2P8IA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
b'GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dioxygenase
molecule tags Oxidoreductase
source organism Burkholderia xenovorans
publication title Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia xenovorans LB400 at 1.40 A resolution
rcsb
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2p8iA00
2NYHA 2PEBA 2P8IA
chains in the Genus database with same CATH superfamily
4NPOA 4U8VA 1SBRA 2HVDA 3V6HA 1KLMB 3GP9A 4M95A 2EXUA 1KOHA 2YTCA 3Q8VA 4U7UK 3UPFA 4X66F 4YQWA 5EWGA 3C8YA 3T6JA 1HNWF 1S77D 3FSYA 4YDXA 2KFYA 2CJBA 2LXUA 1QSSA 4YR0A 1CS4A 2OPQB 3MR5A 2PMZD 2Z2LA 3M8YA 3AXMA 1RYSA 4ZP6A 3KLFB 4CO1A 3POTB 1JXVA 4F3MA 1JLQA 2FJEB 2XZWA 1WF2A 3MAQA 4ZA1A 3WX4A 2B6AA 2BKPA 3CSKA 4ED3A 3V4IB 5T7LA 4QWEA 1VQMS 3KLVA 3CJRA 3MEGA 2N7YA 4OHXA 1XWLA 2DR7A 1TL5A 4ZLPA 2W8LA 4F4YA 4A8FA 1A9NB 2MB0B 2HHVA 1H6KX 1FFGB 1SB6A 3ONQA 4DU8A 2MZ1A 1C2PA 1TKZB 2DYAA 1SC3B 1U8WA 2DH8A 5M2UA 1HD0A 1RT7B 2VF3A 1X60A 1LXNA 2FTRA 1SL1A 1EETA 3EWGA 3VAJA 2VJUA 4C2MA 3LWLA 2D9PA 3ZTOA 3E51A 2UP1A 3PEHA 4IG0B 4RU9A 4DV2F 3JS9A 1CBKA 2BE2A 2CJAA 2I9SA 3RJMB 2ADBA 4K4YA 3QJPA 4QYZJ 3SCLE 2ZH8A 4WP9A 3O2IA 1FX4A 4PYAA 4EBCA 2UUBJ 2Y9HA 1GT8A 3Q8YA 4NMXA 2IC3B 2N4CA 2IRYA 4HR2A 1IUJA 3J7Z5 4WE1B 5JVGQ 3BBBA 4OYXA 2C2DA 3CCTA 3HVTA 4UQTA 3QO9A 4EZ9A 1RA6A 4Y28C 3R9LA 4NE9C 3IFEA 3CJ4A 4W98A 3CCSS 1UTAA 1U47A 3THPA 4EU0A 3PYDA 3H25A 2FHOB 3MEDA 1T05B 1DTQA 1RU1A 4J9PA 1Q86T 4C98A 1NCLA 4N8OA 4HH1A 5IM0A 1DLOA 1UA0A 1NJXA 2RJZA 3RG6A 1G3OA 2AT1B 1HNIB 4P52A 4CH0S 2R2RA 3MPYA 3VAIA 2GIFA 4NLTA 3JTPA 3U02A 2DVIA 4LF6F 2UVUA 4DU7A 1J5OA 1HI1A 4C11A 2E9ZA 2D69A 2J0WA 1PJ6A 1ZM4A 3AY0A 1W2BR 3DLGB 1NSQA 2DNYA 4FS1A 2K1RA 1S6QB 1HARA 3IG1B 5GADU 4CO4A 4EFAC 4DWIA 2F63A 1FKAF 1EP4B 1EB0A 4C8MA 3G87A 5KG0A 3H98A 3DOMB 3PO5A 1X4CA 3SSQA 3BM7A 1IR0A 5EHHA 2XS5A 2QG9B 2UUAJ 4OFZA 2B43A 1SV5B 3H40A 3V6DA 3G8QA 2AQ4A 4WWSA 1VMBA 3GR1A 3GYXB 4UY85 1FE4A 3I6PA 2V68A 3ISND 4O3PA 5CCLA 2A1BA 2BXJA 3JTNA 3HD2A 5C24B 1ITPA 4HDHA 3R27A 5MLCV 2J5AA 4L3KA 4PPZA 4Y2KA 3CCQS 2RB7A 3L3CA 2J6TA 3MMAA 5DS7A 5D8HB 2RQKA 1N5YB 2P6SA 5IQQA 3AXKA 1S1TB 9ATCB 1VC0A 4J9QA 3MXHP 5IQ6A 1DQ8A 2GQCA 2FLPA 1FFWB 5GADI 3OHBA 2DXFA 4A47A 2DBBA 1P9QC 1ELOA 2EK1A 3DOKA 4R0EA 4URQU 4JV1A 3CXCR 2OPSA 5FDLB 3NL0A 1R0BG 4K0KJ 1NSPA 4G65A 1G4CA 2NSCA 4R5PB 2ZH2A 2NUHA 2Z4PA 3BBCA 4KQZA 1Q53A 1F0XA 3K5LA 1T9YA 2KM8B 1MU2A 4FPIA 4QWAA 4O4GB 1U1KA 3UDVA 1FK9A 2X3DA 2G2ZA 4PZVA 2VDHA 4ECRA 3P3DA 1LNQA 3SFUA 4F4XA 2WAQD 2RDIA 2Z56B 3IWXA 4M5MA 3OFFA 4NI2A 3CCJS 2DCLA 3RB3A 2OPPB 3ZZZA 5IT4A 4MKYA 2VA3A 1TUVA 2E44A 4RW4A 5DETA 5AE3A 1HNWJ 4AQYJ 2PIIA 3AHPA 1KHWA 3CD5A 4IOCQ 3R2DJ 1DQAA 2AYEA 1HNIA 4I69A 2DR8A 2V50A 3H5XA 1FD8A 1S5ZA 2V2ZA 1FWKA 2C2OB 3DMJA 4DR6J 3AJDA 2ZH7A 3IRXA 4M5GA 1UFLA 4JUZA 2DO0A 3RBXA 1PYSB 2RHSB 2D3UA 1F9EB 3O44A 2DK2A 4YB5A 3BQ2A 2B5JB 1D8YA 2JLEA 2KT2A 1NK9A 2QLXA 4DS5A 4OYZA 1SH3A 2V94A 3PHEA 3LGHA 2B9XA 2LQBA 4AD6A 2Q1LA 2YBVA 3BSOA 4Y00A 4KH1B 2IA6A 5KFNA 4ERDA 3GIJA 1VOMA 2BJ8A 2BV3A 2QGFB 2QJ3A 2RE1A 3BB5A 5B09A 4JI2F 5C25A 3M30A 4PXDA 5KFLA 4ECQA 2D3OR 4HKQA 3JSYA 4X62J 4PWDB 3UD4P 1EETB 3I56S 4HHHA 5KTQA 1OPZA 4KPYA 1RT7A 4CLSA 4NLOA 1RT4A 2BJEA 1VQ9S 4DCOB 1HKAA 1PKUA 5DGBA 1CQMA 2ILZA 2GGPB 1T9XA 3M6WA 1Y5NB 4LVNP 4ZCLA 2W01A 1UFWA 1F3VA 1UVKA 2DH9A 2MJUA 2ZOFA 3VGSA 1HIYA 1X4BA 3OFEA 1YHQS 2AZ1A 2HFOA 2VHGA 1JLAB 5G0RA 2KFZA 3G6ES 4WZMA 1U1LA 5K14A 4DV1J 1NM2A 1QLNA 4N5SA 1RU2A 1FESA 2NPIA 3S7RA 2PO4A 1N34J 3NXZA 3PNIA 4MIBA 1U1QA 5EDWA 1VJQA 2GNKA 2GAHC 1PO6A 2GIRA 3JSRA 4I67A 1RAJA 3IAS9 5IV3A 4OYAA 1HNZJ 3R6GB 1VI7A 2KXNB 2DB1A 1XBWA 2OD6A 3BH7B 1A7GE 5D4OA 2VPXB 4CLTA 1U26A 3IMQJ 2XMTA 3UN3A 1RYRA 3QGPA 1KNZA 2LQ8A 3NGDA 1G6BA 5IC6B 2FZGB 3FCWA 2E1CA 3D3BJ 3FEYB 2AJ4A 2C2EA 1I51B 1CEZA 3JQMA 3MAHA 5DDQC 4DDFA 2ZH9A 3TUIC 1E6VB 3DDIA 4NRUA 1NJYA 1MG7A 4RW8B 3H2LA 3W9HA 3N9UC 3DCAA 3QGGA 3KLGB 3VAHA 2J6SA 2IM3A 4OX9J 3LTOA 1LW0B 4X64J 1R0AA 1GTEA 1JLAA 1QUVA 3FCVA 5G0RB 4IRDA 5F3TA 3W8PA 1IR1A 1W25A 2AF6A 4LSLA 1S1VA 4Y2AA 5CQGA 4ZMMA 4PABA 2F8HA 1Q8LA 3Q8QB 2MJNA 3UO0A 2WOMB 3NOGA 4UUWA 4K4XA 4F50A 4IQXA 1HBOB 3QLHA 3QFHA 1QE1A 4NZ7A 5HMZA 2Y8WA 2VFTA 5LSRA 1Q8KA 2AJ1A 3KK1A 4K4TA 3GWCA 2RDDA 1UAWA 3DKDA 2FJXA 1H2VZ 1RT4B 1UW9A 4QBUA 2YWEA 5B0DA 1FRHA 1GX5A 2VFRA 3O1LA 1JLBB 3UWTA 4WP8A 3T5LA 1NDKA 2KJVA 2QRRA 4YY3F 2E5LF 1UVNA 4BWJA 4AL7A 1ZTWA 4RW6B 3RW7A 4YB1P 2M88A 3D0IE 4ID5B 4YHHF 3G71S 2J9DE 3GCXP 3OVAA 2CNKB 4I2PA 3SCIE 3TW0A 2DHHA 3J80Y 2LXFA 2QLWA 2YKNB 3NS6A 3A3NB 1OQ3A 3LH2S 4KE5A 2MDAA 5KFSA 2HZAA 4OZLA 1DJ0A 2M4MA 3TO8A 3PKMA 2KG1A 5F0WA 3DMJB 3QSIA 2FUG9 3G82B 4OHZA 2C22A 4B9UA 1TR0A 1RUSA 3C6TA 3DHXA 4B9TA 1KHVA 5LXRA 1HQUA 2HLTA 4LJMA 1RAFB 1RBAA 2ROGA 4I56A 4TYAA 2E1MC 5CHCB 4J90A 3Q86A 1NKEA 1JB0C 1KKHA 4H4OB 3MPUB 4CLYA 1SKUB 2Z2YB 3FFIA 4FZVA 1S6UA 4PKDB 1NK6A 4NLPA 2ALZA 1KEKA 3M8PB 3WBZA 5DG7A 2FQQB 4DV6F 2NR0A 4OZNA 2RUGA 3HSJA 1T9UA 4ZHRB 2JC1A 2NZCA 3TI0A 1REVA 1XTZA 4DPXA 1FK9B 4ITSA 2XSJB 2XYGB 1PIEA 2EWHA 5DG9A 5AJ3J 1Y0HA 2W1BA 2FVPA 2I1RA 3C15A 1S4EA 3ZZPA 2ZC4A 5ETSA 3BGFA 3E01A 1ZBTA 5D77A 1VRTB 3B54A 3FRYA 4CO3A 1U6FA 3GQCA 3ISNC 4A8MP 5HLFB 2FYXA 1FCAA 4RNHA 2B7BB 1XR7A 3OR2A 5E0OA 1TK0A 3HFKA 3EPGA 4S0MA 3ZNJ1 1WC5A 3AOCA 2BOPA 1I1GA 4O3SA 2QLBB 2KU7A 1L3UA 2HQDA 3PO4A 2HRUA 2YKQA 3P5BP 2L3MA 2AU0A 3R5DA 1CULA 2DEIA 2RRBA 1Y9OA 3M6XA 4RUBA 4TXSA 3DRRA 1TFYA 3M32A 2ZBPA 4NA3A 1S12A 2MZTA 5J2QA 1YI2S 2CQIA 1SJQA 1HNVA 1RLCL 2M52A 2WVEA 4WXWA 5D3GA 3AA9A 3KK3A 3FZ2A 2ZWPA 1U45A 3TNVA 1S1XB 2PN6A 1Q79A 4PPDA 4HLBA 2WHOA 4OYIA 2EKYA 4F7VA 3K5MA 1AYEA 4RKUC 3E2EA 2GVDA 1VQ8S 1UJ5A 4B3SJ 5KT7A 3QJLA 4EBDA 1GMWA 3G6YA 3H4DA 4MJKA 1AB8A 2MY7A 2F4FA 1H72C 1WI6A 2LU1A 3FBBA 3K5PA 4IQMA 2ZJQQ 3RR8A 1B70B 5IC4B 1FDNA 3SZ2A 4ZVUB 2MPUA 3PRBA 4PXBA 1UZDA 1T11A 2AMCB 3KWMA 4LUBA 1U0HA 1F2HA 3EGVA 4KFBA 3PX0A 1S6QA 1N56A 2B7CB 4NLDA 2CG4A 2B0GA 3MCSA 4WF9Q 1MMNA 3R3TA 3DYAB 4J9KA 2H3EB 4DL7A 3MR3A 1MWYA 2EVZA 3AODA 2GX8A 2GIQA 3PJ9A 2OELA 3LP0A 4NCGB 4PG5A 1YJVA 1P27B 2AWZA 1X8DA 5IT9Y 3CMAS 4DV5F 2HLUA 1AZSB 1M1KT 1Q7LB 2HNZB 3AQOA 3BSNA 1N32F 4TQSA 4UUXA 3D66A 3P8BB 1V6HA 3NGSA 2DHXA 4DL0C 2BBEA 5M2RA 3CCMS 3MURP 2E5IA 2V8GA 2DR9A 3KMQA 3G86A 4EMDA 4UOHA 3A4TA 5HVFA 4W90B 1Y00A 1FKPB 1VIOA 2YKPA 3CD0A 1FKOA 3WDOA 1B7FA 4DQIA 3GTYX 3NP5A 4PR6A 2C2RA 2OEMA 3R97A 2B56A 4PUOA 2BE2B 5F3ZA 4HHJA 1TL1A 2QA1A 1UPPA 1N34F 4NEZA 2JDJA 2PEHA 4NLQA 3W5XA 1EJ7L 2JFKA 2PA8D 3KYLA 2MLZA 2U2FA 2UU9J 4K5SA 3PM9A 4QU6A 1LWEB 4LR8A 3FMWA 4ZPAA 1FA0A 4YB6A 3T5KA 2YNIA 3G9CA 4C8YA 2V63A 2XY5A 2V9KA 5F8JA 2ZJRQ 3CULA 1CG2A 2FC8A 4ID8A 1IKWB 1JLCA 1RWOB 2G1HA 2K3IA 2Z8QA 2M2BA 4IOBA 4Z7YA 2IBKA 1SQEA 4B3TJ 2UXDF 4ECUA 2VONA 3HXMA 4CLWA 4DPOA 1UWBA 1FO1A 1ZA1B 4CP5A 4J9MA 2PT0A 2D9OA 3DRSA 3MECA 5KFHA 1B0PA 2UUAF 2B6AB 2J7WA 5LMUF 2V8VA 1BQXA 1DQ9A 2VQFJ 1N5QA 3POTA 4DSFA 4X62F 2QA4G 4TLRA 2PGCA 2HURA 1CS4B 5KG5A 1VBZA 3GR0A 1IKYA 3KKFA 5JVHQ 1SL2A 1M5OC 4ZPDA 2WONB 1GAOA 3CDEA 1XR5A 3Q8SB 4BS2A 2BKOA 2E7XA 2MQLA 1RTJB 2OO4A 3OJUA 2B4OA 3RR7A 4PWUA 1XN9A 4ZP8A 2EC2A 3GJQB 3HP6A 4V19X 8AT1B 4PXEA 3FQLA 1CJKB 3O5TB 2COLA 4DFMA 4DQQA 2KHCA 4ER8A 1RT2A 2EEYA 3G8TA 4CLFA 3RYLA 4KPCA 1HQEA 4LREA 3CB4A 1CJKA 1DTTA 2AJFE 3PACA 2BANB 4DJBA 4M5LA 5LJ5Y 1FRKA 2N7CA 3JYTB 3A1YG 1JLGB 1N32J 4YN3B 3M9OB 3G6XA 5LM7E 2MQMA 4DL5A 4OJ3A 4ZLJA 2W4PA 2ZNYA 2CNNB 3ENAA 3P45B 4LRDA 5B08A 3RB6A 3LGNA 5D78A 1OQ6A 2ZITA 1RWXB 3GFYA 4OMFG 3KMSA 2QFJA 1FJEB 1RTIB 2V69A 3UR0A 1WD6A 2GMJA 2IDLA 1VRUA 3S1TA 1MWZA 2A2DA 4RJVA 3QZ7A 4X4QA 4DV2J 5F9LA 1HPZB 4U8YA 4HL9A 2B4PA 4Q7AA 4PCQA 3NKYA 1WHYA 4FNHA 2J0XA 2XMAA 4CRJA 1NHVA 1FNXH 4FYYB 3UR3C 2VA2A 2MMYA 3OTDA 3OW2R 4B3MJ 1RHJB 1SC1B 2V4RA 1U2CA 4P72A 2HQIA 1RTDB 2DIUA 1R31A 4OI1A 1MWQA 2RRNA 4NLRA 4M5IA 4USUA 4OV6A 2F40A 2ABYA 2E29A 1PG5B 4X4OA 1SUQA 1U1MA 3MEEB 1IKWA 2GO8A 2O1PA 3MMCB 3N01A 4Y6IA 1T9VA 3Q24A 3K2YA 5DQGA 3RRKA 2OGUA 2YNIB 5A0YB 2MQOA 3NBPB 1LWEA 5D4PA 3M8SA 2BRKA 2AKWB 2CQPA 2ZHBA 1SXLA 3CCRS 3CC7S 4TVAB 3KJFB 3Q89A 5I42B 2B3TB 1S48A 3N6NA 1HYSB 2HHPA 1GQEA 1PBUA 4ZCIA 4J9LA 2G2OA 1W26A 4L74A 5AT1B 4PUOB 1YZ6A 3VZIA 3HJVA 4O44B 1IWGA 3GIRA 2PI4A 2X3GA 4I7FA 2BX6A 3H7HB 4KGVB 1RT1B 4DEZA 3D0HE 3HT0A 3HO1A 4I64A 4IFYB 2VG5B 3EDQB 3VALA 5E3CA 3UW1A 2IMWP 1WEZA 1RT3B 2LFVA 3QT6A 5LSLA 2F8EX 1JXEA 3HT3A 1F5BA 4F4KA 4B9VA 1FXDA 2YKOA 3HSGA 3F41A 4O44A 2XG8A 4USVA 4CI0B 5ETRA 2QMXA 4WYLA 3MTKA 4DSKA 3TZYA 1F5AA 2R8KA 2ZE2A 1SKRA 4JI6J 5I42A 3JQKA 4MFBA 4DR4F 1YRUA 3HKWA 4LF2A 2VG7B 5HQ8A 2ZH4A 1TKXA 2E9TA 1TK8A 1T94A 3SQGA 2QN6B 2VICA 3K58A 4JI3F 4USMA 2IMOA 3R7NB 2KI2A 3W8GA 3O3LA 4LF6J 1FDDA 1VIXA 4QR1A 3A13A 1NU4A 2DJWA 3OXGA 1AT1B 1IR2A 4DBQA 1SUQB 1UZHA 4DV7J 4USTA 2GMHA 2LDIA 1VISA 4DPWA 5EWFA 2ZBRA 1XERA 2HGNA 3NAHA 4ICLA 5HJXA 4TU8A 4OI0A 3ENVA 1S97A 2BW2A 5KG3A 1UVIA 3PW0A 2E5GA 4KKOA 4ZCKA 1BGXT 1GXUA 4NLWA 3W9JA 2ASJA 2J8SA 1RKJA 4RBTA 1LWXA 3AOBA 4PAAA 4QJVA 3SIPB 2N3OA 2N82B 4CT8A 3HVRA 3GJRB 4DV0F 3DI6B 3OSPA 1C1CB 2L08A 2O5DA 1KVIA 1HLWA 3I96A 2UUBF 4RZRA 