3BH8B 1E4XI 1GH7A 3L6FA 3QARA 3TH3T 1NBYB 3TOPA 4AQ1A 4A7GF 2AJSH 4KMLB 3KD4A 2JKXA 4PJBB 5F6HJ 1FSKC 3ECBB 4PJ9A 2Q1EA 3TBYA 3FT1A 1G9ML 4QF1B 3OKOA 1UM6L 2DMGA 3AQXA 1JGDA 5FWRA 2BVPA 3G6AA 4AG4H 2H1PH 3L9RA 5C6TL 1XWVA 2Y2WA 1T3FB 3BZ4B 4B3VA 2DWYA 2CLZB 3F5WA 5CP3H 1JFHA 4Q9RH 3E3QC 4WNQA 5F97E 1BQLL 2D3LA 3X2QB 2Q2LA 5FHAH 3UPAA 2EO9A 3TWYA 2XVKA 3IDNA 3PXJA 2ITEA 3KGRA 1INQA 4UAOC 1E50A 5BV7H 4ZUUA 1NM4A 3UG3A 4N2FA 4IOIB 3A6CL 2PO6C 3GBML 3PWPB 3VG9C 3JWNG 2HKAA 5C2BL 1XF4A 2KPNA 5CD5C 3TT3L 2IBGA 3OTTA 3M46A 4DN3H 1KTCA 1D7CA 4OZGB 4I87A 3IMBA 4IM8A 1FZKB 4X4XB 5AZUA 2R2HA 5CILL 2XYCA 3QWQB 1EXGA 1KJVA 3WS3A 3MRHA 1UASA 2R1WB 4RFNB 2V17H 2CDEA 4WJG3 3T2NH 4S0TD 3U1SH 1LE9A 1D5RA 4HKBB 4YXHL 3VXNB 5SWZA 3EHBC 5E0FA 1ACZA 2F15A 4NKMB 5DD0H 4HA1A 1PZAA 4CVXA 2ENYA 4DEWA 2GUYA 3O3BA 5I18L 5T1MB 1FNGA 2UXTA 3ARFD 2WLZA 1PY9A 2YQBA 5C6WH 3TPKA 4K7PH 1D7FA 5A2CA 4LHUD 2QFPA 4X6DE 4NRYA 4KY1H 4GKZA 4ZPTA 5E8OB 3V0VA 4NC1E 4XXWA 5TDNA 1A6TB 3NJKA 4EQ3A 4X7TA 4AUUA 4YDJA 2O4EA 1IIIA 3SPGA 2IH8A 2H9GB 2X7LA 1MDAA 3S6CA 2E86A 4GUPB 4AEHL 2KBGA 3S35X 2C9VA 4Z18A 1JL8A 4G5AA 2AV7A 3NFPA 4QEGA 1AQDA 1XH1A 3L9EA 3V5HB 3EYFA 3DYPA 4QRPD 4NQEE 1CFNB 3VD2A 5D7IE 4NO2B 4U1JB 3T4AA 3CUPB 1AJ7H 2OFQA 3QS3A 4Q74A 1CE1L 5DRNA 3G5ZA 5LB1A 3HG1E 4KZDH 1KJ2L 2P52A 3FOLB 4KI5D 1CFMA 1OCRB 5IVXF 1CLYL 1HIMH 1NL0H 3S3SA 4Z7NF 1CD1A 5A16A 1KWGA 2ZX6A 3EGDA 4KROC 5E8PA 2VGLM 5SWSA 5JQ6L 4NNXB 2EC8A 4IKJA 4PRNA 3HRZB 4OAWA 5EN2B 2HFTA 4KKCD 1QSFE 2EXYD 3ZTNH 3CV5A 4LLAA 5KSAD 1LK3L 3PHAA 5E8EB 5TDOB 4R26L 3QUMH 3GHEL 2AABL 3L7EB 4AEIL 4I4WB 3MV8A 3UEQA 1T0NA 2PW2A 4LOEA 4U31A 4M43L 1N9PA 4Z6AT 2C1OB 4EQ2A 1XT5A 1SF5A 3OBAA 3QEHA 3EFDL 2O72A 2VZVA 3GKZA 3IRZA 3OKDA 4G8GA 4ABWA 4D0BB 4JB9H 3NIGE 4XNXH 2WW8A 2G60H 4M00A 4Z7QF 2JB5L 1F86A 5EA0H 2XBTA 4HPYH 2I9TB 4IJTA 1UT1A 1K4CA 4YOKA 1T3FA 2EADA 5D7SL 3DX0A 4GP8B 4L37A 4PG2A 1I53A 3RDTD 3QUYB 4RESB 2CAKA 1V10A 3E1F1 1C16B 2WOBA 4QF1A 3WNNA 1SEQH 1VADA 5EZPA 2IC2A 5KYNA 1COBA 1HJCA 2I9LA 3RZWA 5JHDB 3N44F 4GW5A 2E7CA 4HDIA 5JYMA 4Y1TA 5E23A 5FOBA 1WLHA 2WGNB 4AOFA 3P3TA 4WHTB 5D1XC 2IDSA 3MYJA 3VQMA 1UZ6E 3DYOA 4N90D 2YGQA 3BGMB 1YJDH 1NCCL 3OSKA 3IJ8A 2V2TB 5C86A 4GSQA 2LV4A 3V9EA 1JWSB 2IV8A 3TZVA 1UM4L 4A2FA 1TR7A 2HWZH 2GJJA 3QEQD 2VM4A 1AY1H 5GRZA 1X9RA 5SX4I 1ESOA 1MHCB 1QI3A 4QO1B 1CT8A 4MA8L 4U1KA 5I15L 2XFGB 2WLNA 4QXGL 4XOCA 3RZCD 2OP4H 2G60L 1S3KL 2AEWA 4KKLD 3WHE1 1TQCC 2HVJA 3J07A 1EO5A 1T1WA 3MRGB 4DFHA 1FIGL 3D30A 1B9ZA 3GMNA 5KVDL 3KGUA 4WGWB 3FCSA 1IBBA 1USQA 1TQSA 4O02A 4DPRA 4F7KA 2OMXB 2B2XH 1ZTMA 3FXIC 3N1MC 5C09E 4YXKH 3ABKB 4UB0H 1KBKA 2F1AA 2R1WA 1NEZB 4ZUWB 2F53A 3II2A 2YXMA 4NQDE 4HG4J 4XCEB 2GSGA 3MV9D 3R8QA 4A66A 4HJ0C 1IGJA 4KHXL 4KI5C 1RULH 1IM3B 5HHOB 3R7QA 1JHTA 1OAUH 2B4CH 3B83A 1YHPA 3LAFA 4UMGA 3IU4H 5CLXA 1D9KA 2VC2B 4ZW7A 1J0YA 5A2IH 5TQ0H 4OF8A 2JKSA 2A1WH 1T0PB 5CU9A 5BS0D 3L4WA 5E1IA 4F8LA 3PDGA 5AVWB 5KUKA 2CKBB 4H7VA 4AJYV 5DJYA 1A6ZB 4Z95L 4G8GB 1UQSA 3V8OA 5DZAA 3DX6A 5K9KA 4AYID 1Z9MA 2Z31A 5I28A 1EUTA 3P2TA 3VXOB 1UD4A 4RRPM 5L2KA 5EA0L 3PIQA 2NNXA 1A22B 5DGQA 1YPZE 1RURH 1YUKB 3B2PA 5EU6B 3HS9A 3W9EB 1HINL 1YEEH 1MXDA 3H3PH 1F1GA 3QUXD 2XFXB 4WEMB 