2P80D

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80D00
4BWWA 1E5ZA 1ZDQA 1L9RA 2GSMB 1M57B 1R1CA 1NIAA 3T6XA 2BP0A 2AZUA 5I6NA 1J9SA 3OMNB 1NPJA 4NERA 3T9WA 1JXGA 3EH4B 2PPAA 1AS6A 2WSDA 2AVFA 3NSYA 4YSRA 1E5YA 1XMEB 2IH8A 3D12B 1CC3A 2OJ1A 2VW6A 2XVBA 1JVLA 2MRYA 1YLBB 4YVUA 1I53A 2YARA 4E9WA 1VLXA 1PLCA 3IE9A 4FA7B 1MZYA 4F7KA 1ET8A 5B3SB 4N4YB 1AS8A 2ZWNA 3IN2A 3AG3B 2PP9A 2I85A 1JVOA 2QDVA 2WO3B 1J9TA 2XXFA 3WKPA 2J57A 1PLBA 2FNWA 1AIZA 1NWOA 2HRGA 2QT6A 3FS9A 3NJJA 1URIA 4YSEA 2BP8A 1ZPUA 3NJLA 3AZUA 2IH9A 4DP9X 1IBYA 4G7RB 3UAAA 5AZUA 1KV7A 1BQKA 4HZ1A 1ZDSA 1M56B 2GHZA 3ASNB 1A4AA 4NB7A 4EF3A 3ABLB 2UXFA 4UANA 1GS8A 1NIFA 1PLAA 2UX6A 4KOCA 4DP1X 2FTAA 3WKQA 4G71B 3OMIB 2RACA 1OE2A 3QJRB 1PNDA 3WIAA 2YAQA 4E9TA 4KO7A 3FPXA 3ABKB 2JFCA 3X1EA 3FSVA 4DP4X 2VN3A 3IN0A 1QLEB 2Y69B 1W6WA 1OCOB 3PAVA 2TSAA 2EINB 1N68A 5B1AB 2BZ7A 2MTAA 1OOWA 4HCFA 1JZGA 3CDZB 5B7FA 2UXTA 4WKXA 3SBPA 3X1NA 2HX7A 2HX8A 3T6WA 1TKWA 5I26A 1SNRA 3T6VA 3X1BA 1JZFA 1OCCB 2YAFA 1BXUA 2GI0A 2DWTA 3QJVB 1OV8A 2BWDA 1MZZA 4DPAX 4E9VA 4G70B 1L9TA 1WS7A 1GSKA 3ASOB 3NYKA 3S3BB 8PAZA 4UF7C 3SBQA 2YAMA 1HAUA 1RCYA 1AG0A 2PPFA 1AOZA 2WO2B 1NTDA 4A66A 2XYBA 4BWTA 3PAUA 1AZRA 1OCRB 2PCFA 2ZONA 3S8FB 2XV0A 1SDDB 3BQVA 4K9JA 4DPCX 1KBVA 2H3XC 5IY5B 3CDZA 2B08A 1KDIA 2VW4A 3ZBMA 2W8CA 3ZDWA 1KCWA 1GW0A 2HLEB 5TK2A 5AFAA 1CYWA 3ABMB 2XX0A 2YQBA 2A3TA 1UATA 1BXAA 3NJKA 4AX3A 3NJHA 4KNUA 1IBZA 2UXGA 2XXGA 1AZCA 4KNTA 1PZCA 1ASQA 1OE3A 4AI7A 3FSWA 2GIMA 4E9SA 2FT7A 4X4KA 5I6KA 1SF5A 1AACA 1M9WA 4P5RA 1TEFA 4A68A 2VSKB 2GB2A 1XB8A 3FU7A 3HEIB 1WA0X 4E9RA 2EIMB 3NJFA 1MDAA 4YSAA 3UACA 3NJMA 2PP8A 1NICA 2DYRB 2EILB 4BDVB 1KBWA 1J9QA 2HX9A 3MBWB 3DKHA 2VMJA 2IDSA 2NRDA 3NJGA 5F7AA 1KYAA 2YXWA 2W88A 1CYXA 1KCBA 1ADWA 3S3DB 1EZLA 2PPCA 2CAKA 4G7QB 1TU2A 3GYRA 2VSMB 5I5MA 4BXSV 2X87A 4HALA 3S3CB 4KO9A 3TASA 5D4HA 3UAEA 3NSCA 4UAHA 1GYCA 1JXFA 1T5KA 2N0MA 3TA4D 1XB3A 1A65A 1L9PA 1BEXA 1NIEA 2EIJB 1CUOA 1AANA 3IEAA 2GBAA 4AKQA 4E9QA 3H4HA 2Y1AA 4KNSA 3EF4A 2VM3A 3WI9A 1DZ0A 1ET5A 1NINA 4JKNA 3H56A 4DP6X 1WAEA 3AY2A 4BDVA 4GP8B 1AZUA 3L45A 4L0PB 1J5DA 2JXMA 3KW8A 5AKRA 3X2QB 5LDUA 2PCYA 1L9OA 3KW7A 3NJIA 3PLYA 1A4CA 1OCZB 3UABA 1DYZA 4BXVA 2PLTA 1SFHA 3EH5B 2BW4A 2ZXWB 4GY4A 3X1GA 2VM4A 3TBBA 2BW5A 3EHBB 2XV3A 2VW7A 2B3IA 4A2DA 2UX7A 4M3HA 2JKWA 4A2FA 2HXAA 3C75A 1ID2A 2Q5BA 1JERA 2QPDB 1JZIA 1AG6A 4HHGA 2J56A 4DP2X 1XB6A 3FSZA 1GR7A 4YSSA 1E30A 2UXVA 1PZAA 1ZIBA 3JT2A 3FQYA 5F7BA 3IBOA 4PCYA 1W6LA 1ETJA 1IUZA 4HAKA 4BK5C 2LLNA 2FQEA 1J9RA 4PAZA 1E67A 5E9NA 3U25A 4E9YA 3PCYA 2CBPA 2YAPA 4HIPA 2ZOOA 5FC9A 3DIVA 3AG2B 4YSCA 4G72B 4W1TA 3RYMA 4G7SB 3TU6A 3QPKA 2FQGA 3AG4B 1BQ5A 1B3IA 1JZJA 1PZBA 4YVNA 2OCCB 7PAZA 2P80D 3NP3A 5B1BB 1A3ZA 5I5IA 2XV2A 1F56A 4GP5B 3FU9A 4QLWA 5I5JA 6PCYA 1ILSA 2BP0B 1RKRA 1X9RA 2HRHA 3PPSA 2I7OA 1HFUA 4HCIA 1AR1B 1J5CA 4YSUA 4AKOA 2XU9A 3CZUB 2IWKA 2FT6A 4CSZA 1FWXA 5TK4A 3QJUB 2XUWA 1JZEA 3GXUB 1AS7A 1L9SA 3TBCA 4FAAB 3V9CA 2IWEA 4KOBA 3AG1B 1WA1X 1E65A 2BZCA 4W9ZA 4WTQA 2PP7A 2QDWA 3CVCA 2OV0A 1PCSA 2CALA 1PNCA 1SDDA 5D4JA 1EHKB 5I6OA 2FQFA 1A8ZA 4QKTA 2BP8B 1GY2A 1NWPA 2FWLB 1JXDA 4YSQA 1SFDA 2CCWA 4JHUA 4A2EA 1L9QA 2IDQA 2CJ3A 3WNJA 1NIBA 4F2EA 2AANA 1PAZA 1AAJA 5B7EA 4BWUA 4KO5A 3MX0B 5EHFA 2DV6A 3QJTB 2IDTA 2H47C 1V54B 3G5WA 1SJMA 3PAZA 3QJSB 4NAJA 1ET7A 2YAHA 2EIKB 1V10A 3HB3B 5I6PA 1NPNA 2PPEA 2DYSB 3OM3B 3UADA 1QHQA 3PXLA 4M4RB 3AW5A 4YSOA 2FJSA 3V9EA 4A2HA 1RZQA 1BQRA 2YAEA 5B7MA 3SQRA 1MG3C 1IKOP 2IDFA 4Q89A 1JOIA 3SBRA 1OE1A 4KO6A 2X88A 1CURA 1W8EA 1FFTB 3BVDB 4Q8BA 1HAWA 3UGEA 4HCGA 2BHFA 2FT8A 3ERXA 5PCYA 3X1FA 4DP5X 1GS7A 4YL4A 3ZX1A 3FPYA 4HHWA 3GDCA 1X9UA 3N55A 1A4BA 5B1JA 2H5UA 1BYOA 3DTUB 3NJNA 4A2GA 2TSBA 3NP4A 1PMYA 2FQDA 3ZIYA 2R7EB 4N8UA 3T71A 2AZAA 3CVBA 5D4IA 1ZIAA 2CUAA 4RH4A 1ASPA 4E9XA 2J55A 4AZUA 2GC7C 3QQXA 2BWIA 3QJQB 4YSTA 2YXVA 1JZHA 1NZRA 7PCYA 1ASOA 5A7EA 4AKPA 4GYBA 2IAAC 3CVDA 4MFHA 1AZNA 1PY0A 3NSFA 1AZBA 2QPEB 4CSPA 1RZPA 3FU8A 1QNIA 4DP0X 3EH3B 1AQ8A 3FYIB 2DY2A 3FSAA 3OMAB 1BXVA 4DP8X 4JHVA 2I7SA 1BYPA 2PPDA 1SHXA 2J5WA 1OF0A 1KGYE 4GP4B 1V55B 3WG7B 4DP7X 2E86A 4F2FA 3NT0A 3H4FA 1ZV2A 5I6MA 1NDTA 1PF3A 2R7EA 3CG8A 6PAZA 4YSPA 3FQ1A 1IC0A 1N70A 3NSDA 3JTBA 4A67A 1ILUA 1NIDA 2Q9OA 2YAOA 5ANHA 3FYEB 2IWFA 2IDUA 1BAWA 3N2JA 1GS6X 3FU7B 4ZK8A 1WA2X 3OD3A 3WNIA 4P5SA 2GC4C 1MG2C 2BO0A 4ENZA 2XLLA 5B1KA 2XWZA 2HZHA 9PCYA 3T6ZA 1KDJA 1WS8A 3ABGA 1TEGA 4GXFA 2XX1A 5PAZA 5I6LA 3OQRA 2AFNA 4YSDA 5B1JC 4TXVB 1SF3A 3FT0A 3FQ2A 1SHWA 2DWSA 4DPBX 1GY1A 5I28A 3S8GB 1FA4A 2P80A
chains in the Genus database with same CATH superfamily
