2P80D

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80D00
1TU2A 1E67A 4F2FA 4A2EA 1AZNA 4E9VA 4DP6X 2JFCA 3GDCA 2VMJA 5B3SB 1ASOA 5B1AB 3QJUB 2VW7A 1JZGA 3CDZA 3FPYA 1JXGA 1JVLA 1AZRA 4F7KA 3ASOB 2IWKA 4G71B 3S3DB 2IDUA 4G72B 3T6XA 1GY2A 2LLNA 1HAUA 2AFNA 2PPDA 2XLLA 3S3CB 1J9SA 2YAHA 3AG3B 2P80A 4BK5C 1PNCA 2CALA 3GYRA 3FYEB 1ID2A 2IDTA 1V54B 3UAAA 4DPAX 3X1FA 3TASA 1NDTA 4KNUA 1CYXA 4W9ZA 2BP8A 1KYAA 4PCYA 1BXVA 3QPKA 2FQEA 1ET5A 2UXGA 1A4AA 4L0PB 3X2QB 4A66A 3NJFA 3WKQA 2HRHA 2XXFA 1J9QA 1OF0A 3FU8A 2E86A 2DWSA 3FSWA 1QNIA 2VSMB 4G7SB 1JZIA 3CVCA 2YAFA 3BQVA 3RYMA 5I26A 2AZAA 3QJQB 3NSDA 3WNIA 3HEIB 5I5MA 2IH9A 4BDVA 3X1NA 1AR1B 1BXUA 1PLCA 5D4IA 1HFUA 4KOBA 3OMIB 2CCWA 1AQ8A 4PAZA 2A3TA 3NJJA 3EF4A 3CG8A 5PCYA 1ILUA 3X1EA 3T6VA 2RACA 3NYKA 3N55A 2J55A 1E5YA 2BZ7A 3AY2A 1GS6X 1NTDA 1AZCA 1PLBA 2PP8A 1WAEA 2R7EB 2YARA 1NWPA 5B7FA 3IN2A 3UACA 4YSEA 3FU9A 4RH4A 1E65A 3IEAA 4WTQA 1NIDA 1GW0A 1TEFA 1ASPA 2VM4A 5I5JA 4E9WA 1A4BA 2W88A 1L9QA 4CSZA 2BW4A 1IUZA 1CC3A 2BWIA 4E9YA 5PAZA 1WS7A 1PF3A 4KOCA 1ZIBA 2EIJB 3PAZA 4X4KA 2PP9A 3AG4B 3D12B 2FQGA 1XB6A 3FQ1A 2OV0A 2BWDA 5F7BA 4YL4A 1L9RA 2H5UA 1IBYA 1L9OA 1OV8A 1J5CA 2HXAA 1BQKA 3DKHA 2IDFA 2DY2A 4BDVB 1M57B 1ZDQA 2FT8A 3WI9A 1NIEA 1V10A 2QPEB 1KCBA 5D4HA 5I6LA 1QLEB 1JZJA 2OJ1A 2MTAA 5E9NA 3EH5B 3ZDWA 1BXAA 2ZONA 1SHXA 2BW5A 2W8CA 4YSAA 2XX1A 1CYWA 3TU6A 1RKRA 3SBPA 1BQRA 3AZUA 3QJRB 3KW7A 5B7MA 4A2HA 4DP0X 4HCGA 1GYCA 1NIBA 1PY0A 2PPAA 1WA2X 5I6OA 2IDQA 4BXVA 3T6ZA 1XMEB 3NP4A 1ASQA 2IWFA 1OCCB 2GI0A 3EHBB 4GP5B 5B1JA 3OQRA 5F7AA 4YSOA 2GB2A 3WKPA 1JXFA 3G5WA 1ZV2A 3CVBA 3UADA 3FSZA 2OCCB 1SFHA 4DP8X 3X1BA 1AS7A 4Q89A 1AOZA 1AZBA 2VSKB 2EINB 3NJKA 4M3HA 1NICA 2Q9OA 3PAVA 4E9RA 1PAZA 5TK4A 4ENZA 2FJSA 4YSSA 2YXWA 4NAJA 4DPBX 1W6LA 3OMNB 3PLYA 4A67A 1AG0A 1MZZA 2TSBA 3L45A 1KGYE 2TSAA 4NERA 3V9EA 4YSCA 3PXLA 3ABLB 5AZUA 5AKRA 2WO2B 1EHKB 2B3IA 3N2JA 2XXGA 1NINA 2FNWA 3MX0B 1AS6A 3NJLA 5I28A 2NRDA 2IWEA 5ANHA 2BP0A 2H3XC 2FWLB 4HCFA 1URIA 3UGEA 2H47C 6PCYA 1PNDA 1CUOA 1AAJA 1XB8A 1PZAA 4JHVA 2CUAA 4P5RA 3U25A 4A68A 3KW8A 2VN3A 4FAAB 5I5IA 2DWTA 1KV7A 1A4CA 2PPEA 2QT6A 5I6PA 4DPCX 2XUWA 2FTAA 4KNSA 2CJ3A 3ZIYA 1MDAA 1SNRA 1ET8A 1UATA 1FFTB 2Q5BA 4AKOA 4UAHA 1M56B 4UF7C 1AACA 1JVOA 2FT6A 2PLTA 2YAMA 3NSFA 3FU7A 3CDZB 1ZPUA 4UANA 5B7EA 3H4FA 1L9TA 1NIAA 4YSQA 8PAZA 3QJSB 2CBPA 4EF3A 2AVFA 3T71A 2CAKA 1BQ5A 2PPFA 3H56A 3AW5A 2YAEA 3PAUA 1SF5A 2I7SA 2GIMA 4G70B 2BP8B 4A2DA 1L9PA 2HX7A 4NB7A 2BP0B 3SBQA 1L9SA 1ILSA 3T6WA 3NSYA 4AZUA 3PPSA 1SHWA 1I53A 3IBOA 4N4YB 1WA0X 3NP3A 3NJNA 1DZ0A 2VW4A 3OM3B 3TA4D 2GC4C 4DP4X 1IKOP 4FA7B 3HB3B 1AZUA 2BHFA 1BAWA 1E30A 4AI7A 3ABGA 3ZBMA 1KBVA 2XX0A 2QDWA 1IC0A 2IAAC 3WNJA 2P80D 3FS9A 2BZCA 2GC7C 4GYBA 3SBRA 2XV3A 4K9JA 3MBWB 1J9RA 2QPDB 3ABKB 2WSDA 3FT0A 4HCIA 3NJGA 2IDSA 1NIFA 3FSVA 7PAZA 1SFDA 4BWTA 1ADWA 1E5ZA 1JERA 4M4RB 3ABMB 4KO6A 2YAPA 1AS8A 3FPXA 3TBBA 4JHUA 1PMYA 2I7OA 1HAWA 1DYZA 1OCZB 4YSRA 1A65A 4DP9X 3DTUB 1OCOB 1ETJA 3ERXA 1FA4A 4DP5X 1BEXA 1RCYA 2XV0A 3IE9A 2UXVA 2YAQA 2J56A 2Y1AA 1N70A 2ZOOA 2HX8A 4A2FA 3JT2A 2VW6A 5I6KA 2QDVA 5B1KA 2PP7A 1JZHA 1TEGA 5I6NA 3ZX1A 3SQRA 1JXDA 1ZDSA 2N0MA 1EZLA 2HRGA 3OD3A 1BYPA 1RZQA 1XB3A 3FSAA 4GP4B 4DP7X 3UAEA 3JTBA 1T5KA 5B1BB 2WO3B 2FQDA 4F2EA 7PCYA 2DYRB 1NPJA 1SDDA 4YSTA 4JKNA 1PCSA 5IY5B 4P5SA 3WG7B 2GSMB 2X88A 4TXVB 5A7EA 2X87A 4AKQA 2JKWA 3EH4B 3V9CA 2GBAA 2JXMA 3UABA 3QJVB 1PZBA 3IN0A 2HLEB 3H4HA 2R7EA 1SJMA 2AANA 3FYIB 1ET7A 1X9UA 2XU9A 4GXFA 2HZHA 1JZFA 3S3BB 5LDUA 1AANA 1NZRA 2XVBA 3TBCA 6PAZA 3EH3B 3PCYA 2EIKB 4ZK8A 2IH8A 4YSDA 2DV6A 2BO0A 4DP1X 2HX9A 2YXVA 3QQXA 4E9QA 4E9TA 4BWUA 2YAOA 2PCFA 4E9SA 4QKTA 2XYBA 1JOIA 9PCYA 2FT7A 1GY1A 3OMAB 4HHGA 3QJTB 1ZIAA 3NJIA 4GY4A 4N8UA 1NPNA 4G7RB 3FQYA 3NJMA 1KCWA 3S8FB 4HALA 4E9XA 5D4JA 2ZXWB 3FQ2A 1CURA 4BXSV 3ASNB 1OE3A 5FC9A 1W6WA 3CZUB 3AG2B 4KNTA 2PPCA 3AG1B 1SDDB 5I6MA 4G7QB 1PLAA 1AG6A 2VM3A 1GSKA 4HZ1A 2MRYA 2UX7A 4AX3A 1MG3C 2J5WA 2B08A 4AKPA 4DP2X 1J5DA 3NT0A 4HHWA 4CSPA 1GS8A 4QLWA 4GP8B 4WKXA 2EIMB 3S8GB 1A3ZA 1PZCA 4KO9A 4W1TA 4YSPA 1VLXA 3X1GA 1V55B 3DIVA 4A2GA 1FWXA 1NWOA 2EILB 2UXFA 1QHQA 2GHZA 2XV2A 3WIAA 3NJHA 4KO5A 3FU7B 1WA1X 1F56A 1M9WA 5EHFA 2XWZA 4BWWA 2DYSB 5TK2A 1BYOA 1GS7A 2FQFA 2YQBA 1OE1A 4KO7A 1WS8A 4MFHA 4YVNA 1B3IA 2I85A 2PCYA 1OOWA 1MZYA 4HAKA 3T9WA 1IBZA 4YSUA 1GR7A 1YLBB 1RZPA 1MG2C 1X9RA 1N68A 2ZWNA 1KDJA 1TKWA 1R1CA 2Y69B 4HIPA 3GXUB 4YVUA 1KDIA 1OE2A 5AFAA 2J57A 1KBWA 4Q8BA 3C75A 1JZEA 1A8ZA 1W8EA 3NSCA 2AZUA 1J9TA 1OCRB 3BVDB 1AIZA 5B1JC 3CVDA 2UX6A 1SF3A 2UXTA
chains in the Genus database with same CATH superfamily