3U82B 3WBDA 4NQVB 2A9AA 1TVDA 5KSAC 1C5BL 5ERWA 3F7QA 3F3HA 4Y1SA 3T1FA 5I6NA 3AS0A 5F9WC 4A6YA 2PPCA 2X28A 4MJIE 5JORB 3CDZB 4U1MB 2NXYB 3EDEA 3V5KB 4D0CA 2O6EA 4YEFA 3VACA 2H3NA 2E4FA 4N2AA 1KJ3H 2KUTA 1DSFL 1K6QH 1A7NH 3QC5X 3SPVB 5HSFA 2VZSA 4BSWB 4EN3C 3SKOB 4O2FA 3MAWA 1DCLA 3VWJC 4ZD3H 4P48A 5IEHB 1NGQH 3HG1B 2ZCLL 2WBJD 4GKSA 1CE6A 4L4TA 3WAKA 3LNIA 1UUSA 3ULUH 5DJ8A 1E6OH 5CZVL 2A38A 3APNA 1MCQA 5CFAA 3D9AL 1NAMH 4IJ3C 3BFWA 4XNZB 4K2UL 4RDQF 3VXSA 1JZ2A 1VAHA 2PKDA 4Y4HB 3Q06A 3O8XB 5D8JL 4FI6A 4LMQE 5AAPA 5HGHB 5KS9A 1TZHA 1PAZA 1KPRA 1NEUA 1UYWH 2Z92B 2HSIA 1NC2A 2BNRE 1QEWB 3T8XB 3DHMA 4JVUA 1WHOA 2F7PA 3DOSA 3OAZH 4FQCH 4OW6A 1OP5H 5IFAL 1PY0A 3MTRA 1SZNA 3MCYA 4GMSH 4DQOL 3O3DA 5AVUB 2BC4A 2EDOA 4J3UA 1F4XL 3L5IA 5CR1A 3ARFC 1GOHA 4Y4KC 1ZLVH 2X0UA 3FN0L 1IQDB 5CLYA 3O81A 1BZOA 2D7OA 2P48B 2R0ZL 3EHBD 3KLQA 4X5XA 2X40A 4Y7MA 4GKNA 5IWLA 1E65A 1NWPA 1M05A 3TVMD 4P23A 4HIJA 3W9DA 2NUPB 2VMDA 4K71B 4YGVB 1P9MA 1XO8A 3EOAA 2QSQA 3DJZA 4LCWE 4OF6A 4X99B 4L8BA 1MCPL 3PWJB 3HUJB 2W65B 2EDNA 4OFIA 1IEAB 1EMTH 3KWTA 1E4KA 3CHXA 3QXDB 3HOGA 3TJHD 4AW7A 2VSCA 1Q90A 1UJTA 2CR3A 2WD0A 5JA8B 2KLRA 3LEVH 2Q5BA 3CH8A 3GRGA 3REWA 5HYIA 1ES0A 4QI3A 3KNBA 2OZ4L 2VM9A 3HAEB 1G0YR 2YPKB 4PSPA 5F7HA 3MN8A 3SY0B 5JDJA 1FNEB 4HWBA 2XLLA 5G2NA 2ADGB 4BFEA 3MJ9A 5DMGD 2ENPA 5GJSL 3RWCA 2C9UA 1SM3H 1MHEB 2O6CA 3VXTB 1H3GA 2EJ1A 3PGDB 2BNQB 4D9LH 3HZVA 3GSXB 3QZLA 3FRUA 1F90L 4UM8A 1MUJA 4E5XA 4QRUA 4XXCA 3E6FA 4AMKL 2BVOB 3SCMD 3ULUC 1W91A 3PPSA 4IMLA 2E0PA 5EEVA 4YSPA 3ZRSA 4I1NB 5I24A 3QUYA 2CU9A 1AO7D 2XX0A 3BEWA 5I6LA 2HRLA 3NIFB 3QFJB 1QSEA 1PG7L 3QEGH 4OJFL 2XIIA 4JFZL 3LN5A 3I3BA 4Q6KA 4RFEB 1RJYA 2OK0L 2L7UA 4PJEA 4NGHL 4RAHA 1J8RA 3BUTA 1OGAD 1XH0A 3UCQA 5L6YL 3DURB 1BOYA 4WUKL 4LRNL 1N3NB 4KUCD 4F58L 1XGQA 4EVNB 1NAMB 2OJZH 1FAIL 4QRPA 2EDQA 3MBXL 1TU2B 1S9XB 5EIVA 3RAJH 5D1ZD 5I1CH 2GT9B 6TAAA 4PVNA 2DTML 3NTCH 3X3FL 2GK0A 4UZGA 3RG1C 1F3DJ 3KE0A 1SOQA 2OTWB 3EBHA 4GT0A 1Q1PA 2ZUUA 4BA0A 5K9JL 2XZQL 5DUBB 4YHLH 3SOBH 1N6QH 1KTBA 2YLHA 3TCXA 1MW3A 5T5FL 2VN6A 5ESQB 3ECQA 2OX5A 3MC0A 2OYKA 4ODXB 1BF5A 1H19A 3VI4B 4E41D 5J12B 3SBWC 1GGIL 5JQHC 3ZL4L 4EXKA 1S46A 4JANB 1E40A 1TENA 3FUDA 3MBEA 3REVA 2N7AA 3N43F 4JQVC 1B2WH 3ARDB 3FMGH 3LRMA 2J6EH 1W8NA 4JG5A 1AZUA 2GT9A 3SBRA 4G2AA 2AXJA 4FJZA 4L3EE 3HUJA 3D3VB 4PJIA 5FR3A 1F13A 1XGTA 3MRQA 1IT9L 2DS4A 3H0TA 3GEWB 4AX3A 4L3ED 2GI0A 3V0JA 4QDGA 3C08H 3Q7JA 4FJ6A 4G6AD 3LXAA 4KPHL 4X6DF 4XMLH 2DWDB 3K91A 2FRGP 5ANMA 4O2EB 2E7HA 2CD0A 3HAEG 2RAMA 4XMVA 4OLWL 4QLRA 4I3RH 4WIQA 4HJGB 4WUUE 2IH9A 1R0AL 2X6AA 1B0WA 3B56A 5CO1A 3GXDA 4ZOBA 4HK3N 3BPOC 4S1SH 2C7UA 2VC2H 3IJYA 2MIZA 1NGXA 5FV2A 3HZVB 5IV2B 3Q1EA 1YEIH 2R23A 3CXDL 1FYTB 4UT7L 2GUOB 2WXLA 4DESA 2ZXBA 4PB9L 5DC9B 3KPNB 1U3HA 3AS1A 3CC1A 2WXIA 3O6LL 5ID1B 1C8QA 3C6SB 2ZG1A 2P28B 3O8XA 1U8HA 4TSAL 2R59A 1X4YA 1KLGA 5B3JE 3V52H 1LE5A 4NQVA 3AC0A 4OM0L 3GSQA 4XO9A 5DFVC 1LHZA 3CFJB 1A6AA 1PLGH 3AUWB 4GLRI 4GKLA 4NQSB 4I0CC 3FB8A 5F93C 5JA9A 1P6AB 1A02N 1JGEA 5E6YA 3L3IB 3RUGF 2A9ML 4IU2A 5DVOA 3GHPA 3CHPA 1T04A 1IBGL 1CVSC 3GJFA 4XMUA 5I1EL 4EUPG 4XZ4A 5FDYA 5CGTA 5EEXA 1A7QL 1EZLA 4XPBH 1UKQA 3S3JA 5C07E 1BEXA 3L5HA 4LF3A 