4Z7NB 3P9LA 4Y4FD 4ODUA 4GUQA 1RIVH 1JUFB 2FHCA 4JPWH 2KPNA 2DIAA 3ETSA 4MCZB 2FDBP 1Q0YH 3NA4A 3ZE1F 2EEDA 4LZKA 4WUUB 5C6WH 3SZ6A 2AVFA 5JQ6L 4LPVA 4OJEH 4DN4L 3ULSB 3BD5A 3KS0J 5AZEH 3CDYA 1D5ZB 3EBGA 3SJVA 3QG6A 5GS0D 5JW3H 1ADQA 5DS8B 1BX2B 5JOPD 4PR5A 4YVUA 3TIEA 3VD4A 1A22B 3EBIA 3FONA 3G6JF 4HAFA 4P59L 3MLXL 4WFGE 4HJSA 2OTUB 3ZE1B 1OOAA 1XCXA 2EQDA 1CGSH 4M7KL 2A6JB 4N2CA 4GKOA 5C3LD 1JVOA 2XXFA 1I4FA 1WITA 4X9YA 4JM4H 4BYHA 2C9SA 3RILA 4CKQA 1YDPB 1FL5B 2VDKH 5BZDA 3S36L 4RFNB 2ENPA 1I1YB 1SJHB 4FFWC 4P57A 5FWQA 2ORBH 4Y4HD 1PFCA 3G6JB 2RR3A 3UEQA 1UJ3C 1TZIB 3U1PA 1X9LA 2DM4A 4BZ1H 3ARBA 4ZI8A 3LKOB 5CFHA 4QR7A 3B34A 4NKIH 4S1QH 5A3IC 3DXAE 3VNZA 1IGIL 1EHNA 4FQJL 1DE4A 2EYTA 3WIIL 4DOHB 4N9OB 3QULA 3DX8A 3L3IA 3RVUC 4HV8A 4U7SA 4DP1X 1I8UA 3G5XB 4Y5YB 5AYTA 1EJOH 1OE2A 4BKTC 4ONHA 5C0ND 1JWMA 4JRYB 5GS0L 4OLWH 1EEUA 2H45A 4PQXA 3GRWL 5J7CC 2OR9L 1CGYA 5IW1A 5CEZL 2DEYX 4XMKL 1ORQB 1JMXA 1TF4A 3KPQA 4LPTA 5KYWB 1CL7H 2VLKA 3R4DA 1BQHB 5BUPA 3LKNA 2ZUVA 5K9QG 3QIUC 2HT4D 1NQBA 5BPPA 1KXVA 2IJ0C 2OULB 4OAWA 2AV7A 4AXWB 3SBPA 1UZ8A 2X4RB 1XZ0B 4HS8H 3GSQB 4QXVA 4I77H 1JWUB 2VDPH 3RGVB 5ABAA 1E6JH 2YAFA 3IE4A 1ZY9A 3GI9H 3PDGA 1ZVHA 1MI5E 3RX8A 3WS3B 4AEHL 4NUQA 3U6XS 3QHZH 4WTZA 3BP5A 1BDYA 3IDYB 1L4IA 1J0YA 5JHDA 5ICYB 1Z0MA 5IHUL 4LASL 2VGLM 4FQQB 3GO1L 3F12B 4L3EA 3F7VA 3PWJA 2PW1B 4HJGB 5DHDA 3T1FB 1VIWA 1LMKA 4DHLA 3SODB 2I69A 2F53B 3K6NA 2JKSA 4U1LB 1WIUA 4WI3A 2AK1L 4XPGH 1PDKA 4PW4A 4PJAF 4NKMA 4MQ7A 4X80H 4XPTL 3FUEA 1EBPA 1BF5A 2WKOA 5CBAA 1QRKA 1LO3L 4ZAKB 1YUHB 3GNML 1PBYA 2WC7A 3CQPA 3MTRA 4R0LA 1NCBH 5FOJA 3BZ4B 3LXBA 4TSBL 3U6RA 1WBYB 3RHWF 2XWEA 4U1KA 4AI7A 4QRBA 1N2RA 4PJAB 3VD5A 4IMLB 2DI9A 4DW2L 4Q2ZA 1PS3A 2O61A 2UZYB 1DFBH 1T1WB 5DZ9A 3UZVA 4RDBA 1Q38A 4AQ8A 3UBXI 4NEHB 4ZFGL 4H40A 4KJWC 3LNFA 4TM9A 4EXKA 2R2HB 1T7YA 2E7CA 2EIMB 1WFIA 3MJ9H 2PYFA 3GXMA 1MDAA 3OKOB 4LU5H 4UMSA 3VGAB 1T7XA 4X8JB 5FW8A 4I3RH 1EEZB 4RGNB 1J9QA 3GPEA 1LNUA 2ZX8A 2VO5A 4FNUA 3NACL 2ZCZA 3GMRA 3FQNB 3FT1A 3O4LB 1MN4A 2PWDA 3DJZA 2ED6A 4NUMA 2VRAA 1GW6A 2YA2A 1KXQE 2XJLA 3IMWA 3NSCA 4I0PA 4PRIE 1U92A 5CZXC 4KJYA 3KS0H 4OGYL 5T5FA 1Z5YD 4G8FB 3CXHK 2Y2YA 3CVIH 2Y9RT 1RZ7L 4OD3L 3X11B 3VYOA 1HHIB 3H3PH 2DQTH 1RHHB 4ZSOA 5DSCB 1NH6A 4NO2B 1SOQA 5GRJL 3VWJC 1E8WA 3ISRA 2XWJA 3CHQA 2R2EA 1KELL 3K6OA 1I3VA 1EERB 4Y19E 1KGIA 3VWKA 1WQVT 2WXQA 4AQEB 2ZAHA 1CBJA 3BSZA 1OCZB 1T0NB 4FYSA 3UABA 5BJTA 4W9DC 1H8OA 3Q2VA 4XCYA 2ZXWB 3Q1SL 4KUCD 2CPUA 4PJ9C 1J0KA 2BNUB 3EYVB 3SHSA 4F33B 3P30H 1CDHA 4Z7WE 4P5TC 3UAJA 1RUML 2QQNL 1QSEE 5HGDA 1YEJL 1O6SA 2A73A 4N85A 2HXAA 4XTRD 3VGDA 3VFGL 2B5IC 4UT6L 2XKNA 3WL9A 1AG6A 4JGMA 1TJMA 3B3BA 5I82A 1E30A 3P0GB 2HFGH 1OY3B 2V9TA 3O6MH 3CGTA 1WWAX 4KKAD 3ZK0A 1XH2A 4R4BB 1R9FA 3ZTEA 4WIQA 3MLZL 4W6WB 5L4JA 4P3CH 5GS2D 3TF4A 5H37G 5TH2B 2BK8A 2WAQA 1H0DA 3EZJB 2E27H 5GGTH 4HZLA 2BY0A 2FR4A 3ARDC 3S2CA 3V7AE 15C8H 5T1KA 3RYMA 2ETWA 1H5BA 1DCLA 1Q9OA 3GHBH 3UCRA 2E59A 3DWTA 1DBBL 2VT0A 1B3IA 4U6TA 1X5AA 4NZTL 4WTWA 1P1ZA 2WO4A 2X2JA 4KZDH 2XC8A 2YRLA 5IBLC 4LKXB 4G42A 2DQEH 1MCLA 2DQGH 3T2NH 3EFDL 3LHPH 3T2QA 5I6XC 1BG1A 4QWWD 4ELKB 1FNGA 1CL7I 3BAIA 5EOQH 1ACYL 3D2UB 2BZDA 1BZ8A 4S1SL 5E9DD 3CFCL 5DD3H 5HGAA 5TGBB 3L4XA 4CSZA 3QZOA 4HF5H 4O02H 3X3FH 1YQVL 4K8RC 2XJKA 1PD6A 1J48A 3UMNA 4KY1H 3B9EA 1E42A 2MJWA 2IWEA 3ZZ1A 3QDHA 2CCVA 5D7IF 1WDAA 3VG9C 2X7LB 5JQIB 3JV6B 2X3AA 4PJHE 3O6KL 4X5PA 3OHXB 5J57B 2OKMA 5CXPA 1HCZA 2Z8WC 3ELQA 2BVQA 4HT1L 3ZGHA 4PY7A 2WUBL 5DQ9A 1ZVNA 3QE5A 4MB1A 2ZAIA 1EHKB 1T6WA 3CFQA 1G87A 1Q9WA 4QOKA 3STZA 2BP8B 3P77B 3WHE1 4B5EA 3AREB 5D7IB 2AVGA 2W0KA 3B2PA 4FNRA 1FZMB 2Z7YA 4JY5H 1L9QA 1T21B 1PAZA 2AANA 4NO3A 1AAJA 2XWXA 4BWUA 1ORSB 2ATPB 1RZIB 2DV6A 2FIKA 1G6RH 1KTJA 5C0BD 3QYMA 2P5WE 2FX9L 3BH9B 2PO6B 4QHLB 1CFNA 4BUHA 4GRLD 1HKFA 4EIBA 1DUYA 3ZKNC 2CO7A 2NSXA 3TV8A 2CA3A 3UGXA 3O8XA 1YMMB 3QHFL 5DCCA 2DN7A 3BN9C 1NCGA 2Z92A 4YSOA 5D2LE 1QLFB 4MS8D 5HVHB 4TPRL 4KI5E 2NUTB 1E3XA 3WFCH 2DPKA 2DI7A 3S5LG 4R7NB 2A0LC 2IOIA 1YECL 4M8QA 4G3YH 1VADB 3ISWA 4E41A 3D39E 3QDMB 3ZTDC 4XPBL 4Y2LA 2BHFA 4OUOA 5EUOA 4OZGF 5KVEE 3NOIA 3MFFA 2BY2A 3MRJA 1X9UA 3MZTA 1M7IB 2VERA 2V17H 4NM8H 2FQDA 4WTXA 4OM0H 2FBOJ 3FRPB 5ALBH 1MHCB 4L29A 3RIAK 4MKMA 2A6DB 4TV3A 5C6PB 1LJMA 4X6DE 1WC7B 2WMPA 4PGCA 4JR9H 2HUHA 1CI5A 2EO7A 2XPGA 3D09A 1AMXA 3H6AA 3ILPA 5CMAA 3V4LA 3PYCA 4Y5XA 1P9MC 3ESUF 1RU9H 4OZGB 4YSTA 5J12C 1S5HB 4RSYA 1MRCL 2APSA 1GVIA 1GGYA 4UILL 3VXUE 4U6XA 5ESQB 5LNDA 3N5AA 5HJ3B 4G6JH 2NW3A 1W80A 2EDNA 2XRAL 3DSFH 4NQXA 3ZMRA 4WJ5B 1FZJB 4JN2B 4D3CH 3EH3B 4HIQA 5GIRA 5C7XH 3FYIB 2CXKA 5T5NG 2AJSH 4K7FB 3OX8B 2LTQB 1NCJA 3H9HB 1KCSL 4JHVA 1SHXA 5A2FA 1JMZA 1LP9E 3HRPA 5C6TL 1NGXB 4MB4A 3HAEH 3FTZA 3Q6FA 4WU5B 1I1FA 5FA3B 3EJYC 4N28A 5E2VL 1K5NA 1IU1A 3K8LA 2UZXA 2BIHA 4X98B 1XGQA 2F0CA 4UV7L 4H1LG 3X17A 4AYFB 1HWWA 1MW0A 2AQPA 1A9BA 1FFOA 2AXGB 2A6IA 1D9KD 5E6UB 5C08E 3BIAX 3TJEH 3V5DB 5DTFA 4UOW1 2CUMA 4DUWA 1NIDA 2Q9OA 1CMOA 1ONQA 2IWFA 1YN7A 5CCJA 2QADC 3B2VH 3LZFH 4BFIA 4IGBD 5CJ5A 3C5ZA 3KCWA 4MJIE 4FFVD 3AAZA 3G9VA 4JO4H 4H0HB 4JFZL 2B20A 2AEWA 4ES8A 1ZWIA 3SDCA 4OF5A 1FN4A 4GO8A 2D2CC 4NOFA 4XMXA 5EBLB 4K3JL 1E28A 5K93A 2XLLA 1R3HB 3SPJA 1EO8L 4M6MH 5AVUB 4EZMA 2HZHA 3T6ZA 1FNSH 1I7UA 5A16A 1J1OL 3IMRA 4JM0A 5L88H 2WZPD 5I6LA 4Y4KC 2J43A 3Q01A 4ZFOA 3FQ2A 