3OUYB 3Q8PB 1EZZB 4URSA 5JJBA 3CJ3A 2JJ4D 4QWCA 2UXBF 1SKSA 1HNVB 1WHXA 4CO5A 1IKXB 2I38A 2RS8A 2DRDA 1QSLA 1KOOA 3SV4A 3M6UA 4H4KC 4X65J 3Q8RB 2QT7A 3OPKA 1CULB 1S0OA 2OEJA 4IH6A 1WKJA 2UUCF 3UNGC 3LWMA 2HHQA 3WC0A 3IWNC 1QD1A 5KT5A 5DM7Q 1X0FA 2XMJA 4P2MA 3S8SA 3FC9A 3N4WA 2R7WA 4P2SA 4IDKB 4C3LA 4NXNJ 3CIZA 2CNLB 2PEBA 1B0VA 5D6GA 1OSCA 4QIVA 5CYJA 3W3SA 1S1UA 1GH8A 3B78A 2DNNA 1VGYA 2L48A 4EWTA 4ZCMA 3K5OA 3OJSA 4LR9A 1M5KC 1OWXA 1GEHA 1XQIA 1TMJA 1HBUA 3IBWA 2RU3A 3PIOQ 3BDPA 1Y11A 1T95A 1CJVA 2XSJA 3W60A 4QWDA 1ULRA 4F3OA 1REVB 5KFZA 5CD4A 5AXNA 1LEOA 1X5TA 3T41A 2DNOA 2HBYB 2WB4A 3ZZTA 3R8YA 5F9NA 5J1PA 3M8PA 3NNAA 4K50A 2JEJA 2GHVC 2IRXA 2CXEA 4ES1A 1MROA 3O8WA 4O3OA 4DR2F 4FS2A 4JI8J 3DHWC 4MIWA 2ROPA 4OX7A 2XB2D 4XK8C 1UWBB 2V8PA 4F67A 5F8HA 3NNHA 1RCXB 2ZKUA 2EFQA 1QAXA 3CCVS 1HBUB 1PC4A 1OSDA 3D6TB 2DNHA 4OX6A 3JAMY 2KVQE 5AXKA 5I3UB 1FJCA 2JVRA 4TU9A 4IG3B 3PZPA 4ZK7M 2M5YA 3OTBA 2DPJA 2GVZB 3C46A 4CTAB 3QMQA 5GMEA 4ZVFA 1X9MA 2YPYA 5BR8F 4CH7A 3MOJB 4Q5VA 2YKNA 2XS2A 4LBHA 3H90A 1VYAA 3HHEA 1YJUA 2Q66A 4MIAA 1NUEA 6AT1B 3QT5A 2DIVA 1Q1KA 3CWJA 2BJ9A 4DV1F 3HCXA 5ETVA 2VG6A 5LMNJ 4E98A 3EZUA 2XLIA 2G0JA 4IRKA 4GC6A 2AEJA 2B9EA 4USIA 2OSRA 2BMBA 2CPIA 4OLPA 3MMBA 7FD1A 3KK2A 4H4MB 4QPXA 3N0VA 2RQMA 1ZTTA 2ZM6J 2EFNA 3F73A 2HNZA 1AZSA 2LCWA 1TVRA 2NXCA 2AGPA 1QE1B 1S59A 4RO0A 5F8LA 4A8OA 3EGWB 4JI7J 1YLXA 2F7VA 2RQ4A 4WYWA 1JJCB 5D0RA 1P8GA 3PIPQ 2JEFA 1WNEA 4CLLA 3MMJA 1FERA 2X51A 4DUZJ 1OIAA 1EKRA 2X1BA 3NG8A 4ICLB 2RT3A 5F0UA 4GO7X 2A6MA 4PRFA 2HIYA 1EAYC 3AD9C 3FJ2A 1D3WA 3HI9A 4JI0F 1U0HB 1PYOB 1X4EA 2KB2A 2PD1A 2XYHB 4DMZA 3D67A 4C8NA 4JI4F 1BXNA 3AJ1A 3PFEA 2DGTA 3AFGA 2FHJA 4HHUA 5L39A 2C3UA 2QL9B 2IYGA 4LF9J 2YNGB 1T9TA 2RDJA 4MFBB 1JJ4A 2ZH3A 1UCNA 1SIZA 4EZ6A 1K47A 2NCKL 1N5TA 3FBFA 5K9FA 2D3ZA 3TR5A 1T3NA 4WFAQ 5ETMA 1QVGR 5HO4A 4Y2MA 3TUPA 2YWFA 4GKKJ 2KYZA 4DR6F 5C42A 1OYEA 2KJWA 3M2VB 3OVSA 4DHVA 3C66A 4LSZB 3J7A1 2NXEA 1M5SA 2Y0SD 4RX6A 3KLHB 4DR1F 4IH5A 2RVJA 2EG2A 3J81j 1Z2ZA 1LFPA 3W9IA 1YZ7A 1RABB 3EDRB 5DDPC 3TQ1A 3RBEA 2XMVA 2IJRA 2ROEA 2BKNA 1E6YA 4O3RA 2B4UA 5C5JA 3DU6A 3MM8B 2AYGA 3DNCA 3FVYA 3T1HJ 5KG4A 3ET6B 2W2NP 4WFNQ 1RT6A 2LYVA 2A0FB 5J2NB 5DDRC 2GA7A 4F0HA 1FWPA 2IJFA 1AUSL 3VAFA 2V8DA 1HNZF 3L7UA 3R2CJ 3DXBA 3OTEA 1A6LA 2YQ0A 3I55S 5GAHI 4QPTA 2F1FA 2LP4A 3E01B 4L3NA 2HPUA 3H8YA 1R8AA 3DN9A 3SXLA 5KFKA 5J2MA 4LF8J 1Y7PA 1KTQA 3KUGA 3C15B 4A8YA 2V6AA 4OL8A 4DPTA 1KFDA 2Y1LB 4NXNF 2WCXA 2L9NA 2CWXA 5H9FJ 4BLGA 1QUPA 3TP2A 1WACA 2ACYA 2HWTA 3L7OA 4CLUA 3PW4A 4YY3J 1S72S 2RUSA 3ETOA 4KV8B 4P74A 5C25B 3ELHA 1WC0A 2R4FA 3HD1A 3OXLA 3QATA 1PILA 1HPZA 1NH8A 4ZOSA 2LA4A 4JOUA 2CQGA 2RILA 5J1EA 3EYZA 3BO3A 1MSWD 1UVLA 5ETOA 4ED7A 4PQAA 1PCAA 4LIRA 5DG8A 1HQUB 2QIFA 4OZ2A 5EUHA 4P2XA 3MM9B 2PDAA 3VWSA 4RW9A 2EC0A 4ZVPB 4IO1A 4JI2J 1DURA 4OI2A 4OLOA 5E3PA 1RZMA 4ANCA 4I2QA 2ZM6F 1T3OA 2N3LA 5T41A 3DXSX 4X4TA 3J7YI 5BYRA 2F5GA 3V6KA 4X64F 4LF4F 2H4WB 2DRBA 2QL5B 2XO6A 3OBIA 4AT1B 5FLXU 1RTHA 2YWWA 5A8WA 1TTHB 1JXLA 4Q43A 3L95X 2ZJPQ 4NLSA 1RACB 1LQ9A 1FVSA 1TL3B 1UKUA 2XMUA 3OFHA 5A6PA 4KT0C 4OHYA 1NO8A 2FHMA 4OYWA 5L38A 2FDNA 3DLJA 1Q8BA 2RIJA 3ZZUA 3M1VB 1ZAVA 4NA1A 4ED8A 2H54B 4F0KA 1ZAXA 4KTQA 2P9EA 3T5HA 2Y8YA 5BR8J 5HAOA 1MN7A 3CEDA 1JLEB 3IRWP 4R25A 2AZ3A 2A3JA 1MMLA 4I1TA 4M1KA 2EBEA 3AT1B 4X4PA 5CYQA 1N5YA 1BUXA 3KK1B 1O0PA 5KFMA 4RW7A 4YMEA 3N6LA 4USWA 3TZWA 2VDIA 4LR7A 4AXIA 1HMVB 2XBPA 2V0NA 3NGTA 3I31A 3MECB 3VQSA 2YNFB 9RUBA 1VBXA 2GV1A 5B7WA 3TAPA 2CQDA 4DL4A 2CVEA 4MH8A 3HMJG 2G0CA 4J9OA 1R0AB 3IGVA 3KG0A 5J1NA 3VV2B 4DV4J 2KFNA 5I4MA 1P9YA 3E3XA 1Y3JA 2VV5A 1N5SA 1R8HA 2HAIA 2OD4A 3I82A 1GMWD 2WRMA 3MEKA 4PWWA 1P6TA 3UCGA 2B4VA 1JJ2R 4FF3A 3LGMA 1S6PA 3KLHA 1QM9A 2CPDA 4FYVB 5GAEU 3SYZA 4F26A 2FD2A 1U2FA 3CF5Q 1TL1B 4F36A 1JX4A 1TFWA 3QRPA 2ZZTA 5FD1A 1Q81T 1U09A 2HHHJ 1RWWB 3IM8A 2VBWA 1SV5A 2FZCB 4OYOA 4C0HA 3WIUA 2MZRA 4B17A 2MSTA 3D6MB 4GVBA 1ZAWA 2G0IA 4C0BA 4RUHA 4DSLA 4FF1A 5AXMA 4QYZK 3J80U 1Z4UA 4FBUA 1PJ5A 5DJBA 2WSFC 1FXLA 4DCPB 4P6QA 3RBZA 2XGPA 3EX7B 5ITHA 3VAMA 2H1YA 2VC0A 4RBUA 1X31C 3HHLC 4NX9A 4X65F 2QEXS 4UOFA 2VQEF 1EARA 2WVFA 3F44A 3LP1A 3U27A 3CJQA 1C0TB 2D3O1 4DN0A 5K8OA 1HNXJ 2VJVA 5HVGA 5KG7A 5C7PA 1RDRA 2FJBB 1R3NA 2P9GA 2HNDB 2ZNZA 1TV6B 3HSDA 3PCOB 5A6WA 3J81Y 3GIIA 2R2TA 1C0TA 3TANA 1Q0NA 2KZZA 5IM0B 2Z57B 3ZZ0A 4Y3CA 3NS5A 2P5VA 4RWXA 4D3GA 4CIOA 4CQ1A 2F65A 5KFFA 4M94A 4KFBB 3CJ2A 2W2QP 4H4MA 3TRGA 3MTJA 1TKTA 1SKWA 3IC1A 1WEYA 3FNNA 1RISA 3L9ZA 2ALYB 2QTWA 4GVBB 3M30B 5KOWA 2FHJD 4ZPVR 4FKXA 3W62A 3BEGB 4GKJF 2VD3A 4LFAF 2IVFB 4LMZA 2MHNA 1T03A 4P75A 5GAGU 3SSRA 2B5JA 4NL5A 5LOQA 3KK3B 3K59A 4DFKA 1X9WA 1R6YA 1VQ6S 3N5FA 5D3GB 2IYIA 1IBKJ 1Q78A 4NLUA 5DRKA 2QL7B 3MFIA 4IG3A 5HMYA 4K4VA 3CJTA 1UW4A 4A8XA 1TKZA 4ILMA 1S9EA 4LT6A 3KJQB 4JBCA 5KAKA 2AYBA 1VBKA 1V3RA 2W4CA 4IH7A 2JNJA 1FE0A 3EPIA 2VL1A 4N56A 4BWMA 2XZDB 2BW7A 5E33A 4FP9A 3G6VA 4K59A 2DNGA 2XCAA 3GJTB 1FDAA 2IVYA 2JX2A 2OPPA 4WK1A 4XTTA 5MAOA 5H9EJ 4NXMJ 3P49B 4ZJLA 4CO2A 4WBFA 2HS3A 3M8RA 2R7OA 3DU5A 1FDBA 1RLDA 4Z37A 2UU9F 3TJ8A 4U96A 1M90T 1I94J 3M8QA 1TELA 1UPMB 2J7KA 4BCAA 2C3MA 2DD8S 1RAHB 4ZPTR 3CGIA 2B9WA 1LXJA 2J9CA 2CQBA 3GFZA 1WTBA 1REGX 2OPSB 3T19A 4IR1A 4XAKA 4C97A 2CQ2A 2HHUA 1V3SA 2KN4A 4X4RA 4IRCA 4O23A 1N0UA 2XWXA 3C6TB 1NJZA 3NMAA 6FDRA 1X4AA 2EW9A 2W2OP 2CQCA 3OT9A 4WFXA 7AT1B 3G82A 5B0CA 4ED4A 1PAEX 2YX1A 4FF4A 3I9V9 4WU2A 1NZAA 1RGVA 3OTOJ 3S01A 2P9CA 2F8MA 2AJ0A 1HFEL 3R7BB 3ZC4A 1Y4ZB 4RW9B 4A4JA 2W9CA 3T1YF 2UVVA 3GFXA 1CC8A 1KN6A 4LFBF 5KFAA 1UEKA 4HI2A 1CPZA 2Y1IA 3H2UB 1S9GB 3CJ5A 3J7ZT 1U4BA 4W92B 2YWGA 5EX3A 2FVRA 2PMHA 3GPAA 3GYNA 4TKTA 4C0OC 1NK5A 2EBGA 4KV8A 3H2VE 1LV5A 2RD5C 5HVHA 3MI7X 2HQFA 2AD9A 1URNA 2BZ2A 1N4LA 1S57A 1X0PA 4KKOB 3A12A 3Q2TC 1JLBA 4IKAA 2JOQA 1R0CB 4RPFA 4ZVSB 1GTHA 4O3NA 3FZBA 4YDDB 4ZIVA 4EEYA 1XMQF 2DRAA 4U9RA 2DR5A 1RHQB 2C3PA 1QAJA 3DLGA 1XMBA 1P1LA 1JIHA 3PYFA 4RR5A 2V34A 2CPHA 2W8KA 3QLHB 4LVOP 2CVIA 1C4CA 1Z2LA 3VGUA 5LSOA 1C1BB 2HNDA 1RT5A 1KTVA 2R2UA 1TKXB 3HFZB 2ATLA 1M1HA 2VG7A 1I94F 4LF4J 2D41A 3RAMA 5K20B 1FRXA 2RAQA 2GZOA 4WFZA 1XNQF 1SPBP 1RT6B 3BN4A 2AW0A 1K1SA 3LP1B 5J2NA 3DGPA 4RLEA 2OIHA 4DQPA 2V4QA 3MM8A 4DL6A 1OYDA 3L09A 3TARA 4QW9A 4NXMF 3EZOA 1HD1A 5HK4A 3BS9A 4DFJA 3DLKA 2UV8A 1HBMB 1VJWA 3DM2A 4U7CA 5IFMA 1RT3A 1YRXA 3PRVA 5B0FA 2VH7A 2DPIA 1TMMA 2VG5A 3IBCB 3OD2A 4IFYA 1VQOS 4OYMA 4ANEA 3MM5A 1RT1A 3LF0A 4J9VA 3QRRA 4B3OA 3D3CJ 4JI5J 4YS2A 2FLNA 3OL8A 1NJWA 1BHNA 3A8IA 3W66A 3NWRA 4DX5A 3NGKA 5C42B 2DXDA 3ADAC 2FB0A 3TAQA 3WQPA 2XHCA 2R9LA 1RI7A 3VQTA 2YH0A 1UEUA 4ZN3A 3D1QA 2GHWA 3PKYA 1WHWA 1ZPWX 3CDUA 1DY3A 3IR6B 2XM3A 1NNDA 3B4MA 5KT4A 4G1PA 1URRA 1VC6A 1S6PB 3A8EA 3NCQA 4DR7J 5U47A 5KFOA 3EJMA 4AL6A 2J6UA 4MT1A 1RKIA 1ZOTA 3D5MA 3NWGA 4OHVA 3S6EA 5F8MA 3TVZA 3DRXA 1H7XA 5K14B 5B0EA 5AE1A 3NCRA 1F60B 1I5OB 5HL7Q 3MEGB 1NSKL 5BYSA 3KJVB 4ZVRB 2GQQA 4LQ9A 2XWYA 5T7LB 1N36F 4ECSA 1HMVA 4K2JA 4DR5J 2FJWA 1WC1A 1NBEB 2OLWA 2VBYA 3U1MA 5BYQA 4FNIA 1RAOA 1VRUB 2CFXA 2QZ8A 3BDEA 3BYRA 3QGHA 2SXLA 3W5ZA 3V81A 2R8JA 4F2RA 1OPIA 2CZ4A 4KO0A 3H4BA 4F02A 2A10A 1R27B 2W7PA 4KHRA 3PDNA 1YVFA 3I4PA 1R89A 3M1VA 2HQ3A 4HVZA 2G9OA 4PQUB 5DLFA 1YJTA 2EK6A 4DPYA 4IO9Q 3I87A 1U1PA 5H9FK 3GG0A 4G3IA 3W63A 3FBEA 3T6BA 3CJSA 4UZBA 2DY1A 4FVCA 1FJGJ 3W2WA 5A8WB 1YTYA 3KNAA 2XZTB 1AROP 1WDTA 1UJ4A 1YBTA 3SI8A 1M5VC 2UXCF 4YR2A 1UL3A 3FSIA 1N33J 3ZZYA 4CTAA 2V9WA 1J2VA 3MF5A 1K1QA 2BUNA 3DDNA 2LMIA 3Q2SC 4I2QB 5B0BA 4IUFA 2OFGX 5L9NA 1GMVA 1AFJA 3SSSA 1ICEB 1NPKA 1CSJA 2HVZA 2KVIA 3N5BA 4MK7A 4M5NA 4DXLA 1IKYB 1RTZA 1RAIB 2KG0A 3D28A 5F8IA 2KTQA 3GV5B 2Y1JA 2I2YA 3A3OB 4YFUA 1JLFA 2G13A 2HZCA 2F3JA 3UVJA 3VHQA 1D9FA 3OL9A 3MGJA 2CZVC 3UE2A 4BC9A 4G1QB 2ASDA 2BJ1A 4R0JA 1NMEB 5A2QY 2P8IA 3H42A 3THTA 5HMXA 4L75A 2XS7A 2AGQA 4UZCA 3MD1A 3HK2A 1X4GA 3CO0P 1Q8IA 3VVUA 3HZGA 4FYXB 4DR7F 2GQ2A 4RNFA 2OHDA 1MU2B 3KDNA 5B0AA 3UDCA 2DGOA 5J2MB 4FYWB 3ZFVA 4LF5F 2DY9A 4O4RA 5KFQA 4UQGA 1RWPB 3KUEA 4N76A 3HHDA 1UP1A 3NGRA 1UJ6A 2MQNA 1N5VA 4OZ1A 4P10A 5CD4H 5FDLA 4OJ1A 4OHWA 2YQ3A 1G7CB 3OR1B 4A48A 1W7WA 3DOKB 3PYGA 2OUGA 1ZPVA 2GMLA 4UOCA 1Q4RA 1HW8A 2HKEA 4OIXA 1WKKA 2E66A 4ZVTB 2E1PA 3DGVA 1RHUB 2ADCA 2ASLA 1NKBA 2HBZB 1LOUA 5CCMA 1MN9A 1FKOB 2YWKA 1IJEB 2Y1RI 4WFBQ 3RRHA 4NCBA 4I0WA 1TU0B 4MYTA 4PXCA 4O3QA 1RQ0A 3D2WA 2LQ9A 1DBDA 2HRTA 3FK4A 4KGXB 3RAXA 2JL9A 1CJTB 3GE9A 4MKAA 2HHTA 3SV3A 2JSXA 3QRQA 4M8LA 3TA0A 4B08A 3QFWA 4JI0J 3I0SA 3VAKA 2R3VA 3PW7A 3TX8A 3MAAB 1HWLA 4MKBA 1LWCA 4Y0FA 1RAEB 2Y3YA 5AXLA 3MUTP 1U1RA 4ZJQA 1TL7A 2H5IB 1YGYA 1EP4A 2CJXB 1S7HA 5ETTA 2R8IA 2EFVA 2DO4A 2WW4A 1DHMA 2IM2A 4FXWA 4TU7A 3IG1A 4EGLA 1F2GA 2YKMB 3CD7A 4P7TA 5HQMA 2YKMA 2V5HG 3FKBA 4RUAA 3M9NB 1T7PA 4QZVB 3BSAA 3ZTRA 1XR6A 4C11B 2BEFA 3ILLA 1J5OB 1I6JA 4V1Ak 4RL1A 2WSEC 1K8AT 5D15A 3B82A 1PSDA 5GAHU 1VLYA 1Y5IB 2E9RX 1RBOB 1IM6A 2ZE2B 1UVJA 5KOXA 1TVRB 5KFDA 4ECVA 1XMQJ 2CJ9A 3GFHA 3MCOA 3K57A 2UVRA 1SH2A 5IV4A 3R1HA 3RB0A 1KSPA 2H48B 1BWVA 2UXBJ 3JSMB 3LPYA 2DT9A 4GRSA 4LBIA 1U48A 3OQ2A 3HVAA 1F6TA 1H98A 4NASA 2QYCA 2LQ5A 1M1GA 2QMWA 3ILOA 3PYEA 