3NP3A 3A23A 4OKVA 1CDGA 4BCXA 2XZQH 4HJJH 1AGCB 1H3VA 4YDVA 1KCVL 3EFFA 1NMCB 1UH2A 1D7BA 3LHPL 3ZZ1A 5CMAB 1D6EB 5C0AD 3SDAB 2OAAA 1DBML 3OAZK 5TE6L 4U6VL 2I32A 2VN5A 3EJQA 1NUGA 1U8MA 1TTBA 2CJUH 5EU5B 1T04B 1UH4A 1DVSA 3PP4L 3S98A 1GXEA 3V4PL 1XCTA 1WBXB 2ICWB 4ANXA 1KIRA 3LNEA 2ADIA 2HVBA 3PV7A 4MA7L 4HMDA 1OOWA 3F7VA 4FQIL 5HGHA 1J0KA 4I48B 4NCDA 1CGSL 3D4ZA 5TGBA 2CSPA 2DQDH 1TJHL 2EE3A 5T3XD 1T21A 3MXWH 4JO3H 4RZKA 5JW4N 2EDBA 2OMXA 1PLBA 3MQIA 2EECA 3RP1A 5IHUL 3APCA 2B15A 2OI9C 3MV7E 2JNZA 3PV6A 3S8GB 1RK0B 1OGSA 1MFUA 4H2AA 1AHWA 3G9AB 2J12B 1KV7A 3PHQA 1JZIA 3F6IA 3L4XA 2CE6A 4AY0A 1LJMA 2YLKA 3V5KA 1DO5A 3H2WA 3WFCH 4HISA 1WT5A 3GGWB 3OZ9H 2O5XL 1PSKH 2GITA 3QWRA 4HXBH 4WWPA 2W0KA 3BGFC 3EO9H 1PZ2A 3N0PB 4YLQT 3RI5K 4GBXA 3UP1A 5BS0E 1IC7L 4XNMA 1G7QB 1CK0H 1OWWA 4FABL 2CK2A 2G9HA 3SIKA 2YZ1A 5J4MA 1TIUA 2H1PL 3ENEA 5CN1A 4TUOA 2DN7A 3BIKB 4BK8A 2JCCB 5JPMB 2E6JA 5D1XA 4OD2A 1D9KD 1ZSHA 2VR7A 4CC4A 3IAGC 2XPZA 2ADGA 2K0RA 5ABAA 4KDTA 1PIGA 3WTXA 4GRWE 4BFRA 1FO0H 4LVNB 4Q9BA 5JW4Q 4G8EB 3UTQB 3QUZA 4FFWC 4GO6B 4LHJB 4E9TA 2EE6A 1RUMH 1VZGA 4Y4KB 3IPFA 3HMWL 5AAWC 4X4YB 5A40E 5I26A 2P47B 1NINA 2BNQE 1AO7E 3T1WA 1SUJA 4JX0A 5D6CB 4L4VD 3JZYA 4PGEA 2VDKL 4JFUA 3VFPA 5K1NA 5I8KH 2LR4A 5CILH 4ZSOA 4DEUA 1WQVT 4YZFF 4FL4C 2VLJA 4DKFH 3VGGA 3KPSA 4NI3A 1KGYE 3S5LG 3RGBA 4P23B 1AGDB 3DO7B 1JHTB 4Z7VA 3BLBA 3Q8AA 4XN5A 3AQDA 2VMFA 2VDRH 4EZMA 4DVRH 4M4RB 1S9YB 3DUSA 4ZMOA 2HJFA 5IB1B 1FG9C 3DX3A 5INCA 2D3JA 2FO4B 5SX5H 2XVBA 3TYFB 4ZO8A 4QRRB 3VM5A 5G4NA 3CXHK 5K39A 4MAYA 5KVGL 4HALA 5C0DA 4Y9EA 2ZUWA 5D2LE 2PWGA 5D1QC 4JS7A 1JYWA 3HG1A 1XR8A 2Z9TA 4XP1L 1ZPUA 5T1LB 4NQCB 2QLVB 2UUDH 1QFWL 5E70A 2WQRA 3NEEA 4DGYH 1Q8MA 2A6DA 5CD3B 2J3SA 3U36A 4TSBH 4ZRGA 2XU9A 3IKCB 1L0YA 1YMME 4PJHE 1R5VA 2VLRA 5EOTA 2XG4B 3CSFA 3IPEA 1TT6A 4E42A 3BD4A 5F3BB 4YDJB 2AITA 2YWZA 2D7TH 1DUZB 5D6DA 4PJAB 2QKIC 1JN6B 2JJTA 3SQRA 2MQ3A 2APXA 2WWKT 4B0MB 2PXYA 2NY1D 1UGKA 2BNRB 3B7RL 1J11A 1XCQA 1XR9B 2IOOA 3CBRA 1HCYA 1FGVL 4LSUH 3WJJA 5JIQA 2EDHA 2F54D 2FJGB 2H2SC 4PJDB 2M1KA 4U1IB 3UC0L 3GMQA 4N0FB 4R26H 1Y6KR 4Z0BL 3HUJF 1ES0B 3DMMB 2AQ1A 5HHQA 1NDTA 4M7LH 5CJOH 4PJFB 5F1IA 2WSKA 4NLAA 1X9LA 4NP9A 2BLFA 3WKMH 5LKNA 4JB9L 1YYLH 1CXIA 4NN6C 2ED9A 3B3IB 3LZPA 2CKBA 1UXLA 3ZKNC 3ZIYA 4YNYB 4YDLC 2B3IA 3PV6B 4K3GA 3MGOB 2BIHA 5CSZB 4L29A 2C1OA 1SDYA 4HS3B 1E3XA 2Y4SA 2NT1A 3MV8B 1YEJH 4K07A 4RAVB 4O5LH 3BCDA 3IU3B 4IIQA 3V79C 5ETUB 4NUPA 3AABA 2TAAA 3N42B 4MQSB 1GGUA 5J9PB 4B60A 1JPSL 3K5RA 2ADFL 2ZONA 3FONB 4ZZFA 2WXQA 3H9YA 4MJ4A 4FQJL 1NCWH 4QKTA 4G9FD 1I9JH 1G9HA 3CVCA 5CGBA 4OZGA 3TP4A 4RIRA 4BSJA 1I1FA 5LDUA 4KZDL 3AQYA 3DGDA 3BD5A 5EEZA 4M29A 3C75A 3LPGA 1E2ZA 4IRSC 3ZBMA 2DMBA 4UAOB 2FB4H 1RZFL 1N5AA 3FH8A 3PWPA 1G6RA 4WFGD 5E2TL 5HYSA 3CXFA 1BQSA 1B4JL 2HX8A 1I1AB 4X8JB 1S6NA 2Z4QB 3MCKA 4UYQA 5EIIB 5B38A 3BPNC 4ZMVA 1W80A 1KEMH 3GJFK 4HKJB 3TV8A 2BS71 3VXQB 3DVIA 4IRSD 1HNFA 3C09C 4YHNA 2VKWA 3L45A 3PAUA 2XOTA 4PRIA 3ZTEA 4Z3FA 3ULVF 4AXWA 1UGNA 3WDIA 1KY6A 2C34A 3R0NA 3BDBA 1YEKL 2C3GA 1ET8A 3BN9D 3TA3D 1PX3A 1ADQA 4UB0L 1FFQA 2P45B 3U4BH 1OLZA 2BY2A 1DVTA 2XKNB 3UYRH 4UT9L 1KIQB 3G5XB 3KPQB 4WUUB 4N9OB 4QKXB 4FNTA 5IQ7L 3MRGA 