4UU9B 2DWSA 1GIGL 4XWOD 3S4SA 1ZHBB 3QUZB 1J0ZA 4W9FC 3EKCA 5FYLD 2NUPB 3R7RA 4AYEC 2ATKB 1Q8MA 1NGPH 2P5EA 2NNCA 3H9SD 3FFDA 3UTSD 4N2EA 3PV6B 4PV8A 3DTXB 1MCHA 3D9AL 3D07A 4XPHL 1ZTXL 2Y7LA 5D72H 2J2ZB 5D2NB 4N5UA 5EBGA 1A4JB 4X5XA 2BCKA 1UJTA 1KJMA 3O11A 1C8PA 1Z5LA 4MAYD 3N41F 5JA9A 1E5UI 2WVVA 5D7LB 3PP3K 4HVBA 1LEGA 3RUGA 4AGOA 3P2DA 1CG9B 2XN0A 3FQWB 5ACMA 2W65B 4DCQA 3ILQD 4BCYA 1JWSB 1U8IA 4FZEL 1M1SA 4J6RH 5C2BH 1JPSH 4KKZA 1FGVL 1XF4B 3N85H 1HEHC 1OARL 3ARTA 1L5GA 3N41B 3I9PA 3NJJA 5DRXB 4WWPA 4QTHA 3T8MA 4NN6C 1QYGH 4BFRA 4AUJA 3AZUA 1SEQH 3EJQA 3LEYL 3CFBA 4N2DA 1TQSA 2DDQL 2VDQH 1A6VH 1N0XH 5F89A 4XNXH 2YD8A 4G7RB 2XACC 4JFYB 5FFLA 5CEZE 2E7LC 3H54A 3HHRB 1G6VK 2WYIA 4IIQC 5FYLL 3ROOA 2G75A 1MHPL 3OXSA 5DMKA 1TTRA 5LCVL 4JJ5B 4NB7A 4I4WA 5JZ7D 2UXFA 1CF8L 5E08H 1BMZA 4TVPH 3BKYL 5IFAL 1YEDB 4GFTB 3KCPB 4MAUL 4UTAH 2X1OA 3DGGB 2OZNA 4EO5A 1FV1A 3NSXA 5J13B 3HS8A 1F90L 2VAAA 3JUZA 3GMPB 1DO6A 3BI9X 4ZTOL 3WIAA 1SN0A 2ZYRA 3PHQB 1T2QH 4HS6B 3AXLA 2VISB 2HLFD 3FBKA 4DVBB 4WI0B 4XCEA 1MNNA 1XR9A 3B43A 2UY7B 4DQOH 2R4SL 1G9NC 3ZTJH 2ZWLT 4NRYB 3FDWA 4X6CE 4AGPA 2EO1A 1G9NH 2DMCA 3CFIC 5IUCA 5JHAA 2FHBA 1PSKH 4APXA 4ZO7A 4LLDA 1MHEB 4ECNA 3HBPA 3TYFB 3SPVB 1GPOL 1TKWA 5HHME 4FNLL 2JKNA 1HE7A 4TOYL 3TIDA 2MMXA 4V11A 3VACA 2IALA 1BF8A 2IMMA 2CO1A 2EC8A 4OGZA 2PYEA 1BG9A 3MBXL 3MLTB 2HKAA 4PJBE 4YX2H 4XH2A 1U30A 4EI0A 2Q87A 3HCVB 3MRCB 3UXFA 5C0AA 4GG6A 3TYGL 3IDJA 8PAZA 3T1WA 1Z9MA 1DEEB 4L0YA 2WO2B 1P6AB 2GT9A 2VDML 3MQIA 1OKEA 1CGWA 2WQRA 3O6FD 5DQDL 6TAAA 3FT4B 4YDMA 3F6IA 4Y5VB 2NY3B 1T03H 5K9JL 3EFFB 4LNRA 3KXFE 2WNWA 4K9JA 5CCHE 1E4HA 2H3XC 4DPCX 4P2QD 3QCTL 5HDQL 4D0CA 2NTFA 1F6AA 1KDIA 2N3JA 3EYFA 4P2RE 4J3TA 5KOMC 1CFTA 2E7BA 4OKVA 2ICEA 4OTXH 3ARBC 2EC9U 3CBKB 3TTYA 2E76C 3CSTA 1BW8A 3CX5J 5CD3B 4BIKA 3LOWA 2AJXH 3PWPD 4HJJL 1S9YB 4B5ZA 1CO1A 1QFUH 3ULUD 4X4KA 1JNHB 3QVAA 2YMOA 4L5FL 5EPMB 4YC2C 3K8MA 4A68A 4MTMA 4PBVC 2VM9A 4XCFH 4V1DD 4GW5A 3QS2A 2YPLE 1FVDA 3JTTA 5E23A 2OZ4L 4XZUA 5TDPB 3UOAB 2DYRB 2BJML 3CCHB 3G7TA 3TN0B 1DJIA 1KBWA 3U4AA 4ZMLA 3RP1A 2CO3A 3E9TA 1KXVC 4PTUA 4MA3B 4HFUL 1QZ1A 2EYRB 1CLYL 4WHTA 1CYXA 1YVLA 2MKWA 1YYLH 3OJ2C 4RZCB 4UINH 2V7NA 1QFWL 2ZXEB 4AQAB 3BP6A 3P11H 1UWYA 4NBYB 3LVEA 4Y4FA 5CU5A 2GK0A 3UL4A 3ARZA 4DZBA 2NMSA 1LL1A 2XKSA 4K5NA 2DI8A 5EH1A 2G9KA 3VSUA 5JQHC 5EORH 4UBDD 5CCGE 3IEAA 2NXZC 3CIQA 4F58H 4KDWA 5CU9A 4YZWA 4PJCE 4TNFA 2RFXA 5I75C 1AIFB 4NHUB 3IAGC 3VFPA 1MDTA 5CHNB 2BOCA 4W9HC 4D0DA 1CXKA 3ULUL 3GRWA 4PP2A 4Z3EA 5IVNA 2XFXB 3AY2A 3ARSA 4NM4H 4EKXA 1OAKH 3TVMD 4AQZA 3LEVH 1QBMH 1HIMH 4OQTA 4YDKH 4U0QB 2R29L 1DBMH 1DLFL 1HQRB 1IM3D 1PKQA 3AMLA 4IJ3B 1PLGL 1OW0A 4PJ5B 1WZ1H 1PPIA 2Y5TA 4MVBC 2ODHA 1HQ4B 2GJPA 4GY4A 4R3SA 3MRNB 2I9LA 3LQZA 2MEJB 4OFKA 4J3WA 4K3DL 4R0LC 3MLUH 1EJ6A 1IGCL 1JF6A 4Y4HA 4YBLB 4OY9A 1N59B 3OAZH 1MFEL 3WY2A 3E6FA 2HG5A 3IBEA 1RVFH 2K8MA 3IDXL 5CJOH 3RU8L 3WGUB 2ZXBA 3E3QE 1VGEH 3OMZA 4F7MA 2EE2A 2P46B 4JKPL 1JERA 4G7YH 5FGSA 1E9OB 4JW3A 2ROYA 4AQ8C 2JKXA 4ZUTB 1R3JA 3TBYB 4AJWA 2CRIA 2EXSA 4YSSA 4RMSA 5BS0D 1ZIBA 2ZX5A 3RY6A 1A7PL 2MQGA 4NNXA 2Z7ZA 1UVQB 4HX1B 3FN0L 4AYDC 3MJ8B 4KUZH 3H3BC 3OR7A 2K70A 3CFEB 4MD0B 3DMMB 2ZOOA 1SDYA 3LRSA 4DK5A 5GJTL 2GJ6E 2EDDA 2YPKA 2ZOTA 1DBAL 2YC1A 3S7GA 1R46A 2QGCA 1MH5B 1JK8B 3OKEA 1T1XB 4HKJA 3CSYA 3IGLA 2RD0A 4ZS6D 3GLAA 4JRYE 1SOKA 2ZSVB 1QFHA 4I0PC 2O30A 3U7WH 4GP5B 3L2LA 2KLSA 1AGEA 2Z1KA 3ABZA 1ILSA 5ESAB 4I1PA 1Q0EA 1E4WL 1UM4H 4M61B 4O5LL 4P2OD 1YJDC 5IK3B 3V5KB 5SX5H 2BSBA 2WZ5A 1QPKA 3KZ8A 1F0LA 1S7WB 1YJDH 2A83A 3KEDA 4LLWA 2QVKA 3QDJB 4WVRA 1ROWA 2DWEA 3OZ9H 1V27A 5JXAL 3L81A 3TO2A 3MYJA 4YHZH 4HKXB 3VWKC 1AY1H 4B9FA 2H3KA 1C16A 5AYUL 5K39B 1ZT1A 2WIIA 3OKLA 1WA1X 5LGYA 1QSFE 2AXWA 1S7RA 3MLWL 3K0WA 4A6YB 4ZNCD 1ZVSA 3F84A 1ZSHA 4FTVD 4P3DA 1SQ2N 2C4XA 3ALWA 3KH4A 2CIIB 3TC9A 5DF0A 3UAJC 4AITA 1EO7A 1DDTA 4KKBD 2C7UA 5D93C 1RSFA 5CINH 1VCAA 4CVZB 5IW6A 4XWGH 4X6EA 4NWTH 2Q7YA 3QJFA 1I9JL 2Q2EB 5T8IA 5C7ZA 2B39A 4PGEB 3GS4A 1FNHA 4HIJA 2H47C 1F97A 9CGTA 4O2EB 1ZA3B 4NAJA 5E1IA 1KTCA 4IRSC 2FWOB 2YXFA 3BWUC 3LS4L 3MLYH 4NOBA 1ETZA 1S7XB 1V10A 1UM5H 4NNYA 4CMMB 1Z7JA 1X4XA 2PPEA 3NRQA 2VN7A 4MZIA 4BV1A 5I1GH 3HNTH 5F96L 3V9EA 4I2XB 1UXSA 4PB9H 4PJAE 3BEVB 1H5BC 4DK3A 4ONGL 5FV2A 3ETBF 5DJ8B 1M2VA 1I8IA 4QXUH 2E0PA 4MBRA 2KKQA 1NBYA 3U36A 5E1GA 3QO0B 3HZ3A 3W9DB 2QVFB 3UGEA 3AWGA 5E1AA 3ZL4L 2HAZA 1ZOXA 4N2MA 4RGNE 2H5UA 4P06A 4UT6A 5E8EA 5KAQF 4K7PH 2CBMA 3BGAA 2XWRA 4HFWB 1YO4A 3QR1A 1XSOA 3SE8L 4CADB 1MCOL 4JM2F 5INDB 2AI0L 2GBVA 2YD0A 4H8QA 1MFUA 5B1CA 1ASPA 4QRRD 2J55A 1XCTA 2HLAB 2V3DA 3NVQA 3QQXA 3RNKB 2IMNA 5KEZA 4B60A 4KK5D 3MJ6A 3O4OC 2ZG3A 2YZ8A 1GMIA 3BSHA 4HJUA 3F7KA 4P4RB 1E4XL 2KMWA 3GDBA 4MA1C 4P07A 4ZPTA 1FE8L 4KDTA 4EDXB 1R4XA 4ZDHB 3CN0A 4JM2B 2X2IA 4PU2A 1C9SA 1WAAF 2W60A 2YD2A 3L08A 1VZIA 1D6EA 1LO4L 3H42L 4L4JA 4UQ9A 1NAML 2RGSA 3SKJL 5KBKA 3P4NB 1BYPA 3WIFA 2AXHA 5MEOA 3H2PA 4XXDA 2JK5B 3FUMA 1KGYE 5E7BA 4CBPA 2YRZA 1EK3A 