1E67A 1FC2D 4YZWA 4CL7A 3F85A 5KUMA 4NIKB 3GRWL 1QYGH 4JGJA 5B1AB 3MRCB 4FNUA 4DO4A 1YEHH 5IK3A 3U4BH 3QG7H 1C7SA 1X5IA 3OGCA 4HJUA 3MODH 5ESAB 2CUIA 5AVWB 1FGNH 4TMPA 3T2LA 1S78D 1GKOA 3AS3A 1VGKB 4C8XA 4YHKH 5TH2A 1J9SA 4ODVH 4POZD 4ABWA 1GYVA 1UACL 1TQBC 2CALA 3LQAH 4YBHA 4WEEA 4XXDB 5G4MA 4ZD3L 4MMXB 5ERWB 1SDAB 3F3HA 1KLUA 2WKOF 3FQRA 3NESA 4Z76A 3G5ZB 2ARJA 4S10A 2Q10A 4PCYA 4RRPM 4P4KB 2Z7YA 1ET5A 4MA1C 1A4AA 4R90L 4ZW7A 1RZFL 5DVNA 5D70H 4J8RB 1JJUA 2VJ8A 1T5XB 3FTGB 5BMFH 1KNOA 1G7JA 5GRXG 3GIZH 4MDRA 2XXFA 4XP4L 2ADFL 2KZ1B 4TPRH 1LO0H 2W1NA 5LBVA 2W59A 3H2QA 5ICYB 5CILL 2YOAA 3OAWA 1XGZA 3BWAB 4L8DA 2XWJB 4KUZH 5DUBA 2YAFA 3OJDB 5ETUB 1OZUA 2BVUA 4LCCB 2MCAA 5J11B 2D7MA 4P2RB 5C7XH 2VZOA 3Q6FA 2Q87A 2PW1A 4YBQC 5DHVA 5F93C 4BDVA 4EN3C 1BXUA 5D4IA 1JDCA 2AXFA 1XXDC 4PG2A 1MCQA 3DTXB 3WJMA 2AJXH 2Y22A 1NJ9B 5E0FA 2XJLA 4ZRGA 1JWSA 2MQGA 2VJ0A 3G08A 2HWZH 1B0WA 3N42B 1I7RA 4OCRL 2YLHA 3AMKA 2EO1A 3IFOA 2BLFA 1HHJB 5EC1B 4YX2H 1S3KH 2LE9A 2K7QA 1HZKA 4BH7A 3EOTL 3KWUA 4HUXA 4FTVE 1XZ0B 2CDFB 2PO6D 1M6OA 1DSFH 3GI9L 1XEDA 2PWEA 4KQ4H 5D7LE 1E27A 4PLJC 4EBQH 5E00B 1PKOA 3GKWH 3NFNA 5JR1L 1MCHA 4HBCL 4G43A 4Q6IB 5DFTA 2BWIA 1UXMA 4GKNA 4ZNCD 1ZIBA 2IALA 4PJDA 2F1AA 1FFPA 3PQYD 3HZYA 1YEDA 4JDTL 5C2BH 2XQ0A 4NQEA 4FG0A 2H32A 2WZPA 4U1GB 4EKJA 1XGRB 1NOFA 1UM6H 1MJ8H 5I8OL 4PH8A 4KFZC 1NMAH 4P9HH 2CLRB 4GO6B 3MRJA 1RFDL 2XN9B 2WBJB 3HNVH 2OJZH 3MBED 3WEMA 1P4LB 4GRLA 4M9PA 2MTAA 5DI8B 3TIEB 3VFVA 4CVUA 3RIFK 5DLML 4ZPVA 1C9SA 2EC8A 3I75B 3MRMB 5MEPA 4L1TA 4WFHE 4ELKB 1BFTA 3G5YB 4ZPTB 2UUDH 4AEIH 4WI9A 1J0KA 3DX8A 4JFOB 4Z23A 1WWWX 2A73A 3C8KB 3I6GB 2HPOA 5EFIB 1WA2X 4O4YL 3P4OB 4Q9RL 1YPZF 5HYIA 1MFVA 4B97A 4UOZA 1M7UA 3IXTA 3UTSE 2HVBA 1QR1A 3CIAA 4APXA 4OF3A 5KSVB 1RJZB 3DHJA 2IQAB 3MLSH 3RVXC 2AJYH 1RULL 2ZPKH 4M1GH 4Q89A 3O3BB 4FEMA 4ENZA 3PAVA 1PAZA 3N5AA 4BEIA 2YXWA 3DRQA 3O11B 2PCXA 4PRPA 4PS4L 3OHMB 2TSBA 2UUDK 4HGWA 3LMJL 4D0BB 1A9EB 1QVOA 2RH0A 1F3RB 4HGMA 3ABLB 2XN2A 2VN7A 3HNTL 4L4VB 4WHTB 5AKRA 5EG6C 4ZFGH 1OEZW 5AB1A 5TDPB 2F0CA 1U8IB 2YR3A 3DX1A 2A1WH 3D18B 4R4BB 3VWKD 1X3DA 3NVQA 1NCAL 4JK0D 5IM7A 4KRPD 1SJVA 2DKUA 5A2FA 1SYVA 2X4NB 4ECNA 3UGEA 4Z7OF 2NY2C 2AP2A 3MFFB 4PW9A 4LE8A 4XMWA 3N41F 2XWTB 5LGJA 3P3UA 4FKKA 4M56A 3MC0A 5E8EA 3WFBH 5IKCB 2CUAA 4IBSA 4AJYV 4NKMB 4K0OA 4PYHA 3ML9A 1I1FB 2DMGA 2IGLA 5GS2D 3U6RA 3BMWA 4DERA 5FGRA 2CJ3A 3EYQC 1ZSDA 1H6UA 4AEHH 4N0YH 1K3IA 4NXKA 5FO8B 4ABQA 3Q7JA 3KWVA 4FP8L 1MREH 2P26A 3CAFA 4H88L 1A6VH 1OALA 2VN4A 3MGTB 3PUUA 1JCKA 5EZOL 4CJ0A 3PGFH 3RA7L 1J1OH 5FM5O 3N6YA 5BO1H 3CVHH 3KYOA 5B7EA 3KBPA 2Q8BH 4YFLI 1NGYA 1UWXH 4IK7A 5FM4A 5D96B 4YSQA 5JIHA 3JUYA 3MMEA 1J9CT 3CH1A 3PP3K 1B2YA 4YR6B 1UCBL 3LS5L 3VTTA 4PU2A 1QKZH 3MJ7B 3RFRA 1RIVH 4PCTA 3RWCB 1HINH 1T20B 2FECL 4OF8A 1SBSL 3PAUA 3UBGA 5E08H 4JY6A 3UZVA 4LHUA 1DN0A 5CWSA 1X5GA 3AT0A 1KF9B 2BMKB 1VJSA 3UPRB 3BSZA 5F71A 1C08B 2DBLH 4W9JC 4IYKA 4QRQA 1ETZA 1BVKB 3V5HB 4AIZB 1CXIA 4GSXA 3LTVA 3ZDZF 3FQTA 3AAZA 1WCBB 1FDLH 4WFGE 4XH2B 5I1DB 2LAGB 5D1ZD 5CBAA 1RVFH 2F54B 1DQKA 4UOJA 5HTSA 2KLSA 1NCHA 2VERN 2GC4C 2KL6A 3PWPD 1VFAA 4R97C 3V4PH 4BE5A 3TA3C 5H4YA 4D9LH 1CD1A 1MAKA 3L5JA 3HNSL 1BVNP 1S5HB 2VQ4A 1RIHL 3PABB 4Y1AE 3TBYA 4W9IC 1OAXH 3KDMB 2DQJL 2P80D 1DBJL 2EYTB 1KN4L 2A9ML 3UAJA 3IGLA 1IM9A 3MBWB 4NP4H 3HJEA 4G9FD 2WSDA 4KMTH 2A4EA 2EYSB 2FO4A 2ODHA 4L4VE 2VIRA 4PR5B 4BE6A 1HHGB 4XX1E 1CFTA 3U46A 3WFCL 3VD0A 3SDXF 8FABA 4KMQA 5I0XA 1MHPH 3EYUH 2GK0A 2OSWA 5A2IH 1AD9A 2J6EL 1HAWA 4XO9A 4FGMA 4EAEA 2L8AA 3P3RA 5DD0H 4X7TB 2WWMC 3NGBC 1NGQH 5AZ2L 1AGDB 4QTFA 1YEIL 4NBZB 5EZLA 5JHDE 2AK4D 1HE8A 5E2VH 5E4IA 4JPKL 2ZUVA 2QVFB 3CFTA 3I9IA 2OYMA 1CDUA 1HDMB 1KIPB 2B5IB 3KLDA 4L5FL 4ADGA 5KS9A 3MROA 1RZKL 4MWFA 3KBEA 3RI5K 4ONFL 4HOWA 2R0LL 4F92B 3QZNA 5HI5C 1UD5A 4G8EA 3TBTA 3GI8H 5DQ9B 3RKPA 2P24B 4M93B 4JRLA 4YFEA 4NKIL 1EANA 1EIBA 1UJ3B 1Q9LA 4NQQA 4WKZB 1OLLA 1HNYA 3Q8BA 3U30C 5DSCB 4YSTA 4XCFL 5CMAB 3BESR 4LL1A 1WGVA 4D8PA 4FQIL 4ODWB 5HI3C 4GXUN 3CK0H 2M2DA 2NY0B 2XIDA 2GUYA 3ULSA 5L88H 4K7PH 2G9HA 2G4GA 1G4RA 2C9SA 2XPZA 3BSGA 5SWQB 2VR6A 1CFMA 5HXMA 4BKLB 2F54E 1K8IB 3LB6D 4WO4A 5DC9B 5E8DL 5IVZB 1RV6X 1XF2B 5CZRA 2AV7A 2VR5A 3PCYA 4IBTA 4OLWL 4L9DA 4RQQB 3DV4B 4U1NA 3TURA 3MRHB 1VKXA 3QWQB 1RERA 3BZ4A 4H1LH 4JKLA 2LGNA 4LQFH 3U2JA 5FB8A 3SJVB 1WT5A 2JQMA 1E4XL 4AK1A 3OKNB 4GLRH 4X99B 2XYBA 4E2OA 2KI6A 2MOQA 2RQ8A 1SMOA 4MVBC 1SM3L 1JF6A 3OMAB 3VJ6A 4PJHA 1EO5A 1GGCH 1X4ZA 4PJ9C 4R3SB 5GHWH 3B9KB 3EJRA 1RURH 1IKFH 4OD1H 5F3HB 4EEEA 2F53A 4J27A 2E0PA 5AQ0A 3RBGA 1TMQA 3SO5A 1MIEL 4POYA 4GAYB 1U41A 4ZZKA 2DTMH 3UMTA 1JV5B 1BVLA 4G7QB 1PLAA 5AVSB 4BFJA 1WITA 4QJ5B 5I6MA 1GSKA 3GLAA 3MCYA 3GM0A 4MLIA 5I1GL 1U21A 5IHLB 5J1TC 1WFOA 3VGBA 4DP2X 3NT0A 2ESVB 3JV4B 3RU8L 4N8VA 1J8KA 4KJWC 1TO5A 2WY3B 3MLRL 2BOLA 1PZCA 4XE5B 3PP4H 1A2YB 1TPXC 4ZXBC 3KS0H 2Q6WA 3MOAL 4MYWB 3I3BA 3NZSA 4P3DB 1NWOA 2E4FA 4JRXD 3TEXA 1QHQA 2OMWA 1R46A 5EBWA 5HHQB 3B6SB 4XCYA 2V9QA 1IU1A 3BKCL 3FU7B 3RAJL 1B6UA 4RGOL 4LCWD 3GSWB 4ANUA 2AQTA 3K3QA 4JFZL 2Z31D 2H1PH 1IC4H 2XN1A 2N7SA 4U0RC 4UQ2B 5TK2A 3C6LD 1UQSA 5BVPL 2OMTA 3P2BA 2HRPH 4OZFG 4UI2A 3GM8A 3H8NA 1T0MA 2IBBA 4TSAL 3CFQA 3K2MC 5DS8B 1RZPA 3OVUB 2B1AL 2ZWNA 3W2DH 2D3NA 4K2UL 1XTMA 1IILE 2WXQA 4QPEA 3QYNA 4PJBA 5DJCA 3RWJA 2W07A 4NNXB 4TUOB 4XCCL 2OZ4H 4ZMWA 