1RIHL 3JYBA 4H0LC 3GEFA 1BD2D 4WFED 4IOSA 5DD5H 1QSED 5C0NC 3EJZD 2YN3A 1AD9A 4MQXD 4PWHA 3RL2B 3WMQA 1XEDA 4BFBD 4HMEA 1JHKL 3HBQA 2W59A 4U7MA 1HX0A 4AV0A 3VVVA 3ZR6A 3ML9A 3C6SA 9CGTA 5CLTA 2NY0B 3WXWH 5GZOA 4JR9H 2V2TA 4JN1H 4JUSA 1FZKA 2BHYA 2W88A 1SJEA 2NZ1A 4AV4A 4EDXB 4ZTPL 4DUXA 5ID0B 5AW0B 1XSIA 2YK1H 4KRPC 4JZJB 4R5VA 5CD3A 4OJDH 4B7IA 3PFUA 5JW5B 4OQTH 5A43C 2PO6B 3TF4A 1BXXA 5GISH 2EEAA 3F62A 3RB5A 1CFVH 1SY6A 2NY5H 1RMFL 2OZ4A 1BBDH 2JVUA 3SYAA 5BMFH 1OSPL 3RWFA 1NQBA 1R5VB 1W9XA 4Q9RL 4GXUM 3HJ0A 2NPLX 4FFWD 1JNNL 3KMDA 1K4CB 5DJYB 1G7IA 4QT5A 1AZCA 5ANMB 3MJ8A 2JJWA 1R1CA 3DA0A 3LHAA 4HXAH 4TN9A 2J88L 1RZJL 2EVGA 3PJSB 4XCNB 5J1AA 3DSNB 2EDYA 1CL7I 4PHZA 3HNTL 3T09A 2BM3A 2FX8H 4X80L 4LSSH 4R9HA 5BV7B 3DVGA 2YPVL 2X6VA 5JIDA 4JM2D 3DI3B 1R3JB 3ZOAA 1UB5B 1H5BC 3GFUA 5D1QD 4LCUA 4HJSA 4KQ3H 3C2AH 3C5ZB 2R7EA 1MFEH 4FGMA 4KTEH 4G6JL 2BCKA 1U6AH 1CD1B 5A16B 2W8CA 1MY7A 3BSGA 4GH7B 4AL8H 2A1WL 1J9SA 2AV1A 4PJ5A 4H5SB 1YZZA 3QCVH 3UTSB 3QCTL 4JFWA 1NJ9A 3AG3B 3ESPA 3LKNA 4IRJB 3RIAK 3MOAL 4LQ1A 4P3DA 5DWPA 4HV8A 3WAJA 2EH8H 3L1OH 5E2VL 3FQ2A 1HEZA 3C60B 3VRIA 5C9JB 5IFAH 2FO8A 4L9LB 3JTTA 3MKGA 1X7SA 4BDVB 4KKZA 4ZAKD 3IJSB 4AE0A 1NFDE 1Q0EA 2OULB 5FYKL 1SBSH 3A3YB 3UTPD 3P0GB 1C7TA 2X2JA 2BNUB 4PLJC 3TBWB 1Y6MR 1WGOA 3P9MB 5BQDA 4H8UA 5EFIB 3UABA 4DN3L 4RFOH 3VD4A 1UD8A 4JY6A 4HUMB 3FQUA 1NM9A 3MV9E 2GIYA 5AW4B 3WXVH 2XT1B 1PKOA 2DQEH 2EP6A 4A7UA 1HS6A 4R5TA 5GZNC 1G7PB 2UWEF 4ZUSB 4DP7X 4A6YL 3BAXA 3PGFH 1KCKA 4NERA 1WIOA 5CMAA 1NBVL 5CEZL 1RZKL 4D8PA 3DRTA 3K2KA 4KI5F 1OP9A 2IGTA 1AR1C 1I3GH 4NQDA 3FF7A 4PJCF 1T2JA 4RQQA 5FA3B 1FI8C 4IHBA 1HT6A 1F58L 2EABA 1RUAL 2FZ3B 4HULB 1JYXA 2Y7NA 4PJXB 2MMXA 4LP4A 1IFHH 4NM4H 2IOIA 2E6QA 2EIZA 4L4TE 2FX7L 5EULV 4DUWA 3NJJA 3SKNA 3HTLX 4OD3L 3TTSA 3UO1L 1FF5A 4ETYA 3GF8A 5ADPL 5BZDA 1DQTA 3EJJX 5IMLA 1HZHL 3QG7L 5IVXB 5KYWA 2E46A 3L95A 5IHWA 4HD9A 1CS6A 1ED3A 2HFFA 3FAWA 1BVOA 5CJXA 4NUGH 2WTRA 2GIMA 1ORQB 3KPTA 4XB8A 2R1YA 3QXUA 4LF3B 3T6WA 3X17A 4ZYKA 1JI2A 3SDCA 1LXMA 2L8AA 5GS3A 4FQ1H 2MCPH 2FHCA 2X89A 1SXSA 2ILLA 5DJZB 4JJ5A 5KVEL 4W81A 3OJDA 4W4NA 1YNLH 4DGWC 2VXUL 5JHAA 1WS7A 5AVYB 5TQ0L 1QSZA 3AG2B 2RH0A 5HI3D 2JKIS 4XN4A 2BP8B 1BJMA 4G6KH 1YPZA 3VXPB 2WKOA 2PWHA 4LU5H 5IM7A 2XZCL 3BX7C 4YHIB 1LK3H 3E0GA 4N8UA 1VEPA 1EEQA 4MXWL 2ZX8A 3FQNA 5AUMB 1U8HB 1T1ZB 4UZSA 5TK2A 3S3DB 4BKTC 2ADYA 5JNYB 4AM0B 1U3NA 1ZHBA 2VLRB 3GJFB 4XXDB 4PJCB 5EOTB 4B3EA 4J3XA 1I1CA 2QMJA 4M7JL 4BQ8A 2KHAA 4D8OA 4P2AA 1K2DB 2ALWA 2X4OB 1N6VA 5HDOA 2VZ1A 1NCBL 4PJ6A 1OPGH 4XAKD 3MMEB 1E2WA 1T0MB 4LCIH 4OVUA 4W4OC 3I9GL 4MMZB 5IJKA 4M5YH 1OXYA 1UG9A 1LO2H 1WGVA 2P42B 3G6DH 4FE9A 1THAA 3V6OC 2EIMB 2WYZA 5I0VA 4CDHA 4EJ1C 4AENA 2QLYA 4K3DL 3U83A 3DX8B 3PWLB 3DKHA 4IJ3B 5J3HC 1MCLA 5IB1A 3WL9B 1B6DA 5FFOA 3SGEH 2ZSVA 5KOMC 1B4TA 1KXVC 3P0YL 4FLSA 4XP6L 3GUTB 3P9WB 4W9LC 4O4YL 5JLZA 2I25N 2J8OA 1IKNA 4YZFE 4FCHA 1X5FA 2RBLA 3N6YA 1R75A 4V1DD 5DHVB 1M6OB 5KW9H 2D7PA 2WBXA 3B8SA 5ESQA 3MRQB 4YSCA 4R5XA 3MLRH 4V1DE 1EZUA 5DZOA 2R1YB 4KXAA 3ARFB 1PYWB 3QXAB 3NACH 3JWDH 5E4EC 4ISVA 4F9LA 5DJ0A 1JAEA 4JANA 1H8LA 1UVQB 3DDFA 3O6FD 3AG1B 2WYTA 3GMLB 3VWKA 1TLKA 1HSBA 1NAKL 3MCLL 3UJTH 4M5YL 