4QNPF 4PRDA 3EOTL 2A99A 2IFGA 1IVLA 2ZYSA 3QUML 5I8CB 1S6NA 4HC1A 3ZZQA 3H7BA 3OAUH 3I02A 4IS6A 4GSUA 4ZOBA 2I9TB 5JW5A 1FG2A 1U95A 1SLVA 3NZ8A 1XL4A 2YGQA 4RNRA 4ODTL 4F24A 1WEJL 3OPZL 4FQ1L 3VMOA 1OTTC 4WY7H 4KXAA 1KJ3H 4M7ZB 4UDTB 3II2A 4NKDA 5DI8A 3SE4A 1BGXH 5DS1A 4HWZB 2MFNA 1E4JA 4MJ6B 4R7LA 4OCYL 5CP7B 4P5SA 2WSPA 3D2TA 1VKXB 4U0RB 2BO0A 5AZ2L 4EVNA 3LRGA 3BUBA 1XIWB 1ZTXE 2XWZA 2M8XA 4OF8A 1MCWM 3F5WA 3EYUH 4LHJB 5BW7A 4HIHB 1AXTH 4FNPA 4ZO8A 3T4AA 2UZIL 4NWUH 1HWGB 5DYOA 2E6QA 2ZUTA 5I17A 3TPKA 4RGOL 4UYQA 2BIIA 2C3XA 2QVTA 1MWOA 2EDMA 4Z7AA 1O75A 4LLYB 3VG0L 3T6XA 5H2BA 4LMQE 4QJ3B 4N2HA 4CU7A 2GI7A 2OSLB 3CH8A 4Y5XC 4XMPL 3KLAA 3NZUA 4LHUA 1MFDH 1GTNA 2J8UF 1FYTB 1KPVB 5CNHA 3MROB 4YBQD 1HH9B 4FFZL 5GGQH 5FO2A 4JHAH 3UJJH 1ACXA 4JFHD 3RWCB 4Z9KB 2APTA 3BH4A 3OR6A 3BRFA 2VQUA 1WH0A 2FO1A 2VH5H 2J8UB 4ZPVB 3S96A 3AG3B 2PP9A 2XZZA 4DGYL 3WKPA 1UB5A 5C8JB 4IU2A 2F6AA 4ERSL 1CVSC 1WFMA 4PWEA 4J1UB 4TUOA 1EWHA 3G9AB 1HXYB 4WI8A 4YGVA 1RIUL 2QV2A 1XCQA 3U4BL 3VXNA 2NDFA 4HW6A 4L4VD 4XX1G 2Z3FA 4YHOH 5TDOB 5FYKD 3SSGA 1A02N 4ZBJA 1BFVH 3BIKB 5D70L 3GPSA 4IU3A 5TFSL 3WKYA 1OF2B 3EDJA 2WN2A 5CSZA 1ZDSA 5C0BA 4R2GB 2DQCH 1NGYB 5GGRA 1VEOA 3C5ZC 3DBXB 4GRLA 2F19L 1XGRB 3CDFA 4HJ1A 4AT6B 5JW4N 5AB9A 2H1PH 1G43A 1A1NB 2NLJB 4QRSB 4GJTB 3SDCC 3RAJL 4BH8A 4NQVA 4G6KL 4HJTA 2GUYA 4FLSA 3BKCL 3MRGA 3HPJA 3DJRA 1G0YR 1CE1H 2AS5M 3CSFA 3PAVA 2VC2H 3DO4A 3FH5A 1LM8V 3SN6N 3ZHDA 3EO0B 4F20A 1NUFA 2WWNA 1HHKB 1JPTL 5HHPA 1SLUA 4Q14A 1VENA 3V4PL 1XGPB 4FQ2L 2ZOWA 1I3GL 3AROA 5MP6H 3QK0A 3NRFA 3S34H 3OAZK 4MX7A 1ZLDA 3PREA 4TQHA 2GI0A 2KDGA 3VFRB 3D69B 3D06A 1WS7A 3HHMA 3QI9D 4KZ0A 5AUMB 5FGRA 5FYKL 4HOXA 5BVJA 4YR6B 5EFIB 4ZMAT 1DVZA 2B7DT 1A2YB 3KLHD 3OGCB 2HVKA 1U3HC 3VXQA 5AAWA 1N5AB 1CFVL 2CK0L 5EU7C 3CFKB 1T4WA 2IBZY 3PAUA 4MWFB 4JY4A 1WK0A 3DK2A 4QI3A 3RWHB 5SWSA 3GSNB 4OZGE 4PYGA 4R5XA 4R4NC 2FZ3B 4RIRA 4YO0A 3BVNB 4IM8A 1QPXA 4KRPD 1K3IA 2AMGA 4M1CD 2XWDA 3VRJB 3QRGH 1RLBA 3GMLA 3QYCA 4L8BA 1T5WA 3HRZB 3RGHA 5ADOH 4O2CB 4RAHA 3QGVA 3FFCB 4LIQL 3G6AA 3I2CL 4N0UB 5LBSL 1GMEA 3X14B 4EN3B 3NDYE 5K1JA 3PDDA 2C1PB 2WUCH 2CDGB 2O5ZH 4IBUA 1HILA 3VFUA 3VFVB 1D9KA 1KJ2H 5I1HH 1KGUA 4M8RA 5AWNL 5CJXA 4KZEH 1W2KT 2AP2A 4YLQT 3ETTA 4IGBA 2D3LA 1E9PA 4X4ZA 3FU7A 1TEYA 2VO8A 2EIZA 2PN5A 4BSVB 3O3DA 3M86A 3D8MA 4ABWA 4JL2A 5GRVL 4JVUA 3UC2A 1TVBA 1ICTA 1MJJA 2E9JA 3MO1A 4MMXC 5HHVL 2D31B 5HYJB 3C2AL 4OLYH 4LSTL 4PRHD 3KYKL 2WZPA 4LLQA 5F9DC 4X50A 2CGRL 3U46A 1ADWA 4M00A 4BZYA 3GEWB 4QPEA 4DKFH 1N18A 3PUUA 3LMJL 3OWEA 1MFBL 2CJUH 5DUML 1ZLWK 1NPUA 2H0PA 1MF2H 1PEZA 3HI6L 5DDHA 3SPCA 3WMPA 5CIPB 1U93B 5HI3D 1U8KB 5KG9A 5LCVA 5GRZA 3G5YA 4OCWH 1TXKA 2XQYG 2K3HA 1BVLA 4PLOB 5FYJE 5B38G 3H9SA 3UTSA 1RUKH 4LCWB 2XPZA 1TYJA 2SEBA 4OV6F 5A2JH 3K1KC 2HG0A 5I1JL 1JFQL 3HS0B 1A7OH 3TJHD 1N6QL 4LSQL 4MLSA 1K2DA 3SKNA 3UTZB 3WI9A 5F3FA 4P4KD 4MAYA 4WK2B 4P8QA 2QQKH 1PYWB 4JKWA 2W9DL 1TVHB 2OSWA 3SCMB 2C3VA 4GP8B 4PMEA 3UTTB 1KENH 1IGYA 3G04B 3K3QA 4TMPA 4ESKA 1PU0A 4P05A 2C9AA 2YEVB 4YHLL 1UA3A 4KKNA 5D7LE 5IQ9A 1SFHA 2B59A 1HSBB 2ICEC 2XFGB 3PWUA 4DNLA 5HYSB 4YXHL 4KFZC 4M3KB 5T1MB 4G9FB 3MUHL 1N5YL 4MNHA 3QEUB 2ICCA 1AHWC 5ADPL 4BE6A 4PRAB 3F7YB 3BPLC 3ECBA 5JQ6H 4UIKL 4DN4H 4JRXB 5LBVA 4JHBA 1FNEB 1VSCA 4W9GC 1G7HB 2CBOA 5T3ZD 3BP7A 5B8CB 5IEHB 5TE6L 4M1DL 2OMVA 3HUJF 3ESVF 3RI5F 5F44A 1BLNA 1GR7A 3WKNA 3MV11 4WU7B 2UWEA 1LXMA 4FQCL 1JHTB 4P59H 4G11A 2CLRB 3MLXH 4JO8A 4LQ1A 2LAGB 1ETJA 2X2UA 5GRXG 1XXDC 1FO0B 1MXDA 1ZLEA 4M7KH 4E9YA 3U25A 3BPOB 4BFBD 2YAPA 3JTSA 1QRND 3QUKB 3VXTA 2H9GB 1IBGL 4F7EB 2BDNL 3HUJB 4NPYA 2YN3A 3S36H 1FSKC 2YEQA 3OJDA 3FO2B 5DK3A 5BV7L 3PDOB 3WEBA 4JE4B 1X4YA 4L4TD 1QFWM 4UQEA 2QL1A 3M8OL 5EO9B 1I9IL 4WWKD 1J0IA 2NSMA 3NPSB 4Y4FC 1F56A 4HUKB 5AKVA 4X5WB 1IEAA 1F42A 1RKRA 3EOYG 1IGIH 3T5WA 4FQJH 1OM3L 3Q3GA 2I7OA 3WIIH 2XSKA 5L4IA 3A24A 4M8UA 2J44A 2D73A 3VYNA 2A9NL 3RX7A 1B0RA 4PVNA 1NGZA 4ZUWA 3TZVB 3HNSL 3UTPD 3RURA 5GS0C 1O7DC 1G94A 2DMGA 3LPPA 5E8NA 2WXNA 2CHNA 1AS7A 4WO0A 4WI7A 4BBWA 5GS0H 1FYHB 3GRWH 2OR9H 3NZHL 4IRJB 1A6ZA 1YN6B 3LH9A 5CEZH 2ITDB 4L2YA 1T3FB 4XMKH 5FUOL 2IANE 2R56L 1OW0C 1QHOA 4OQTH 4FXTA 1KF9B 3QEHA 1S7VB 4GSXA 3O6FA 3I74A 5KYYB 5E8OA 1ZLUK 3WFHA 2ZE0A 1WICA 5E6YA 3IGAA 5K9OB 4NO5A 2ERJB 1E0OB 3RY4A 4P2QA 3PF2A 1QA9B 4Q9BA 2ZXCA 3OAWA 5IFHL 3D05A 2VCOA 4HUXB 2V2TA 1RSYA 4Y1AB 1WVZA 1R3IL 4HPYL 2HVJA 1SM3L 2CJ3A 3DROB 3V0WL 5SWZA 2FSDA 1EA9C 4AEHH 3X12B 4L23A 2YD1A 1T2JA 1RK1A 4OFIA 2CKBL 4PW9A 3PWPA 1ET7A 2ESVD 4ODBD 3APDA 1DJXA 4RAUB 5IHUH 3GUTA 2YAHA 4LASH 4YIQB 4E42B 3L2MA 3GO1H 4O2FA 3HB3D 5IHHA 4YPGA 5IF0B 4X5QA 3V8CA 3ZU8A 1JVKA 2R29A 4QXGL 5C0NC 4TNVK 2XXMB 3TF7C 5K33A 1ZHLA 2W81C 1RMFL 3NFNA 3MRBA 2AW2A 4V1DA 5KBLA 2F1BA 4RVBA 3SE9L 1WYJA 2AK1H 1JOIA 4JQXC 4N8VG 4XPTH 3PIQA 2HT4C 3BVDB 3QRBA 5ACZA 3GKWL 4L18A 1LO3H 1FAIL 3GNMH 1OB1B 3KNBA 4GQQA 4YL4A 4CILA 5B1JA 2AJUL 3DTUB 3NJNA 4TSBH 3OSVA 1U8HA 3DURA 4IHOB 1IAKA 1FFNA 2E7HA 5J4MA 1BM3L 