3PWJB 2E56A 1RUQH 4W9FC 2JELL 4BH8B 2VABA 1EJ6A 1ZLDA 4BSWA 2HN7A 4UT9H 1KB5H 3MRDB 3BIBX 4PLNC 4F37F 2AZUA 4MD4A 1V7ML 2WUCH 1F1DA 4XNYL 2YPVH 4B9YA 4KJYA 4EI5A 4XAWH 5ACMA 3QJUB 3VXUB 1FAIL 4P3CL 3FFOA 4DKEH 1UOVA 2O5XH 5EUKA 5DJAA 1NAMA 3KPSB 2VLKD 4QIRA 3V0WH 5ISZA 1BMGA 4K23L 3SPVA 4H20H 4YAQA 4OV6F 3O4LD 2O6DA 2NTSP 1NC2D 2EDKA 5KSAA 2QLVB 2DJ4A 3OXRB 5DT1L 4YXKL 4PB9L 1N4XL 1U8LB 3QT2A 2EE6A 1AKJA 3D25B 4GNKB 3TJPA 5HY9A 1DVZA 4OJFL 4G8AC 1QFHA 4QRPA 4WDIA 3O9WC 5F9JA 1DQQB 2IDTA 5KTEL 1C5CL 1PDKA 4TVSa 1YC8A 3VD2A 5HVHC 5I17A 1I8KA 1K4CA 2J8OA 5I1HL 3TT3L 1S8DB 4ZSOA 3AUVA 1NKGA 3B4NA 3K80A 4HJ1A 4NFBA 3HLAA 1UG9A 4OUUB 3RTQA 2P5EB 2BP3A 4LGSB 4BV1A 2OM5A 4LAQL 2F7PA 5CU5A 4N9OB 3H9SB 4XPTL 3ARUA 3FU8A 4JZJC 2EABA 2YRLA 2VO8A 5DZJA 3G6JB 4JFQB 3T04D 3IMUA 1T1YA 1OWRM 4GMSL 4AL8C 4Y4HA 5CJXC 4LPCA 2YMTA 2LAAA 4RDQF 5SWZB 5CN2A 2FD6H 1FH2A 1P5UB 5G4OA 4NO5B 4M62L 3JVGA 3U2SA 2J4WL 3CPUA 1R3HA 1RZ8B 3X1NA 1OTTC 2EIBA 1R5VA 1MWOA 2AABL 2Y36H 5IW1A 1MRCL 4PAZA 3EDDA 4ODUB 4HKZA 3U4EA 5JUEL 1O0VA 3BE1L 4P46C 4LLYB 3S0PA 1CQKA 5CKGA 1TF4A 4KI5C 2ENJA 1QBBA 5HGAA 3FO2B 2FX7L 3QI9C 1NTDA 2BHZA 2PP8A 1F4YL 1WZMA 5DS1A 3VFTB 5B7FA 2OP4H 3KPQA 1I7ZA 1QSFB 3DX7A 4YSEA 5BS0E 4J3XA 4ODHH 1E42A 3U4BL 3QG7L 1SY6H 1A4BA 1DVFC 4QRRD 3ZYZA 2XOTA 1CFBA 4U1IA 2WNWA 1NL0L 2CRZA 1RUML 3P0GB 2WP3O 3VRIB 1ZT1A 3GUFA 5IROC 4JX0A 1Q94B 5AAWA 4YHKL 5TGBA 4G6JH 4PJAE 1AJ7H 2IGFL 4FC3E 5HP5A 5J56B 1IEAA 2QADB 3KPSE 4XAKE 5K69A 4XN1A 4OT1H 4NC1C 5EUOE 3HBGA 1DDHA 5LBSL 4Y19D 4RMUA 3UAJC 1U0QA 4TVUA 1JF5A 1HZHL 3ZN6A 2PF6A 4BQ6A 4GIOA 1N9PA 2NT0A 2BIIA 2DMBA 2J71A 2DD8H 2KZWA 5D70L 3QIWA 1HSBA 3MJWA 4FFWD 3GIZL 4MCYB 1C16B 3RDTA 3P3TA 4JM2A 3IF1A 3JVFC 5F96H 1GGBL 1CXEA 3ECUA 5DZNA 3GJFB 3HE7B 1SXNA 4U1MB 2NY3D 1JPGA 3OKKB 5IR1A 1H6EA 5DRZB 1FVDA 1MCBA 2NMSA 4V1DD 1PSKH 4PGEA 3P40A 4QXVA 4JFWA 1Z1WA 1MXGA 4IU3B 4MNQB 2P5EE 1H3TA 4QRTB 3OSVA 4JANB 1ESOA 3D0VA 5T3XH 2VYRE 5GGRA 2FWUA 2G3NA 3H9SE 5CIPH 3KPNB 3O2WH 1MNUH 4A6YL 2FECI 1VEMA 1AO7A 5MEND 1JGVH 3KPPB 2YZ1A 2VDQH 5CSZA 1MHEA 2PTTB 3WSQH 2HWZL 4XPBL 5KYUA 2YD0A 4YE0A 1YY9D 3QP3A 2XWBB 2VMCA 5EU6D 2NPLX 4H7VA 4XR8C 4YX2L 3UADA 4LSVH 3MLPA 3KJ6L 3AQXA 3CN4A 4IOIB 3D0AA 3UTQB 25C8H 2XTJD 2VKWA 3ZE1B 3VFSA 1IGIL 3HAEB 4XXWA 4DPBX 2CPCA 3GSOA 4P48A 2XPGB 5C0EB 1E5BA 3N40P 3QQDB 4JVPA 3TFBA 3NN8B 1T1ZB 1WGOA 3I84A 3RGVC 3K81A 4YO0B 2C9RA 2BSRA 1IC7L 2AJVH 3R19A 2BNRD 4NKDA 4Z5RB 3BAXA 1NINA 3ZKMC 3G3LA 3MX0B 3TX4A 2JH2A 1D6EB 3I6SA 5ANHA 1WD8A 4U3HA 2WNXA 3QDGA 1FBIH 2D7TL 3FRPB 3LQZA 2XWEA 3HE6A 2CDEB 3EFOA 1PNDA 2FHBA 5DO8A 3TH4T 2GAZB 3HG5A 2UWEA 5CCKL 3GMMA 4BKTC 2OXGB 1X5LA 5SX5H 3F58H 3HNVL 2OJZL 3SE3C 5GZOA 4NI6A 1HK6A 2BOBA 3QDAA 4YEEA 1WT5C 2ICES 2IFFH 4ORGB 4KJPC 3GGWA 4XC3H 1FFTB 3JBG7 1SUJA 4MA8H 4TLUA 3FFCA 3GXNA 1I4FA 4MS6A 5ANMA 3VRJB 1YZZA 3AVEA 2VMDA 3DX6A 2IPUK 4AEIL 1TETH 2OYPA 3V5KB 1BHGA 3EJUA 4Y8DC 4KK8D 4ETQB 2LU4A 2E6JA 3H9ZA 3CZJA 1OD9A 3ULVE 1L7IH 4NP9A 1OAYL 1YG9A 1FVEA 1S78C 4WHYG 4Y16B 5INDB 4ERSL 3BO8B 3ESNA 5D6DC 5E6ID 5F1IB 2XG5A 3CVHA 1LEKB 5GRVK 3QZMA 2BFVL 4E41D 2NY7H 5IHHA 2JIXB 2AJYL 3Q3GA 3MGOB 1WICA 2DKMA 4L0YA 4MNQE 1UASA 2EDOA 4M1GL 4WCYH 1HN1A 4K3EH 3VXOB 3S5LA 4YNYB 3BQUD 3QH3A 4JO2L 3PWLB 3PPSA 4AC2A 4NDMA 4N6RB 2C1OB 1MFEL 3WE1A 1M1XB 4WNQA 5DJXB 3HAEG 5F97E 2ED7A 5LJYH 1RQ5A 3F7YB 4KAQL 3HB3B 3HKZA 3MYJB 2KC0A 1HNFA 2A1WL 1RZJL 2BHFA 4OZGF 4X5PA 4AW4A 3VD9A 4I18B 3GNMH 5FF6A 3ABGA 3ZBMA 1CL7H 1KBVA 1P6FA 1ULVA 4AJWA 4AV5A 3ZE1E 5I24A 2FE0A 4JW3A 4QAWA 2NY5L 5FWRA 5CEYB 3WTWA 5DUPL 3W81A 3QDMA 1JNHB 3FRPG 5HHNB 3V4PA 3W9EB 4RMRA 2HKHH 3W39A 3OLEA 5HYQB 5IQ9B 1E4XI 3MRRA 1F6AB 2V5RA 3CFEA 4XZUA 2Y23A 3O6MH 1DQDL 4P8QA 2LLLA 3TCLA 3V79C 4OVVA 4BSVA 2WZ5A 4XHQA 1AYRA 2GSGB 4FFYL 4AT6A 4NM4L 1EJFA 2RIKA 5BO1L 4G6KH 2DLFH 4GG8A 5TQ2H 2PO6C 4X6DF 3U7WL 5I19H 5D2LA 4W6XB 1ZE3H 2NX5B 1AIFA 5J7CC 4LP4A 5JHAA 3WJJA 4MDIA 3DSFH 3B1UA 4OGYL 3SCMB 2DL2A 4NKOB 4LOFA 1JNLL 2XVGA 5AAMA 2HFGL 4ONGH 2X6AA 3MV11 4L9LA 5AVUB 4AENA 4BQCA 1INEL 5TE4L 2PXYB 2VLLB 4M6NL 4P57B 3AB0B 5T1MB 3U2IA 4KKZA 3GK8H 2JKLA 3ARBB 3FW6A 3ULUH 1WFMA 4CA4A 1SXSA 5DJ6A 2WLMA 4C83A 4B0MM 4L8CA 3MSPA 4XMKL 2WO3B 1CE6B 1EJOL 5FYJU 2VSCA 5BV7H 3LSOB 4JKNA 4KK6D 1QG3A 3MBEC 4KKLD 3X14A 2MPVA 3IJSA 3CMOL 2X4PA 5FUZL 4PWGA 2A77H 5E23A 4E5XA 1UA6L 4TXVB 4IU2A 3VH8B 3T0EB 3TIDB 4APQA 3FCBA 2VRAA 1S7QA 5HJBA 3FRUA 1JG9A 1QEXA 1UENA 5IMOB 4NT6B 3HFFA 2R1WB 3TN0D 3KJ4C 4M61B 1NBZB 1Z6JT 4Y5XC 4M7LT 4MX7B 3D52A 3JWNE 1DVXA 1ZCRA 2BO0A 3N1MC 1OQXA 3C08L 2GG1A 2E8ZA 4YSDA 3SPCA 2YPLB 2ZKHH 3H2WA 2BK8A 2NNAA 2JB5L 2PCFA 4ZFZB 4ZTOH 1DBML 4WFFD 2JCCB 4HIQA 1XCTA 4EIGB 1GY1A 5DUJA 4FLRA 1NEZB 4JFED 4NGHL 3MNZB 3QULA 1NPNA 4NYLB 5BZDA 1KTRL 4Y2LA 3KL3A 1FP5A 4IEFA 5F6IC 5AUMA 3UIZA 2EXYD 4Q58C 1INDL 1QI3A 1NGQL 4H1LA 4PV9A 5CN3A 4IJ3C 4DQOL 3KPOB 2APBA 4XMVA 3FONA 1AG6A 4NUJB 3SY0B 1N67A 1FORH 1B0GB 4Z0XA 1A6ZB 1J1XH 2J5WA 5K9KA 2PR9A 3VWKC 5M94B 3KL0A 2ENYA 4W81A 