2FK9A 1J1PL 4YHOL 1CYXA 1N7MH 1HESA 3CHOA 4A7VA 1UJ3A 3VFMA 3BUQA 5AEAA 2XWTB 1XL6A 2XX1A 4NN7B 1G9NC 4NQDB 2GJ6D 4M6NL 1SYSB 4AH2B 4KHXH 2CPCA 4DOHE 5KYWB 5EZJA 4KO9A 1QRNE 3V0DA 3TO4C 4DCQB 4JM0A 1UKSA 5JYLA 2R29H 4XNZC 1PEWA 4LCYB 1NFDB 4HCRH 4CVZA 1LP9E 2JI2A 2CLRA 2F08A 2IFGA 1HL4A 2IWFA 5DMGC 1IAMA 3VSVA 2EH7L 3OKKB 4PH8A 4I0PB 1MHEA 3V4LA 2CO4A 4Y9FA 4BK5C 3T77A 4GO9A 1OO2A 3U7YH 3RVUC 2DKMA 5FHBH 3QIUD 5BW7C 3CMGA 5JDSB 2FWLB 3BAKA 3GLZA 2ED8A 3TH2T 2CCLA 5C0BD 2OZ4H 1KJ2B 1N3NA 4XPFL 2YUWA 5CUSL 4NQDD 3ZIMA 2FBOJ 4QRFA 3EJYD 3VDCA 3IGLA 2YGOA 4YVNA 4M3JA 5F3FA 1B88A 4J3OD 2G2NA 4QCIB 1N0XL 1PS3A 2AZAA 5HPMA 5ISZD 2JKTM 3IDJA 2BY3A 4R4FL 1JDCA 4KZEH 4QJ5B 3LZFH 1TEFA 3VX1A 4AMKH 4PRHE 4DP5X 1CXHA 4R84A 1ZIBA 3QIBD 2H6OA 2WANA 3VXMD 2M26A 4FA8A 3EFOA 2Y1ZA 4XNYL 4FQIH 5J13B 1P4IL 2V7HB 4X5QA 1XCXA 4FOMA 2EUWA 4GQQA 5K9QI 3FQXB 1GZPA 4QRSA 4AEFA 2VSMB 3R4DA 1QA9B 2P5WD 1AC6A 3BW9A 5FK9A 4FG6C 3WKQA 1JGUH 3TN0D 4K5OA 4HDIB 2WXHA 3INUL 4JFFB 3GTNA 2DMKA 1I7TA 4KK5C 4A2LA 4AVIA 2A77L 1JVOA 1WAAF 5C0CE 15C8L 2WVVB 3P9LB 4FYSA 1TMQA 3CU1A 1NWOA 2OTUA 5F88A 3QEUA 3U46A 4IKIA 4P9MH 1FN4B 2A73B 3H9SD 1DUYB 3BP5A 5SWQA 1HK6A 4L8DA 3AT8A 1N68A 1UEYA 4HXBL 1TTRA 1QQDA 4UQ3B 3JWOL 3NFNB 3MLWH 3MLSL 3WUWB 4W6XB 5T3ZL 5H35A 4XP4L 1BQHA 4NDMA 4PREA 3I84A 1YNTB 1RZ8A 1OGAA 2C9SA 1RZGB 2AEPH 2WBJA 4L4TD 3HN5A 1SM3L 3U7AA 4F3FB 2Y72A 1KXVA 5ID0A 4CA4A 1QEWA 2R0ZH 1GS7A 4TL5A 2K6YA 1U2YA 2WXJA 4HUCA 4Q56A 4PFEA 1ZHBB 3SDDB 2JWYA 3F2LA 5EPMA 1WFJA 4NZJA 1F2XK 3UTZA 1A0QL 3SE3C 3MA9L 1IUZA 5FO2A 2GQHA 4P2OC 5J5EA 1G4MA 1OAJA 15C8H 3UC2A 5GRYA 2NNCA 3W9EA 1CFNA 2VNCA 1MQKL 3CE1A 3SKOA 1J1OH 1A6PA 3CFEA 1MPAH 1G5GA 1TQUA 3SE8L 1FZJA 3H42H 5EC2B 4LLMA 2YOCA 5I5IA 3HMXL 4OD1H 5EFIA 5LO7A 5BVJB 1VJSA 1DSYA 3E8VA 3ZUCA 2VDKH 4F5CE 5MERA 3VVWA 1ZGLP 3CDZA 5C3IA 2R4RH 3SDCB 5IVZB 5DJ8B 2FJFB 1AXIB 1FL5B 1XBDA 2WINB 4ZS6D 1QWNA 5EBMA 3L3HA 1LM8V 3QNFA 5TF1L 4BXSV 1F42A 2DJSA 4WSJA 4XCFH 2X09A 2Y9RT 3QIBB 4N85A 2AEQL 5FO9B 3SPVA 1M57B 5FYLL 4NJAH 5HHXL 2JXMB 2WBJC 1RSYA 2HT2D 3C5SA 4LOFA 4Y5YC 4S0HA 5IVNA 1O7SA 3U9PL 2X4PA 2O5XH 3VFTA 4MMZC 4IMKA 5DS1A 3CNKA 5T8IA 1WHPA 4Y9BA 3GSVB 4K4KA 2AJYH 5GGTA 5L2KB 1HN1A 1MLCB 1JG9A 2WXPA 3RY6A 4TTGA 4OIIL 3L9YA 4YMPA 4DK3A 2W81C 3AW5A 4OIAA 3HI5H 5LBVA 1D5MB 3IMRA 1A3LL 2J6EL 3MR9B 5F9JB 4ZFOL 1Q94A 2Q7YA 4X6DA 3VH8A 3VTMA 1MAML 1MJ8H 4FRWA 1NGWA 2AJZB 4N24A 1Q1JL 4F3FA 3WNPA 4YPGB 4DN4L 1D9KB 1E28B 4ES8A 3GSOB 2OCFD 4Y5XB 3HG2A 3QISA 4N5EC 1SEBA 1CDIA 5F7YC 3PAZA 3VRJB 4WWKB 3LNDA 1G9EA 4FAAB 1CLVA 3QULB 2XG5A 4UM9D 4CSZA 1IBFA 3OM3B 4DFIA 5IR1B 5GXBB 4FZEH 5E6IC 1KLFB 3SDXA 2AQQA 4TL4A 5TE7L 1KB5B 4FNLH 5I9QC 5EG6C 3TN0B 1C12B 3G6AB 2ZYRA 2LU3A 2Q87A 4G59C 1QD0A 2O6DA 2Z0UA 5L88H 1IC4H 5F1SA 1BJ8A 5D1XD 3RE0A 2M8XA 5LGYA 4F37K 2H1XA 3FQYA 2DEWX 2BIIA 1U2HA 2BNQA 1XCQB 3WSQH 2GJPA 2AAVA 3MJWA 1MFAH 4TUOB 3OLIA 3B43A 2Y7MA 3PPEA 2BZ7A 4DO4A 1ICTA 4GG8A 4GAGL 2PP9A 2B2XL 3AWEA 3IYLW 4DKDC 3JV4B 4Y7OC 1JP5A 3GMQB 3RWGB 3P3SA 2R0KL 1R9FA 1MREL 2W9EL 2I5YL 1XH2A 3NA4A 1XSJA 4LCWD 4PJCE 4FXKA 2WMPB 4ONFL 3WLBB 1QRNB 1QBAA 3ZL1A 1M9SA 4KKBC 4KQ4H 5AQ0A 4MQ7B 3US1A 1HCZA 2FAUA 2WCPA 1QOKA 3ARBD 3FO2B 3HHSA 