4Q6IA 1R5IB 4E9XA 1S8DB 2HMID 4ZFGH 1A1OB 3STBA 1JZHA 5A6MA 4OZFB 3SDXF 5AENA 2IAAC 4NUJB 3QNZA 2XZCL 3FQTB 5F9WB 2L7EA 4YBHA 2H6OA 4KDVA 2X4OA 3NSFA 4G9DB 4RDQF 5HYFA 2Q7NA 3Q8AA 5JORA 3DARA 5L6YL 3JV0A 3ZUCA 1H6TA 3U9PH 3DJSA 3NACH 3TVMA 4X83A 3BHBA 1SLWA 2Y7NA 3FSAA 5CZVL 1IM3A 2A4CA 2OFQA 3SDXB 4CSSA 4DP8X 3IJSA 3IJEB 5H37A 1WLHA 5TDNA 3S5ZA 3Q5TA 4WWOA 2XIIA 3HC0A 2P52A 3D5OF 5BZWA 1PX3A 3JVGA 5I0WA 1ZA6B 2OXGA 4FMVA 5TQ2L 3UMTA 4J12A 5FAAA 4AVJA 1AGFA 1RFDL 1TTFA 4OGYH 3P73B 5D55A 4O51A 3II3A 1KZYA 3OKDB 2XXCB 1H3TA 1RZ7H 3NEXA 4OD3H 4PJ5E 5DURB 1WFTA 1YYCA 5HI5D 4PIRF 1RJYB 4G8GB 5GRJH 3WU1A 4J3OD 4XP4H 1NGQL 1QW9A 1BBDL 4G1MB 3WUWB 4MD5B 5E8PA 4FE9A 1KIQA 5BS0A 3PWNB 3FT2B 3F7QA 3RTQB 2CU9A 1J8HB 4HUUA 1XF2B 3O0RL 4TQPA 3RFZB 2WVSA 1MFVA 2CLZA 2Q3ZA 4I9WE 4HK3N 1KTKE 1RUAL 4DZ8B 1A3QA 3QDGD 1I7TA 3KBFA 3AQXA 3Q1SH 5DVOA 2AC0A 3OG4B 1TEGA 4JFFB 3OQRA 2AFNA 4YDVB 1XEDA 2K6YA 4TXVB 3DX2A 1RUMH 1SF3A 4GW4A 2QQNH 1K6QL 1T6VN 5E6IB 5I2IA 1XF3B 3MJGX 1IGML 4S10A 3VFGH 4LRNL 4KMTL 4UT6H 5FGCB 5I76B 3IDNB 4OLEA 1UOVA 3ZY7A 2WJ7A 4P2OA 4LNVA 4NP4L 1D5XA 5I6NA 2HJFB 2K9UA 3OMNB 4LARL 4FN0A 3ECUA 3OAYH 3PJSA 3JVFC 4P0DA 3T9WA 3RFRA 4WUUD 3ZYJA 3VSTA 1A9EA 1G7JA 1OGAB 3HC3L 3MLZH 4KDTC 3EJRA 1SPDA 1T7ZA 5B4MD 1C12B 3WV0A 2VW6A 3OWRA 1JVLA 5JLZA 1J05A 1U8JB 4FI6A 4JUTA 1JNLL 1U91A 1COBA 3RRQA 3TNMA 1LE9B 4ORGB 1PLCA 3IDIB 4WEMB 2WYHA 3OHMB 1DBBH 1GSMA 4RQQA 4N90E 1UCTA 5E5MB 1I1AB 5J11C 2QDVA 4NZTH 1KBPA 3KPMB 5FM5M 1H3PL 2W0PA 4JGJA 4U6YB 4I5BA 2ZXQA 4FTVA 3S5LA 4YSEA 3EFDH 4BGDA 4B9GA 4L8CA 1D5MB 2GW5A 1ACYH 3VGGA 4XTRC 5MERA 4S1SH 5I66B 1W15A 4JFTA 2BHUA 3CFCH 1JDAA 3KYMA 4J3SA 1YQVH 4RRPM 4BFOA 1WD9A 3SE4C 1ZS8A 1W0VB 3HN5A 4HOWA 1B90A 3QIBD 4ZX4A 2JJSA 2WXHA 5ILTL 4DJMA 3O6KH 3QJRB 2YEZB 4BHUI 3DVGB 1AJ7L 4HT1H 5IKCA 5ENWB 1BVNT 1ZAGA 2WUBH 1LWRA 1MJ7L 5E70A 5GS2H 5BW7C 4A7VA 3RZWA 3RZCD 2P47B 3T4AC 3TFBA 5D9SA 1CXFA 1KJVB 1NJ9A 3QUMA 4G80B 2FYYA 2TSAA 1TZHB 4JO1L 1Q1PA 5B1AB 4Z7VE 4JANA 4MDJB 4I2XE 3CDZB 2ADIA 3L7EA 2JB5L 3V52L 5B7FA 3A4AA 4PJDE 3W2DL 1P7QB 3TCLA 2HX7A 1G7LA 3RL1B 2XI9A 4UQ2B 2FX9H 3CFMA 3ECQA 1A6AB 4N9GB 1ZD6A 1RI8A 2NYKA 1RZKL 2F7PA 2KI6A 4KX9A 2XYCA 1MZZA 3K7UA 5GGUA 3CH1B 2K1MA 3QHFH 2C1OB 1CGXA 4H1LA 5EN2B 4QRRA 1NFAA 5DMGC 5I0XA 1BXXA 3WN5A 4B9YA 4ZMXA 4BKLB 4TPRH 3VE0B 2PPFA 3JV4A 4CDGC 5KVFL 1MWAL 4J3VA 2FBRA 5MHSD 4JRFA 3DSNB 4X6FA 3E2HC 1W9XA 4HUWB 1VESA 1YECH 2EDBA 2GFBA 2UYLA 3MRRA 4XPBH 2NY5C 1WTLA 3DRTA 1FPTL 2F53D 3L3HA 2A6KB 3ZHKA 1MCWW 3KWWB 1ZTMA 5EU5A 3KH3A 4M3JA 2DH3A 3X3GL 5C0JA 3TPUA 1L6XA 3SY0B 3TL5A 4IQHA 3GXNA 3IXTA 3MCKB 1SXZA 3LZNA 1OLZA 4ZAKD 3WAKA 4NXSA 4YXLL 4XNZC 3O3EB 3MKKA 1DJSA 3N40F 4OSUL 2BLFA 5D71H 5SV3A 1OAZL 32C2A 4FKKA 4GRLC 4X9BA 3QT2A 5LBGA 4HDIA 4MJJA 3BPCB 2FD6L 1MRCH 4JY6A 1R17A 2GIMA 4FFZA 4UILH 1Y07A 4YFDB 3WS6A 4JZNB 1C5DB 1WAAE 2P7TB 1BIIA 4UQIM 2XRAH 4L9LA 4L8DB 2OL3L 4GS7C 4C4KT 1B2WL 2I07B 2J3SA 2JCCF 4OCSL 4MS8C 1LK2A 1U8MA 3L16A 2HRLA 3HOGA 4E9RA 4K9EL 4MQXD 3ULVL 3LKRA 1NOFA 1KCSH 2G0LA 3QR2A 5C6TH 4RGMB 4BDVB 4DN3L 3MBWB 3DKHA 2J7LA 3L3OA 3NIDF 5AKTA 1KYAA 1SEBA 5E2VH 2ZCKL 1HHJB 3SY6A 1Q9LB 2JCCB 3DO3A 8FABB 1O9WA 3O4LD 4UV7H 3S3DB 2CAKA 4OZHA 3O9WB 5GXBB 1IRAY 4C55A 2KDYA 5FECA 4KO9A 1ZLSL 3UAEA 3MRDA 4M4PA 4ODXA 1YNLL 3NIDB 3VXSB 1TQBB 1D7BA 2R1YB 3U30B 4MXWL 4CNIB 4MGXA 1TR7A 1CD1A 2ICWA 5KOVC 3MV8B 3H0TB 2QZ5A 1H9VA 3TWCL 5AAWC 3H4HA 3U4KA 4OF7A 4JFZH 1NMCB 2VLRD 3EF4A 1VFAA 2Z93B 3QA3A 4APQB 4KKPA 4K3JH 1VFBB 3HVNA 4OJFL 4YE4L 4UIMA 1EO8H 1JTTA 2BP5M 5EC2A 4V2CB 2B1OA 1J1OH 1FYTE 4HWBL 5AKRA 1J5DA 3X2QB 2VNCA 3KDMA 2HKHL 2XA3A 3NJIA 3T4YB 4OW6A 1GIGH 2AQQA 4Z7WA 4K7PY 2WLJA 1MAKA 3BH8B 3EBAA 3F6JA 4HH9A 3V4PA 2AK4D 3HBGA 4ILDA 4LCYA 4XMWA 4ZTPL 2NY6B 3GXFA 2VLJB 2ADGA 2UV3A 3IFOA 2J8UE 2M1KA 1TJGL 5IB5B 2YOCA 1HVXA 4NT6B 5C09B 1PZSA 1KGJA 2OMZA 4R97B 3D9AH 3VXPB 4L4VA 2YWYA 1D9KC 4XPHH 1ZTXH 2ED8A 4EPSA 2F8XC 1CXIA 2E7DA 4CGTA 4UQBA 3KVDD 1N3NB 1UWEL 2AAAA 5CJXC 1FF5A 5FO9A 2EABA 2FH8A 3EG9A 5AW3B 2J56A 4IGBC 1UYWL 4PSRA 2ARJQ 4FFVC 5DMYA 1RH8A 4G82A 5H35A 1JSYA 1NEZB 4FZEH 3ECWA 2X05A 1FGVH 5AQ0A 4FEIA 1UKQA 1XSKA 1OARH 1EXGA 1X4ZA 1YMHA 4JQIL 5IMKB 4BKSC 3MLPA 2CDEA 4JAMB 2YFOA 5IB2B 3QISA 4XRCA 2FQGA 1QTSA 3E8UL 2AQRA 2HT3D 1TCRB 1BBJA 3LEYH 1A1MB 4XWOC 2ID5A 2DDQH 2H2SD 2JH2A 5AW2B 5LBSA 7PAZA 4HEPG 1A3ZA 5J9PB 5DEGB 1SMAA 3VD9A 5A2CA 7FABL 6PCYA 5FYLH 5HGHA 1MHPH 4I1RA 2DJUA 3MRFA 5IBUB 5LCVH 1IAOB 1EAOA 1UEMA 1CF8H 4Z0XA 4NN7B 2Q86B 3BKYH 4FQHB 4JFQA 5IFAH 4F37K 4OZIA 4MAUH 1LO2L 4I13B 4LBEB 1RJZA 2F7QA 1F90H 2GJRA 3CSGA 5D96B 3VFNB 1NBZB 3VW3L 3FU5A 4YNYB 4ZTOH 3CWGA 3QI9A 4MAYC 3UG4A 4U1IB 1DVXA 3APNA 5FF6B 3L3GA 2NT1A 1S9WB 2ITCB 2AXFA 4C47A 4JEGB 4M9PA 1GAFL 3CBJB 2R59A 3RJDA 2VDLL 3HW7A 3B7UX 1KB5B 2R4SH 4M8VA 5B3JF 2WINA 3ILQC 3JXAA 5DJYB 5LG1A 3P1VA 1KTDA 4C83B 4D9QD 4N2OA 4WTQA 2B15A 1S4IA 2QDWA 5D7JB 2DICA 3VXOB 3MJWA 4EUPB 3QCUL 4BSJA 1LO5A 4EIZC 2R1WA 4XHJD 3ZT7A 2GAZB 1OWRM 1GPOH 