4GI9A 2DIEA 2K78A 4YK4B 3D4GA 4KRPC 4J12A 5HHXL 3SDYL 2NR6A 3ISRA 5E4EC 4BGDA 2JWYA 3QB7C 3KD4A 1PZ5A 1UZ6F 1A4JA 3Q13A 4A2GA 4KI5F 4E9LA 4WJ5B 4O02H 1YMHB 2MNJB 4LFHG 4LU5L 2IMNA 3QZPA 4PUBH 3WIAA 4Z77B 2VXTL 1NBQA 4BFGA 5FO7A 4OVUA 3H0TB 3DJTA 4KKQA 2EDQA 3CPLA 3O45A 4CNIB 2VZSA 4ILDA 3VH8G 1PZDA 5D1QE 4H8PA 3QUKB 5JOPE 5CF3A 1DSYA 3BHBA 5BOJA 3H42L 4GXVH 4UT6H 4MJIB 5F6HJ 2PCYA 1G84A 1MZYA 3NG5A 3SO3B 1IBZA 2QTEA 5TQ0L 1MG2C 3MV01 3SYPA 4MNHB 4OD2B 4AZ8B 1KC5H 2CCLA 4F7PA 2C9QA 3EO1A 1EFQA 2X2HA 1R1CA 5JXAL 3F6LA 2NLJA 1MRFL 5F1OB 2ODIA 2X1WL 5DRXA 3CLFH 1ZVSB 4K3DH 2YGVA 4ZS7H 1KDIA 1A3QA 3S5YA 4QTHA 3NPSB 1GGCL 1P7QB 3O41B 4M5ZH 4MMZA 1PY4A 3NDZE 1BZDA 1KCSL 2X41A 5JW3H 1S9YA 3TL5A 2FIKA 4BHUI 5D1ZC 5IOPB 4HSCX 3QDHA 2UX6A 2IBZX 4KROC 4OB5H 2DTML 2OZ4A 2YPLE 3CSYA 3TO4D 2LV4A 2X42A 1W2KT 3OKOA 2JCCE 1NDMB 4PJEA 4ZDHA 4A2EA 5F9OH 4PW3A 1MVYA 2DLGA 3BPLB 4UT9A 2G5BB 1KB5A 3GPEA 4HMEA 5E7BA 4F8LA 3W11D 2MH4A 1E50A 4L2YA 3U6XA 1I8IA 1E7VA 2FGWH 2YPVA 3HMWL 4HF5H 5KS9F 4AYFA 4G71B 4PRHB 4G72B 3FH7A 1V3KA 3BUYB 1R9FA 3BP6A 3K2UH 4JPWL 4LCUA 4HUCA 5DVOA 1EHAA 1Q9OB 1I8AA 2FEEL 3KH4A 4D8OA 3NCJL 1ZLWH 3WTUA 1YPZB 1PNCA 1N59A 3D69B 3ZQXA 2VDOH 1QWUA 3U0PA 2QR0A 4JDEB 4LLDA 4BK5A 5BPPA 1BXVA 5K59F 5HDQL 1AQHA 4N8CH 4WI5A 5I30L 5GZOC 5K1VA 4LEXL 2DEXX 2E86A 3IU3B 1ZTXL 5F0MB 3VYPA 1TCMA 5F1SA 3EJTA 3VD3A 2MCMA 4YDKH 4F8OA 1T4KA 3PDOB 2B59B 1S7WA 4LRNL 4UNVA 3FTSA 4MJIE 2YBGA 3ROOA 5HGBA 1FH5H 2DQDH 1FJ1A 4ZMPA 2GTZA 4FL4B 4WU7B 4XTRD 4M43H 1ILUA 4WI0B 1A7QL 4H0IA 3N41B 1E5UI 4XAWL 5E2TL 2YXMA 4PJHF 1K3ZA 4OCYH 4LLQB 1E5YA 1G87A 3KCWA 3BP4A 4WWKA 2FO1A 1YMMD 1WAEA 1DBBH 3RFZA 2FSDA 3H85A 3R8QA 2VLJA 3FO9A 3CD4A 2WXHA 1DL7H 4H20L 1K6QH 1GW0A 1TJHL 3QUML 4GEJA 5LAXA 4A63A 1LQSR 4PRAA 3LVTA 1P7BA 4DHLA 5IUCA 3MV9D 2V7HB 1DN2A 1R33A 1TJGL 4XCEA 3VFUB 3LB6C 4WK0B 3C9NA 3CZNA 1HCVA 3FKUS 4HLZG 5KZCD 3QUXB 1NCUA 4P4RB 2V2XB 3AY4A 2VDRL 1ZVYA 3FBQA 4RFNB 1A6UH 3DGDA 2WQSA 1UH2A 2DLIA 1AR1D 3ARVA 5DURB 1EEZA 3VCLA 4AM0Q 5L8KB 5FEBA 1SY6A 3QYCA 4M7JL 3ZGIA 1VPOL 1OV8A 3EO0B 1LNUA 3O6FD 4PRHE 1T3FA 4HP5A 1MLCB 2QPEB 3QR1A 4NN7B 4NUPA 2ADJA 3DVFA 2GTWB 1YPZE 3ZDZB 3DO7A 3VGGA 2OL3L 3U36B 2LU7A 1SHXA 1T4WA 2LVEA 2QSCH 4PTUB 3PPEA 1WP6A 4Z7UA 3WHE1 3AZUA 4XN4A 3IGAB 5DYOB 1PS3A 5DD6A 3RIAK 4PRDB 9CGTA 5AVQB 3JTTB 3RWDA 3GSNL 2N1KA 3WJJC 3QUZB 4XMZA 1FIGL 4DVRH 5BOZG 2IEPA 4JRYB 2B4CL 1IL1A 5EOCL 5IB5A 1X7QA 4UYQA 4Q56A 4BZ2H 2XVLA 1G9NC 3L9RA 1DQML 4N2CA 5JORA 1OGPA 4Z7IA 3K46A 3LIUA 3DPBB 1ZOXA 4NKQB 3D87B 3REVB 5A16A 4F3FA 5C0GB 2YPKA 2WQXA 5CIPA 4Y4FD 4GUCA 3T4AB 3QRLA 4PP2A 4M3HA 3SDXB 1BDYA 2YEZB 2X9YA 2Z31C 4K55A 2EDDA 3C6LC 1QLFB 1FL3A 2X7LB 2XI9A 3N0AA 2DM3A 2FB4H 4Y5VA 1QNZL 2H41A 2Z8VC 1MHCB 2DZEA 2NNCA 2ZXAA 4FDWA 3L2MA 3K4AA 5DEFA 4APQC 4JZNA 5I28A 1CD8A 2VDKH 2NRDA 1AC6A 2Z93A 1OPGH 4LSUH 2CGYA 2QZ5A 3ETSA 3L3OC 4OT1L 1LTXA 2QQNH 5GGVL 1XD1A 4K9EL 3VU2A 2GEQA 1JF1A 3P3SA 1CBVH 1AAJA 3F05A 3FTZA 3QEQD 1PL3A 4AMKH 5I66B 3AGVA 4QXGH 4WWNA 1XF3B 3ES6B 3TZVA 1I1CA 4PHZA 4Y4KD 4PJCA 2A38A 3UJIH 1U92A 3D2UD 3LD8B 5EZPA 5HGDB 4GFXA 3FNKA 4LDCA 3VB8A 2YAMA 2AQRA 2OX5A 3O6KH 2RCSH 3AM8C 4KITB 2OMYB 1NANH 3THML 3I9AA 1MCSA 2P42B 1KYOJ 2BSSB 3G6AB 4P2YA 5B38B 2JKSA 4I3SL 5K9OA 5GGSY 4NAQA 1BZ7B 4X5WA 4Y1SA 1GW6A 3CFDB 4RFEA 3MACH 4TNVF 1XR8A 4R83A 3MKKA 4JFYB 3NZ8B 5FYKH 1CLVA 3LRSA 1EMTL 1GZQA 1TQBB 1V5JA 2G2PA 2P8LB 2UZYB 3IJ7A 5I75C 4LSVL 4TVPL 2LU5A 5HBBA 4P59H 3G6DH 4M5YH 1KTLB 2YRPA 1FVCA 4PFEA 1ROWA 2TRYA 3T6WA 2ETWA 1SHWA 3HBPA 2ADIA 4XPHH 4JRYE 5E6ZA 3DJSA 3GHBL 4MA1B 1MVFA 4IHOA 5EOQH 4FQJH 2VW4A 4HISA 5E1QA 3TC9A 5CGMA 3X3GL 4GKLA 3G9AB 4AW7A 3L13A 2YK1H 4D0DB 1KXTB 1S9XA 2E46A 2HFFA 5BVJA 2V2TA 2AW2A 5FCSH 1WISA 2P5WB 2E7LC 1BAWA 2EVFA 4PJ8D 3MLUL 4JDZA 2A9AA 5KJ4A 3MGAA 1JWMA 5I2IB 1FBIL 2GC7C 1AY1L 2DQCH 3LKSB 4JFEA 3X11B 8CGTA 3DIFB 2ZSWB 1FNGA 4HCIA 4EN3B 2O4EA 1W72A 4QHLA 3MLTB 7PAZA 1R34A 2P1YA 2Z65C 5GRVL 1U2YA 5JW5B 1I31A 1T1XB 4GSRA 1J8HA 4YGVB 1Y6NR 4U1HA 2QV2A 3V0EA 2W9DH 2ZWYA 3CFCL 5I1EL 5JPMB 1KIUA 3IJ9A 1ZANH 2VLRD 1PMYA 3WNLA 4P2AA 2DWEA 3RWHA 1KIQA 2AGJH 1R0AH 5GSRB 1RHHB 5KSUA 3FCGA 1A65A 4RDBA 1X7SA 2ZX6A 3SGDI 2I9LA 3T09A 2ZUQC 3SZKC 4TQEL 2OMNA 4NPYB 5BRQA 1WFIA 4LCIH 3LPFA 2FZ3B 3R1GH 4XP6H 5B38G 1KPVA 1R5WA 2HX8A 1EEUA 3OHXC 1K4DB 1N6QH 2PP7A 5ESVA 1UT2A 2MJWA 1Z0MA 5EIIB 5IWLC 3IGFA 4BRJA 2CG9X 4FQQA 3ZX1A 5JDJA 1HEZA 1SEBA 4TNEA 3A23A 1ZKAA 2YD7A 1UUNA 3WUWB 1JYVA 1QUNA 3L3IA 1W0VA 3BRFA 1BD2B 3MI6A 4R26L 2X89D 2L7EA 4HPHA 4F2EA 3D06A 1EEYA 5EU5A 1BM3L 2VM9A 1IZKA 1MEXL 4GEIA 1FZOA 3CC5B 4XO4A 3QIBA 2X4QB 5HJ3A 3VFPB 2R9HC 4FFWC 4ZUUB 4F57L 2AC0A 5J06A 3O2DL 2ED8A 2CRYA 3MRGB 2CRMA 4HIEB 4GRMA 3HUJF 3PHOB 4Z78B 3BH4A 3QDJA 1NMBH 2NZIA 4XNUL 3GBNH 3I02B 4PGDB 2V9UA 4J3OD 5TF0A 1KGWA 4FQ1L 4O51A 4IOFD 4OM1L 1PQZB 1N7ML 1Y18A 1KENL 3S3BB 2B20A 1VFOA 1NFIA 5EO9A 5KYNA 2X12A 4I9XA 1DE4B 3QWRA 3UTPE 1T03L 4MB3A 4ZMNA 2W9EH 2W0LA 1YY8A 3QZWA 4YUEH 2P5WE 1G7QA 