1BM7A 4ODBD 1AE6L 2IXQA 3RFRA 1LNUB 1U8NA 2ZOTA 4BFNA 3P3YA 2BOCA 4D3CL 4KKLC 3WO4C 3NRPA 1DBAH 4I4WA 4XRCB 4L1LA 2D7TL 1NZRA 4M93C 1BGXL 3RZCC 4DWHA 4BGDA 1QR1A 5FOJA 2IANE 2ZP9A 5GRUL 3RFZB 4LNRB 4KROD 4WO4A 3DUHA 1EJ8A 2CUHA 5INCB 4Z78B 3M6DA 2MCG1 3DXAD 4I0PA 4R8WL 4CMMA 1SDDA 5DRXA 3QEHB 2FQFA 4RZCB 5LAPA 4DK6A 4HZLB 1OB0A 3MJ7A 3E38A 1A9EA 1SNRA 4LVEA 4ZSOE 1KBPA 3GSVA 5EC1B 5LGJB 1DP0A 2E56A 2YEZB 3N41F 2Q7YB 1C12A 4MNGE 3A4FA 4H88L 3U4BL 1I1RA 2DM4A 2HJFB 1U3HD 3HW7A 1U8LB 1CO1A 5CBAB 1D5MA 3ZDXE 1GYCA 3G9VA 1CGXA 1ECZA 5IG7B 2ENSA 1CR9H 1IO4C 1QYGH 1ZA6A 1JTTA 3UJJH 1SOSA 2J6WA 3DPDA 4H0IA 4IQHA 5TDNB 5IWLC 2PYEB 4OGYH 4A37A 4CBZA 4F33A 1N64L 1MRCH 1EA9C 1A3ZA 4B9PA 1QBMH 3MR9A 1R5WA 2X41A 5F9JA 3UH8A 1D3CA 2JELH 4ALAH 1R33A 3QPXH 1H9VA 4IGBB 1JS4A 4LGRB 3RGVD 3UTTD 5L88L 5D96C 5GHWH 1E6OL 2XTJE 2MTAA 2Y0SA 5DD0L 3RUGB 4JRYA 1OM3L 3NJXA 4Q4EA 4F8NA 4Y88A 4HWUA 4KZCA 1YEHL 2MPAH 4N8CH 3RIKA 4XE0A 4PRIB 3R8BB 2XFXA 4J23A 5B39A 1MFAL 2FSDA 4PRDA 1HHGB 4KY1L 1A5FH 3QCUL 3JWOC 4RRPG 3GM8A 2OCJA 5HTSA 1NPUA 2WN3A 3PP3K 4PJHA 3R1GH 1A3QA 5KVGE 2CRMA 3E6HA 1HL5A 1DQJB 1FDLL 1SEQL 4HLZG 4KXZI 4Z3JA 4FI8A 2VSDA 4TLKA 3S34H 3LQMA 2CDEB 1R4XA 1A4KB 2NNAB 4HBQA 4AEHH 3P0VL 5CEZE 1DN2A 2DWTA 4G7VH 3VCLB 3VW3H 2I60H 4GQRA 4MS8D 1PLCA 1XZWA 1GSMA 3D25B 3MRMA 1G5AA 1MFBH 1GGBL 2GTWB 2AQTA 3T0XA 2V8LA 5ESVB 4FG6D 1DL7L 4ZS7H 5HYSB 5I6XC 1HYSC 2ROYA 3A4EA 3U1SL 5F7BA 3I9PA 4PRHB 4KNUA 4JRLA 1T1XA 3X12A 4X6DB 3VH8B 4NZFA 4RZCA 4LDEB 1AGCA 3IMSA 3BP4A 2H7WA 1YPZB 2WHVA 2OTUB 1E6JL 3SO5A 4WO4B 3IDMA 4DO5A 5GISL 5E6IB 3VI3E 3OL2A 4UT9A 3BZ4A 3FCTB 5SX5K 3HE7D 4N2EA 2EYTB 4MX7A 1E5CA 1PQZB 1OGTA 4I88A 4J3OC 2AK1L 1W72L 4HOWA 3KH3A 5DVNA 4IU2B 4ZUUB 4K5LA 3ZDXB 4JQIL 3GI8L 4IDJH 4YNYA 5DHXB 3DBXA 2PO6D 5BUAA 3ZSTA 1UFGA 3C5JA 4DGIH 3QZOA 2PUQT 2BNQD 3QK0A 5IHHA 2EE0A 2W91A 1TU2A 1JXDA 3GKWH 3RVUD 1JF6A 1FO0B 1A9BB 4LL4A 4Z3TA 3W2DL 3PHOB 5IW6A 3ZT7A 1YYML 2TRYA 4GAJH 4A6YH 1JZHA 3CZNA 3TASA 2WLJA 4CGTA 4G80A 4KVCL 4PJBA 5F0JB 2EE9A 2BNRA 4YN3A 1X5KA 1E9QA 2BWDA 5D93B 5I1GH 2V7HA 4FQ2L 3O0RL 1PZCA 1W6WA 3TN0C 5EF1A 1QRND 2VL5B 4RAUB 3WHXB 2C7UB 3VYNA 2NSMA 3UTSE 4U3SA 4M7KL 3BP6B 2P7TA 3VXRB 2KZ1B 3CN0A 1B0RA 4JHWL 5LHDA 2AK4E 3UTSD 1BIIA 4OQ1A 5FB8A 1YEGH 3OWEA 1BWWA 3NIFF 4ZW8A 2VO8A 5F72S 3ATEA 3ES6B 1DBBL 2CKBL 1ZHKB 3CSBA 1FHNA 4JREC 4N3TA 5DCCA 5J6SA 5T1LA 5LQBH 2HT4D 1ZE3H 5D7HA 4ONGH 3TONA 12E8H 1LVEA 4NWUH 2OR9H 5D1QA 1I1AD 4LLWB 2RD0A 1L0PA 1ZVSA 3L2MA 5FA4A 3U48A 2HRGA 2NY2B 1RHHB 4FA7B 3FN3A 2CALA 3DX9A 3P4MB 2QQNH 3LIZA 4JM2F 4X0KB 1KN2H 4OLVL 4ZPVA 3O6KL 2ZCLH 1F4WL 4PRNB 3QIUC 3ZKMC 1NUFA 1AGDA 3DO7A 3JTSA 4ELKA 2AV1B 4PJ5B 4NQQA 3BAJA 2R83A 4N3UA 5EZLB 5FGSA 1R47A 4W70A 5AW9B 1ZGLB 1QABA 2CLRB 5IMKB 1ORSB 2OMTA 3OGCA 4YHML 4WJ5A 5GGTH 5AZEH 1UYWL 4J3VA 2YUVA 5E6IA 3T0WA 5C0EB 3CFMA 2MQGA 4GG6B 4AQ8A 4GRMB 3EJCA 5FO9A 2X38A 5KYUA 5J57B 1RHHA 4TQIA 1I8MB 3GO1H 5MEOA 4MKMA 5I16B 5AG8A 1YUHB 5IVZA 5B3JF 3SYCA 3GMOA 3UO1H 1AFVH 1ASPA 4OLUH 4LSSL 3BZEA 2GHZA 1E8YA 3NGBC 1JK8B 1K8DB 2AVGA 2IPUG 3POCA 4CC0A 4GKOA 1FE8L 2Y3NA 2DBLL 4RGNB 4TUKH 2QKIA 3B2VH 3ULVL 5A6MA 4PB0H 2KQMA 1LLAA 3MHZA 5KVFL 4RFNC 3CFJA 4Y4HA 2YAPA 3EYQC 