3R6LB 4C4WA 3SDEA 4I7FB 1GX6A 1NLKL 3KNGA 4DV3F 1FJ7A 3OFGA 1JMTA 1Y3KA 1FFSB 4B9MA 3T3FA 3T1YJ 2CQHA 1G2EA 2YXLA 1H74A 3HF5A 4DR1J 3M9MB 1R8BA 1GXLA 2GS8A 1U24A 1L3KA 4AYBD 4DN9A 1G1XA 2ZZMA 5BXIA 3VGVA 1SQFA 1OY6A 3WHIA 1HHQA 2GVZA 4TLQA 4DG1A 4DR5F 1VQKS 3CTRA 1VRTA 2C3YA 2IRUA 1KONA 5I3UA 3BQ0A 5ETPA 4M5JA 3M05A 4JI6F 3RTVA 4E2FB 4ECYA 1UMJA 3NLCA 3W2VA 4CM0A 2NREA 2FGOA 1DFDA 4B3RF 3QIPA 4RBVA 1PJ7A 3HHKA 1N6QB 1HW9A 4X84A 3CO9A 3DC2A 4N7TA 1MROB 3EZ5A 1QVFR 1R7IA 1O51A 4RNMA 4DSIA 5DM6Q 1L3SA 3CD6S 2LA6A 2U1AA 2YNHA 1U0SA 4NCAA 1RHRB 2QV6A 3R5BA 4OX8A 3NMRA 4WXOA 1IBCB 3AJ2A 4WKRA 3HSZA 3K89A 1NPRA 2W25A 2RQCA 2MKKA 1DAXA 2DNMA 1D0EA 3D1HA 3D9BA 2KRBA 3M2UA 2MQPA 1S1UB 2BM1A 3I5CA 2OAUA 2EFGA 1JLGA 3MOZA 5JUMA 2A6OA 4DX6A 5K8PA 2BANA 3RBDA 4G6VB 4QCLA 3BV8A 4K8RA 1ZYQA 4IFVB 1NB7A 2PFFB 1R8PA 2QMUB 4MK9A 4KGZB 3ZTPA 4DZ6A 1KDNA 5HQLA 4QQBA 5HP1B 1OO0B 3V2UC 1VC5A 3I4HX 4BC7A 2Z0GA 4PQUA 2IM0A 2W9BB 4B3MF 1IKXA 4TQRA 3AD8C 2XMKA 4L6V3 3BGRA 3TOQA 1JJHA 1NH7A 1NZ8A 2CJYB 3B8HA 5IWAJ 4P71A 2FGCA 2F9JA 3TAMA 4HT7A 2AIRB 4BDPA 3FRZA 4YB7A 1IQTA 2FY8A 1FT8A 3KFWX 2W24A 4P7VA 3FBCA 1HBOA 1P1TA 3TAMB 1HR0J 1K0TA 4QYRA 4WZQA 1JQGA 1MMDA 1YBAA 2IDEA 4H54A 2DHAA 3RGIA 4MTPA 4QR2A 2FVQA 4DR4J 3BH6B 2NUUG 5CABA 3AD7C 2RKIA 2XTJP 3H5UA 3KUHA 2O3DA 5GVQA 4Q0BA 3KLGA 1Q16B 2L9DA 4C7QA 1YJNS 5L46A 2MKCA 1UFKA 1YJWS 1SI9A 2H5EA 2V2VA 5HBMA 5HP1A 1VK3A 3LPEA 4WIQA 1I3OB 1VQSA 3W5YA 5H1SV 4OYPA 3QGIA 2VQEJ 5L1LA 4GO5X 1IVZA 3DDKA 4IFVA 2ZUGA 2DNQA 2MQ8A 4CNYA 3O6QA 4ANDA 4KHMA 4JV5J 4OZ0A 3QWUA 4CCHA 4JP8A 1WG4A 1X5OA 3C6UB 4NYPA 4WPAA 3N6MA 4Q2MA 1IXKA 4Y34A 4ZPCA 5KFIA 2DGQA 1VQ4S 1FKPA 3D6HB 2GFFA 2CKWA 2IM1A 3DLBA 1WF0A 2CNOB 3I5BA 4XDDA 2FJDB 1V3ZA 5JXSA 2OTJS 2LU2A 1NSAA 1BQMB 4HT5A 4QR0A 4TY8B 1IM4A 1AA1B 4HI1A 4JV5F 3DLKB 2I0XA 2J76E 2NXUA 4P9SA 4DF4A 2ZFHA 2AX0A 3IGNA 3CCLS 1VQ7S 5HANA 3KG1A 2IVMA 3NEKA 3TX0A 4CO0A 3MZIA 4N47A 5GAGI 2ZH6A 4DFPA 2YX7A 1S10A 1HYSA 3ETMA 1N6QA 4CZCA 4ATNA 1YIJS 3HKZD 2DGXA 1XEZA 2GGPA 3DYAA 1WHVA 3QAUA 3QPIA 3CJ0A 4DZDA 1SC4B 3BPSP 4Y65A 4RNOA 2E7WA 4RU2A 4ZVQB 3PVXA 3P5TL 4YR3A 1HR0F 4DG1B 3Q23A 2CUYA 4H4KA 3TWZA 5IXUA 4MK8A 3AB4B 1U25A 2ZWOA 3L4BC 5DZ6A 4EK2A 2L41A 2RH3A 4GVLA 1WG5A 4HTIA 3OLBA 2DHGA 2LEAA 3QIDA 3UN5A 1IBKF 1XC9A 2X1GA 2Q3PA 4J9NA 2OKQA 1RHMB 2PFDA 2J9EA 3F56A 3QBCA 5KFYA 3NNCA 2XI3A 1WUUA 1NHUA 4A8KA 3CC4S 5HMWA 2OH2A 2WK4A 1RTIA 4ILRA 2XQCA 3CDBA 2P6TA 3ZXWA 4GKJJ 1WC6A 1TAUA 2R7UA 1S7IA 3CC2S 4AUKA 2FC9A 3CCWA 3I9ZA 3LW5C 4F3QA 5J2QB 1U6BA 3J7AN 2APOA 3ZZOA 1Y5LB 5IWAF 3GU0A 2XY7A 2PMWA 4QIGA 2J0SD 1VQLS 4KJIA 5GMDA 1JK9B 2XULA 1DTTB 4F4AA 2M0GB 2HGLA 2HS4A 3W64A 2J8AA 2QA2A 1RSCA 1EKSA 4HDGA 1N88A 2HFSA 4ENOA 2WSCC 1L5UA 5D0GA 2W4DA 1VDHA 2YH1A 2I6WA 3G8SA 4DL3A 5EGYA 4QU7A 2X1FA 3HDSA 1KVJA 1NDCA 2VQFF 4FDFA 3U1NA 1SVDA 4DPUA 1RTJA 4C3KA 3BGLA 4DR3J 1CJUA 1FXRA 1QAYA 3EICA 1Y10A 2BYCA 1T02A 4CH1A 2NQPA 2HHXA 5EN1A 3IWLA 2R7SA 3LP2B 2CQ0A 1TL7B 4MKVA 1SJRA 1IBLJ 1QTMA 2VBXA 3WX8A 2XLJA 1PGZA 2BJ7A 2Z2MA 3LOUA 1QJHA 3C14B 3MCNA 2EKNA 4ZHRA 1U02A 2EFPA 2XHWA 1HWJA 1RHKB 3Q83A 4R5PA 2I8EA 2VKRA 3OLAA 2K8GA 2UVWA 7FDRA 1CJTA 2YQ1A 3SFGA 2AJ2A 4CYUB 2I5JB 2H65B 2NXJA 4ZIWA 2JH3A 3BN7A 2ZOMA 3T9NA 3EGZA 4Q8FA 1C0UA 2CPZA 2CDRB 2O67A 1WF1A 3GG1A 4LQ3A 2G2YA 1S9EB 3PY8A 2KRRA 3C3LA 4I6AA 1S0VA 3MMAB 4ZVOB 1FNMA 3EVOA 1S0NA 3RW6A 1RCOB 1RWUA 2W7AA 2WB1D 2YKAA 1RWMB 3H20A 1LW2A 4A46A 3G96A 2FVSA 3DLHA 4QOTA 3QWPA 5C24A 2DTJA 2K06A 3BKFA 4WCEQ 4K4WA 3OR1A 1T03B 1W2IA 1N54B 3NGUA 4TNOA 4DV3J 2JRSA 2XSFA 1RWVB 1RWKB 3LANA 1O8BA 3IAM9 2VFSA 1UETA 3LAKA 4HEA9 4I2PB 4Q44A 2OTLS 2VOPA 2MTLA 1WWHA 3IM9A 4IYQA 1QY7A 4KBIA 4UTGA 5LT5A 3DLLQ 2BE7D 1BC6A 3DOMA 2XGQA 3OTCA 1R8CA 1LKZA 1U2RA 4UY8T 4YOEA 4KIAA 4L72B 4K7QA 1C4AA 2BM0A 1PYTA 3W65A 3VTIA 4WU3A 4B02A 3GV8B 2W9AA 5ETNA 1VHFA 2K3KA 4ZPBA 2K7KA 3KDOA 5E2QA 3MM6B 3QQCD 3MR2A 3JQJA 1VR6A 2BJDA 1VS3A 1RAAB 3NOCA 3UVJB 2BA9A 2CPJA 3QAEA 4R8UB 2DGVA 1TV6A 2LDYA 3DOLA 3FQKA 3LP0B 2XO7A 1ZH5A 2AYMA 1U1OA 4CLPA 3PFOA 2K7JA 1UWAA 2DH7A 5CYMA 4KRWA 1B64A 4XPCA 2HK2A 3HULA 3A8KA 3EMTA 3PX4A 1LW0A 5A8RB 1KC8T 1GFWB 4ZP9A 1SCJB 2MXYA 2HFUA 1V5IB 3RU0A 3BKTA 3GONA 2KKHA 4U6PA 5DGAA 2DNLA 2MKJA 4WE1A 1HL6A 3TUJC 4JV2A 1FI4A 2Q79A 2QLFB 3D68A 1FEEA 1D8ZA 1GMUA 3W2WB 3RB4A 2RF2A 3BBFA 2R2SA 1GK8A 2HGMA 2G1DA 1WSVA 2GVDB 3EM1A 2E1AA 2P2CB 4HACB 2DEJA 2CQ4A 2IAJA 4J9SA 4DS4A 3KTQA 3C16A 4OZ3A 3C19A 3SCJE 4NLYA 3SEOA 4ALZA 5KFWA 3PR4A 3SQOP 3DRYA 4D3HA 2WBRA 1OMSA 2CWKA 5D4LA 5LJ3Y 1NK0A 2CIMA 1N33F 2RS2A 5C2CA 3Q0AA 5L1JA 3PJWA 5LL6d 4KO0B 1APSA 1K73T 1FRLA 3DRRB 4XDCA 3U7JA 3V81B 4OV1A 4LRCA 3IBFB 1OS5A 3UCZP 4LIWA 5CA5A 1RJJA 4J9RA 3ICLA 2R7VA 4URGA 2MZJA 4JYAJ 2GJ2A 2QX0A 2FJVA 3MPDA 3ZNUA 4NYZA 2YX4A 4DUTA 2FLOA 2YNFA 2XEXA 2CJKA 1LFWA 3IA0A 4DUYJ 1H2UX 2HMIA 4C48A 3V4IA 4LF5J 3GSIA 1KS2A 2L9WA 3G2XA 2V4JB 2NS1B 1S49A 4RW7B 4OJGA 3CJKA 5BJRA 5CYQB 3VGTA 3BQ1A 2VPYB 2OJ3A 2AP6A 2W2PP 3VZHA 2E7VA 1HWKA 2OPQA 4ZS6A 5IOLA 4JI8F 2R7RA 5KG1A 2D74B 3CMQA 1K0VA 4ZPWR 1UA1A 2A18A 3PW5A 2ZBCA 4GKKF 4PWDA 1VLOA 1ZS6A 5DQHA 5C2GA 4LF1A 2VASA 2UZAA 3V6JA 4FF2A 1KLMA 1X4DA 3MDFA 4C3MA 4X4UA 3FFIB 1YKWA 3PXGa 4HACA 3X3UA 2MZQA 2DGSA 2HBQB 3VF0B 2ZDPA 1BE4A 3MM5B 2JVOA 5I3PA 2ZOGA 5HROA 4BBYA 3DRPA 2MGZA 1SJ3P 2RU9A 2MQQA 1JWWA 1F9HA 2OEKA 3MUVP 4JI1J 3UDLA 1FX2A 1BLUA 2W7OA 1S6OA 4P73A 1HBMA 3DM2B 1B4SA 2O66A 3TZZA 1TP7A 2VPZB 4F2SA 2HQCA 4LRBA 1XJWB 4X4SA 1WDDA 2XMMA 2HSEB 5GMKa 4FYDA 1FRIA 2RNEA 5A8KA 4C8OA 3KJNB 3MM9A 3MHYA 2E5LJ 4JI7F 4CM2A 2EFOA 2IBOA 5DZ7A 1WG1A 2VU5A 1IBLF 4U7UD 4ES2A 3PEJA 4I4BA 4NEYA 5J1EB 1RT5B 5SZTA 1RK8A 1C1BA 3DOLB 5CZVA 3RUBL 1RB0A 4DUZF 2H5JB 2XY6A 3GB0A 1KFSA 1S4FA 4ID5A 3TA2A 2OP5A 2V67A 3DLEA 4GMKA 5DLGA 1N52B 4NI2B 2NXNA 3Q8UA 3BO2A 1NK4A 3TA1A 4OI4A 3ZO7A 1XNQJ 4PG6A 1O6XA 4J91A 3MM7B 1HBNB 4DV0J 4OQJA 3NY0A 3CT9A 3T5JA 1VHIA 1BMQB 2M70A 3DLEB 4DL2A 1N36J 2F4VF 1SQGA 1L3VA 2VC1A 1S9GA 3TYTA 1U7LA 4RUCA 2CRLA 3LAMA 1S1VB 1ZA2B 4MYUA 4K4SA 1FD2A 1H7WA 2BJ3A 3KLIA 3OSNA 4J7CA 1FJGF 1KQSR 1WTFA 1U8SA 2W9CB 4QIFA 3GJSB 4ZVHA 5L8RC 2DNZA 4ZKAA 1K44A 2D7SA 3MPVA 5HI7A 4U67Q 3UD3P 2R7XA 1S1TA 3GSDA 2WZ1A 2EPIA 3ZTQA 1GXTA 3D0GE 2H4YB 2C2KB 4ZITA 1B3TA 5E3RA 4Z7CA 4JYAF 2BOAA 4N8NA 4ELTA 2HHSA 2BVZA 1Q5YA 2MGZB 2ERRA 3GLJA 3P4UB 4F0MA 2DNKA 3MUMP 1AXQA 2BRLA 1PBAA 3IR7B 3VR1A 4CYUA 1QAIA 1SC6A 4JI5F 1D09B 2J7UA 2Y0BB 3OTOF 3LA0A 3NRBA 5DDOC 4CWBA 1DZ5A 5DO2A 2RRAA 3ENQA 4L76A 5IT9U 1S99A 2OSQA 2YNGA 3M8QB 2YY3A 1H0HB 3C14A 3JXOA 4FN5A 4UF4A 3GIMA 1U1NA 2XCPA 3D1OA 3IS9B 2NPFA 4NZ6A 5J2PB 3W61A 2JEGA 5F8NA 1KRPA 1A0OB 3WC2A 1FTCA 1J5EJ 2HK3A 3IXQA 3D4JA 2UV8G 3R5JB 1KR4A 2V4JA 3TZXA 5AE2A 1FVQA 1HWUA 2HFVA 1XMOJ 3R5CA 1WOOA 3IP0A 3N79A 3AA8A 3THVA 4ZLNA 1M5HA 4DQSA 1RE1B 1DRZA 3VCDA 1BD6A 3EVWA 3MR7A 5KG6A 3M2RA 4LFCJ 1DLOB 2JFDA 2OPRB 2DHSA 2BR0A 2XLKA 2POKA 2OI2A 2XI2A 1DTQB 3KXDA 3MEDB 3UD5A 3PTWA 4CDIA 3A3PB 3WIVA 3BJYA 4DR3F 1WJ9A 4QWBA 1T8EA 3QJJA 4NLXA 2HFZA 2WVDA 3CCUS 3MCMA 1B0TA 1VFJA 2C2NA 2V2QA 2J9DA 4DCJB 4EI2A 2X1AA 3QO9B 4PYDA 3M4XA 1VQ5S 1OY9A 4NYOA 1S9FA 4B9NA 2KYXA 4LF7J 2XC9A 1WC4A 3PHTA 3HM9A 2G4BA 4ED5A 3D54A 2JEIA 3VVTA 4WKYA 1D9AA 3C16B 1KQGB 3HVWA 4ZJOA 2PC6A 4ECZA 3ZZRA 4N77A 2IAJB 3EXYA 1X5PA 3H5SA 5JMNA 4IG0A 3SMZA 1RBLA 3H5YA 3H0PA 4EBEA 2C2MB 2M3DA 2YPZA 2CPEA 3F0NA 1TKTB 2QC3A 2YVSA 3IRXB 4M5KA 4M63A 4ECXA 4JI3J 1FNOA 1NKCA 1X9SA 2FVCA 5E5NA 5A8RA 4C8LA 1OY8A 4L73A 2OPRA 1FTRA 1QTNB 2DNPA 5CYMB 3M2RB 1LK5A 3M8WA 2KDOA 4M5HA 1X4FA 4TYBA 2HVHA 2WTFA 4R8UA 1EQ0A 1QDUB 2DGUA 4RW4B 2HVEA 3N28A 4ECWA 1RADB 2BQUA 1JLQB 2CAJA 2DKOB 3MM6A 4I6YA 1U6ZA 4J9UE 4DSEA 3KHLA 3GMGA 5KFCA 3KLFA 4ZVEA 1HHTP 3FSXA 4NZ0A 4KAIA 5J2PA 3LO3A 1D9DA 3U1LA 2J0QD 1CJVB 1TZ0A 1KQKA 4O4GA 4E0DA 2CJQA 2C2ZB 2HRYA 1UEVA 2H51B 1KBRA 1T05A 1B7YB 5CZXA 3I5AA 3CPWR 3DFEA 2WVCA 3HJFA 3PR5B 2MEWA 4UW2A 3C6UA 4ETZA 4B3TF 2UXDJ 4JV0A 2MHEA 2VOOA 4IDKA 2PSZA 2ZBIA 5HN0A 3HHLA 1HWIA 1J27A 2VFUA 3AB2B 1AUDA 2FIUA 4KGKA 4B9SA 2CZ9A 2XNRA 4U95A 2HW3A 2QA4S 2ZH1A 4K4UA 3TUZC 3B4DA 1Q82T 1R6VA 3MD3A 5G4DA 1ACMB 4M5DB 4ED6A 4MMOA 5F41A 2HHHF 4BHQA 2ZDOA 3LQVA 4EYIB 3CMES 2LEBA 3M8ZA 2RKIB 4Q0BB 2ZBQA 1MLAA 1C0UB 1TL4A 4LRFA 2C1EB 5CAAA 1VBYA 3E8OA 3BGOP 2H9ZA 1K9MT 4ZN1A 2MKYA 5EWEA 2DITA 5KFPA 1WC3A 1FWLA 1C1CA 5T14A 3KOAA 5K5MA 3VAGA 4ZLLA 2FY1A 3V6DB 1BY9A 1HA1A 2GAGC 4OI6A 2GHPA 2ASYA 5E3AA 2R8GA 5D0HA 4FPRA 4GC7A 4LFAJ 4CT9A 2ZD1B 5FIIA 1JLEA 1YRTA 3I0RA 4USHA 4ZP7A 4ED0A 2CPFA 4J37A 2XYPB 3T9ZA 1CJUB 2DR6A 2W9BA 2K1RB 1S79A 5E3QA 2QFIA 4LSNB 3V4MA 3PV8A 3OHAA 3QSYB 3CCZA 4ZVGA 2ZKTA 2HBRB 1VK8A 2C42A 5THWA 3UN2A 2MKIA 4ECTA 2HYIB 1GNKA 1TL3A 1TUGB 1WI8A 1S0MA 1ROFA 1F3FA 1RTHB 2A2CA 2KXHA 2YWHA 2LEPA 1H38A 1NK7A 4LF7F 1RXOB 2AJQA 5KFEA 3HX9A 5H9EK 2M8DB 2HNYB 5A8KB 3P96A 4I68A 1FHTA 4X2BA 5ETQA 1OJ4A 4O0IA 3J7YU 3KLEA 3SBMA 2MLXA 1FRJA 2NLWA 3HVTB 4LFCF 3EUNA 5HSPA 2UUWA 2R42A 3DRPB 5HROB 1N8RT 2QE5A 2JC0A 3D6FB 2IC3A 2W2MP 3B6BA 4K2XA 5RUBA 2PI5A 2OMLA 1RWNB 3I32A 1XNRF 1NDPA 1VQYA 5ETKA 5L1KA 1XMOF 5KFXA 4QIWD 2R7QA 5IT0A 3ILJA 2VIHA 2E1RA 2MKSA 1FF2A 