3MOBL 4LOUD 2YAOA 4AH2A 2WP3T 4OIAA 3DVGB 4X6EA 1YY9C 3GEFA 2WSPA 2FX8H 2JJSA 3LNGA 3MRNA 4ACTA 1RK7A 2UWEF 5L9DL 1S3RA 4CADA 5FUCC 4LSRH 3TBWB 2XTJC 2W0FB 4G6KL 2ZXWB 4XP5H 5HYJD 1I8LA 3GIVB 4HJGA 4X2UA 5EU7C 3SPIA 3VXQA 4CN6A 3AADB 4PJGF 3HI6H 4YZFF 5SWSB 1E4WL 5A3ID 1BLNB 2J8UA 3L3DB 5C0BA 4UM8B 2IANB 4JPIA 2NXYD 2DIAA 4JJOA 5I6XC 2GPZA 2G9KA 4FLSA 1Q0YL 4JO3L 2HLAA 4CSPA 4WTXA 4JFDD 1KCUL 1SDYA 1NCTA 3BAKA 4Z7VB 4E0RA 3C60D 4OW6A 4Z95L 5EIIG 7CGTA 4ODXA 3BX7C 4KO9A 1QUPA 3OR7B 1F90L 3L3GA 4M02A 2NY2B 5DK0A 2NYYD 3BH8A 3WUWG 2FEEI 2IXQB 3C09C 1M2VB 3SDCD 3RX8A 2FYYA 4KHTH 5KYYB 2WD0A 3LNEA 3UCRA 5B39B 1IGTA 2HCZX 2BRRL 1TZIB 5J6HB 4M29A 3SOTA 3RVVD 1FI8C 1IE5A 1BYOA 1BD2E 4O02A 5CS7A 3V7MA 1T89A 2RJMA 4NWUH 4KK8C 5AB9A 5IJKA 2AI0H 5AW6B 1YLBB 3T2QA 4QRUB 1H8LA 1S9VA 4YQXH 4BK8A 2A4ZA 5J13B 5F7HA 1HHKA 1S46A 3SDDA 1N0LA 2DM7A 4XGZA 1TVBB 3VD7A 5KVEE 2WLYA 2Y69B 4JFFA 3TEYA 2GIXA 4TLSA 5E6IC 4ZFOA 3U83A 2H6PA 3NZHL 4UT6A 1CI3M 3PJNA 4FMKA 4C59B 2VDLB 3NSJA 1QLEL 2QHRL 1YMMA 2XZCL 4Q8BA 3FB5B 3G04A 3LZFH 4UZUA 1CLYH 2WINB 1AQKH 1P9MC 2ICWA 3AMLA 1H6FA 1LD9B 1AIZA 1B4JH 1TJMA 3CVDA 4XPAH 3HHSB 3ARFB 1KLGA 4OFDA 1R3LA 5B8CC 4AQ8C 5L7XH 4F1ZA 5SV4A 3TPUA 4R97B 2APWA 2W92A 3SPGA 3TA3B 5D2LF 4XVTH 3ZMNA 4GQZA 4K8RD 4M1CD 5B3SB 2YD9A 2ZWKA 4JS7A 3VW3L 3PIQA 2VW7A 1DJSA 5EDSA 3AXLB 4BBWA 1F11A 5C08D 2IWKA 1PD0A 1Q72H 1NLBL 1R24A 2EDWA 2JJUA 5BZZA 4NNYA 5IW3A 3D9AL 5SWSE 4RDQG 2IANE 2BCKB 1I1AD 1ZGLP 5D8JL 2BRQA 5FYLL 4OCNC 5GJTL 3VXSB 1MJ7H 3MNWB 1E90A 4PTTB 4UYPA 4YDJB 3K8LA 4FG4A 2OQJB 4P5TA 4Z7VE 5B39G 1H5BA 32C2B 3VI3F 4H26B 3NIFF 4U1JB 3NA4A 5AAPA 4B9JA 2CK0L 1U58A 4K71C 4L0PB 1MW0A 3WS3A 2H1XA 4AYBA 2VDNL 2BVOB 2XC8A 5EA0L 4CDHA 4NZTL 4URKA 1UYWH 3ET9F 3NGBB 4KGLA 1QNIA 1X5AA 1PX8A 1KC5L 5L2KA 1BGXL 3P30H 3WHXA 5J89A 4Y9FA 1JGUH 3CVCA 4DF9A 2WVUA 5C9KA 1FRGL 4MSWA 5J6GA 2R23A 2EAEA 3BD3A 5I26A 1TLKA 3B2VH 3CLFL 1BQHB 2CR0A 4K3DL 4ZO9A 5BUPA 5HGHB 4MDJA 5JHLL 3O3EA 3FQWA 5DZVA 3W0WD 4B0MB 1ADQL 4MXQD 4UV4H 1FFOB 1WSST 2CCWA 4YPGA 2ZWLT 5IK3B 1ZLVK 5IEKA 5JW3L 3OGCB 3QHZH 1G43A 1HTYA 5LGHH 1OP5K 5I9QC 1BBDL 4KMLB 1M05A 4OLYL 4YDVA 2G0LA 3RNQA 1BEYH 4PJFA 4P5KA 1HJCA 4KK6C 4KKLC 4NUGL 3U30B 3BAJA 5ICXA 3QUYA 4U6VH 2CA3A 3QJXA 4UQ9A 3OWRA 3QCVH 1CQYA 1AZCA 5F9OL 3V0HA 5DVLA 1KLUB 3CDGB 3FQRB 4Z76B 1KN2H 3FQUA 2OSLA 3FN0L 5C0AD 5IBUB 3RPKA 2ARJB 1SYSA 4LLWA 2WMPA 2JB6A 5T1LD 4RWYL 2W88A 4HF5L 1HU8A 3DURB 3QGVA 2YD8A 3TN0C 1WBZA 1XVSA 3FUFA 1S5IH 3P11H 2C4XA 1S7TA 2F7IA 3I2CL 4OFVA 4AM0A 4N68A 5ICZB 1L6ZA 5IJVB 5DUBB 3VXMB 1I82A 3D2UA 3ZZLA 1KGCD 3RB5A 4Y7MA 3GLZA 4L8SA 3AWFA 3IJ8A 3MRLA 2O30A 3QXVA 2PW1B 4FJ6A 1KEMH 4BDVB 3S35H 4LMQI 4PJ9B 2BIHA 2AXFB 3NEXA 4X4ZA 1CYGA 2EXYC 1AGCA 4KDVA 3DMMD 4OZFH 3F7QA 1BX2B 5L4FA 1LLAA 2WYZA 4E68A 2ITDA 1RZ7H 3M6DA 5LN4A 2WOBA 3HCVA 2JV6A 4OCMC 3KW7A 2R2HA 3CDFA 3HG2A 4A2HA 4RAUB 4YHIA 1GYCA 3HZ3A 3QCUL 3IMBA 4LCYB 1BQHG 4FQ2L 4OZGB 4PLKD 4BXVA 2IADB 4WV1A 2DPKA 1XMEB 4HIHB 5HI4C 1TPXB 4ZXBB 1M7DA 2FYVA 2WXLA 4G43B 4KH2A 3BKJL 4M43L 4X6CA 1NOLA 3FCSA 3VDCA 4QXUL 1RJLA 2OMXA 2GB2A 4PJDB 4QCIA 3G5WA 3IMSA 4NO0B 3GKZA 3D85A 2FAUA 3E9UA 3CCHB 5E6UB 1DBBL 5DJ2B 3QPXH 5T3ZE 3EUDA 1DL7L 2HVJB 4XC1H 1ACYL 4WUUD 4UM9B 4U0RB 2FLMA 4BZ2A 1CD0A 2YN3A 2TSAA 4W4NA 5T33H 4PJEF 5H2BB 2K7PA 5AENA 3L1OL 1W8NA 5KVGE 1MDTA 1T0OA 4U33A 1D5ZA 3E3QE 4X6DB 2UY7A 1KCKA 1IAOB 4NQDB 2CNZA 5FA4B 3CFIC 2UZPA 1GKEA 3BVUA 4OM0H 3WFHA 1WIOA 5AW5B 5MEPB 3P73B 4D0CA 3W37A 3HI5H 2VXVL 4GBXA 4UMGA 5KVDL 5IGXH 1U6AL 2VLRA 1P1ZB 2O1AA 1DSWA 5DZ9A 4P5MA 1SJHA 1JGDA 5I0VA 2NW2A 1L9MA 3IMRA 4NO3B 4O2FB 3SE4A 5E99H 4U1LB 5FR3A 2HT4D 3IXTB 4DFIA 4GH7B 4APXB 1TZAA 2WJ7A 3FU0A 3NACL 4NQVA 3PS6A 3TO4C 1V3JA 4ZMZA 3V0VB 2VDPL 4LRIA 3SKOA 3CXHK 3CDZB 4Q0XH 3IDJB 3QAQA 4L1HA 5ENWB 2CBTA 3QXAB 1IIKA 1W0WA 1NQBA 3W11C 1AE6H 4LEOB 3L3JA 2WTRA 4X50A 3DRQB 1YC7A 2CBPA 2HPTA 4AG4H 1NBYA 3D07A 4EZJA 2BSED 3T71A 3REWA 1J48A 5T1JA 2Z3FA 1ZWIA 4DTGH 2KT6A 4NQXA 1SF5A 5I1IL 2I7SA 3IU4L 3UH8A 2BSDA 4I13B 5KBDA 4N85A 4ZX3A 3BZFA 2BP8B 3NFSH 1UM5L 3FB7A 2WQ8A 4NHUB 3LKQA 1VRSA 5IM7B 5HVFB 4L3CB 1GMIA 1MLBB 4YFLF 5HVHB 1ILSA 1ND0A 2H0FA 3UC2A 4WSJA 1FPTL 4QOKA 3FCTA 3HZVA 1WA0X 4FTVA 3V7AE 1A47A 4QHNA 1X6LA 1KJ2B 2GEEA 5MEQB 2DQMA 4GQPH 4H8WH 1IKOP 1T2QL 4PWHA 4JZJB 4PJDE 3TXAA 2D31A 2NZ1A 4EDWH 1U91B 4P06A 2OZNA 3VFMA 2G0KA 1EBAA 1I1YA 5CNHA 4N0RA 4N0UA 3SDAD 4YXLL 4S1SL 2ZYHA 4NQEE 2N7BA 2QQNL 1P7HL 3HFML 3IPEA 5LG6A 1HOEA 3MRCA 1NGYB 3MJ8A 4JHWH 1P84J 3WY2A 3C6SA 5KWYC 2BVYA 1MCRA 5HYJA 3FBKA 1IGJB 3IWVA 4XTRC 1JERA 3EKCA 4Y2NA 3L7EA 1N26A 2DWXA 4NQDE 4P46B 5JW4N 1MAJA 4KO6A 2J43A 4M8UA 5FS5A 5BQ7A 1J8RA 3HG4A 4NZRH 1A0QH 2VZTA 4LHUB 1MF2H 1YYLL 4MMXA 5ERWA 3RX9A 3QI9B 4JMNA 1OM3H 3RWGB 4QRQB 3M88A 1ETZB 2C1PA 1ETJA 3LN5B 1JYXA 1I3RA 4G1MB 4TSCH 1DVFB 2YAQA 1NCDH 3FTGA 2BFGA 3DJZA 3RE0A 1N70A 3LDBC 1VFAB 5B1KA 5ICYA 2LOEA 2X5PA 5E03A 4ALAL 2ENPA 1TEYA 1AR1C 1CS6A 3AU1A 2C3XA 4NOFA 2MPAH 2MKLC 4MD0B 4P2OD 