4FQXB 2ZX7A 4ZZKA 3TT1L 4JFDB 3NQKA 3A6BL 1MCRA 4NX0A 3ARED 4TOYH 4KXBA 4A2EA 5IBTL 2WXFA 2NW2A 4WNSA 1M6OB 2WSKA 3MBXH 4MCMA 5IMOA 2ADYA 4M5SA 3ZUNC 3S35X 4WGWB 5JZ7C 1MXGA 3TYGH 4G6FB 1J8RA 1R5VA 1V54B 4E5XB 2PO6D 2X4UA 3OAYK 3K6SB 2VDMH 4AH2A 1MEXL 1YMMD 3EW3B 5DQDH 1EGJL 2HLFC 4L3CA 1URLA 1LHZA 5K9JH 3AW5A 5HDQH 1I7RB 4ELMF 3QCTH 2BINA 1RZQA 3OB0H 3HIZA 4PRBB 3T3MF 1VJSA 4KJPD 1JV2A 2RH0A 3BLPX 2MPAL 1RD6A 2B1HL 3CHOA 4URKA 4F3FB 3QDMD 4PRHA 2A9AA 3ERXA 1ID5I 2VITA 5EU4A 1I3RB 2J21A 1X5GA 2VDKB 4TVUA 3U48A 1JGEA 5AAPA 4LSSL 4ELMB 3T3MB 2APWA 3B37A 3ESOA 5HYJE 4PRPB 4R7DA 3K72A 4HJJH 1XL6A 1E90A 4WI4A 2IQAB 2M2DA 2B9AA 4L5FH 4RH4A 4C56B 4YAQB 2WQWA 4AVHA 4KROD 3VD0A 5I8EA 1GGBL 3BCFA 1ZK5A 1ACZA 4AKPA 4POZD 2OZ4H 3D34A 4YWGL 2HKFL 2VDOL 2BJMH 5IIEB 4P4KA 2R1XB 3F3HA 3QQ3B 4PBWD 3O6FC 3KPTA 4JFXB 2DBJA 4LCWE 4KHXL 4KMQA 1QNIA 3W37A 4AUUA 1UFUA 4AQ1A 4HFUH 4HSCX 5ISZD 1ND0A 3VXRB 1CLYH 2O5NA 4FYTA 4PV9A 1LEIB 5IJVB 4QHUA 5KVGE 4NGHL 5DWPA 1QFWH 3BAEL 2CDFA 3QUXD 3PXJA 5IQNA 1BZ9B 3UTTE 5LWYL 3MZGB 3H4FA 3DDFA 1AC0A 2K6WA 3T77A 2IDCA 3F64A 5ESVA 3AUVA 5AW1B 4ISVA 2VDPB 1IC4L 3ULUC 1DQQB 2XN2A 5ITFA 3CZFB 1NCCH 1QG3A 5DLLA 3F00A 1BPLB 1QBAA 1WWBX 4ORZC 3ZMEA 5KAQG 3DPBB 5LGHL 4RMQA 3ULUH 4Z1PA 1LILA 3ML9A 1GS6X 3AY4A 4F91B 1CCZA 2R29H 1DLFH 1MG2C 3ZYZA 1EO5A 1A7NL 1NFDF 2V5RA 1D3CA 1PLGH 1WCBA 3T0EE 1UUNA 1ED3A 3MYZA 2ZUYA 3C6SA 4NQSA 3ARGC 1JNNL 3L9BA 2QQLL 1K8DA 2NY1D 5CP3A 3D33A 2Q3AA 1SUHA 2XX1A 4K3DH 1Q94B 4I7ZC 1IGCH 5B1JC 4DO5A 1ZJBA 2AQSA 2MOGA 4L4TA 3SE3A 1NFDB 3H9YA 4PJ7F 4LMQI 1MFEH 1DANU 5I28A 3S97C 3IDXH 1T80A 4WWKA 3RU8H 2Q8AL 4YJZL 1UXWB 3AS0A 3HUJE 2CKBA 4X7TA 1W72L 3PGCA 1PQZB 4JKPH 1T1ZB 4BFFA 3K71A 4W4OA 1NBVL 2NXYB 2V9QA 5L0QC 1X7QA 4UBDC 1K4CB 1KXTB 3L7FB 4KTGA 1I8KA 2Z7WA 4GAGL 1V3KA 1VGKB 2NSQA 4G8IA 5AG9A 1A7PH 3EH4B 4PJ7B 1IL1B 5C0GA 3FB5B 5F1IB 3PWLA 4UTBL 2AKRB 1AGBA 2Y7QA 2Y24A 3FN0H 5T1LB 4DTGL 1G9EA 4NFDA 4W6YB 5FUCE 3BT0A 3D12B 3M6DA 3RHWK 1T0OA 3U0TB 2WWMD 3EUDA 2ZF9A 3CDCA 5GJTH 3TVMC 3GMNB 3QSKB 2IH3A 2VMDA 3RPIA 3CXDL 4F7KA 1KIUB 4JFEB 4PTTB 3IDMA 1AS8A 3TURA 2XWTA 4XN7A 5DQJA 1XGZA 4N6RA 4AW7A 1YNTF 3JVGC 5H37H 2DLFL 3ZOAA 5ID1A 4Z23A 4AVIA 4E2OA 3U6XA 1B4RA 3QYNA 4F1SA 1E4WH 3W81A 2PWGA 4O5LH 3GSOA 2F08A 5ITBH 3HBQA 4OM1L 3G5ZB 4KPHL 5AD0A 1YNTB 4PBXA 2Y6SD 1X3DA 4UNIA 5DD6B 3ATEA 5ICZA 4Y1AE 5JXAH 2XWBB 3NRPA 3U9UA 4EI6A 2ESVA 2BVYA 2IVFC 3HE6A 5AYUH 2L7UA 1E27B 3MV9D 3HE7C 3MLWH 1GA2A 1OT2A 5F9AC 1D6VL 3MRMA 4DP4X 3VWJB 1JTOA 5CN3A 4QEGA 1OCOB 1EFQA 2CSPA 2VXQL 3V4VL 1TLMA 3SGDI 1M1XA 5TF1L 4ZS6C 5HPMB 1CT8B 1P4IL 5IJDC 2BVOB 1HHGB 1FGNL 1MSPA 2ZCHL 3N9GL 2JKIS 4ZYKA 1I9JH 3MV7B 3Q6GL 2HX8A 3T65B 3MNWA 1RJLA 4ZZFA 4P2OC 1PG7L 3SB3A 4PJ9B 1OCCB 3EOAB 3QORD 4AENB 3LRHA 2Y25A 4WV1A 3LS4H 3KPRD 1BXUA 1R6VA 1V7ML 1YPZA 1JNJA 3IDGB 4P5TB 2BWDA 2WXLA 5D1QB 1RY7B 5E9AA 5C0IB 2R4RL 5JPNB 3G08B 3ASOB 5I9QC 2X09A 4XZ4A 2VYRE 2J5LC 3V6BR 2B5IB 3WE6A 3IT8D 4ONGH 4W9IC 5DK0B 1K4DA 2AEOA 4DKAA 2EE9A 4L2LA 5I74C 4I3GA 3CVHL 3HZYA 5TJWK 4IOIB 1LWJA 2EDKA 1JGUL 4QRTA 3EDKA 1WGVA 1OWWA 3UZQB 3D6GA 4X9FA 2DRUA 3ZL4H 2LU7A 1XX9C 1MLCB 1OPOA 4NQED 2GIXA 4KKBC 4X4XB 3W11D 2V6HA 4MKTA 2X70B 2VW4A 3CFJB 2IPUK 3VMNA 3VDAA 3ULVE 4PJXE 1QKZL 1KT2A 3ABMB 3PGDB 2VE6A 3SE8H 1MCOH 3MSPA 1RPQA 1BMWA 2AI0H 4LCCB 4U49A 3O3BA 3SDXE 2WQSA 3APMA 1CB4A 1BXAA 3QXDA 3KYNA 4ODHL 4PGZA 4E0RA 1QFWI 1AZCA 3PNWB 3R4RA 5EOCL 2LHAA 3HPLA 3SBWC 3GZOA 2JJSC 4BZ2L 1E4XH 4XP1L 4NI3A 1BEYL 1FE8H 5E1QA 1KYUA 2X4PA 1OD9A 1J8SA 1UKSA 3KVPA 5EU3A 3C8KB 3FO1B 1QO3B 3JWDC 1HC1A 3FRUB 4O02B 1LO4H 4NENA 1NAMH 3SKJH 4ZS7L 4CW1B 1OSYA 3M45A 4MDIB 2OQJA 5FFOA 4NNPL 5E24E 3E6HA 3IJYB 5DJAB 3QDGA 2X44D 3EOTH 3QUMH 1DVTA 1PAMA 1J8HE 1A64A 2Y1VA 3V0IA 5LNEA 3ZJAA 5ANMB 5FW7A 3A6CL 4KBPA 2P43B 1D7CA 1HI6B 2KT6A 3MUGB 5I5MA 4UT9L 3S3CB 5EZLB 4QHNB 4ODTH 1WEJH 4NRZA 3OPZH 3RWFB 4JFFE 4FQ1H 3B1UA 5JNYB 2Y5EA 1F2QA 1IO4C 3M7FB 1RHFA 3BLBA 1E9QB 4Z78B 3CX2A 5IT2L 1CZ8L 4MRBA 4Y9CA 4RCAA 1G6RB 3L3KB 1W91A 3WN5C 2W0FA 5BO1L 1CUOA 2BNRD 4QHMA 4H1LH 4KK5C 4OCYH 1DFXA 4MNGB 1QEWB 4WUUA 2LABA 5C0CE 4AZ8B 5A2IH 5FGCE 1GYWA 2HFFA 4KX8A 5F8RC 5AZ2H 3ULSA 6CGTA 4WCYH 3US9A 4JMXA 1Q72H 1BX2A 4LEXL 4YDLC 1AZUA 3QNXB 2OX5A 1MJ8L 2AAVA 3GSWB 3SKMB 3CC1A 4JREC 2H3NB 2OTUA 2UZIH 2ZWSA 4I89A 3I85A 5E4OA 4K73A 4OLXL 4BXVA 4RGOH 3IGUA 2Q76B 2A6JA 4PJ5D 1M05B 3A22A 1XEUA 4PPTA 2O6EA 4X80L 3VG0H 1FL5A 4FG0A 4NZDA 1O0VA 1UT2A 1NLDL 1SJHA 4XMPH 3G6JA 5INCB 1BD2D 1M7DA 2DWDB 5MEPB 3ZVVA 1TZIA 2PTTB 2B77A 3WS6C 3LKOA 4L9LC 3O3UN 4FFZH 2PCXA 1AO7B 4XI5D 1AXSB 1MWAA 3MUUA 2GHWB 4ZNEE 3QIBA 4HLZG 1KTLB 3D0LB 3K5SA 3G5XA 3GMOB 5F1NA 2IGTA 4IDLA 4LU5L 4NP9A 4DGYH 1LMIA 3L3OC 3FTGB 4C58B 2QHLA 3A47A 5HJGA 4ERSH 3DIVA 4QJ4B 5F88B 3BZEA 5J6GA 1I1CA 5SX4H 2G60H 3RZCA 1NLBL 1RIUH 2JJVA 3L54A 4JK0D 4NCDA 1R3KB 12E8L 1JZJA 3U4BH 3VRIA 5KYWA 3DUSB 4EXPX 1BQHA 4KTYA 5G4NA 3WOVA 2J71A 1HZHL 3HAEB 1JGDA 1L6PA 1XAKA 4NSKB 5D70H 3BGFB 4NKOB 4Y2OB 5TFSH 