4ELMB 1HNGA 2OJ1A 1LE5B 2Q3AA 4Q9CA 3MU3A 1KFAL 3W39B 4CVUA 4ZFGL 5IEHA 2X4TA 3B9EA 4H26A 4PJEB 2X0VA 5ELIA 3GK8L 5H2BB 3O2DH 3TIEB 3W5MA 5TFSH 4NBXB 1X7QA 2AKRA 1SN2A 2X70B 3UGUA 3ZHKA 4LGPB 2VLKA 4Z8FH 1P7BA 1DDHB 1IC0A 4GOSA 1NGXB 2WKGA 2I07B 3SY0A 2WZ5A 4PRPD 1O5DT 3CFCL 4NDMB 1NAKH 3MCLH 4PREB 4N2BA 1A9BA 4W9KC 4ODWB 3UGEA 4M93B 3I2CH 1CFSB 3LYRA 3QS2A 3GBLA 4NN5C 2ZP0T 5TGBB 1ACXA 3S3CB 3L3KB 5DRZA 3STLB 1OAZH 5G55A 5E4AA 1KGUA 3QEQB 3OLGA 4NUQA 1RIVL 5BRZB 3J2PA 3SZ6A 3CVHH 3WTTA 3DJTA 2VZ3A 1MWAH 1XCTB 3NP4A 12E8L 1EZVX 1RPQA 3AY2A 4IBSA 4NWUL 3VU2A 5LNDA 3DO3A 5GJTH 3O3UN 4FI7A 5EU5A 1QHOA 3HB3B 1ID5I 1P7KB 4P2QE 3SKNB 3LEYL 1X9QA 4FQLL 3GTVA 3HHMA 1XGYH 3L3IA 1AZRA 1AKJD 1KXHA 3C60C 1YSOA 1MCJA 1ZOXA 4NHUA 2XN9B 3BPCB 4J4PA 4IHOB 5CZXD 2ZF8A 4QTIL 4JO5A 4F58H 5CLWA 1BD2B 3LZQA 4NFBA 3S3PA 2AHIA 1I9IL 3QAQA 5FDWA 2Z4TA 2WV3A 4WUUD 5DZJA 4J12A 2VJ0A 4OD3H 1SBBA 3EJSA 3ROOB 1JV2B 2NW2B 3TJPA 5I66B 5IREA 2CA4A 4Q6IC 4JPIA 2LABA 3TURA 1F45A 4JFFD 1DVFB 2HJKB 2X44D 4FNRA 5DK0A 3ZE2F 2XXGA 4YO0A 4P4RB 4H26B 2N0KA 1A6AB 3N04A 5GZOD 3T3ME 1JPEA 5KYYA 2EYSB 3FB7B 4RA0C 4XRCA 1BAFH 4Y2OA 2QDWA 2VXQA 3AM8A 2K6WA 5JHLL 4KK9C 4RMVA 3ARBA 2EUZA 1XF2A 4KXBA 1FVEA 4BSWA 1JZDC 3ULAB 3FN0H 1NH6A 5C0JA 4P0DA 2ZPKL 2X4OA 3FULA 2QVTA 3O2DA 2CUMA 5ENWB 8FABA 4BGLA 4DP4X 2BFGA 2WNKA 5ES4B 1MFEL 2WY3B 3VXSB 3VYOA 4KOBA 3EIFA 2W1NA 3N2JA 4BE6A 3F6JA 5GGRY 1EHNA 1BQRA 4TSCL 5GSVB 3WIAA 3HMWH 4BQ9A 2W92A 2OKMA 3QPQD 2YXFA 1TQCB 2HFEB 4FMKA 4N2MA 4ZX3A 5CBEB 1BHGA 2F5AH 4AT6B 2TSAA 3FB5B 2P8PB 1KXQA 3WLWD 4HGWB 4BZ2A 3JWOH 3BHBA 3WTSA 4KTDL 1NCDH 4UQEA 2X12A 1O6SA 4Q4IA 1XDTT 3MLSH 4JKKA 3VFRB 3CG8A 3F85A 5BW7A 4E9VA 3W38A 3MV01 3GIZL 3MLYH 5LBSA 4A2MA 3SB3A 2BSBA 3TZVD 4K9JA 4AGPA 5J7CC 2OR7A 2PCFA 4LAQH 4QHNA 2CO7A 4LSQL 3KYKH 4PP1C 2ZAIA 4L2LA 1ETB1 5E1GA 4F33B 3MBEB 1Q9LB 3T71A 4I89A 5DZLA 3LKPB 1DBKL 3MRIA 3DURA 3V5DB 4JRXE 3S96A 1T0NB 1CJYA 5F89B 3UX9B 1MDTA 1A1OB 1MQKH 3PG2A 4RDQG 4JFPA 1J5DA 4R7XA 3WN5B 3T08A 4X6CA 4RCAA 2PWFA 5ABZA 2CLVB 3BZFB 3QGVA 3TJEH 5EN2A 5D7KD 5CCHE 1OHZA 4HIQA 4PGCA 4FTVE 5H4ZA 2YJLA 3KW7A 1PIFA 3MODH 5C0ND 1FFPB 1KTLB 1MHHA 5K1VA 3JT0A 3TEUA 4C56A 5J1AB 2P8LB 1UD6A 3RJQB 3PGCB 4WTZG 4ZO6A 1T2QH 3BPLC 1QRNA 3W11C 4G80B 4LNRA 4PW3A 2WSPA 2P5WE 3EBAA 1NSNH 3GBEA 4NZDA 2ZT9C 1KGCD 3O2WH 4XWOC 1IKNC 3VMNA 4X7EC 2J8HA 1AP2A 4XXCC 4P8QA 3WHXA 4E5XB 2D0GA 4HGWA 1A6WL 3AREB 3P0YH 1GVIA 4XP6H 3DIDA 3F64A 1RVFH 1UATA 3OR7A 4EN3B 2H3NB 2F1BA 1RU9L 2DH3A 2QQQA 1VHPA 1EAPA 4I2XA 5C0GA 4FD0A 1LGVA 3NSFA 2V7NA 2OMYA 1Q1JH 2PPAA 4WHYG 1TYRA 1N19A 3CZEA 4NO0B 3BE1L 1AAJA 4WI3A 5SWZB 4ANVA 1U42A 4POYA 1FO0A 2ARWA 2CCWA 2OL3A 1GYVA 4K2UH 1TFPA 3VXRD 1INEH 1WSST 3GBNH 4DERA 2YD9A 3B9AA 4P2RA 4MNQB 4NFCA 4HJUA 3C5JB 5I6PA 3FSZA 1N6UA 4OFQA 5J13C 1YMHB 1IQDA 2Z4QA 3MCKB 1P7QB 4IRZA 4QWWD 2QADB 2BXYA 4ZOEA 3GXUB 1IJNA 1IC4L 3ARPA 3QZNA 4MQXC 3BWUF 3ME0A 1PX4A 4QWWC 4XC3L 1A7QH 2ZQKA 4PRIE 1FL3B 2YHGA 1VGEH 2I7SA 4KH2A 3S36X 8PAZA 3WUWA 3M7FB 2GTWA 2DM7A 2FT8A 1BDYA 4IU3A 1ACCA 4K3DH 3BWUC 4WHCA 5KN5B 3HPJB 4G42B 2XN9E 3ZGIA 1J0HA 3CVDA 5DSCA 3MLTB 4AXWB 3FU8A 5D7IF 4N0CC 1TNNA 4S1QL 4OZ4A 1KIRB 3MJ9L 2XZAH 1RU9H 1JV2A 2NW2A 