4C9DA 2PE8A 4UOGA 5L1IA 2CADA 3FUYA 2AEFA 4EUVA 2IA0A 3LUYA 2HIQA 5F8GA 2MKHA 2ZZNA 5A0YA 3PX6A 1F1BB 3ZTSA 1LK7A 4AE5A 3CJKB 4PG8A 4WTOB 1YITS 4NWBA 1YSJA 4OJHA 3MEEA 1M5PC 2AX1A 1Q5VA 3W7BA 5IS2A 5KFJA 4DX7A 2JWNA 4YEAA 2DNRA 3PG9A 1V9OA 1YX2A 2HMIB 3TQEA 3HLUA 2NZ4A 4B3RJ 1RA7A 1H73A 4O0NA 4IOAQ 3OVBA 1WOPA 3ET6A 2VODA 4C8ZA 1Z1ZA 1IQZA 1F9FA 4WJBA 3HHNB 1EX8A 1X5SA 4DLEA 1E6YB 1SL0A 4FXDA 1YJ7A 3SCKE 1SH0A 2LQJA 1SJ1A 2MLYA 4QIEA 4TY8A 2VZ9A 1ZETA 2UUCJ 1DARA 2BACA 5GAEI 5FLXY 1JNRB 3GV7B 3Q22A 3FGVA 4QW8A 3HPOA 2KM8C 3BR8A 4EO6A 3K0JA 3M2VA 4USJC 1CC7A 2IHR1 3TVKA 3MFHA 4AL5A 5LXYA 2JLFA 2KH9A 3JYTA 2F4VJ 3UCUP 2BQ3A 3M6VA 3FDSA 2JLGA 2RF2B 2ZC3A 2HG4A 2WBMA 2IFXA 2R8HA 2FLLA 2HZVA 2HFNA 4JB8B 4RWWA 2GJFA 4ELUA 2E5HA 2MY8A 1F5CA 2GJIA 2HAFA 5HBMB 4WTYA 3KHGA 3CDWA 2AHOB 2CDQA 3R5AA 3UI3A 2ZVIA 3V5RA 2HS0A 3OL6A 4FXVA 3K7RA 5LMUJ 4KHPF 1KLNA 2GCFA 3JAMU 6FD1A 1ZZNA 2OMOA 2RMLA 2WONA 4X4VA 4Q8EA 3I0RB 3CJ8A 4TN2A 2K2PA 1CLFA 2ZD1A 2OFHX 3BSCA 2KL8A 4FKYA 2ZHOA 2NSBA 4W4MA 3LALA 1SIWB 5KFTA 8RUCA 2NYIA 3MAAA 4DLGA 2IY5B 4Y2CA 5ADZA 2BQRA 3FCHA 3R5GA 1SJ4P 4CLZA 3PJXA 1BQNB 1TQLA 2DCUB 5I3QA 3DRSB 3PW2A 3MMBB 5KG2A 3KK2B 4B3SF 4JI1F 2ILYA 4HTJA 1V5VA 4WFYA 1Q95G 3K8WA 1TK5A 4OI3A 3BGUA 1FEHA 3K17A 1PC5A 1JLCB 2KZMA 2LLZA 2VG6B 4ED2A 2AV5A 2VFVA 1LWFB 2MZSA 2XNQA 4PEOA 3BO4A 1J5EF 1EQMA 1WSRA 2Z58B 4WP3A 5FJ4A 1XK8A 1O5JA 2VB6A 4A8SA 5M2PA 5HATA 3US5A 2E5JA 5KFGA 4XO0A 1VQPS 3G4SS 1YG0A 3FEZA 2FPHX 2HQGA 1WOSA 2B8PA 2V8HA 2VBZA 3HHLB 2M9KA 4DV4F 1D1UA 8ATCB 4KH0B 2IPOB 4E8UA 1LW2B 4DSJA 4DOZA 2R7TA 1KD1T 3HFVA 4X66J 4DF8A 1VRQC 2LECA 2CA9A 5AJ3F 4NOHA 4LF8F 4ES3A 3PRDA 4KSEB 4ZDNA 2Q6BA 4DV5J 3J81U 3M2UB 3T1HF 4HH0A 3CDAA 1AW0A 2FZKB 3R7SB 4DV6J 5A76A 4NLGA 2XMWA 5KFUA 1IBMJ 5KT6A 2C3OA 1NAQA 1ZM9A 1UVMA 2I5JA 2ZUAA 1YJRA 1WKLA 2CQ1A 2PA3A 2ZVSA 3M7VA 4NMLA 4CNZA 2BDPA 3P6YC 2YNHB 1BQNA 2KT3A 3NS7B 4K5RA 3GILA 2HHWA 1WORA 2HVIA 5KFBA 4F4ZA 3EE3A 4LRAA 2FJAB 1CQNA 4OYBA 5EX0A 3OL7A 3MR6A 5CXTA 1JKHB 1MNEA 3L7PA 1QSYA 4JI4J 1FRMA 4NCGA 1T0TV 1HI8A 3BPDA 3QIPB 2ACMA 2WW8A 4ETXA 2ZHAA 1NHKL 1X7VA 4B9LA 3W2VB 2DXEA 3LP2A 1XIQA 3KG4A 3NCPA 4NA2A 5ETLA 4LF9F 2Q43A 1KWMA 3TEHB 3ULHA 1S1WA 2AEMA 2RSQA 4NRTA 1YQHA 2LXIA 1EHWA 3IN5A 1NJIT 2QLJB 3JTOA 4C6AA 1B99A 4A8QA 3CE8A 3CCES 2VUGA 3A8JA 1M0SA 2UUTA 1YDLA 4DQRA 1HNXF 5KFVA 1HQ2A 3H59A 4PG4A 1IKVA 5A2QU 1NK8A 4K4ZA 4N41A 4KY3A 3T1AA 1WEXA 1T9WA 2IJNA 3GYGA 3ITHA 2HWHA 3HHLD 1RP5A 3SDEB 1S1XA 3WZ0A 1Q7YT 2DGWA 5LMNF 3IR5B 1NDLA 3BR9A 4XIUA 4LBPA 2HEKA 2CPXA 2B9YA 4OZ5A 3BYPA 3KHRA 2UXCJ 1IJFB 5HJYA 3OV7A 3R1LA 3M32B 3QNWB 3HZEA 2MSSA 1MW7A 2Q6CA 5K8NA 5KT3A 3OUYA 3JSMA 4ED1A 1SJFA 3UNYA 3CIMA 3ITHB 4P2FA 4AFFA 1RAGB 3DI6A 3GIKA 4Q2LA 4YP3A 1IKVB 3TJAA 4A8WA 3MWBA 4J5OA 1VCTA 4Z2XA 1CVJA 2QSFA 2EI5A 2IIHA 3QYYA 1TUWA 2LVWA 4CLKA 4FBTA 4KHPJ 3W1YC 3OR2B 3TJ9A 3CNQP 3KJVA 2O01C 3AAWB 4NLVA 1HI0P 5HLFA 2M7SA 3ENWA 4IR9A 1YK9A 4WIIA 3C2PA 3TVYA 3RAQA 1S1WB 1TKDA 1JNZB 5DQIA 4HYKA 5E7OB 2CG8A 2FHKA 3FMBA 3GCWP 3IS9A 4G1IA 5IZHA 4AQYF 2ZH5A 3SQGB 2QSWA 4KGMA 2M8HA 1S76D 3QT7A 1LWCB 1JKHA 3UQSA 4DI6A 4Q45A 3RRGA 3CUNA 1ZZFA 1IWAA 2F9DA 4KB7A 4Y2IA 2NYHA 3I0SB 1N48A 2KXFA 2Z2ZA 3NAIA 2MYFA 4DX8H 4DV7F 2JZ5A 3JB9k 4TY9A 3UDEA 2KT5A 1WELA 3AOAA 4H4OA 5D0EA 3ISZA 2RHQB 4DR2J 4B3OB 2QO3A 1BQMA 2KO1A 3MPWA 4WK3A 2GO9A 3BF4A 3QT8A 4DUYF 3EVMA 2VKZG 3ILIA 2DISA 2BE9B 2X7IA 3X1LB 5SUHA 1KP6A 4RNNA 2ZEJA 4K0KF 2BABA 2WVBA 2EG1A 4YHHJ 1KVKA 3RZAA 5KFRA 4EO8A 3KLEB 1NRKA 1NXIA 2CYYA 2HNYA 3OXFA 4F04B 4AXJA 3DGPB 1NB2A 3KLIB 3TEGA 1YWXA 2B51A 1PAUB 3K8VA 4EYHB 3EGNA 2Z30B 5K8MA 2CPYA 3CW2C 1NEEA 1YBUA 2GW8A 3FEXB 3NBPA 5KT2A 2VPWB 4FVMA 4XPEA 1LWFA 1KQFB 3GZ7A 4F4WA 4LSNA 3D7SB 5CH7B 4RW6A 1ZM3A 2GC8A 3MMCA 4USKA 1IN0A 1HBNA 2B8QA 3MM7A 1H2TZ 3EXCX 2JHEA 3UFCX 5L9XA 4KC5A 4OZJA 1BWEA 2N4DA 1RTDA 2LKZA 1H3DA 4UT4A 3JSBA 1EIYB 4KYZA 1XNRJ 2KHDA 4G1QA 1L3TA 1N0VC 4OX9F 3QZ8A 5D4NA 3BZQA 1JLFB 2AGOA 4ELVA 4MAKA 2WOMA 2D1CA 3KHHA 5B0GA 1VQNS 3AQPA 1U49A 4LSLB 4I6WA 1R43A 3BGRB 2C28A 2ATCB 1ZM2A 2QYGA 2HWIA 3K5NA 1X4HA 4M5DA 4C8KA 4RW8A 2CQ3A 3CVKA 4YUDA 4V19J 1E6VA 4F8RA 4ILLA 5E41A 1HQEB 4X4NA 3IO1A 4PG7A 1IBMF 1YJ9S 4LFBJ 1AFIA 4KR0B 1RT2B 4F25A 1TAQA 3BREA 2V2KA 1HHSA 3BKUA 3AH6A 1NPPA
chains in the Genus database with same CATH topology
2NYHA 2PEBA 2P8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYH A;  2PEB A;  2P8I A; 
#chains in the Genus database with same CATH topology
 4NPO A;  4U8V A;  1SBR A;  2HVD A;  3V6H A;  1KLM B;  3GP9 A;  4M95 A;  2EXU A;  1KOH A;  2YTC A;  3Q8V A;  4U7U K;  3UPF A;  4X66 F;  4YQW A;  5EWG A;  3C8Y A;  3T6J A;  1HNW F;  1S77 D;  3FSY A;  4YDX A;  2KFY A;  2CJB A;  2LXU A;  1QSS A;  4YR0 A;  1CS4 A;  2OPQ B;  3MR5 A;  2PMZ D;  2Z2L A;  3M8Y A;  3AXM A;  1RYS A;  4ZP6 A;  3KLF B;  4CO1 A;  3POT B;  1JXV A;  4F3M A;  1JLQ A;  2FJE B;  2XZW A;  1WF2 A;  3MAQ A;  4ZA1 A;  3WX4 A;  2B6A A;  2BKP A;  3CSK A;  4ED3 A;  3V4I B;  5T7L A;  4QWE A;  1VQM S;  3KLV A;  3CJR A;  3MEG A;  2N7Y A;  4OHX A;  1XWL A;  2DR7 A;  1TL5 A;  4ZLP A;  2W8L A;  4F4Y A;  4A8F A;  1A9N B;  2MB0 B;  2HHV A;  1H6K X;  1FFG B;  1SB6 A;  3ONQ A;  4DU8 A;  2MZ1 A;  1C2P A;  1TKZ B;  2DYA A;  1SC3 B;  1U8W A;  2DH8 A;  5M2U A;  1HD0 A;  1RT7 B;  2VF3 A;  1X60 A;  1LXN A;  2FTR A;  1SL1 A;  1EET A;  3EWG A;  3VAJ A;  2VJU A;  4C2M A;  3LWL A;  2D9P A;  3ZTO A;  3E51 A;  2UP1 A;  3PEH A;  4IG0 B;  4RU9 A;  4DV2 F;  3JS9 A;  1CBK A;  2BE2 A;  2CJA A;  2I9S A;  3RJM B;  2ADB A;  4K4Y A;  3QJP A;  4QYZ J;  3SCL E;  2ZH8 A;  4WP9 A;  3O2I A;  1FX4 A;  4PYA A;  4EBC A;  2UUB J;  2Y9H A;  1GT8 A;  3Q8Y A;  4NMX A;  2IC3 B;  2N4C A;  2IRY A;  4HR2 A;  1IUJ A;  3J7Z 5;  4WE1 B;  5JVG Q;  3BBB A;  4OYX A;  2C2D A;  3CCT A;  3HVT A;  4UQT A;  3QO9 A;  4EZ9 A;  1RA6 A;  4Y28 C;  3R9L A;  4NE9 C;  3IFE A;  3CJ4 A;  4W98 A;  3CCS S;  1UTA A;  1U47 A;  3THP A;  4EU0 A;  3PYD A;  3H25 A;  2FHO B;  3MED A;  1T05 B;  1DTQ A;  1RU1 A;  4J9P A;  1Q86 T;  4C98 A;  1NCL A;  4N8O A;  4HH1 A;  5IM0 A;  1DLO A;  1UA0 A;  1NJX A;  2RJZ A;  3RG6 A;  1G3O A;  2AT1 B;  1HNI B;  4P52 A;  4CH0 S;  2R2R A;  3MPY A;  3VAI A;  2GIF A;  4NLT A;  3JTP A;  3U02 A;  2DVI A;  4LF6 F;  2UVU A;  4DU7 A;  1J5O A;  1HI1 A;  4C11 A;  2E9Z A;  2D69 A;  2J0W A;  1PJ6 A;  1ZM4 A;  3AY0 A;  1W2B R;  3DLG B;  1NSQ A;  2DNY A;  4FS1 A;  2K1R A;  1S6Q B;  1HAR A;  3IG1 B;  5GAD U;  4CO4 A;  4EFA C;  4DWI A;  2F63 A;  1FKA F;  1EP4 B;  1EB0 A;  4C8M A;  3G87 A;  5KG0 A;  3H98 A;  3DOM B;  3PO5 A;  1X4C A;  3SSQ A;  3BM7 A;  1IR0 A;  5EHH A;  2XS5 A;  2QG9 B;  2UUA J;  4OFZ A;  2B43 A;  1SV5 B;  3H40 A;  3V6D A;  3G8Q A;  2AQ4 A;  4WWS A;  1VMB A;  3GR1 A;  3GYX B;  4UY8 5;  1FE4 A;  3I6P A;  2V68 A;  3ISN D;  4O3P A;  5CCL A;  2A1B A;  2BXJ A;  3JTN A;  3HD2 A;  5C24 B;  1ITP A;  4HDH A;  3R27 A;  5MLC V;  2J5A A;  4L3K A;  4PPZ A;  4Y2K A;  3CCQ S;  2RB7 A;  3L3C A;  2J6T A;  3MMA A;  5DS7 A;  5D8H B;  2RQK A;  1N5Y B;  2P6S A;  5IQQ A;  3AXK A;  1S1T B;  9ATC B;  1VC0 A;  4J9Q A;  3MXH P;  5IQ6 A;  1DQ8 A;  2GQC A;  2FLP A;  1FFW B;  5GAD I;  3OHB A;  2DXF A;  4A47 A;  2DBB A;  1P9Q C;  1ELO A;  2EK1 A;  3DOK A;  4R0E A;  4URQ U;  4JV1 A;  3CXC R;  2OPS A;  5FDL B;  3NL0 A;  1R0B G;  4K0K J;  1NSP A;  4G65 A;  1G4C A;  2NSC A;  4R5P B;  2ZH2 A;  2NUH A;  2Z4P A;  3BBC A;  4KQZ A;  1Q53 A;  1F0X A;  3K5L A;  1T9Y A;  2KM8 B;  1MU2 A;  4FPI A;  4QWA A;  4O4G B;  1U1K A;  3UDV A;  1FK9 A;  2X3D A;  2G2Z A;  4PZV A;  2VDH A;  4ECR A;  3P3D A;  1LNQ A;  3SFU A;  4F4X A;  2WAQ D;  2RDI A;  2Z56 B;  3IWX A;  4M5M A;  3OFF A;  4NI2 A;  3CCJ S;  2DCL A;  3RB3 A;  2OPP B;  3ZZZ A;  5IT4 A;  4MKY A;  2VA3 A;  1TUV A;  2E44 A;  4RW4 A;  5DET A;  5AE3 A;  1HNW J;  4AQY J;  2PII A;  3AHP A;  1KHW A;  3CD5 A;  4IOC Q;  3R2D J;  1DQA A;  2AYE A;  1HNI A;  4I69 A;  2DR8 A;  2V50 A;  3H5X A;  1FD8 A;  1S5Z A;  2V2Z A;  1FWK A;  2C2O B;  3DMJ A;  4DR6 J;  3AJD A;  2ZH7 A;  3IRX A;  4M5G A;  1UFL A;  4JUZ A;  2DO0 A;  3RBX A;  1PYS B;  2RHS B;  2D3U A;  1F9E B;  3O44 A;  2DK2 A;  4YB5 A;  3BQ2 A;  2B5J B;  1D8Y A;  2JLE A;  2KT2 A;  1NK9 A;  2QLX A;  4DS5 A;  4OYZ A;  1SH3 A;  2V94 A;  3PHE A;  3LGH A;  2B9X A;  2LQB A;  4AD6 A;  2Q1L A;  2YBV A;  3BSO A;  4Y00 A;  4KH1 B;  2IA6 A;  5KFN A;  4ERD A;  3GIJ A;  1VOM A;  2BJ8 A;  2BV3 A;  2QGF B;  2QJ3 A;  2RE1 A;  3BB5 A;  5B09 A;  4JI2 F;  5C25 A;  3M30 A;  4PXD A;  5KFL A;  4ECQ A;  2D3O R;  4HKQ A;  3JSY A;  4X62 J;  4PWD B;  3UD4 P;  1EET B;  3I56 S;  4HHH A;  5KTQ A;  1OPZ A;  4KPY A;  1RT7 A;  4CLS A;  4NLO A;  1RT4 A;  2BJE A;  1VQ9 S;  4DCO B;  1HKA A;  1PKU A;  5DGB A;  1CQM A;  2ILZ A;  2GGP B;  1T9X A;  3M6W A;  1Y5N B;  4LVN P;  4ZCL A;  2W01 A;  1UFW A;  1F3V A;  1UVK A;  2DH9 A;  2MJU A;  2ZOF A;  3VGS A;  1HIY A;  1X4B A;  3OFE A;  1YHQ S;  2AZ1 A;  2HFO A;  2VHG A;  1JLA B;  5G0R A;  2KFZ A;  3G6E S;  4WZM A;  1U1L A;  5K14 A;  4DV1 J;  1NM2 A;  1QLN A;  4N5S A;  1RU2 A;  1FES A;  2NPI A;  3S7R A;  2PO4 A;  