5ETUA 4LCCA 3TBYB 2BVQA 4P2RA 4M5YL 1IGCL 3JZYA 2QKIA 5DMGD 4PRPE 3STZA 4XPHL 4ZI8A 3DTXA 5DJDB 2FO4B 1WK0A 3SD2A 5CEZH 1F58L 2L7QA 2VDML 3WGVB 1NJ9A 1ZT7A 4P0DA 2O26U 4AKQA 4ELDA 4P5TC 1N19A 2H3NB 4ZYKB 4RAVB 3QJVB 3ARDD 4IM8A 1PZBA 5B22A 2CXKA 5EC1A 5EOCJ 1XL4A 3AQYA 5IFJB 1L0XA 4LKCA 3QO0A 1Q9KB 2NNXA 2VTFA 3ZPDA 1L6PA 3NABH 4PJIF 5LB1A 4DSYA 4LP5A 1A7RH 3JWDH 1FYTA 4KDWA 3LIZL 3F6IA 4XMLL 4H5SB 3QQXA 5KS9B 1TTBA 2CCVA 1SJEA 4TOYL 4WJG3 3ENEA 2EEFA 4BCYA 4RLDA 4M03A 4PGBB 3ZRCC 3Q2LA 4MWFB 1BREA 3Q2NA 1S7VA 3VWJD 4ZMYA 1K5NA 1NC4D 1JUFB 3QJTB 4YHPA 3NJIA 3IKKA 4G8EB 3K4ZA 2AGJL 3BRDA 4LHUG 4Y4FC 3GJFH 2C9PA 2EXWD 3O8XD 4ORZC 1XGRA 4PJCF 5DFWH 4AQOA 2CLRA 4N90D 1Q9LB 3V6OC 5TJWK 1DQVA 2XN9A 3SZ6A 1AZZC 3U0TA 5J1AB 1Z32X 1RZKC 2VM3A 3GF8A 5E2UH 3RGVB 1IAIL 5IBLD 5A6MA 1LE9A 5DI8A 1WO2A 4L3EB 2UZXB 2I25N 4OU3A 4WHYH 4B96A 1PW3A 2COVD 3ATAA 1GA2A 2DW5A 3MRMA 3MLZL 3G5YA 5E2WL 2AMGA 3P0VH 1IRAY 4JFOA 3C8KA 3LOWA 1LQBC 1PIGA 4JLRB 4W4OA 4W9HC 3D7PA 3P4OA 5EFIA 3UJTH 5I1AA 4R84A 2VNCA 3WKMH 1MFDL 1CE1L 3GJFK 2P8PA 4U1NB 5EH1A 3HAEH 2VR4A 4DKFH 3BZ4B 4AQ1C 1XCXA 3D3VB 4FKHA 3NRFA 2XY2A 3F7RA 4I85A 3VJ6B 4PJHB 3ZZSA 3UFIA 5C0CD 2ZXCA 3B3BA 1U3HD 3O3BA 2OMBA 2WCGA 2F53B 3O11A 3RBSA 2XY1A 4Q9CA 3MXVH 3ILQD 3SGJC 3U1QA 5T1KA 1I7TB 4IDLA 1HILB 4D0BA 1A9EA 3UDWA 2HKAA 4WHTA 4Z7WF 1GIGH 1OAJA 5TDPA 3WS6C 1VEPA 1U8IA 3UMNA 1WG3A 1CF8H 2AEQH 2Z4QB 2HT3D 1X4YA 2P9RA 4MXWH 2VH5H 5FKPB 1YUKB 2OMVA 3PXHA 1G9ML 1JZEA 2X4NA 3A0OA 3HMXA 4I77H 3S88H 3II2A 3MFFA 2IJ0C 2XWTA 1FNAA 3VNZA 2Q6WB 5F7MC 2KQMA 1KELH 1B2WL 5BJTB 5KS9E 2NW3B 1PYWA 4F20A 5IHUL 1ORQA 2E47A 4XCYB 4E9VA 2AVGA 4GT0A 4QJ3B 1C5BL 2ZXGA 4PJ8C 5HHPB 1LXMA 3N1PC 3MGTA 2ED9A 3L2NA 4GW5A 5DQDH 5CBEA 3C2AL 4LIQH 4OIIH 1T7XA 3FC8A 3MCKA 4DGYL 3HN5A 4Q2ZB 4X9FA 1H3PL 2OSYA 2IDCA 4YH6A 5K59E 4KHTL 4YR6A 3GS7A 2O6EA 1OWWA 4HZAA 2A7BA 3MJ7A 1OGAD 3RWCA 2V9RA 1T20A 3NA9L 4IMKA 3E8UL 5DJCB 3RWJB 3TASA 2YLKA 5F7NC 3E80A 4KXDA 1AHWA 1TTGA 2EDTA 4IBYA 1C08A 3CDCA 1HYSD 3F6JA 3HC4H 4AIZA 4MAUL 4BSWB 3FO0L 5D1XD 2PO6B 4K94L 3I9PA 3S9DB 1VB9A 1SLUA 2GT9B 1U8NA 3QRGH 1RJYA 3T2NH 2FRGP 3VVWA 2YA0A 4PJHE 4QO1B 1KY6A 4ENED 3PQYB 5ISZB 3SPVB 3KDMA 4KOBA 4BCZA 2EYTA 1HI6A 2F53E 2FX9H 3WIIL 4WUUA 2XWRA 1JMXA 3MLXL 3GLEA 2WAQA 2KKQA 4PR5A 2N4IA 3MCG1 3NYKA 3ZGHA 3F5WA 3MBEB 4WEUD 1JD9A 4WDIB 2BERA 2BZ7A 1WZAA 1XCWA 3AY2A 3FMGH 4HCRH 5F9JB 1PDKB 1WHOA 4LLMA 2BVTA 3FDWA 3ZMRA 1LMKA 4IHBA 1K4CB 1OHZA 4BGLA 1T5WB 4NJ9H 4ZSOB 4FXGC 1NIDA 3IJYB 4J3OC 4AEFA 4MCMA 3BKYH 4XX5A 4IOFC 2H9GA 1FE8L 1URLA 5DGQA 4X7TA 1WS7A 4G7YH 4HVBA 1AGDA 3HS0A 4KXBA 5GGSB 4CMHC 4I0PA 3KJ4B 4Y5XB 2E5EA 3AG4B 4HAGA 1NCCH 4OR1A 1HDMA 4TVPD 4QHMA 4LOUC 3P9MB 5F7BA 1H0DA 5HVWA 4NQCD 3WFEL 4QY8B 2HXAA 2E27L 3DKHA 3QEHA 3KYMA 1PJ9A 2VRKA 3V6BR 2P24A 1R5VB 3GSVA 4B6ZA 1T83A 1MJUH 3ZJAA 1UJ3A 1KCBA 5CD3A 5IW1B 5C86A 3S2AA 1PU0A 5F6IB 2D73A 1II4E 2YD3A 4HKZB 4QRFA 4DO5A 5EIQA 5LDSA 5A3IC 1MFAL 5IJCC 4PJBE 2NXYC 4UIKH 2RFXA 3TU6A 3U9PL 3V0AC 5GGQL 4ODWA 2Y7QA 1A6TA 4N25A 1BQRA 12E8L 1O7DC 2K3TA 5BZXA 1N12A 3B2VL 1BVNT 3EYSH 4LPXA 5LAPA 3C60C 3HPJB 3DX7B 4OZFA 4KRPB 4XPFH 2YIHA 5C7ZA 3PY9A 1LO3H 1OD7A 2EVGA 5E4EB 3IFLL 4YHOH 1O7VA 2GI0A 2NYYC 2X4TA 4BKLA 5LGHL 3H54A 5FHBL 1OF2B 3DRTB 4GP5B 4HUMB 5B1JA 1ZT1B 3P4MB 1MI5D 3OQRA 3SDCC 1XF2A 4JAMB 4RQQA 3CZSA 3DV4A 2B2XL 4Q9BA 3D33A 2I9TB 3SJVA 3FSZA 3CBRA 4X99A 5ISZE 2AXWA 1FFRA 1AZBA 4D2NA 4M5TA 2QKIC 3RVVC 3R06B 4R0LC 4ZJ9A 5J1SC 5AYQA 3EBHA 2Y3AA 4R3SA 3JWOC 5F3HA 1KGYE 5FO9B 3MRQB 4R2GD 1D5MA 4A7GA 1HSBB 2XACC 1OL0A 2BOCB 1P53A 4GAYA 3H6JA 1N2RB 1LDPH 3FU3A 5TE6H 2JJTA 5DQJA 3T2PA 1FVDB 4JY5H 1E2WA 4YLQT 3KAAA 4PGEB 4ZSOE 2ESVA 2WSKA 3A4DA 3B5GA 4FMFA 1F86A 3W3BA 4KRNA 3LPOA 2E74C 3I6LD 5D71L 3O0RL 4IIQC 1DQIA 1PZAA 2BNUB 3D0VB 4ACPA 3ZDYF 2PWHA 1A2YA 35C8L 3H1ZA 4OJEH 3ETTA 1TZHA 2ZYRA 1AO7B 1J1PH 3A4FA 1MDAA 4WQOA 5EBLA 3QNZA 2DLEA 3NIGF 5D1ZB 1MHEB 4KROB 4TSBH 1CO1A 3AXIA 4UAHA 3B6SA 1Y6KR 4OI8A 2NZ9D 1DJGA 3PWPB 3FQXA 2EZ0D 3FU7A 1HT6A 4GO8A 2QSQA 3ZY7A 4K8RC 3FT1A 1XSKA 3GSWA 4M1CC 2J12B 2BS9A 3A6CH 2JKJA 1JRHH 4B60A 1YEFH 3HUJB 3RJOA 2CQVA 4DQAA 2KDGA 3LEXB 3NCBB 4QRSB 3L1GA 2BSRB 4G9FB 2E7DA 4M00A 2X2JA 4DN3H 4NKDB 1I1AC 2JKXA 4UDUA 5MP6L 1UADC 5EORH 3P54A 3DXAD 5EEYA 4F7MA 3SBQA 3PWJA 1M4KA 1AVAA 1JZ6A 4PJFF 3W57A 3LQZB 3EFOB 4X8GA 4DGVL 1P4IL 5IB2A 1UWEL 2UWEB 5F1NB 3GMMB 3V4VH 3WNOA 4KQ3L 1GGUA 3N1QC 4HKJB 5JXED 3PUCA 2D2CC 3VQ1C 3MV7D 1GH7A 2BOBB 4PD4K 1OY3B 3LHPH 1YEEL 3T3ME 4HLZH 3GGWB 1E30A 1HQRB 3VXUA 5I71C 1FL6B 3MPCA 4PJGB 3A6BL 5ANMB 2VOTA 5FW8A 4JMXA 1JHKH 2NQDA 4GYBA 3DX6B 4CW1A 3OKEA 1BF2A 4J6IA 1X5YA 3NEEA 2NSQA 1CIDA 1MN4A 4MXQC 5C0RH 3OXRA 2XETA 3UDWC 1U8LA 5DZPA 4M6OH 3GT6A 1E5ZA 3D25A 1T7ZA 5MERB 2OCJA 2WWOA 4OCXH 4DUWA 1XEUA 2FLRT 1AS8A 5CZVH 3OKYA 2AKRB 4FOMA 2XG5B 3NJVA 4C56A 1IARB 4HLJA 1ZY9A 1FCCA 4IBQA 3H9YA 4LESA 4G59C 1QZ1A 4N2MA 4PB0L 1N10A 4QT5B 3S5LB 1PLGH 1PIFA 2D7NA 2X70B 3QH3B 1BAGA 4FNRA 1EVUA 2BM3A 2FBRA 