3W9EB 2X4RA 2FJFB 1XZ0A 5E4EB 2QSCL 4OGXL 1MNUL 3RWDB 5KSVB 5BRPA 1JWUA 2F19H 4JPKL 5C97A 4IKNA 4BE5A 2HPOA 1J12A 3RAJH 3WS3A 4YBQC 3DX7B 3QDJD 5JIMA 4H8WL 4G6KH 3SQBB 1JDDA 4GKSA 5J1AA 3V55A 2WV3A 1MOEA 2CO6B 3BKCH 2JJTA 4NQCE 1AQMA 4FQQA 1G1YA 1UXMA 2QADB 3F12A 3RDTD 2DKUA 3QZMA 4D94A 2EUWA 3EGXA 2R9HD 2PW1A 4HJGA 1P1VA 3T1FA 3FOMB 3SGEH 1JPTH 3V4PH 1RK7A 2F53A 4FQ2H 4BFNA 1I3GH 1HT6A 1UA7A 1HEZB 3ZRFC 1LGVA 4FJZA 3E38A 3W39B 3VI4E 5IQOA 4Y4KB 2ARJA 3M1BA 1P5VA 3QPXL 4Y7OC 2ZUSA 3KLKA 4Y0GA 4ETYA 1C5CL 4KO5A 3TCXA 3ZE0E 3LZQA 4ZAKA 1FZKB 1YUHA 5FYKH 2NX5D 5AKSA 1FAKT 4P5KB 1SVCP 1NAKL 4X9IA 4GEIA 3ALPA 3REWA 1M9SA 1CFVH 1XAUA 2L8AA 3M17B 2XQYA 5B38A 2CK0H 2X4TB 4KTDL 4IMLA 4WFHD 3VVVA 2Z34A 3QZWB 4G8AC 3OM3B 4LLAA 4O9HL 4AVKA 4DKDC 3D0VB 3C5SB 2X6UA 4PWJA 1QHQA 4AOFA 3V7MA 5E5LA 4OR1A 1B9KA 1OGSA 2GTWB 4TL4A 1F00I 1ZKAA 2R2HA 4YHPA 1N19A 5GGTL 1E4XI 4HS3A 5F7DB 3LEXA 5IV2B 3C09C 4OCNC 4LIQH 3UP6A 3I2CH 4M29A 4YHYB 5LBSH 1BA9A 1TFHA 3O4LA 5CWSB 3QWRD 3GDCA 5D7EA 1O9VA 3LD8B 4N2NA 2BXZA 3QEGL 3BXNA 2NNFA 2VDQB 3CVBA 1GC1L 2JCCE 3QZLA 1YQ2A 5D4IA 4N86A 5AWNH 2GUOB 3QI9C 5HDOA 4PREB 2VIRB 5DHYA 5CILL 2V3EA 2YXVA 2ZJSL 3X11A 3K6IA 5EU6B 1HHIA 2J6EA 4YQXL 4IIQB 5CD5D 2VLRA 3CVDA 1RHHA 3NIDE 3VXSE 4JZOB 2V37A 3MA7B 3P9MB 2BVTA 4FG6D 3P3RA 4JQIA 2QPEB 4H25A 1EDHA 2MQ3A 2FLBT 1Z9SB 1MLBB 3MPCA 4K8RL 4PRNB 4RA3A 2AJYL 5HHVH 1WWCA 2QMJA 1E8YA 3MJ7A 1KV3A 3IJ7A 3L5JA 4LSTH 3KYKH 3MUJA 2CGRH 4PV1C 4HUCA 4AQEA 1MHHA 3LMJH 5E7FA 1MFBH 4M1CC 5DUMH 3HC4L 1T0NA 1E6OL 4F15C 3HI6H 2VLLB 4GP4B 2Y0SA 1A7QL 4YUEL 2AK4A 3RPKA 4KKLD 5F6IC 4JY5L 3EYVA 1YSOA 3KGUA 1MRDL 4ONFL 5I19L 1F13A 4F33A 3D3VE 3P9LB 2WHVA 4J8QA 1IQDA 1KNOB 4ODUB 3PY9A 1KPRB 5JO5A 4YSPA 3CU1A 5I1JH 1JFQH 1IILE 1N6QH 4OZFG 2VLJE 4PWIA 3F7PC 5I15L 1HOEA 3O2DL 5HDBF 4F5CE 2BSED 2W9DH 3B9KD 2HFEA 3SJVB 3FU3A 3EXJA 1QUNA 1FNFA 3GBDA 4YHLH 2EDXA 1LO0L 4PR5B 2LV4A 5B1KA 1XIWD 4GUCA 3ZMNA 1F3JB 2ED7A 2H1LM 5HDBB 4RDQG 4YXHH 3KJ6L 1XGUB 4X7CC 4LOFA 1I4FB 4WGVB 2X9YA 4Y16B 1SJEB 1EAQA 4B41A 4DPBX 1N5YH 3NMEA 4EKJA 1RURL 4PJIE 1AGDB 2EDHA 3BZFB 4RMTA 5HI3C 4BWWA 4H7VA 5GGRY 4UTCA 2XN9B 4UIKH 1XDTT 3FQUA 2CGYA 4KRLB 1A25A 3WNOA 5SX4I 5ALBL 4P48A 5EF3A 5TE6H 1TENA 4WEEA 3ARBB 3GSUA 3N1FC 4ELKA 4FQCH 4ODWB 5AAMA 1RPUA 5FX3A 4ZOCA 1EJ8A 3TJHC 4I8DA 3VCLB 1EGJA 5JHMA 4KH2A 1DUZB 3GSVB 2CR0A 2FECL 3MDJA 4J28A 4P4KC 5CEXB 5TGBA 3QULB 3DX8B 3L3IB 4HV8B 2OJ1A 4AQ1C 5BV7C 1IBGH 1H3UA 2BDNH 3QQ4A 4GI8A 2UVEA 3B1TA 1MZYA 1T22B 4V2BA 4XGZA 4YC2B 5BV7H 4ONHB 3JV6A 1JWMB 3IN2A 5DJXB 3FZUD 4MB5A 2I85A 3A3YB 3M8OH 1I9IH 5IW1B 2FNWA 4I0CC 2V8LA 4X6BB 1KMGA 4OIBA 3LKNB 1OM3H 2D7QA 3UROR 2BP8A 3LRMA 1ZPUA 3NJLA 3AREA 1E2VA 4OAWB 5D7IA 3V0FA 2BY1A 1FZMA 2WCGA 1JZ5A 5EF2A 2A9NH 3CPLB 5DT1L 2LLLA 5E2WL 1N7ML 3HNSH 3L1FA 3O3AB 3NIGE 3SGEI 3WEAA 4HZ1A 2ATPA 1JZ2A 5JHLA 1RAMA 1IFGA 5E6SB 3AY4C 1GTFA 1GS8A 1WZAA 3BH9A 2F54D 2PO6A 4QHLA 3NZHH 1DVFD 2XTSA 2ARWA 3IPFA 4HK0B 1I8MB 2R56H 2NXZB 5JHDB 1YMMA 4ZMPA 1BFSA 3VXMB 2WCSA 5TF0A 1BVZA 2MPVA 3HFFA 3KM1A 5I75B 4HXAL 4L3EB 3WMSA 3EJZC 3F7VB 5TE4L 3OPUA 4TF4A 2PNDA 4M6ML 5HHNB 2NUTA 3ZDZF 5CP3H 2FIRT 2WNKA 3TH2T 5IFHH 1KEMH 1BZOA 2JQZA 3KPSE 4QYAA 3O41A 1V7NL 3WKML 2OP4L 2VR9A 3SE3C 1R3IH 3SQOL 4HPYH 4J2QA 1SM3H 1A3RL 3AU1A 3GINA 3IKKA 3V0WH 2YPVL 3HKZA 3HG4A 3QDMA 5HBBA 3MCG1 3EDEA 4W4OC 2MCPL 3VFOB 4LP4A 2CKBH 3ZDZB 3QP3A 3KJ4C 2IADA 1M7IA 3IK2A 2OTPA 1MHCA 3NIFE 4R0LB 2Z35A 4KTEL 1WC7A 1GSKA 4ELME 2BVUA 4QXGH 4U1KB 1N2RB 2P1YA 4IK7A 4PRPE 5SWQB 3N3EA 2OSXA 4HMDA 2EKSB 2YAMA 1F4YL 1RMFH 3QG7L 1S5HA 3UZVB 2GPZA 4WUKL 2VZVA 2MOQA 5AW6B 3JWNG 4LSDA 5F9OL 5AW0B 3RLSA 4M7JL 5F8QC 3SE9H 4C56E 1JRHL 3BSGA 3R06A 2HWZL 1SDDB 3GF8A 3GKWH 4J6RL 4N1HB 3SE6A 2R8SL 5ISZA 1QOKA 1FAIH 3HJ0A 1LNUB 3OX8A 1IFHL 3VNYA 2G3MA 5L8LB 1S2EA 2AJUH 1H6UA 1U8PA 1W72A 3GMRB 1QYGL 5H4YA 1NGXA 3CFTA 3EADA 4WU5A 4F7PA 1CYWA 3VXRE 5FA3A 2UUDK 3FH7A 4S0TD 3FFCD 1A6VL 1BM3H 4X98A 4J8RA 2K4AA 4I0PB 3TH4T 4AYFA 2I26N 2UXGA 4UTBA 3EYSL 3X13B 3ZRCC 1G7PB 3N1QC 2HN7A 1FCCA 2XZCH 4GRMB 5EV7A 1KG0A 3HB3C 1D7FA 1X5YA 4X4MA 3Q2WA 4FKEA 5GJSL 4JGNA 5KUKA 4WJG3 2AJZB 5L6YH 4ZXBD 1MCFA 3IAQA 3T08A 1UXLA 4E68A 4GG8B 2JTDA 4BQ6A 4PSPA 5KBNC 3ZZLA 5M94B 3S4SG 5CZVH 2R2EB 1S7UA 2OW7A 1HL8A 3DNKA 2CD0A 2EDEA 2J20A 2Y3NA 5EBLA 1OXYA 1T89A 3VWKB 3B3IA 4D8OA 1R3HA 5GPRA 2EDYA 5I0ZA 4MMYB 2NRDA 5TQ2H 4GAJL 1ZXKA 5BJTB 1RFDH 3QWOB 2V2WB 4BA8A 2Q6WA 4NPKA 5FR3A 3WLWC 4UU9A 1N6VA 3GHEL 4BXSV 3QZBA 1ZHBA 4WV1C 4FX5A 2NUPA 2Q10A 3AVEA 2N0MA 2ATKA 2Z0BA 1O6SB 2A73B 1NGQH 3WXWL 2HMIC 1BBDH 1NFDE 4L37B 2HTKD 2BIMA 4XNYL 1Y6KR 1TJHL 3N6YA 2Z64C 5IVXE 4ATTA 2E5EA 2J2ZA 1Q0XL 5D2NA 3ALXA 3O0RH 5BRZE 1A4JA 4BRVA 3GIVB 1ADQL 2JTYA 4UQ3A 3S3PA 3BAWA 4IRSB 4TS6A 1RUAH 2X6MA 1XF5A 2V7HA 3UH8A 3U0PA 1FNAA 4PW3A 2VXQA 5IM7B 2VN4A 3UTTD 2K4WA 3ZSTA 5FHAL 2H7WA 3FQWA 4XNBA 2W65A 4FABL 1H0DB 3BRGC 1JWSA 5JW4Q 1K6QH 4KXZH 2FR4B 1N12A 5T1KB 2NOYA 1IGMH 1XF4A 3MRLA 4NXKA 1EBAA 2BHZA 4LRNH 