1N34 J;  3NXZ A;  3PNI A;  4MIB A;  1U1Q A;  5EDW A;  1VJQ A;  2GNK A;  2GAH C;  1PO6 A;  2GIR A;  3JSR A;  4I67 A;  1RAJ A;  3IAS 9;  5IV3 A;  4OYA A;  1HNZ J;  3R6G B;  1VI7 A;  2KXN B;  2DB1 A;  1XBW A;  2OD6 A;  3BH7 B;  1A7G E;  5D4O A;  2VPX B;  4CLT A;  1U26 A;  3IMQ J;  2XMT A;  3UN3 A;  1RYR A;  3QGP A;  1KNZ A;  2LQ8 A;  3NGD A;  1G6B A;  5IC6 B;  2FZG B;  3FCW A;  2E1C A;  3D3B J;  3FEY B;  2AJ4 A;  2C2E A;  1I51 B;  1CEZ A;  3JQM A;  3MAH A;  5DDQ C;  4DDF A;  2ZH9 A;  3TUI C;  1E6V B;  3DDI A;  4NRU A;  1NJY A;  1MG7 A;  4RW8 B;  3H2L A;  3W9H A;  3N9U C;  3DCA A;  3QGG A;  3KLG B;  3VAH A;  2J6S A;  2IM3 A;  4OX9 J;  3LTO A;  1LW0 B;  4X64 J;  1R0A A;  1GTE A;  1JLA A;  1QUV A;  3FCV A;  5G0R B;  4IRD A;  5F3T A;  3W8P A;  1IR1 A;  1W25 A;  2AF6 A;  4LSL A;  1S1V A;  4Y2A A;  5CQG A;  4ZMM A;  4PAB A;  2F8H A;  1Q8L A;  3Q8Q B;  2MJN A;  3UO0 A;  2WOM B;  3NOG A;  4UUW A;  4K4X A;  4F50 A;  4IQX A;  1HBO B;  3QLH A;  3QFH A;  1QE1 A;  4NZ7 A;  5HMZ A;  2Y8W A;  2VFT A;  5LSR A;  1Q8K A;  2AJ1 A;  3KK1 A;  4K4T A;  3GWC A;  2RDD A;  1UAW A;  3DKD A;  2FJX A;  1H2V Z;  1RT4 B;  1UW9 A;  4QBU A;  2YWE A;  5B0D A;  1FRH A;  1GX5 A;  2VFR A;  3O1L A;  1JLB B;  3UWT A;  4WP8 A;  3T5L A;  1NDK A;  2KJV A;  2QRR A;  4YY3 F;  2E5L F;  1UVN A;  4BWJ A;  4AL7 A;  1ZTW A;  4RW6 B;  3RW7 A;  4YB1 P;  2M88 A;  3D0I E;  4ID5 B;  4YHH F;  3G71 S;  2J9D E;  3GCX P;  3OVA A;  2CNK B;  4I2P A;  3SCI E;  3TW0 A;  2DHH A;  3J80 Y;  2LXF A;  2QLW A;  2YKN B;  3NS6 A;  3A3N B;  1OQ3 A;  3LH2 S;  4KE5 A;  2MDA A;  5KFS A;  2HZA A;  4OZL A;  1DJ0 A;  2M4M A;  3TO8 A;  3PKM A;  2KG1 A;  5F0W A;  3DMJ B;  3QSI A;  2FUG 9;  3G82 B;  4OHZ A;  2C22 A;  4B9U A;  1TR0 A;  1RUS A;  3C6T A;  3DHX A;  4B9T A;  1KHV A;  5LXR A;  1HQU A;  2HLT A;  4LJM A;  1RAF B;  1RBA A;  2ROG A;  4I56 A;  4TYA A;  2E1M C;  5CHC B;  4J90 A;  3Q86 A;  1NKE A;  1JB0 C;  1KKH A;  4H4O B;  3MPU B;  4CLY A;  1SKU B;  2Z2Y B;  3FFI A;  4FZV A;  1S6U A;  4PKD B;  1NK6 A;  4NLP A;  2ALZ A;  1KEK A;  3M8P B;  3WBZ A;  5DG7 A;  2FQQ B;  4DV6 F;  2NR0 A;  4OZN A;  2RUG A;  3HSJ A;  1T9U A;  4ZHR B;  2JC1 A;  2NZC A;  3TI0 A;  1REV A;  1XTZ A;  4DPX A;  1FK9 B;  4ITS A;  2XSJ B;  2XYG B;  1PIE A;  2EWH A;  5DG9 A;  5AJ3 J;  1Y0H A;  2W1B A;  2FVP A;  2I1R A;  3C15 A;  1S4E A;  3ZZP A;  2ZC4 A;  5ETS A;  3BGF A;  3E01 A;  1ZBT A;  5D77 A;  1VRT B;  3B54 A;  3FRY A;  4CO3 A;  1U6F A;  3GQC A;  3ISN C;  4A8M P;  5HLF B;  2FYX A;  1FCA A;  4RNH A;  2B7B B;  1XR7 A;  3OR2 A;  5E0O A;  1TK0 A;  3HFK A;  3EPG A;  4S0M A;  3ZNJ 1;  1WC5 A;  3AOC A;  2BOP A;  1I1G A;  4O3S A;  2QLB B;  2KU7 A;  1L3U A;  2HQD A;  3PO4 A;  2HRU A;  2YKQ A;  3P5B P;  2L3M A;  2AU0 A;  3R5D A;  1CUL A;  2DEI A;  2RRB A;  1Y9O A;  3M6X A;  4RUB A;  4TXS A;  3DRR A;  1TFY A;  3M32 A;  2ZBP A;  4NA3 A;  1S12 A;  2MZT A;  5J2Q A;  1YI2 S;  2CQI A;  1SJQ A;  1HNV A;  1RLC L;  2M52 A;  2WVE A;  4WXW A;  5D3G A;  3AA9 A;  3KK3 A;  3FZ2 A;  2ZWP A;  1U45 A;  3TNV A;  1S1X B;  2PN6 A;  1Q79 A;  4PPD A;  4HLB A;  2WHO A;  4OYI A;  2EKY A;  4F7V A;  3K5M A;  1AYE A;  4RKU C;  3E2E A;  2GVD A;  1VQ8 S;  1UJ5 A;  4B3S J;  5KT7 A;  3QJL A;  4EBD A;  1GMW A;  3G6Y A;  3H4D A;  4MJK A;  1AB8 A;  2MY7 A;  2F4F A;  1H72 C;  1WI6 A;  2LU1 A;  3FBB A;  3K5P A;  4IQM A;  2ZJQ Q;  3RR8 A;  1B70 B;  5IC4 B;  1FDN A;  3SZ2 A;  4ZVU B;  2MPU A;  3PRB A;  4PXB A;  1UZD A;  1T11 A;  2AMC B;  3KWM A;  4LUB A;  1U0H A;  1F2H A;  3EGV A;  4KFB A;  3PX0 A;  1S6Q A;  1N56 A;  2B7C B;  4NLD A;  2CG4 A;  2B0G A;  3MCS A;  4WF9 Q;  1MMN A;  3R3T A;  3DYA B;  4J9K A;  2H3E B;  4DL7 A;  3MR3 A;  1MWY A;  2EVZ A;  3AOD A;  2GX8 A;  2GIQ A;  3PJ9 A;  2OEL A;  3LP0 A;  4NCG B;  4PG5 A;  1YJV A;  1P27 B;  2AWZ A;  1X8D A;  5IT9 Y;  3CMA S;  4DV5 F;  2HLU A;  1AZS B;  1M1K T;  1Q7L B;  2HNZ B;  3AQO A;  3BSN A;  1N32 F;  4TQS A;  4UUX A;  3D66 A;  3P8B B;  1V6H A;  3NGS A;  2DHX A;  4DL0 C;  2BBE A;  5M2R A;  3CCM S;  3MUR P;  2E5I A;  2V8G A;  2DR9 A;  3KMQ A;  3G86 A;  4EMD A;  4UOH A;  3A4T A;  5HVF A;  4W90 B;  1Y00 A;  1FKP B;  1VIO A;  2YKP A;  3CD0 A;  1FKO A;  3WDO A;  1B7F A;  4DQI A;  3GTY X;  3NP5 A;  4PR6 A;  2C2R A;  2OEM A;  3R97 A;  2B56 A;  4PUO A;  2BE2 B;  5F3Z A;  4HHJ A;  1TL1 A;  2QA1 A;  1UPP A;  1N34 F;  4NEZ A;  2JDJ A;  2PEH A;  4NLQ A;  3W5X A;  1EJ7 L;  2JFK A;  2PA8 D;  3KYL A;  2MLZ A;  2U2F A;  2UU9 J;  4K5S A;  3PM9 A;  4QU6 A;  1LWE B;  4LR8 A;  3FMW A;  4ZPA A;  1FA0 A;  4YB6 A;  3T5K A;  2YNI A;  3G9C A;  4C8Y A;  2V63 A;  2XY5 A;  2V9K A;  5F8J A;  2ZJR Q;  3CUL A;  1CG2 A;  2FC8 A;  4ID8 A;  1IKW B;  1JLC A;  1RWO B;  2G1H A;  2K3I A;  2Z8Q A;  2M2B A;  4IOB A;  4Z7Y A;  2IBK A;  1SQE A;  4B3T J;  2UXD F;  4ECU A;  2VON A;  3HXM A;  4CLW A;  4DPO A;  1UWB A;  1FO1 A;  1ZA1 B;  4CP5 A;  4J9M A;  2PT0 A;  2D9O A;  3DRS A;  3MEC A;  5KFH A;  1B0P A;  2UUA F;  2B6A B;  2J7W A;  5LMU F;  2V8V A;  1BQX A;  1DQ9 A;  2VQF J;  1N5Q A;  3POT A;  4DSF A;  4X62 F;  2QA4 G;  4TLR A;  2PGC A;  2HUR A;  1CS4 B;  5KG5 A;  1VBZ A;  3GR0 A;  1IKY A;  3KKF A;  5JVH Q;  1SL2 A;  1M5O C;  4ZPD A;  2WON B;  1GAO A;  3CDE A;  1XR5 A;  3Q8S B;  4BS2 A;  2BKO A;  2E7X A;  2MQL A;  1RTJ B;  2OO4 A;  3OJU A;  2B4O A;  3RR7 A;  4PWU A;  1XN9 A;  4ZP8 A;  2EC2 A;  3GJQ B;  3HP6 A;  4V19 X;  8AT1 B;  4PXE A;  3FQL A;  1CJK B;  3O5T B;  2COL A;  4DFM A;  4DQQ A;  2KHC A;  4ER8 A;  1RT2 A;  2EEY A;  3G8T A;  4CLF A;  3RYL A;  4KPC A;  1HQE A;  4LRE A;  3CB4 A;  1CJK A;  1DTT A;  2AJF E;  3PAC A;  2BAN B;  4DJB A;  4M5L A;  5LJ5 Y;  1FRK A;  2N7C A;  3JYT B;  3A1Y G;  1JLG B;  1N32 J;  4YN3 B;  3M9O B;  3G6X A;  5LM7 E;  2MQM A;  4DL5 A;  4OJ3 A;  4ZLJ A;  2W4P A;  2ZNY A;  2CNN B;  3ENA A;  3P45 B;  4LRD A;  5B08 A;  3RB6 A;  3LGN A;  5D78 A;  1OQ6 A;  2ZIT A;  1RWX B;  3GFY A;  4OMF G;  3KMS A;  2QFJ A;  1FJE B;  1RTI B;  2V69 A;  3UR0 A;  1WD6 A;  2GMJ A;  2IDL A;  1VRU A;  3S1T A;  1MWZ A;  2A2D A;  4RJV A;  3QZ7 A;  4X4Q A;  4DV2 J;  5F9L A;  1HPZ B;  4U8Y A;  4HL9 A;  2B4P A;  4Q7A A;  4PCQ A;  3NKY A;  1WHY A;  4FNH A;  2J0X A;  2XMA A;  4CRJ A;  1NHV A;  1FNX H;  4FYY B;  3UR3 C;  2VA2 A;  2MMY A;  3OTD A;  3OW2 R;  4B3M J;  1RHJ B;  1SC1 B;  2V4R A;  1U2C A;  4P72 A;  2HQI A;  1RTD B;  2DIU A;  1R31 A;  4OI1 A;  1MWQ A;  2RRN A;  4NLR A;  4M5I A;  4USU A;  4OV6 A;  2F40 A;  2ABY A;  2E29 A;  1PG5 B;  4X4O A;  1SUQ A;  1U1M A;  3MEE B;  1IKW A;  2GO8 A;  2O1P A;  3MMC B;  3N01 A;  4Y6I A;  1T9V A;  3Q24 A;  3K2Y A;  5DQG A;  3RRK A;  2OGU A;  2YNI B;  5A0Y B;  2MQO A;  3NBP B;  1LWE A;  5D4P A;  3M8S A;  2BRK A;  2AKW B;  2CQP A;  2ZHB A;  1SXL A;  3CCR S;  3CC7 S;  4TVA B;  3KJF B;  3Q89 A;  5I42 B;  2B3T B;  1S48 A;  3N6N A;  1HYS B;  2HHP A;  1GQE A;  1PBU A;  4ZCI A;  4J9L A;  2G2O A;  1W26 A;  4L74 A;  5AT1 B;  4PUO B;  1YZ6 A;  3VZI A;  3HJV A;  4O44 B;  1IWG A;  3GIR A;  2PI4 A;  2X3G A;  4I7F A;  2BX6 A;  3H7H B;  4KGV B;  1RT1 B;  4DEZ A;  3D0H E;  3HT0 A;  3HO1 A;  4I64 A;  4IFY B;  2VG5 B;  3EDQ B;  3VAL A;  5E3C A;  3UW1 A;  2IMW P;  1WEZ A;  1RT3 B;  2LFV A;  3QT6 A;  5LSL A;  2F8E X;  1JXE A;  3HT3 A;  1F5B A;  4F4K A;  4B9V A;  1FXD A;  2YKO A;  3HSG A;  3F41 A;  4O44 A;  2XG8 A;  4USV A;  4CI0 B;  5ETR A;  2QMX A;  4WYL A;  3MTK A;  4DSK A;  3TZY A;  1F5A A;  2R8K A;  2ZE2 A;  1SKR A;  4JI6 J;  5I42 A;  3JQK A;  4MFB A;  4DR4 F;  1YRU A;  3HKW A;  4LF2 A;  2VG7 B;  5HQ8 A;  2ZH4 A;  1TKX A;  2E9T A;  1TK8 A;  1T94 A;  3SQG A;  2QN6 B;  2VIC A;  3K58 A;  4JI3 F;  4USM A;  2IMO A;  3R7N B;  2KI2 A;  3W8G A;  3O3L A;  4LF6 J;  1FDD A;  1VIX A;  4QR1 A;  3A13 A;  1NU4 A;  2DJW A;  3OXG A;  1AT1 B;  1IR2 A;  4DBQ A;  1SUQ B;  1UZH A;  4DV7 J;  4UST A;  2GMH A;  2LDI A;  1VIS A;  4DPW A;  5EWF A;  2ZBR A;  1XER A;  2HGN A;  3NAH A;  4ICL A;  5HJX A;  4TU8 A;  4OI0 A;  3ENV A;  1S97 A;  2BW2 A;  5KG3 A;  1UVI A;  3PW0 A;  2E5G A;  4KKO A;  4ZCK A;  1BGX T;  1GXU A;  4NLW A;  3W9J A;  2ASJ A;  2J8S A;  1RKJ A;  4RBT A;  1LWX A;  3AOB A;  4PAA A;  4QJV A;  3SIP B;  2N3O A;  2N82 B;  4CT8 A;  3HVR A;  3GJR B;  4DV0 F;  3DI6 B;  3OSP A;  1C1C B;  2L08 A;  2O5D A;  1KVI A;  1HLW A;  3I96 A;  2UUB F;  4RZR A;  3OUY B;  3Q8P B;  1EZZ B;  4URS A;  5JJB A;  3CJ3 A;  2JJ4 D;  4QWC A;  2UXB F;  1SKS A;  1HNV B;  1WHX A;  4CO5 A;  1IKX B;  2I38 A;  2RS8 A;  2DRD A;  1QSL A;  1KOO A;  3SV4 A;  3M6U A;  4H4K C;  4X65 J;  3Q8R B;  2QT7 A;  3OPK A;  1CUL B;  1S0O A;  2OEJ A;  4IH6 A;  1WKJ A;  2UUC F;  3UNG C;  3LWM A;  2HHQ A;  3WC0 A;  3IWN C;  1QD1 A;  5KT5 A;  5DM7 Q;  1X0F A;  2XMJ A;  4P2M A;  3S8S A;  3FC9 A;  3N4W A;  2R7W A;  4P2S A;  4IDK B;  4C3L A;  4NXN J;  3CIZ A;  2CNL B;  2PEB A;  1B0V A;  5D6G A;  1OSC A;  4QIV A;  5CYJ A;  3W3S A;  1S1U A;  1GH8 A;  3B78 A;  2DNN A;  1VGY A;  2L48 A;  4EWT A;  4ZCM A;  3K5O A;  3OJS A;  4LR9 A;  1M5K C;  1OWX A;  1GEH A;  1XQI A;  1TMJ A;  1HBU A;  3IBW A;  2RU3 A;  3PIO Q;  3BDP A;  1Y11 