4NDMB 1XMWA 3KLSA 4LPVA 2MCPH 4K7FA 4AG4L 4FA6A 1AO7E 1BQSA 2W9LA 1IAII 2Y1AA 4L4TD 1N0XL 5C09A 5JPNC 3MUHL 3G6JA 1KTCA 1TEGA 1U3ZA 4JFQA 4JFVA 4JKPH 2QQKL 2X0UA 3EFDH 3PWPE 3MLWH 4UTBL 1G1OA 2WLJA 3QZBA 3LXUX 1RZIB 1YYMH 3HBQA 5GGUA 2BCMA 1NCWH 5SWZA 1KEGL 1P5UA 3MRFB 1IM3A 2A9BA 2AJUL 1G7HB 2J44A 1G6RH 1DANU 1J0JA 1D7BA 3VXRA 3BAIA 3V4PB 2R0ZL 3W39B 2CUHA 5LXVA 4H8WL 4Y8AA 1RZJC 3MRRB 4LLYA 3L9EA 1OW0A 1F2XK 5I8KL 3EYOB 4P2CG 4XZUB 5GRUL 1ODUA 2QSVA 3JXAA 1AHWC 4BSVB 4DGUA 1D2PA 3EG9A 2NY5C 4I5BB 3FYIB 4OLXL 4XWOD 1QRKA 1QSFA 3INOA 2WYIA 3CFUA 1IGMH 4TYUA 5GRYA 5CCGE 2BNQD 4GG8B 2WJ5A 5D2LB 1NZRA 2J3SA 2UWEE 3BKMH 4PLKC 6PAZA 4UT7L 1AIFB 1WLHA 2FATH 5FYLD 4MDIB 5D7SH 4QF1A 1H3WM 1YAZA 1Q94A 3MCLH 2DQGH 4JRXB 3FFCE 4YZFE 4NZRL 4LZKA 5ANME 4YXHL 3DNKA 1UM4H 1NA8A 2X3AA 3QRFM 1KCWA 2ZCLH 3WIFA 4BFKA 5D4JA 4LCWB 1YNKH 3OC8A 3UTOA 5CSBA 1UZ8B 2XTLA 3ZHKA 2NNRA 2Z31B 5C6WH 3C5JA 3VI3B 5E5MB 3S5LG 5L4JA 3C6LB 3NIFB 3IS1X 4A2MA 4MCYA 1C16A 3IJSB 4HZ1A 2CKBL 4E5XB 1SMDA 4BJLA 1QFWH 2OXHA 1KFAL 4P23D 3HE7A 4APQB 4U1MA 3Q5TA 3OKKA 1S7QB 2B9BA 2MPAL 1YCSA 1MH5B 3D08A 4LBAA 2Q7NA 1CWVA 4X9IA 4IU3A 1AGBA 1JPEA 2XZAH 4QRTA 3PWVB 5TFSH 1H15B 1RZGA 4I0PC 5J9PB 2CSPA 3ISWA 4WW1B 3KPPA 2HT4C 5DD1H 4OJAA 4KO5A 4D9RD 3DX9A 3SBWC 4TQPA 2Y24A 4BWWA 2XWBA 3K91A 1RUPH 3B2DC 1XCTB 4N5ED 1Z3GH 1WV7T 4IOIA 5TPWH 3WO3B 2VLKB 2H2PD 2ZIDA 4KO7A 1E28B 2AK1L 4XOBA 2GQHA 3KXFD 3LH2H 1GL4B 3QDME 4HAKA 4IEFB 3WEXA 3X13B 3GZPA 3HAEA 5C0EA 4YHML 3IDNB 5JW4R 4PV9B 1NC2B 2D4FA 3QQDA 3JWDL 3ZKSD 1T1ZA 3BPNC 2QPSA 2D3JA 3FONB 4GPVA 4Y7OC 4EPSA 3MRBB 1QATA 5A2JH 5K9KB 2XNAA 4ZFFA 3KGSA 4NHCL 1D6EA 1NFDA 1QABA 1EFXD 3N40F 3C12A 2LABA 1BJ1J 2W65B 3ULVL 3LZPA 1RU9H 5I75B 3IJHA 4OF6A 1MWAH 4HQQH 5D2LE 2WLKA 3FRPA 3ALXA 5DEZA 4GRWF 1IFRA 3ECWA 1OSZA 4HJJL 2WBKA 1OCRB 1A4JB 1TVHB 1VGEH 2FH8A 2R69H 4FD0A 4L8BA 4LARL 4XNZC 2GAZA 5B1JC 1MKFA 3KCPB 3GFUA 4AWJC 2F5BL 4YOKA 5E2UL 4DCQA 4JPSA 3KR3L 2DI8A 2K8MA 4GW4A 4JRXE 3L95A 4LL9A 4DP6X 2ZOLB 2H7WA 1NCOA 4ZO6A 3VRJA 4FXKC 4TN9A 1B4TA 3HC2A 5KJRH 4J6RH 2R83A 2A6KB 3T6XA 3NCEB 4BD4A 2YQ3A 4F58L 3NIFE 4KX9A 3FQNB 3KLHD 3UJTL 3WBDA 3T1WA 3I6KB 4ETQA 4NIYE 4B95C 2DEYX 4ATTA 3PXJA 4HPYL 4G3YH 3D39D 1UA7A 3DVIA 2JJTC 1SPDA 4OH2A 4A2LA 3OZ9L 3GYRA 2C5DC 3SGEI 3EO1B 4Y16A 5INDA 2NLJB 2C8NA 4LVNC 5F1IA 5DRXB 2HTLD 4ZW3A 1LEKA 2JIXA 4GG6A 3J07A 4X4XB 5ALCL 4XB7A 1KUMA 4J4PD 4YNYA 2J2ZB 1OT2A 1J9QA 2ZP9A 3PWLA 5FHAL 2JI3A 3Q6GL 2VSMB 3UGXA 2C1OA 2FIKB 4KZDH 1M1XA 2ZUQB 5AKSA 1U8HB 4QRRB 5DJXA 5HYEA 2ALWA 1B0RA 1L4IA 2MKWA 3LZOA 1JV2B 3OHXB 1YQVH 2VCOA 3MYJA 4PJEB 4ZDHB 4AGPA 4GW1B 2AEQL 1BQLL 4U6TA 4UINL 3F84A 3GSRA 4IRSD 1VCAA 3HC0A 2IH9A 1KB5B 4P2OC 2VLKE 4KTEH 4WUKL 1QFUL 1BOYA 43C9B 3ORJA 2ICEA 5F7DB 5TE7H 2ZAGA 4I77L 5DMGC 4Y19B 4YDIL 5D7HA 4HS3B 5CEYA 3QUGA 5HHNA 3W9EA 3BP6B 5CJOH 1CR9H 4WEMB 3TCXA 4LCUB 3FZUD 1F6AA 2VZUA 2R56H 3QEGL 4Z0BL 4AQAA 4NBXB 1PLBA 5HHMD 1KV3A 3Q2VA 2AQ3A 1I8MB 2ZJSL 3ARDC 4A7QA 4OCSH 2WUBL 4RH4A 2QR0B 3EO9H 5HDBF 2EDLA 4MA7L 1TEFA 4LLDB 2YFNA 5IBTH 2IC2A 1JPSL 2HAZA 2KMWA 3DDGA 5LHDA 4EIBA 4WO0A 1J5OL 2NX5A 1AXTL 4HCRA 5C92A 2PP9A 4R5XA 2E6QA 1KLFA 2R4SH 3SCMA 3FQ1A 5MENB 4NKOA 3VGHA 3Q8EA 1LDSA 3VAEA 1O6TA 2R4RH 3TYFB 4N5UA 4HMCA 3RIFF 2PXYA 2VLLA 4P57A 3VWJC 3WD5H 5T1MA 4NZUH 4LQ1A 4LSQH 5FFGA 5HHOA 5JIKA 3HC4L 3O8XC 1WE5A 4HIJA 1A64A 1FJ1B 2WYHA 3WY1A 1CE6A 1KBPA 1Z9SB 3OB0H 5I1KH 5DJZA 3A67H 1ZGLA 1CXFA 4NPJA 3T2NL 1OP3K 3VH8A 5I6XB 1R6VA 3BP4B 4WWKB 3TIDA 1QSZA 3TPKA 3QQ4A 3T0EA 1SVBA 3QORA 5CP3H 4PJ7A 1UFUA 4WU5A 4LDEB 3FO9B 1G5AA 1JXJA 4HS8L 1A6PA 1T0PB 2X6UA 4NT6A 5ABZA 4N2GA 1EGJL 1GC1C 1WFJA 5LAXB 3BP5B 1U4EA 2R1WA 2I07A 4JKKA 4M61A 3E7JA 1M9SA 3P4NA 3C09B 1V27A 4MX7A 4XVOA 2OYKA 4X5QA 4HPOL 3RPBA 1HQ4A 4PJEE 2I5YL 5JXEA 4FNTA 1A6WL 3CVBA 1WHPA 4Q97A 3BC9A 4XCNB 3X1BA 5TF1H 1BG9A 1NICA 2FJGA 4NJ9L 2ZNWA 3ARQA 4PGCB 2B0SH 3MNZA 4NYLA 1LNUB 3UXFA 3KYNA 1U3HC 4YSCA 3WJLA 3V9EA 3WTYA 2Z7ZA 5CJBA 4GSDH 2WKOA 5D7LD 4XE0A 3ILQC 3KPOA 4KKRA 2BDNH 4G6FD 4NUJA 4RISH 3SY0A 1B0GA 4QHKJ 4OZHF 2K45A 2ZP0T 1Y0LA 5C07D 1TVDA 1I7UB 4B41A 5E6IB 4OCWL 2HT3C 4OAWB 4IKLA 3SYQA 4G9DA 4NPKA 1UFGA 5DD6B 4E41B 1FN4B 3RZCA 3DBXA 4KTYA 4XZ4A 4AVHA 5DHDA 3MKGA 3RWDB 1D5IL 1TU2B 2WLHA 4ZG1A 5I8CB 3K7UA 2V0AA 1DDTA 3HVNA 4ZMTA 5EULV 4GKOA 5SX4H 3HJ0A 2BWQA 2N0KA 1F4XL 1UGKA 3L9RB 4UF7C 2IPTL 5JORB 5B8CB 2HJFA 4OLZL 3NAAH 3ZTDC 3NSFA 5A16B 4LOEA 4CKQA 1AMYA 2YPKB 2OTUB 4O5LL 4B27A 3IDIA 1E4KC 4PP2B 3QUKA 4NM8L 4XNMB 5FUCE 4IBZA 4O9HL 2B4CC 4PMFA 4WFHD 2VDQB 5EU7E 1FL3B 2DQFA 4MJIA 4MCNA 2VDLH 3K74B 4N2BA 5DTFA 2XPYA 4DUXA 5L6YH 5CCHE 4MNHA 4OD2A 1HEJC 2DLHA 1IKNA 4UNTA 5DEFB 4PJIB 4UOW0 2XKNA 3U1SH 4X5RA 3UTSD 1N3NA 2Z93B 2DEWX 1ZK9A 1F3DH 2VLJE 2Y06H 4BRVA 2EDJA 1ZVSA 3OL2A 1V7NL 1A7NL 1JF1B 1P7QA 3VFGL 1HYSC 1OARH 3VM5A 1I8UA 2KHAA 3NJNA 4U6HB 3CQPA 4JFHE 4K71B 1MRDH 5F0LB 3WNMA 4LHQB 2LW3A 3K6FA 2IG2H 5D1XC 5IB4B 3KPRA 4GAJL 3TZVB 5DD3L 3TT1H 4A04A 2JSFA 4PJCB 2Z1PA 