1TTCA 4HUWA 1CE6B 2NQ3A 1YEDB 4FG2A 3NN8A 3TC9A 5KW9L 2GBVA 2HFGL 2YMXH 4GB9A 1M2OA 3L7EA 3T0EB 5DZ9A 5E4IA 4NRXA 3BUYB 5D5MA 2DLGA 2NCMA 2C9PA 5J0BA 3PQYE 4OT1H 3ZZSA 1RJZA 2XXCB 1J8HD 1KWKA 3ABGA 3CN4A 4QXWA 2APSA 1MJUH 5EU3A 3VXMA 4JE0A 1WWCA 4QIRA 1WA0X 1A8ZA 3OQRA 5JXEA 5GQBA 3GDBA 4H8PA 3FFCA 3BSHA 1FL5A 3OLEA 1FYTD 4TYUA 1XCWA 2NNAA 1BLNB 3C2SA 1CLZL 1LEGB 1N59A 1KTRL 3CZKA 4CW1A 1RKRA 4U6TA 1WWAX 3UPCA 1EPFA 1AQDB 3V5HA 4QCIA 1FZJB 1V55B 1A1NA 1S9VA 5JW4R 2YMOA 4PD4K 4X7SL 4JHUA 4M5ZL 5EUOA 3LZNA 4JPWL 5GZNA 2IANB 5IB5B 1AANA 1S7TB 3V0AC 1JDAA 3U30C 3GPSA 1NOFA 3P3RA 1WH0A 3IDYB 1EEUA 4G1EA 4L3EB 3QJZA 1XX9C 3Q2VA 3F12B 3ARQA 3GZOA 4WK2B 4ZOAA 1FQ9C 1QSFD 3FUFA 3P4OB 1UB5A 1G87A 2H2SD 2HTLC 5TDPB 4A04A 4Y5YB 3LS5H 1DUZA 1QLEL 3MLVH 2NY1C 4P23C 4AEEA 3HB3C 3DIFB 2DL9A 4HC1H 2CA3A 1KCWA 4KJYB 1I1FB 1OT2A 2LTQB 3KR3H 4J7RA 3IDNB 4OFPA 2D2OA 2E4TA 2FUTA 4E41B 2EQDA 2NMSA 3DUUA 4PJGB 4ZUWA 1X5HA 1DE4B 3C5ZD 1M56B 5DA4A 2WBWB 3QZWG 1NFDF 4NC2B 1KGXA 4QJ4B 3WLWC 1IM9A 2ICWJ 4XP4H 4TOYL 4DGUA 1QR1B 3ZKXC 4C56D 3FCSB 4J3OH 2ZUSA 5K59F 2A3TA 1D9KC 3BRDA 3G6JB 1IC5L 3V0EA 3VSUA 1BG9A 3QWRD 5B39G 4FABH 3ZHDA 4YE4L 4A7GA 1SLWA 2YD8A 2R1XB 5EU4B 5I30H 1U41A 1PDKB 1DVFC 4K3EL 4NJ9H 3PNWB 1T03L 2BP0A 2JJUA 2UWEE 3TCLB 5CXPA 2WO4A 3BVDB 3GXFA 2Z91B 1GGCH 5DHVH 1ZSDA 4QTHB 1BEYL 4ESKA 3NJGA 4Y4HD 5GPRA 5D72L 1VFOA 3NEXA 2X6CA 2IH3A 5TK4A 4KI5E 3WN5C 3TL5A 2GJZA 4NOFA 1X5AA 3FQXA 2FGZA 3O4OB 4QRSB 1T1WB 3O41B 2VCOA 3I6GB 1PZDA 4N9GB 2XWBA 4BH8A 1XF1A 5JMOC 3E80A 2ATPA 3BWSA 3VX0A 4QYOB 4HS8H 1F2QA 4B9KC 1DVQA 1C16A 5EO1B 3BQUC 4PD4J 4ZW5A 2YXVA 3VU1A 5EBLB 1TYEB 1U8IA 3GGWA 2IF7A 4JO1H 1EHXA 4NN6B 1M1SA 5B7EA 5BVPL 5HPMB 4OB5L 4OCSL 1QSVA 2XV6B 1BREA 3M88A 4JLRB 3B2DC 3SE9H 1F56A 1A6UH 4GUQA 5AB9A 1AIFA 4OD2B 1DVFA 3KJ6L 4YX2H 1ZHNA 1HXMA 3GM0A 3QHFL 1A1MA 1HTYA 1YDPB 4IS6A 3D8MA 4NM4L 1JPTL 2HKHL 1WZKA 3QRGH 4DH2A 4W9ZA 4CVXB 1NBZB 1MCHA 1W72H 3G5YB 5IBUB 5KBNC 1DN0B 4LCWB 4NUJB 2EYSA 1BVNT 4ODUA 4QGTA 4JFHE 3GLAA 3N06B 2CR0A 4RGMB 3OAYH 4N2DA 4PMFA 4DCQA 1GA2A 3CDYA 3WNLA 4Y4FD 3OJMB 4ORZC 4XNDA 2NXZD 3IN0A 4OFVA 5HHMB 5TTRA 4PRAA 1TCRA 2FX9L 4LSPH 2LU4A 5B21A 2G75A 3VSTA 4NUMA 2QDVA 3HHRB 3P77A 4MB3A 4K3JL 3Q2CA 3HNSH 4F1SA 2Z3FA 5FECB 5IW6B 2C9QA 4N2LA 3RI5F 5C08A 3CH1A 2HVKA 1W0WB 5GRUH 2XWJA 1I9JL 2XNAB 3JT2A 1VFUA 1BMGA 3GXPA 2F74B 1F6AB 2IAND 3LN4B 5K93A 3MFGB 4KRNA 4RMBA 4WNSA 1TETL 2ZKWA 3GSNA 3VG0L 3S4SB 2BVQB 1CFVL 3HI1B 4M8RA 1JYVA 1I9RL 5FGRA 5FCUL 4YSTA 4UOZA 4QRTB 4Y19E 1XD1A 5I1KL 4JFEE 4PV9A 1HWGB 3P2BA 1V3JA 4NP4L 3EUUA 2FSEA 2YGVA 3L3JA 2ITCA 2FHBA 3QIWC 2P43B 4M6AA 4ELME 3CPUA 1ZK9A 1HYRC 2YC1A 4CDGC 3OR6B 4GAGH 4ZBJA 3OVUB 3DX8A 2DQTH 4BIKA 4XO5A 3WS6A 3PF2A 1EEYB 2QGEA 3UIYA 3SJVD 3GHBH 2NTFB 4JO3L 4EN2A 3UTZB 1ZHLA 4WF7A 5ITBL 1CI5A 2EDLA 3FT2A 3MRKA 2HX7A 4P5TB 2WK2A 1ACYH 4KHTH 4WKZB 5CM1A 5DEGA 4H44C 5C7XL 4GKZB 5IUCA 5DD5L 3V0WH 4GAFB 1E5AA 1IGYA 3CDGB 3MLUL 5IFJA 1AE6H 2XY2A 3HLAA 3PWPD 4HYTB 5AVTB 1MEXL 1KT2B 1HCFX 2IADA 1NGPH 1Q0YH 1Q72L 2UWEB 1Z0MA 2A6KB 2W07A 5BZZA 4P2OA 2J7LA 2OMWA 4PG9A 3RZCA 2JKJA 3P3UA 4FCAA 5DJAA 3R06B 4RMQA 4P57A 1T7XA 1EWHA 1JPGA 1SMDA 5AZ2L 5LG6A 2HLEB 1BXUA 3UGXA 1TJXA