A;  1T95 A;  1CJV A;  2XSJ A;  3W60 A;  4QWD A;  1ULR A;  4F3O A;  1REV B;  5KFZ A;  5CD4 A;  5AXN A;  1LEO A;  1X5T A;  3T41 A;  2DNO A;  2HBY B;  2WB4 A;  3ZZT A;  3R8Y A;  5F9N A;  5J1P A;  3M8P A;  3NNA A;  4K50 A;  2JEJ A;  2GHV C;  2IRX A;  2CXE A;  4ES1 A;  1MRO A;  3O8W A;  4O3O A;  4DR2 F;  4FS2 A;  4JI8 J;  3DHW C;  4MIW A;  2ROP A;  4OX7 A;  2XB2 D;  4XK8 C;  1UWB B;  2V8P A;  4F67 A;  5F8H A;  3NNH A;  1RCX B;  2ZKU A;  2EFQ A;  1QAX A;  3CCV S;  1HBU B;  1PC4 A;  1OSD A;  3D6T B;  2DNH A;  4OX6 A;  3JAM Y;  2KVQ E;  5AXK A;  5I3U B;  1FJC A;  2JVR A;  4TU9 A;  4IG3 B;  3PZP A;  4ZK7 M;  2M5Y A;  3OTB A;  2DPJ A;  2GVZ B;  3C46 A;  4CTA B;  3QMQ A;  5GME A;  4ZVF A;  1X9M A;  2YPY A;  5BR8 F;  4CH7 A;  3MOJ B;  4Q5V A;  2YKN A;  2XS2 A;  4LBH A;  3H90 A;  1VYA A;  3HHE A;  1YJU A;  2Q66 A;  4MIA A;  1NUE A;  6AT1 B;  3QT5 A;  2DIV A;  1Q1K A;  3CWJ A;  2BJ9 A;  4DV1 F;  3HCX A;  5ETV A;  2VG6 A;  5LMN J;  4E98 A;  3EZU A;  2XLI A;  2G0J A;  4IRK A;  4GC6 A;  2AEJ A;  2B9E A;  4USI A;  2OSR A;  2BMB A;  2CPI A;  4OLP A;  3MMB A;  7FD1 A;  3KK2 A;  4H4M B;  4QPX A;  3N0V A;  2RQM A;  1ZTT A;  2ZM6 J;  2EFN A;  3F73 A;  2HNZ A;  1AZS A;  2LCW A;  1TVR A;  2NXC A;  2AGP A;  1QE1 B;  1S59 A;  4RO0 A;  5F8L A;  4A8O A;  3EGW B;  4JI7 J;  1YLX A;  2F7V A;  2RQ4 A;  4WYW A;  1JJC B;  5D0R A;  1P8G A;  3PIP Q;  2JEF A;  1WNE A;  4CLL A;  3MMJ A;  1FER A;  2X51 A;  4DUZ J;  1OIA A;  1EKR A;  2X1B A;  3NG8 A;  4ICL B;  2RT3 A;  5F0U A;  4GO7 X;  2A6M A;  4PRF A;  2HIY A;  1EAY C;  3AD9 C;  3FJ2 A;  1D3W A;  3HI9 A;  4JI0 F;  1U0H B;  1PYO B;  1X4E A;  2KB2 A;  2PD1 A;  2XYH B;  4DMZ A;  3D67 A;  4C8N A;  4JI4 F;  1BXN A;  3AJ1 A;  3PFE A;  2DGT A;  3AFG A;  2FHJ A;  4HHU A;  5L39 A;  2C3U A;  2QL9 B;  2IYG A;  4LF9 J;  2YNG B;  1T9T A;  2RDJ A;  4MFB B;  1JJ4 A;  2ZH3 A;  1UCN A;  1SIZ A;  4EZ6 A;  1K47 A;  2NCK L;  1N5T A;  3FBF A;  5K9F A;  2D3Z A;  3TR5 A;  1T3N A;  4WFA Q;  5ETM A;  1QVG R;  5HO4 A;  4Y2M A;  3TUP A;  2YWF A;  4GKK J;  2KYZ A;  4DR6 F;  5C42 A;  1OYE A;  2KJW A;  3M2V B;  3OVS A;  4DHV A;  3C66 A;  4LSZ B;  3J7A 1;  2NXE A;  1M5S A;  2Y0S D;  4RX6 A;  3KLH B;  4DR1 F;  4IH5 A;  2RVJ A;  2EG2 A;  3J81 j;  1Z2Z A;  1LFP A;  3W9I A;  1YZ7 A;  1RAB B;  3EDR B;  5DDP C;  3TQ1 A;  3RBE A;  2XMV A;  2IJR A;  2ROE A;  2BKN A;  1E6Y A;  4O3R A;  2B4U A;  5C5J A;  3DU6 A;  3MM8 B;  2AYG A;  3DNC A;  3FVY A;  3T1H J;  5KG4 A;  3ET6 B;  2W2N P;  4WFN Q;  1RT6 A;  2LYV A;  2A0F B;  5J2N B;  5DDR C;  2GA7 A;  4F0H A;  1FWP A;  2IJF A;  1AUS L;  3VAF A;  2V8D A;  1HNZ F;  3L7U A;  3R2C J;  3DXB A;  3OTE A;  1A6L A;  2YQ0 A;  3I55 S;  5GAH I;  4QPT A;  2F1F A;  2LP4 A;  3E01 B;  4L3N A;  2HPU A;  3H8Y A;  1R8A A;  3DN9 A;  3SXL A;  5KFK A;  5J2M A;  4LF8 J;  1Y7P A;  1KTQ A;  3KUG A;  3C15 B;  4A8Y A;  2V6A A;  4OL8 A;  4DPT A;  1KFD A;  2Y1L B;  4NXN F;  2WCX A;  2L9N A;  2CWX A;  5H9F J;  4BLG A;  1QUP A;  3TP2 A;  1WAC A;  2ACY A;  2HWT A;  3L7O A;  4CLU A;  3PW4 A;  4YY3 J;  1S72 S;  2RUS A;  3ETO A;  4KV8 B;  4P74 A;  5C25 B;  3ELH A;  1WC0 A;  2R4F A;  3HD1 A;  3OXL A;  3QAT A;  1PIL A;  1HPZ A;  1NH8 A;  4ZOS A;  2LA4 A;  4JOU A;  2CQG A;  2RIL A;  5J1E A;  3EYZ A;  3BO3 A;  1MSW D;  1UVL A;  5ETO A;  4ED7 A;  4PQA A;  1PCA A;  4LIR A;  5DG8 A;  1HQU B;  2QIF A;  4OZ2 A;  5EUH A;  4P2X A;  3MM9 B;  2PDA A;  3VWS A;  4RW9 A;  2EC0 A;  4ZVP B;  4IO1 A;  4JI2 J;  1DUR A;  4OI2 A;  4OLO A;  5E3P A;  1RZM A;  4ANC A;  4I2Q A;  2ZM6 F;  1T3O A;  2N3L A;  5T41 A;  3DXS X;  4X4T A;  3J7Y I;  5BYR A;  2F5G A;  3V6K A;  4X64 F;  4LF4 F;  2H4W B;  2DRB A;  2QL5 B;  2XO6 A;  3OBI A;  4AT1 B;  5FLX U;  1RTH A;  2YWW A;  5A8W A;  1TTH B;  1JXL A;  4Q43 A;  3L95 X;  2ZJP Q;  4NLS A;  1RAC B;  1LQ9 A;  1FVS A;  1TL3 B;  1UKU A;  2XMU A;  3OFH A;  5A6P A;  4KT0 C;  4OHY A;  1NO8 A;  2FHM A;  4OYW A;  5L38 A;  2FDN A;  3DLJ A;  1Q8B A;  2RIJ A;  3ZZU A;  3M1V B;  1ZAV A;  4NA1 A;  4ED8 A;  2H54 B;  4F0K A;  1ZAX A;  4KTQ A;  2P9E A;  3T5H A;  2Y8Y A;  5BR8 J;  5HAO A;  1MN7 A;  3CED A;  1JLE B;  3IRW P;  4R25 A;  2AZ3 A;  2A3J A;  1MML A;  4I1T A;  4M1K A;  2EBE A;  3AT1 B;  4X4P A;  5CYQ A;  1N5Y A;  1BUX A;  3KK1 B;  1O0P A;  5KFM A;  4RW7 A;  4YME A;  3N6L A;  4USW A;  3TZW A;  2VDI A;  4LR7 A;  4AXI A;  1HMV B;  2XBP A;  2V0N A;  3NGT A;  3I31 A;  3MEC B;  3VQS A;  2YNF B;  9RUB A;  1VBX A;  2GV1 A;  5B7W A;  3TAP A;  2CQD A;  4DL4 A;  2CVE A;  4MH8 A;  3HMJ G;  2G0C A;  4J9O A;  1R0A B;  3IGV A;  3KG0 A;  5J1N A;  3VV2 B;  4DV4 J;  2KFN A;  5I4M A;  1P9Y A;  3E3X A;  1Y3J A;  2VV5 A;  1N5S A;  1R8H A;  2HAI A;  2OD4 A;  3I82 A;  1GMW D;  2WRM A;  3MEK A;  4PWW A;  1P6T A;  3UCG A;  2B4V A;  1JJ2 R;  4FF3 A;  3LGM A;  1S6P A;  3KLH A;  1QM9 A;  2CPD A;  4FYV B;  5GAE U;  3SYZ A;  4F26 A;  2FD2 A;  1U2F A;  3CF5 Q;  1TL1 B;  4F36 A;  1JX4 A;  1TFW A;  3QRP A;  2ZZT A;  5FD1 A;  1Q81 T;  1U09 A;  2HHH J;  1RWW B;  3IM8 A;  2VBW A;  1SV5 A;  2FZC B;  4OYO A;  4C0H A;  3WIU A;  2MZR A;  4B17 A;  2MST A;  3D6M B;  4GVB A;  1ZAW A;  2G0I A;  4C0B A;  4RUH A;  4DSL A;  4FF1 A;  5AXM A;  4QYZ K;  3J80 U;  1Z4U A;  4FBU A;  1PJ5 A;  5DJB A;  2WSF C;  1FXL A;  4DCP B;  4P6Q A;  3RBZ A;  2XGP A;  3EX7 B;  5ITH A;  3VAM A;  2H1Y A;  2VC0 A;  4RBU A;  1X31 C;  3HHL C;  4NX9 A;  4X65 F;  2QEX S;  4UOF A;  2VQE F;  1EAR A;  2WVF A;  3F44 A;  3LP1 A;  3U27 A;  3CJQ A;  1C0T B;  2D3O 1;  4DN0 A;  5K8O A;  1HNX J;  2VJV A;  5HVG A;  5KG7 A;  5C7P A;  1RDR A;  2FJB B;  1R3N A;  2P9G A;  2HND B;  2ZNZ A;  1TV6 B;  3HSD A;  3PCO B;  5A6W A;  3J81 Y;  3GII A;  2R2T A;  1C0T A;  3TAN A;  1Q0N A;  2KZZ A;  5IM0 B;  2Z57 B;  3ZZ0 A;  4Y3C A;  3NS5 A;  2P5V A;  4RWX A;  4D3G A;  4CIO A;  4CQ1 A;  2F65 A;  5KFF A;  4M94 A;  4KFB B;  3CJ2 A;  2W2Q P;  4H4M A;  3TRG A;  3MTJ A;  1TKT A;  1SKW A;  3IC1 A;  1WEY A;  3FNN A;  1RIS A;  3L9Z A;  2ALY B;  2QTW A;  4GVB B;  3M30 B;  5KOW A;  2FHJ D;  4ZPV R;  4FKX A;  3W62 A;  3BEG B;  4GKJ F;  2VD3 A;  4LFA F;  2IVF B;  4LMZ A;  2MHN A;  1T03 A;  4P75 A;  5GAG U;  3SSR A;  2B5J A;  4NL5 A;  5LOQ A;  3KK3 B;  3K59 A;  4DFK A;  1X9W A;  1R6Y A;  1VQ6 S;  3N5F A;  5D3G B;  2IYI A;  1IBK J;  1Q78 A;  4NLU A;  5DRK A;  2QL7 B;  3MFI A;  4IG3 A;  5HMY A;  4K4V A;  3CJT A;  1UW4 A;  4A8X A;  1TKZ A;  4ILM A;  1S9E A;  4LT6 A;  3KJQ B;  4JBC A;  5KAK A;  2AYB A;  1VBK A;  1V3R A;  2W4C A;  4IH7 A;  2JNJ A;  1FE0 A;  3EPI A;  2VL1 A;  4N56 A;  4BWM A;  2XZD B;  2BW7 A;  5E33 A;  4FP9 A;  3G6V A;  4K59 A;  2DNG A;  2XCA A;  3GJT B;  1FDA A;  2IVY A;  2JX2 A;  2OPP A;  4WK1 A;  4XTT A;  5MAO A;  5H9E J;  4NXM J;  3P49 B;  4ZJL A;  4CO2 A;  4WBF A;  2HS3 A;  3M8R A;  2R7O A;  3DU5 A;  1FDB A;  1RLD A;  4Z37 A;  2UU9 F;  3TJ8 A;  4U96 A;  1M90 T;  1I94 J;  3M8Q A;  1TEL A;  1UPM B;  2J7K A;  4BCA A;  2C3M A;  2DD8 S;  1RAH B;  4ZPT R;  3CGI A;  2B9W A;  1LXJ A;  2J9C A;  2CQB A;  3GFZ A;  1WTB A;  1REG X;  2OPS B;  3T19 A;  4IR1 A;  4XAK A;  4C97 A;  2CQ2 A;  2HHU A;  1V3S A;  2KN4 A;  4X4R A;  4IRC A;  4O23 A;  1N0U A;  2XWX A;  3C6T B;  1NJZ A;  3NMA A;  6FDR A;  1X4A A;  2EW9 A;  2W2O P;  2CQC A;  3OT9 A;  4WFX A;  7AT1 B;  3G82 A;  5B0C A;  4ED4 A;  1PAE X;  2YX1 A;  4FF4 A;  3I9V 9;  4WU2 A;  1NZA A;  1RGV A;  3OTO J;  3S01 A;  2P9C A;  2F8M A;  2AJ0 A;  1HFE L;  3R7B B;  3ZC4 A;  1Y4Z B;  4RW9 B;  4A4J A;  2W9C A;  3T1Y F;  2UVV A;  3GFX A;  1CC8 A;  1KN6 A;  4LFB F;  5KFA A;  1UEK A;  4HI2 A;  1CPZ A;  2Y1I A;  3H2U B;  1S9G B;  3CJ5 A;  3J7Z T;  1U4B A;  4W92 B;  2YWG A;  5EX3 A;  2FVR A;  2PMH A;  3GPA A;  3GYN A;  4TKT A;  4C0O C;  1NK5 A;  2EBG A;  4KV8 A;  3H2V E;  1LV5 A;  2RD5 C;  5HVH A;  3MI7 X;  2HQF A;  2AD9 A;  1URN A;  2BZ2 A;  1N4L A;  1S57 A;  1X0P A;  4KKO B;  3A12 A;  3Q2T C;  1JLB A;  4IKA A;  2JOQ A;  1R0C B;  4RPF A;  4ZVS B;  1GTH A;  4O3N A;  3FZB A;  4YDD B;  4ZIV A;  4EEY A;  1XMQ F;  2DRA A;  4U9R A;  2DR5 A;  1RHQ B;  2C3P A;  1QAJ A;  3DLG A;  1XMB A;  1P1L A;  1JIH A;  3PYF A;  4RR5 A;  2V34 A;  2CPH A;  2W8K A;  3QLH B;  4LVO P;  2CVI A;  1C4C A;  1Z2L A;  3VGU A;  5LSO A;  1C1B B;  2HND A;  1RT5 A;  1KTV A;  2R2U A;  1TKX B;  3HFZ B;  2ATL A;  1M1H A;  2VG7 A;  1I94 F;  4LF4 J;  2D41 A;  3RAM A;  5K20 B;  1FRX A;  2RAQ A;  2GZO A;  4WFZ A;  1XNQ F;  1SPB P;  1RT6 B;  3BN4 A;  2AW0 A;  1K1S A;  3LP1 B;  5J2N A;  3DGP A;  4RLE A;  2OIH A;  4DQP A;  2V4Q A;  3MM8 A;  4DL6 A;  1OYD A;  3L09 A;  3TAR A;  4QW9 A;  4NXM F;  3EZO A;  1HD1 A;  5HK4 A;  3BS9 A;  4DFJ A;  3DLK A;  2UV8 A;  1HBM B;  1VJW A;  3DM2 A;  4U7C A;  5IFM A;  1RT3 A;  1YRX A;  3PRV A;  5B0F A;  2VH7 A;  2DPI A;  1TMM A;  2VG5 A;  3IBC B;  3OD2 A;  4IFY A;  1VQO S;  4OYM A;  4ANE A;  3MM5 A;  1RT1 A;  3LF0 A;  4J9V A;  3QRR A;  4B3O A;  3D3C J;  4JI5 J;  4YS2 A;  2FLN A;  3OL8 A;  1NJW A;  1BHN A;  3A8I A;  3W66 A;  3NWR A;  4DX5 A;  3NGK A;  5C42 B;  2DXD A;  3ADA C;  2FB0 A;  3TAQ A;  3WQP A;  2XHC A;  2R9L A;  1RI7 A;  