1RJCA 1U92B 1LDPL 3U48A 2P48B 2OULB 5KEZA 2EUWA 1NDMA 1JVKA 4FHKA 4K9EC 1F97A 1TSRA 4Z7QE 1KIRB 1UA3A 4N1EA 2G5BA 3V4VA 4ENEC 3FTXA 3GMQB 1HESA 5FDWA 2Z1KA 5ITBL 3EUUA 5HYFA 5JQ6L 4IRZH 1YDPA 1DLFL 2ZX8A 4HKXA 3NPZB 1DBAH 3BUYA 4RWHA 2X0WA 3OPZL 5I9QB 4X5WB 2DQTL 1IBGL 1Q9OA 3FPXA 4DVBB 3KEHA 4ANVA 1DJWA 4Z7UE 3LRSB 3OZLA 3LEVL 3RI5F 3B56A 3BGAA 1F42A 1I85A 4E41E 2F19H 5F9DC 4U7MA 3P1VA 5EZJB 1VIWA 2R15A 2ADIB 2QVTA 3FTUA 4JN1L 4LPUA 2AEPH 3HS8A 4PIRF 1NMCC 3TN0B 4OLUH 5T3ZH 4EO5A 1F4AA 3IU3A 2WBJD 1WC7B 5D93C 4UQ3A 2K6ZA 4L1SA 4DN3L 1S9XB 2HFFB 3ZLQC 4M7KL 5T3XE 5EORL 3ZTNH 5IESH 2A0LC 2V37A 2R8SL 1EZLA 5KVGH 1JWMB 3IM1A 3FSAA 3S4SG 1KTBA 3VD1A 1XCQB 2CGRL 3PDOA 4DH2A 2IOMA 3MZGB 1LVEA 1BP3B 4JFEB 1J05B 1MQKH 5JNYA 1FNGB 4QHLB 1W72B 3SKJH 3U9UA 4ZNEE 4JO4L 3OSKA 2FLBT 4F2MA 4WI0A 2N7AA 4WFGD 4GKZA 4GOSA 3LHPL 2G60H 2EKSB 3VVVA 1AR2A 2WXMA 2XBTA 3S36H 4LLQA 1FLRL 3H4HA 5J8OA 1D5BB 1KIUB 3TO2B 1G6RA 1T22B 4A7GF 2Z91A 4F8QA 1XR9B 4G8GA 4HSAC 1EHXA 1JZFA 2E75C 1INQB 4Y1AD 3UP1A 2D0FA 3BN9D 3TBCA 5C97A 4MJ5A 2I9LB 3IDXL 4S2SB 1KBKA 1GHFH 4FQLH 4PJCE 3VG9C 4PS8A 3GMOB 3FT3A 2BY2A 3QUXA 4KRLB 1KPVB 4FQCH 4P4RA 3L6FA 4BWUA 5J5EA 2FR4A 4WEBH 5ESVB 4QJ4B 3KLLA 3NFPA 1UKQA 4FQQB 4GY4A 4TNWF 3VDAA 4X8JB 3FQYA 5FYKU 1HEZB 2ICEC 1KXQE 4FYRA 4TQIA 3V4UL 3EO0A 1V3LA 3QR2A 2X9ZA 4JFUA 3D50A 5HDWA 1AGFB 2NUPB 4B9ZA 4FMVA 4R2GC 5HJ3B 1Y07A 4K3GA 4ODSH 1R3JB 1XAKA 4KV5F 4H0LC 4CC4C 1XFPA 3QXDA 5AL0A 5JHDD 1NUNB 2BXZA 4JKPL 1AFVH 3MU3A 4NWTH 3QDJB 3DA0A 4PTUA 1WWCA 5BO0D 1WD9A 4P49A 2IFGA 4CVXB 1KMGA 1ZVNA 3BXNB 3N9GL 4W1TA 3IGAA 5DYOA 4ZOAA 1Y18B 1ZEAL 5EO9B 2FO8A 5DA0B 3QUZA 5DJ8A 3EBAA 1P5VB 2NT1A 2I32A 1Q38A 2FJFA 2IOOA 3RB7A 5IQMA 3MLYL 1YY8B 3VE0B 5CLZA 2DKSA 3CVIL 2JK5A 4LOVA 2DQIH 4N87A 3ZE2F 2D9QB 1M3JA 1HL5A 3MUGA 2JMRA 1JP5A 3B7YA 2NZ9C 3MRNB 4WFFE 2EZ0C 4TUUA 5C0GA 3DECA 4N26A 3W9DA 4CADB 2ZKXA 3T4AA 1NCBL 4JFEE 3PL6D 3SDXA 1MCCA 2FWSA 2YEZA 3G9VA 4HEPG 4U6XA 4UV7H 1NFKA 2CO3A 3B2PA 2B3RA 1QLFA 2FATL 2E59A 1CLCA 1H3UA 1J8HE 3PV6B 2J8UB 2F54D 3ARWA 4PG9A 5C0BB 4JPIB 4Y0GA 1MHCA 2JKNA 5E51A 2Y7SA 3FAWA 5HYSA 5KYWB 1JDAA 4G5ZH 5E6YA 3QORC 1Y7VA 1JGLH 2Y5QA 5K9JL 1KB9K 4LPWA 3BAEH 3OX8A 1MCOL 1OTUD 4F5CA 5I18L 1UM4L 2MNUA 5FGSA 1IX2A 2XWCA 3ASWA 3C75A 3GTVA 3II3A 4ODXB 4BFNA 1JNJA 1UKSA 2ZCLL 4GUOA 4HIIA 1SQMA 5DMKB 2EDYA 4Z3TA 5DK0B 1BMWA 4HC1H 3SE8L 2PYED 1BF8A 2AQNA 3QUHA 2VISB 5I66A 3N3EA 1XF3A 5JXEC 5E8OB 2H0EA 5E8PA 1HKLL 1IGTB 2ORBH 3ECQA 5IFAH 1ML0A 4IOSD 3GC3A 4B3EA 1MWAA 5HGDA 1L0PA 5DEJA 2R69A 3M1BA 5F7UA 3AREA 2KZKA 5D7JD 1I3VA 4ZUVA 3KMDA 5EEZA 4GMTL 1GJUA 3ESVF 3OPUA 2WWKO 1G7IA 2OMYA 1RP9A 2E9JA 3CH8A 2PPDA 4JG0H 3DGCR 3G6AA 2LQRA 4OD3H 5B38A 2IV9A 1E2ZA 1S9VB 2EADA 3L17A 3F04A 1NAKL 1HHKB 3SDDB 1M42A 4XGZB 5AEAA 3CFDA 3ULUE 5D9SA 3LQMA 4H0GA 1ZMYA 2P28B 3CE1A 3QDJE 1NDTA 4XP1L 1KJ2H 1CYXA 1WQVT 1EEQA 4JFYA 4MGXA 4N2IA 4ZFOB 2YKLH 4QXWA 4DEPC 1FNLA 3RZCC 1MY5A 3B5HA 2XTSA 3GS0A 1XL6A 1YMMB 2KLTA 1DJHA 1KTLA 2ZUWA 2ZUSA 5TPWL 5CUSH 1O5PA 4AL8H 5FCUL 2HH0H 2HKFH 2EH7H 4K3JL 3W38A 4F9PC 5AYUH 4I48B 4MJ6B 5IMKA 3ZL4H 5E9DD 3MV9B 1KLGB 3I50H 3OXSA 1R3LB 5A43C 3BQVA 1F5WA 1QQDB 2R2EA 2EUZA 2V3DA 4JG1L 3LDBB 3H9HA 1IC1A 3H2PA 2P5WA 3J7HA 1W15A 3L5IA 2BSTA 1GAFL 4NFDA 4XNDA 1AR1B 4X4YB 1GPOH 2HFEB 4FYSA 1NBVL 3EF7A 4H25B 5I2IA 4XXCC 1CGSH 4FG6D 5LWYH 3X11A 4YLCA 4IGBD 2ZSWA 2ITCA 3ROLB 4EN3A 2J8UE 2JXMB 5C0BE 3MLTA 2FSEA 1IKNC 5HJGA 3GMNB 2GK2A 4C4UA 5D2NC 1EO8H 4PSRA 3FTWA 3ZDYB 4H8QA 1DCEA 4JB9L 2YARA 1PD6A 2K4AA 4P5TB 3PU7A 4EJ1C 1E65A 3NIGB 3RY6C 3UL4A 2EJ1A 4XBEH 4N8PA 1U58B 2PMZA 4FF9A 4XWOC 2Y07L 2BW4A 4GAFB 3BZ5A 5PAZA 3B9KD 1IMHC 4CU7A 2OKMA 3VD5A 2EO7A 4P9ML 1OB0A 4X4KA 1QHPA 3T6QC 4B50A 3TNNA 3QFJD 2FQGA 1DP0A 1E8WA 3TJHD 2IV8A 1YEJL 3Q1SH 1O6SB 5EU3A 2DLTA 2PNDA 1UD4A 4MSWB 5J6GB 1AI1H 5EIIA 5IV2B 1IFHH 4XN7A 3QK0A 4LEBA 3T0BA 4M6MH 4FQXD 4MDJB 2I60H 1X5HA 3DTDA 3WUWA 1A14H 1HVXA 1JE6A 1RIUH 1CU4L 4Y4FB 1NIEA 2O5YL 4YPGB 3AT8A 3DO3A 1IBBA 2L3BA 2YKKA 4HDIA 1M05B 3AS0A 2DQUH 5CCJA 4PJFB 2X4QA 4RGND 3ZDWA 4LB8A 1BXAA 1R75A 2ZONA 4ZUUA 4JFFE 4YSAA 5IZ7A 4HBQA 1TQSA 1UOWA 4AUJA 4R8WH 4QHUB 3WO4C 2D3LA 4IDJH 4P23C 2Y7OA 3M45A 4OY9A 4TULL 2W91A 2Y1VA 4Z78A 3FO1B 1YMME 5GGVY 2OSLB 4PGDA 1SYSB 2IDQA 4LLWB 4OBRA 4KTDH 2WMPB 2JB6B 3UROR 1QMUA 5DUML 1PQZA 2ATPB 1EZSA 5FWQA 3RKDD 1KCLA 3FH8A 5EWIH 3EHBB 1Z9OA 1NFDF 3V6FA 4ZOEA 3DK2A 3ZW3A 5CP3A 4ZBJA 3WFZA 1JXFA 2L7JA 1A7OH 3SKMB 3N06B 2F5AL 3EGDA 3D2UB 1HYRC 1C1EL 3ATBA 4QYOA 3BDXA 5EF3A 3DVGA 5C8JA 2ZXBA 4QYAA 1A1NB 2F7OA 4OCSL 4N5EC 3MRLB 3PLYA 5L8LB 1YO4A 1Z3RA 4NCC2 5DDHA 3LXAA 3AROA 5BS0D 4NQSA 3GIVA 4KVNH 4GAGL 5F8RC 3WN5C 4KTGA 4LSTH 2QQQA 5I73C 3N2JA 5DWUL 5F0JB 3S2CA 3ZDYE 5F7EL 1HH6B 3FT4B 1BLNA 1U8OA 1YA5A 3L3DA 3O3UN 4UM8A 5GGTL 1DLHB 3PGCB 3V0FA 3QAZC 4FFZL 4GSQA 1J87A 3LKOB 5F72S 3FCUB 3KPSD 4MS8D 4XAKD 2F18A 5KVEL 1WIUA 4WV1B 1MUJA 3K2KA 1KV7A 2MEJB 2QT6A 5I6PA 5IREA 3MQIA 3L54A 4YWGL 3VSQA 5C1MB 2M1KA 2IXQA 4KUCD