4KMTH 4A7TA 5GQBA 3HTLX 3S98A 4JFEE 3O0LA 5DRXA 5B22A 2CR3A 3P0VL 5EEUA 4YFEA 4GAYA 2XIDA 4QRPE 4NP4H 4G9FD 1F41A 1MRFL 3C6LD 4LARH 1JD7A 2E9BA 5HI5C 4G42B 2N4IA 4JFYA 1XH1A 3HC3H 4G5ZL 4OFQA 5DJZA 4JRXD 3ZKSD 1FNGB 1F11A 4BSWB 3L9YA 4J3OC 1U8QA 4PY8I 2K3TA 2J4WL 2DQHL 1IEHA 1JNLH 2J72A 4FP8L 1YEDA 3KCPA 5HGAB 4ZFZA 3CVHA 3DGGA 4QKXB 3AT9A 5E2UL 3IBOA 4PCYA 1CGUA 3WIHL 2QEJA 5GRVK 2LLNA 3MV9A 1DQIA 3SYCA 2X1WL 1D5BB 3PHQA 4HAGA 3O4OB 4HS6A 3S9DB 2CBPA 2JV6A 4M43L 1H3PH 2CO4A 4H88L 4MA1B 4WI0A 1KYFA 4GEJA 4OCMC 1B0GA 3TU6A 5KSBF 1P84J 1HOCB 1SQMA 4KNQA 2IEPA 1Q9WB 4QOKB 3L8QA 3NEEA 1U42A 4FOMA 1A4KA 1PW3A 4WSGA 3TYFA 1H19A 1JPFB 2HRHA 1OP3H 3SPVA 3K0YA 4X9HA 4NO3B 3CN4A 4BZ2A 3WENA 3F58L 3QORA 5KSBB 1G7IB 1ZANL 2TRHA 3JZYA 1H3WM 3KPRA 3GTTA 5EORL 1N0LB 3K4AA 4MNQD 2WOYA 2PXYD 1CFNB 3NJXA 2EDJA 5B4MC 1AJ7H 3HCVA 3MRCA 1MJ7H 2YBRA 2WP3O 3H9ZA 3W56A 1WFNA 2C7FA 3RX5A 3RDJA 3LXCA 2Z92B 2V33A 2AQ3A 5EUOF 2PKDA 3BFOA 4JO1H 4P3WA 2PP7A 3QJXA 1C08B 4Y5VA 4FXGA 3VDBA 4AGMA 3B8SA 2JB5H 4XBPA 2BNQB 2MNJB 3V52H 5I6OA 3IWVA 3W2DH 4UT9A 1FL6A 3EO9L 5KS9A 4NQEA 4E41B 2KQMA 1NWPA 4U2ZA 1T20B 3S6CA 4TQ8A 3UBXG 1NIBA 1JK9B 1MCKA 1RZKH 5EUOB 5KVMC 4UQAA 4PD4J 4Y19B 5EHFA 2H0FA 1KCVL 4TNVF 1CFQB 5DA4A 4GQRA 5CJBA 2F1AA 1P69B 1SJMA 5CD3A 3QIBC 2FNBA 3BP4B 2OW6A 4PGCB 1S9YA 4OF3A 3SGJC 1MWAH 1UG9A 2XPGB 4N2GA 3ILPB 5KVFH 4Y5XB 1JNHA 1HJCA 2DYSB 4P9ML 4NIYE 4M48L 5EZIL 2DS4A 2WVUA 4M5YL 4Q58C 3CDGA 5L4MA 3AGWA 1QSEB 1FPTH 2NW3B 2KZBA 1KLFB 5T3XD 3RZCC 4NQXB 4EUPG 5F0MB 3X3GH 5GIRB 1IKOP 4HULB 4YLCA 2H2PD 5C07D 4GMTL 3CCHA 3MRHB 3UYPB 4KO6A 2EIEA 3EJCA 4PLKD 3PQYE 1TO5A 4LL9A 2ZICA 1HAWA 1CE6A 5IHZA 1J7VR 1F86A 2EYRA 4TNEA 2F74A 5KSAB 4JG9A 3LDBC 2DLTA 2VJXA 4L9DA 1F8TL 4YXLH 5FYJU 2OYKA 4OSUH 5DO2D 1OAZH 1HINL 4AQAA 4S2SA 3C5JB 2UZXB 1KBKA 2FD6H 1XGQB 3GS7A 3IJHA 4HUNB 3MAWA 2ZWZA 3MMEB 1AQDA 5T5FL 2V8MA 3FKUS 4RAVB 2DMKA 1X7TA 1FFOB 2OL3H 2A6IB 4K9EC 3V0JA 4K55A 1B2WH 1UB6B 2YQGA 4OCSH 2BNRA 1RL1A 2JJTC 4OIAA 5DZPA 4K9EH 4XNAA 4FRWA 3ULVH 1ONQB 1YN7B 1AIFA 2N56A 4NHUA 4MFHA 4WFFD 4BFIB 2IBZX 5GSVA 3C5ZB 2EVFA 3WHE0 3AAZB 1KTBA 2PCFB 4DN3H 2XETA 4DP0X 3UTQB 3LQAC 1FN4B 3NGBC 3FCBA 1I1RA 4JG1L 4M5ZL 1HQRA 3BSZL 1SHMA 3LQAH 1AVAA 1MFAL 2Z65C 5T3XL 1I7UB 5A16B 2LQRA 2HRPL 4U6HA 1EH9A 1QBBA 4PJ5A 1ZLSH 4AL8C 5KYNA 4K2UL 1RUPL 1YNLH 4IKJA 4ZFOB 2GYSA 3DOHA 3MRNA 4ZAKC 4MXWH 1B9ZA 1IBFA 3K80A 3Q7JA 2G5UA 2C9PA 5B39G 4KXZI 3E9UA 4NN5B 1N59A 3TWCH 2P5EB 3RUGF 3HKFA 1KLGB 4G8GD 1JTPA 1QR4A 4HU8A 1J1PL 4OJFH 4YE4H 4CU8A 5BQ7B 3WN6A 1Z9NA 1BAWA 3TBYA 3CFDA 2WLMA 2CJTA 1UM6L 2BCKB 1KJMB 1WA2X 3F7LA 4MQXC 3TXAA 1Z5LB 4NO0D 2WVVB 4PUBL 3WNPA 2HKHH 1E3ZA 2DL9A 2M83A 3VGAC 2BVPB 3UP1A 3RUGB 1U3HB 4MBOA 3CFEA 1AHKA 1CFSA 4M03A 5D2LF 2J1XA 3F85A 1NBCA 4OH2A 1QLEL 4ZTPH 1U8IB 4LSUL 4C59B 5FEBA 4U1HB 2ZNWA 1E50A 1TJGH 1UOLA 5CLXA 1MH5A 1L5GB 4JDZA 1JK8A 5DVPA 4R4FL 4QTHB 3JQOB 3IJ8A 3N0AA 5IOKA 1T4KB 2E9IA 1UWEH 2PF6A 5D2LB 1NIAA 5ESAA 3GGWA 1MKFA 3PL6B 3KL5A 4M7LL 1QEXA 1GL4B 1UYWH 3MBEB 1CR9L 4M61A 1A6WL 3JUYA 5LNGA 1MIML 4OGAD 5I16B 1GZHA 3ROOB 2G75B 4X6DF 4NLHA 1AS6A 5DMKB 1KJ2B 2G0KA 2WLLB 3UFIA 4I48A 1OGAD 5IB1A 2CLVA 2V5YA 2IH8A 3QDJA 4WW1A 1OSPL 1J11A 4JQIH 5DMIL 2VAAB 5KVDL 2AITA 5DD5L 4GKLA 4D9RE 5K39A 3WNNA 5DEJA 3RDTA 3E8UH 4WJKB 4X6DB 2XHNA 5DUBA 4UOZA 4URTB 4PG2A 1PLBA 3EOBB 4UOW0 7FABH 1NKGA 3E1ZA 4OI7A 2G3XA 3EXLA 3NCMA 4DEUA 4Q9QL 4N0YL 2CIIA 4APXB 1LP9F 4MMXB 4GO6B 4P49A 2WLZA 1LO2H 1IGTB 1XSIA 5H94A 4WO4D 3V0EA 3SO5A 3OKKB 1CWVA 4CVZA 1S3RA 5DRZB 3VW3H 1CYGA 4OLVL 3RY5A 3TIDB 2NX5A 3ZT6A 4PGEA 2IALB 5JTWA 1GAFH 2WYZA 2PYEB 3BN3B 2VDLH 3HG1E 4O2EA 5D7KE 1LP9B 3QWNA 2YZ1A 4XH2B 3CFUA 1S7XA 5DD0L 1IC1A 1S9XA 3VI3E 1S46A 1WSST 2WD0A 4Z7QF 2ENYA 1IZJA 4AC4A 4JUSA 3QCUH 2VN3A 3N44F 3D87B 1YEGL 4KQ3L 2C8NA 3BEVA 5C08B 5HVWA 3TT1H 2HT3C 5DGRA 3A6BH 2XZQL 1IBHA 5DJ8A 3FK3A 2H2SC 2Q2LA 2BZ7A 3FT9A 2G5BA 1OOWA 5IBTH 5JMRA 2UY6B 4QCIB 4Z7QB 2VDRL 1A14L 3W9DA 4DKEL 1N4XL 4MJIB 4LPXA 4PCTA 4OKVB 3QWRA 3N44B 1U3JA 2ICEB 3P69A 3T6VA 2OLDA 2G4EA 2P48B 4GKNB 2BFVL 1OLLA 4JPIA 5HTSA 5JIHA 5AAMC 2BXYA 4JQVA 2Q8BL 3T0WA 1E3FA 2YGNA 5KJ4A 1WISA 4BCXA 3O2DA 4ES9A 4HFWA 2DWTA 4P23D 3TTSA 5INDA 4G70B 4LFHG 1MEXH 4CVWA 1AHWB 1EGJH 1ZEAL 4FZ8L 4Y89A 3JZ7A 2WTRA 5D5MA 1YC8A 1RJCA 2LFGA 4NQDE 5IGXL 1JV5A 5DUPL 1DR9A 4MJ4A 4EDXA 3RI5K 4ZDHA 2MPAH 2B1HH 3GJFA 4GW5B 4N2KA 3LN9A 4F27A 1FVDB 2AQ1A 4TVPE 5BZXA 4XNMA 4XHJC 1UWGL 4WKZA 2Y2TA 4CKVX 3NFPA 2RHEA 1FDLL 1XH0A 4HCRL 4LSSH 2B08A 5HVGB 1YEKL 2A38A 3P4NA 5LKNA 4PTUB 4XVJL 3AREC 3KGSA 5IFJA 1H8NA 1P4UA 3ZBMA 4WHTB 3MRKA 1LE5B 1GW0A 1P4LB 4UUJA 1FSKB 3KEHA 2KBGA 2V7NB 3DX4A 3KE0A 1TFPA 3BP6B 4PP1D 1YY9C 5HGBA 4GW1B 1GGBH 4Y4FB 5HHOE 2OYLA 2PO6C 2ZT9C 4KNTA 5JHLH 3VA2C 5DRNB 1Z9OA 2D4DA 4YWGH 2HKFH 2VDOH 5AW5B 4FLQA 4MCNA 4NJ9L 3GLEA 4ZD3L 1X5XA 4KHXH 2BSEA 4UDTA 4JVPA 3B9KA 3TLRA 3VFPB 4DGVL 1DQJA 4MJ6A 1K5WA 2BOCB 4D0DB 4KJPC 4PP2B 3BVTA 3NJMA 1VKXA 4NGHH 2YR3A 4KKCD 2KZ1B 1XBDA 4