3VQT A;  2YH0 A;  1UEU A;  4ZN3 A;  3D1Q A;  2GHW A;  3PKY A;  1WHW A;  1ZPW X;  3CDU A;  1DY3 A;  3IR6 B;  2XM3 A;  1NND A;  3B4M A;  5KT4 A;  4G1P A;  1URR A;  1VC6 A;  1S6P B;  3A8E A;  3NCQ A;  4DR7 J;  5U47 A;  5KFO A;  3EJM A;  4AL6 A;  2J6U A;  4MT1 A;  1RKI A;  1ZOT A;  3D5M A;  3NWG A;  4OHV A;  3S6E A;  5F8M A;  3TVZ A;  3DRX A;  1H7X A;  5K14 B;  5B0E A;  5AE1 A;  3NCR A;  1F60 B;  1I5O B;  5HL7 Q;  3MEG B;  1NSK L;  5BYS A;  3KJV B;  4ZVR B;  2GQQ A;  4LQ9 A;  2XWY A;  5T7L B;  1N36 F;  4ECS A;  1HMV A;  4K2J A;  4DR5 J;  2FJW A;  1WC1 A;  1NBE B;  2OLW A;  2VBY A;  3U1M A;  5BYQ A;  4FNI A;  1RAO A;  1VRU B;  2CFX A;  2QZ8 A;  3BDE A;  3BYR A;  3QGH A;  2SXL A;  3W5Z A;  3V81 A;  2R8J A;  4F2R A;  1OPI A;  2CZ4 A;  4KO0 A;  3H4B A;  4F02 A;  2A10 A;  1R27 B;  2W7P A;  4KHR A;  3PDN A;  1YVF A;  3I4P A;  1R89 A;  3M1V A;  2HQ3 A;  4HVZ A;  2G9O A;  4PQU B;  5DLF A;  1YJT A;  2EK6 A;  4DPY A;  4IO9 Q;  3I87 A;  1U1P A;  5H9F K;  3GG0 A;  4G3I A;  3W63 A;  3FBE A;  3T6B A;  3CJS A;  4UZB A;  2DY1 A;  4FVC A;  1FJG J;  3W2W A;  5A8W B;  1YTY A;  3KNA A;  2XZT B;  1ARO P;  1WDT A;  1UJ4 A;  1YBT A;  3SI8 A;  1M5V C;  2UXC F;  4YR2 A;  1UL3 A;  3FSI A;  1N33 J;  3ZZY A;  4CTA A;  2V9W A;  1J2V A;  3MF5 A;  1K1Q A;  2BUN A;  3DDN A;  2LMI A;  3Q2S C;  4I2Q B;  5B0B A;  4IUF A;  2OFG X;  5L9N A;  1GMV A;  1AFJ A;  3SSS A;  1ICE B;  1NPK A;  1CSJ A;  2HVZ A;  2KVI A;  3N5B A;  4MK7 A;  4M5N A;  4DXL A;  1IKY B;  1RTZ A;  1RAI B;  2KG0 A;  3D28 A;  5F8I A;  2KTQ A;  3GV5 B;  2Y1J A;  2I2Y A;  3A3O B;  4YFU A;  1JLF A;  2G13 A;  2HZC A;  2F3J A;  3UVJ A;  3VHQ A;  1D9F A;  3OL9 A;  3MGJ A;  2CZV C;  3UE2 A;  4BC9 A;  4G1Q B;  2ASD A;  2BJ1 A;  4R0J A;  1NME B;  5A2Q Y;  2P8I A;  3H42 A;  3THT A;  5HMX A;  4L75 A;  2XS7 A;  2AGQ A;  4UZC A;  3MD1 A;  3HK2 A;  1X4G A;  3CO0 P;  1Q8I A;  3VVU A;  3HZG A;  4FYX B;  4DR7 F;  2GQ2 A;  4RNF A;  2OHD A;  1MU2 B;  3KDN A;  5B0A A;  3UDC A;  2DGO A;  5J2M B;  4FYW B;  3ZFV A;  4LF5 F;  2DY9 A;  4O4R A;  5KFQ A;  4UQG A;  1RWP B;  3KUE A;  4N76 A;  3HHD A;  1UP1 A;  3NGR A;  1UJ6 A;  2MQN A;  1N5V A;  4OZ1 A;  4P10 A;  5CD4 H;  5FDL A;  4OJ1 A;  4OHW A;  2YQ3 A;  1G7C B;  3OR1 B;  4A48 A;  1W7W A;  3DOK B;  3PYG A;  2OUG A;  1ZPV A;  2GML A;  4UOC A;  1Q4R A;  1HW8 A;  2HKE A;  4OIX A;  1WKK A;  2E66 A;  4ZVT B;  2E1P A;  3DGV A;  1RHU B;  2ADC A;  2ASL A;  1NKB A;  2HBZ B;  1LOU A;  5CCM A;  1MN9 A;  1FKO B;  2YWK A;  1IJE B;  2Y1R I;  4WFB Q;  3RRH A;  4NCB A;  4I0W A;  1TU0 B;  4MYT A;  4PXC A;  4O3Q A;  1RQ0 A;  3D2W A;  2LQ9 A;  1DBD A;  2HRT A;  3FK4 A;  4KGX B;  3RAX A;  2JL9 A;  1CJT B;  3GE9 A;  4MKA A;  2HHT A;  3SV3 A;  2JSX A;  3QRQ A;  4M8L A;  3TA0 A;  4B08 A;  3QFW A;  4JI0 J;  3I0S A;  3VAK A;  2R3V A;  3PW7 A;  3TX8 A;  3MAA B;  1HWL A;  4MKB A;  1LWC A;  4Y0F A;  1RAE B;  2Y3Y A;  5AXL A;  3MUT P;  1U1R A;  4ZJQ A;  1TL7 A;  2H5I B;  1YGY A;  1EP4 A;  2CJX B;  1S7H A;  5ETT A;  2R8I A;  2EFV A;  2DO4 A;  2WW4 A;  1DHM A;  2IM2 A;  4FXW A;  4TU7 A;  3IG1 A;  4EGL A;  1F2G A;  2YKM B;  3CD7 A;  4P7T A;  5HQM A;  2YKM A;  2V5H G;  3FKB A;  4RUA A;  3M9N B;  1T7P A;  4QZV B;  3BSA A;  3ZTR A;  1XR6 A;  4C11 B;  2BEF A;  3ILL A;  1J5O B;  1I6J A;  4V1A k;  4RL1 A;  2WSE C;  1K8A T;  5D15 A;  3B82 A;  1PSD A;  5GAH U;  1VLY A;  1Y5I B;  2E9R X;  1RBO B;  1IM6 A;  2ZE2 B;  1UVJ A;  5KOX A;  1TVR B;  5KFD A;  4ECV A;  1XMQ J;  2CJ9 A;  3GFH A;  3MCO A;  3K57 A;  2UVR A;  1SH2 A;  5IV4 A;  3R1H A;  3RB0 A;  1KSP A;  2H48 B;  1BWV A;  2UXB J;  3JSM B;  3LPY A;  2DT9 A;  4GRS A;  4LBI A;  1U48 A;  3OQ2 A;  3HVA A;  1F6T A;  1H98 A;  4NAS A;  2QYC A;  2LQ5 A;  1M1G A;  2QMW A;  3ILO A;  3PYE A;  3R6L B;  4C4W A;  3SDE A;  4I7F B;  1GX6 A;  1NLK L;  3KNG A;  4DV3 F;  1FJ7 A;  3OFG A;  1JMT A;  1Y3K A;  1FFS B;  4B9M A;  3T3F A;  3T1Y J;  2CQH A;  1G2E A;  2YXL A;  1H74 A;  3HF5 A;  4DR1 J;  3M9M B;  1R8B A;  1GXL A;  2GS8 A;  1U24 A;  1L3K A;  4AYB D;  4DN9 A;  1G1X A;  2ZZM A;  5BXI A;  3VGV A;  1SQF A;  1OY6 A;  3WHI A;  1HHQ A;  2GVZ A;  4TLQ A;  4DG1 A;  4DR5 F;  1VQK S;  3CTR A;  1VRT A;  2C3Y A;  2IRU A;  1KON A;  5I3U A;  3BQ0 A;  5ETP A;  4M5J A;  3M05 A;  4JI6 F;  3RTV A;  4E2F B;  4ECY A;  1UMJ A;  3NLC A;  3W2V A;  4CM0 A;  2NRE A;  2FGO A;  1DFD A;  4B3R F;  3QIP A;  4RBV A;  1PJ7 A;  3HHK A;  1N6Q B;  1HW9 A;  4X84 A;  3CO9 A;  3DC2 A;  4N7T A;  1MRO B;  3EZ5 A;  1QVF R;  1R7I A;  1O51 A;  4RNM A;  4DSI A;  5DM6 Q;  1L3S A;  3CD6 S;  2LA6 A;  2U1A A;  2YNH A;  1U0S A;  4NCA A;  1RHR B;  2QV6 A;  3R5B A;  4OX8 A;  3NMR A;  4WXO A;  1IBC B;  3AJ2 A;  4WKR A;  3HSZ A;  3K89 A;  1NPR A;  2W25 A;  2RQC A;  2MKK A;  1DAX A;  2DNM A;  1D0E A;  3D1H A;  3D9B A;  2KRB A;  3M2U A;  2MQP A;  1S1U B;  2BM1 A;  3I5C A;  2OAU A;  2EFG A;  1JLG A;  3MOZ A;  5JUM A;  2A6O A;  4DX6 A;  5K8P A;  2BAN A;  3RBD A;  4G6V B;  4QCL A;  3BV8 A;  4K8R A;  1ZYQ A;  4IFV B;  1NB7 A;  2PFF B;  1R8P A;  2QMU B;  4MK9 A;  4KGZ B;  3ZTP A;  4DZ6 A;  1KDN A;  5HQL A;  4QQB A;  5HP1 B;  1OO0 B;  3V2U C;  1VC5 A;  3I4H X;  4BC7 A;  2Z0G A;  4PQU A;  2IM0 A;  2W9B B;  4B3M F;  1IKX A;  4TQR A;  3AD8 C;  2XMK A;  4L6V 3;  3BGR A;  3TOQ A;  1JJH A;  1NH7 A;  1NZ8 A;  2CJY B;  3B8H A;  5IWA J;  4P71 A;  2FGC A;  2F9J A;  3TAM A;  4HT7 A;  2AIR B;  4BDP A;  3FRZ A;  4YB7 A;  1IQT A;  2FY8 A;  1FT8 A;  3KFW X;  2W24 A;  4P7V A;  3FBC A;  1HBO A;  1P1T A;  3TAM B;  1HR0 J;  1K0T A;  4QYR A;  4WZQ A;  1JQG A;  1MMD A;  1YBA A;  2IDE A;  4H54 A;  2DHA A;  3RGI A;  4MTP A;  4QR2 A;  2FVQ A;  4DR4 J;  3BH6 B;  2NUU G;  5CAB A;  3AD7 C;  2RKI A;  2XTJ P;  3H5U A;  3KUH A;  2O3D A;  5GVQ A;  4Q0B A;  3KLG A;  1Q16 B;  2L9D A;  4C7Q A;  1YJN S;  5L46 A;  2MKC A;  1UFK A;  1YJW S;  1SI9 A;  2H5E A;  2V2V A;  5HBM A;  5HP1 A;  1VK3 A;  3LPE A;  4WIQ A;  1I3O B;  1VQS A;  3W5Y A;  5H1S V;  4OYP A;  3QGI A;  2VQE J;  5L1L A;  4GO5 X;  1IVZ A;  3DDK A;  4IFV A;  2ZUG A;  2DNQ A;  2MQ8 A;  4CNY A;  3O6Q A;  4AND A;  4KHM A;  4JV5 J;  4OZ0 A;  3QWU A;  4CCH A;  4JP8 A;  1WG4 A;  1X5O A;  3C6U B;  4NYP A;  4WPA A;  3N6M A;  4Q2M A;  1IXK A;  4Y34 A;  4ZPC A;  5KFI A;  2DGQ A;  1VQ4 S;  1FKP A;  3D6H B;  2GFF A;  2CKW A;  2IM1 A;  3DLB A;  1WF0 A;  2CNO B;  3I5B A;  4XDD A;  2FJD B;  1V3Z A;  5JXS A;  2OTJ S;  2LU2 A;  1NSA A;  1BQM B;  4HT5 A;  4QR0 A;  4TY8 B;  1IM4 A;  1AA1 B;  4HI1 A;  4JV5 F;  3DLK B;  2I0X A;  2J76 E;  2NXU A;  4P9S A;  4DF4 A;  2ZFH A;  2AX0 A;  3IGN A;  3CCL S;  1VQ7 S;  5HAN A;  3KG1 A;  2IVM A;  3NEK A;  3TX0 A;  4CO0 A;  3MZI A;  4N47 A;  5GAG I;  2ZH6 A;  4DFP A;  2YX7 A;  1S10 A;  1HYS A;  3ETM A;  1N6Q A;  4CZC A;  4ATN A;  1YIJ S;  3HKZ D;  2DGX A;  1XEZ A;  2GGP A;  3DYA A;  1WHV A;  3QAU A;  3QPI A;  3CJ0 A;  4DZD A;  1SC4 B;  3BPS P;  4Y65 A;  4RNO A;  2E7W A;  4RU2 A;  4ZVQ B;  3PVX A;  3P5T L;  4YR3 A;  1HR0 F;  4DG1 B;  3Q23 A;  2CUY A;  4H4K A;  3TWZ A;  5IXU A;  4MK8 A;  3AB4 B;  1U25 A;  2ZWO A;  3L4B C;  5DZ6 A;  4EK2 A;  2L41 A;  2RH3 A;  4GVL A;  1WG5 A;  4HTI A;  3OLB A;  2DHG A;  2LEA A;  3QID A;  3UN5 A;  1IBK F;  1XC9 A;  2X1G A;  2Q3P A;  4J9N A;  2OKQ A;  1RHM B;  2PFD A;  2J9E A;  3F56 A;  3QBC A;  5KFY A;  3NNC A;  2XI3 A;  1WUU A;  1NHU A;  4A8K A;  3CC4 S;  5HMW A;  2OH2 A;  2WK4 A;  1RTI A;  4ILR A;  2XQC A;  3CDB A;  2P6T A;  3ZXW A;  4GKJ J;  1WC6 A;  1TAU A;  2R7U A;  1S7I A;  3CC2 S;  4AUK A;  2FC9 A;  3CCW A;  3I9Z A;  3LW5 C;  4F3Q A;  5J2Q B;  1U6B A;  3J7A N;  2APO A;  3ZZO A;  1Y5L B;  5IWA F;  3GU0 A;  2XY7 A;  2PMW A;  4QIG A;  2J0S D;  1VQL S;  4KJI A;  5GMD A;  1JK9 B;  2XUL A;  1DTT B;  4F4A A;  2M0G B;  2HGL A;  2HS4 A;  3W64 A;  2J8A A;  2QA2 A;  1RSC A;  1EKS A;  4HDG A;  1N88 A;  2HFS A;  4ENO A;  2WSC C;  1L5U A;  5D0G A;  2W4D A;  1VDH A;  2YH1 A;  2I6W A;  3G8S A;  4DL3 A;  5EGY A;  4QU7 A;  2X1F A;  3HDS A;  1KVJ A;  1NDC A;  2VQF F;  4FDF A;  3U1N A;  1SVD A;  4DPU A;  1RTJ A;  4C3K A;  3BGL A;  4DR3 J;  1CJU A;  1FXR A;  1QAY A;  3EIC A;  1Y10 A;  2BYC A;  1T02 A;  4CH1 A;  2NQP A;  2HHX A;  5EN1 A;  3IWL A;  2R7S A;  3LP2 B;  2CQ0 A;  1TL7 B;  4MKV A;  1SJR A;  1IBL J;  1QTM A;  2VBX A;  3WX8 A;  2XLJ A;  1PGZ A;  2BJ7 A;  2Z2M A;  3LOU A;  1QJH A;  3C14 B;  3MCN A;  2EKN A;  4ZHR A;  1U02 A;  2EFP A;  2XHW A;  1HWJ A;  1RHK B;  3Q83 A;  4R5P A;  2I8E A;  2VKR A;  3OLA A;  2K8G A;  2UVW A;  7FDR A;  1CJT A;  2YQ1 A;  3SFG A;  2AJ2 A;  4CYU B;  2I5J B;  2H65 B;  2NXJ A;  4ZIW A;  2JH3 A;  3BN7 A;  2ZOM A;  3T9N A;  3EGZ A;  4Q8F A;  1C0U A;  2CPZ A;  2CDR B;  2O67 A;  1WF1 A;  3GG1 A;  4LQ3 A;  2G2Y A;  1S9E B;  3PY8 A;  2KRR A;  3C3L A;  4I6A A;  1S0V A;  3MMA B;  4ZVO B;  1FNM A;  3EVO A;  1S0N A;  3RW6 A;  1RCO B;  1RWU A;  2W7A A;  2WB1 D;  2YKA A;  1RWM B;  3H20 A;  1LW2 A;  4A46 A;  3G96 A;  2FVS A;  3DLH A;  4QOT A;  3QWP A;  5C24 A;  2DTJ A;  2K06 A;  3BKF A;  4WCE Q;  4K4W A;  3OR1 A;  1T03 B;  1W2I A;  1N54 B;  3NGU A;  4TNO A;  4DV3 J;  2JRS A;  2XSF A;  1RWV B;  1RWK B;  3LAN A;  1O8B A;  3IAM 9;  2VFS A;  1UET A;  3LAK A;  4HEA 9;  4I2P B;  4Q44 A;  2OTL S;  2VOP A;  2MTL A;  1WWH A;  3IM9 A;  4IYQ A;  1QY7 A;  4KBI A;  4UTG A;  5LT5 A;  3DLL Q;  2BE7 D;  1BC6 A;  3DOM A;  2XGQ A;  3OTC A;  1R8C A;  1LKZ A;  1U2R A;  4UY8 T;  4YOE A;  4KIA A;  4L72 B;  4K7Q A;  1C4A A;  2BM0 A;  1PYT A;  3W65 A;  3VTI A;  4WU3 A;  4B02 A;  3GV8 B;  2W9A A;  5ETN A;  1VHF A;  2K3K A;  4ZPB A;  2K7K A;  3KDO A;  5E2Q A;  3MM6 B;  3QQC D;  3MR2 A;  3JQJ A;  1VR6 A;  2BJD A;  1VS3 A;  1RAA B;  3NOC A;  3UVJ B;  2BA9 A;  2CPJ A;  3QAE A;  4R8U B;  2DGV A;  1TV6 A;  2LDY A;  3DOL A;  3FQK A;  3LP0 B;  2XO7 A;  1ZH5 A;  2AYM A;  1U1O A;  4CLP A;  3PFO A;  2K7J A;  1UWA A;  2DH7 A;  5CYM A;  4KRW A;  1B64 A;  4XPC A;  2HK2 A;  3HUL A;  3A8K A;  3EMT A;  3PX4 A;  1LW0 A;  5A8R B;  1KC8 T;  1GFW B;  4ZP9 A;  1SCJ B;  2MXY A;  2HFU A;  1V5I B;  3RU0 A;  3BKT A;  3GON A;  2KKH A;  4U6P A;  5DGA A;  2DNL A;  2MKJ A;  4WE1 A;  1HL6 A;  3TUJ C;  4JV2 A;  1FI4 A;  2Q79 A;  2QLF B;  3D68 A;  1FEE A;  1D8Z A;  1GMU A;  3W2W B;  3RB4 A;  2RF2 A;  3BBF A;  2R2S A;  1GK8 A;  2HGM A;  2G1D A;  1WSV A;  2GVD B;  3EM1 A;  2E1A A;  2P2C B;  4HAC B;  2DEJ A;  2CQ4 A;  2IAJ A;  4J9S A;  4DS4 A;  3KTQ A;  3C16 A;  4OZ3 A;  3C19 A;  3SCJ E;  4NLY A;  3SEO A;  4ALZ A;  5KFW A;  3PR4 A;  3SQO P;  3DRY A;  4D3H A;  2WBR A;  1OMS A;  2CWK A;  5D4L A;  5LJ3 Y;  1NK0 A;  2CIM A;  1N33 F;  2RS2 A;  5C2C A;  3Q0A A;  5L1J A;  3PJW A;  5LL6 d;  4KO0 B;  1APS A;  1K73 T;  1FRL A;  3DRR B;  4XDC A;  3U7J A;  3V81 B;  4OV1 A;  4LRC A;  3IBF B;  1OS5 A;  3UCZ P;  4LIW A;  5CA5 A;  1RJJ A;  4J9R A;  3ICL A;  2R7V A;  4URG A;  2MZJ A;  4JYA J;  2GJ2 A;  2QX0 A;  2FJV A;  3MPD A;  3ZNU A;  4NYZ A;  2YX4 A;  4DUT A;  2FLO A;  2YNF A;  2XEX A;  2CJK A;  1LFW A;  3IA0 A;  4DUY J;  1H2U X;  2HMI A;  4C48 A;  3V4I A;  4LF5 J;  3GSI A;  1KS2 A;  2L9W A;  3G2X A;  2V4J B;  2NS1 B;  1S49 A;  4RW7 B;  4OJG A;  3CJK A;  5BJR A;  5CYQ B;  3VGT A;  3BQ1 A;  2VPY B;  2OJ3 A;  2AP6 A;  2W2P P;  3VZH A;  2E7V A;  1HWK A;  2OPQ A;  4ZS6 A;  5IOL A;  4JI8 F;  2R7R A;  5KG1 A;  2D74 B;  3CMQ A;  1K0V A;  4ZPW R;  1UA1 A;  2A18 A;  3PW5 A;  2ZBC A;  4GKK F;  4PWD A;  1VLO A;  1ZS6 A;  5DQH A;  5C2G A;  4LF1 A;  2VAS A;  2UZA A;  3V6J A;  4FF2 A;  1KLM A;  1X4D A;  3MDF A;  4C3M A;  4X4U A;  3FFI B;  1YKW A;  3PXG a;  4HAC A;  3X3U A;  2MZQ A;  2DGS A;  2HBQ B;  3VF0 B;  2ZDP A;  1BE4 A;  3MM5 B;  2JVO A;  5I3P A;  2ZOG A;  5HRO A;  4BBY A;  3DRP A;  2MGZ A;  1SJ3 P;  2RU9 A;  2MQQ A;  1JWW A;  1F9H A;  2OEK A;  3MUV P;  4JI1 J;  3UDL A;  1FX2 A;  1BLU A;  2W7O A;  1S6O A;  4P73 A;  1HBM A;  3DM2 B;  1B4S A;  2O66 A;  3TZZ A;  1TP7 A;  2VPZ B;  4F2S A;  2HQC A;  4LRB A;  1XJW B;  4X4S A;  1WDD A;  2XMM A;  2HSE B;  5GMK a;  4FYD A;  1FRI A;  2RNE A;  5A8K A;  4C8O A;  3KJN B;  3MM9 A;  3MHY A;  2E5L J;  4JI7 F;  4CM2 A;  2EFO A;  2IBO A;  5DZ7 A;  1WG1 A;  2VU5 A;  1IBL F;  4U7U D;  4ES2 A;  3PEJ A;  4I4B A;  4NEY A;  5J1E B;  1RT5 B;  5SZT A;  1RK8 A;  1C1B A;  3DOL B;  5CZV A;  3RUB L;  1RB0 A;  4DUZ F;  2H5J B;  2XY6 A;  3GB0 A;  1KFS A;  1S4F A;  4ID5 A;  3TA2 A;  2OP5 A;  2V67 A;  3DLE A;  4GMK A;  5DLG A;  1N52 B;  4NI2 B;  2NXN A;  3Q8U A;  3BO2 A;  1NK4 A;  3TA1 A;  4OI4 A;  3ZO7 A;  1XNQ J;  4PG6 A;  1O6X A;  4J91 A;  3MM7 B;  1HBN B;  4DV0 J;  4OQJ A;  3NY0 A;  3CT9 A;  3T5J A;  1VHI A;  1BMQ B;  2M70 A;  3DLE B;  4DL2 A;  1N36 J;  2F4V F;  1SQG A;  1L3V A;  2VC1 A;  1S9G A;  3TYT A;  1U7L A;  4RUC A;  2CRL A;  3LAM A;  1S1V B;  1ZA2 B;  4MYU A;  4K4S A;  1FD2 A;  1H7W A;  2BJ3 A;  3KLI A;  3OSN A;  4J7C A;  1FJG F;  1KQS R;  1WTF A;  1U8S A;  2W9C B;  4QIF A;  3GJS B;  4ZVH A;  5L8R C;  2DNZ A;  4ZKA A;  1K44 A;  2D7S A;  3MPV A;  5HI7 A;  4U67 Q;  3UD3 P;  2R7X A;  1S1T A;  3GSD A;  2WZ1 A;  2EPI A;  3ZTQ A;  1GXT A;  3D0G E;  2H4Y B;  2C2K B;  4ZIT A;  1B3T A;  5E3R A;  4Z7C A;  4JYA F;  2BOA A;  4N8N A;  4ELT A;  2HHS A;  2BVZ A;  1Q5Y A;  2MGZ B;  2ERR A;  3GLJ A;  3P4U B;  4F0M A;  2DNK A;  3MUM P;  1AXQ A;  2BRL A;  1PBA A;  3IR7 B;  3VR1 A;  4CYU A;  1QAI A;  1SC6 A;  4JI5 F;  1D09 B;  2J7U A;  2Y0B B;  3OTO F;  3LA0 A;  3NRB A;  5DDO C;  4CWB A;  1DZ5 A;  5DO2 A;  2RRA A;  3ENQ A;  4L76 A;  5IT9 U;  1S99 A;  2OSQ A;  2YNG A;  3M8Q B;  2YY3 A;  1H0H B;  3C14 A;  3JXO A;  4FN5 A;  4UF4 A;  3GIM A;  1U1N A;  2XCP A;  3D1O A;  3IS9 B;  2NPF A;  4NZ6 A;  5J2P B;  3W61 A;  2JEG A;  5F8N A;  1KRP A;  1A0O B;  3WC2 A;  1FTC A;  1J5E J;  2HK3 A;  3IXQ A;  3D4J A;  2UV8 G;  3R5J B;  1KR4 A;  2V4J A;  3TZX A;  5AE2 A;  1FVQ A;  1HWU A;  2HFV A;  1XMO J;  3R5C A;  1WOO A;  3IP0 A;  3N79 A;  3AA8 A;  3THV A;  4ZLN A;  1M5H A;  4DQS A;  1RE1 B;  1DRZ A;  3VCD A;  1BD6 A;  3EVW A;  3MR7 A;  5KG6 A;  3M2R A;  4LFC J;  1DLO B;  2JFD A;  2OPR B;  2DHS A;  2BR0 A;  2XLK A;  2POK A;  2OI2 A;  2XI2 A;  1DTQ B;  3KXD A;  3MED B;  3UD5 A;  3PTW A;  4CDI A;  3A3P B;  3WIV A;  3BJY A;  4DR3 F;  1WJ9 A;  4QWB A;  1T8E A;  3QJJ A;  4NLX A;  2HFZ A;  2WVD A;  3CCU S;  3MCM A;  1B0T A;  1VFJ A;  2C2N A;  2V2Q A;  2J9D A;  4DCJ B;  4EI2 A;  2X1A A;  3QO9 B;  4PYD A;  3M4X A;  1VQ5 S;  1OY9 A;  4NYO A;  1S9F A;  4B9N A;  2KYX A;  4LF7 J;  2XC9 A;  1WC4 A;  3PHT A;  3HM9 A;  2G4B A;  4ED5 A;  3D54 A;  2JEI A;  3VVT A;  4WKY A;  1D9A A;  3C16 B;  1KQG B;  3HVW A;  4ZJO A;  2PC6 A;  4ECZ A;  3ZZR A;  4N77 A;  2IAJ B;  3EXY A;  1X5P A;  3H5S A;  5JMN A;  4IG0 A;  3SMZ A;  1RBL A;  3H5Y A;  3H0P A;  4EBE A;  2C2M B;  2M3D A;  2YPZ A;  2CPE A;  3F0N A;  1TKT B;  2QC3 A;  2YVS A;  3IRX B;  4M5K A;  4M63 A;  4ECX A;  4JI3 J;  1FNO A;  1NKC A;  1X9S A;  2FVC A;  5E5N A;  5A8R A;  4C8L A;  1OY8 A;  4L73 A;  2OPR A;  1FTR A;  1QTN B;  2DNP A;  5CYM B;  3M2R B;  1LK5 A;  3M8W A;  2KDO A;  4M5H A;  1X4F A;  4TYB A;  2HVH A;  2WTF A;  4R8U A;  1EQ0 A;  1QDU B;  2DGU A;  4RW4 B;  2HVE A;  3N28 A;  4ECW A;  1RAD B;  2BQU A;  1JLQ B;  2CAJ A;  2DKO B;  3MM6 A;  4I6Y A;  1U6Z A;  4J9U E;  4DSE A;  3KHL A;  3GMG A;  5KFC A;  3KLF A;  4ZVE A;  1HHT P;  3FSX A;  4NZ0 A;  4KAI A;  5J2P A;  3LO3 A;  1D9D A;  3U1L A;  2J0Q D;  1CJV B;  1TZ0 A;  1KQK A;  4O4G A;  4E0D A;  2CJQ A;  2C2Z B;  2HRY A;  1UEV A;  2H51 B;  1KBR A;  1T05 A;  1B7Y B;  5CZX A;  3I5A A;  3CPW R;  3DFE A;  2WVC A;  3HJF A;  3PR5 B;  2MEW A;  4UW2 A;  3C6U A;  4ETZ A;  4B3T F;  2UXD J;  4JV0 A;  2MHE A;  2VOO A;  4IDK A;  2PSZ A;  2ZBI A;  5HN0 A;  3HHL A;  1HWI A;  1J27 A;  2VFU A;  3AB2 B;  1AUD A;  2FIU A;  4KGK A;  4B9S A;  2CZ9 A;  2XNR A;  4U95 A;  2HW3 A;  2QA4 S;  2ZH1 A;  4K4U A;  3TUZ C;  3B4D A;  1Q82 T;  1R6V A;  3MD3 A;  5G4D A;  1ACM B;  4M5D B;  4ED6 A;  4MMO A;  5F41 A;  2HHH F;  4BHQ A;  2ZDO A;  3LQV A;  4EYI B;  3CME S;  2LEB A;  3M8Z A;  2RKI B;  4Q0B B;  2ZBQ A;  1MLA A;  1C0U B;  1TL4 A;  4LRF A;  2C1E B;  5CAA A;  1VBY A;  3E8O A;  3BGO P;  2H9Z A;  1K9M T;  4ZN1 A;  2MKY A;  5EWE A;  2DIT A;  5KFP A;  1WC3 A;  1FWL A;  1C1C A;  5T14 A;  3KOA A;  5K5M A;  3VAG A;  4ZLL A;  2FY1 A;  3V6D B;  1BY9 A;  1HA1 A;  2GAG C;  4OI6 A;  2GHP A;  2ASY A;  5E3A A;  2R8G A;  5D0H A;  4FPR A;  4GC7 A;  4LFA J;  4CT9 A;  2ZD1 B;  5FII A;  1JLE A;  1YRT A;  3I0R A;  4USH A;  4ZP7 A;  4ED0 A;  2CPF A;  4J37 A;  2XYP B;  3T9Z A;  1CJU B;  2DR6 A;  2W9B A;  2K1R B;  1S79 A;  5E3Q A;  2QFI A;  4LSN B;  3V4M A;  3PV8 A;  3OHA A;  3QSY B;  3CCZ A;  4ZVG A;  2ZKT A;  2HBR B;  1VK8 A;  2C42 A;  5THW A;  3UN2 A;  2MKI A;  4ECT A;  2HYI B;  1GNK A;  1TL3 A;  1TUG B;  1WI8 A;  1S0M A;  1ROF A;  1F3F A;  1RTH B;  2A2C A;  2KXH A;  2YWH A;  2LEP A;  1H38 A;  1NK7 A;  4LF7 F;  1RXO B;  2AJQ A;  5KFE A;  3HX9 A;  5H9E K;  2M8D B;  2HNY B;  5A8K B;  3P96 A;  4I68 A;  1FHT A;  4X2B A;  5ETQ A;  1OJ4 A;  4O0I A;  3J7Y U;  3KLE A;  3SBM A;  2MLX A;  1FRJ A;  2NLW A;  3HVT B;  4LFC F;  3EUN A;  5HSP A;  2UUW A;  2R42 A;  3DRP B;  5HRO B;  1N8R T;  2QE5 A;  2JC0 A;  3D6F B;  2IC3 A;  2W2M P;  3B6B A;  4K2X A;  5RUB A;  2PI5 A;  2OML A;  1RWN B;  3I32 A;  1XNR F;  1NDP A;  1VQY A;  5ETK A;  5L1K A;  1XMO F;  5KFX A;  4QIW D;  2R7Q A;  5IT0 A;  3ILJ A;  2VIH A;  2E1R A;  2MKS A;  1FF2 A;  4C9D A;  2PE8 A;  4UOG A;  5L1I A;  2CAD A;  3FUY A;  2AEF A;  4EUV A;  2IA0 A;  3LUY A;  2HIQ A;  5F8G A;  2MKH A;  2ZZN A;  5A0Y A;  3PX6 A;  1F1B B;  3ZTS A;  1LK7 A;  4AE5 A;  3CJK B;  4PG8 A;  4WTO B;  1YIT S;  4NWB A;  1YSJ A;  4OJH A;  3MEE A;  1M5P C;  2AX1 A;  1Q5V A;  3W7B A;  5IS2 A;  5KFJ A;  4DX7 A;  2JWN A;  4YEA A;  2DNR A;  3PG9 A;  1V9O A;  1YX2 A;  2HMI B;  3TQE A;  3HLU A;  2NZ4 A;  4B3R J;  1RA7 A;  1H73 A;  4O0N A;  4IOA Q;  3OVB A;  1WOP A;  3ET6 A;  2VOD A;  4C8Z A;  1Z1Z A;  1IQZ A;  1F9F A;  4WJB A;  3HHN B;  1EX8 A;  1X5S A;  4DLE A;  1E6Y B;  1SL0 A;  4FXD A;  1YJ7 A;  3SCK E;  1SH0 A;  2LQJ A;  1SJ1 A;  2MLY A;  4QIE A;  4TY8 A;  2VZ9 A;  1ZET A;  2UUC J;  1DAR A;  2BAC A;  5GAE I;  5FLX Y;  1JNR B;  3GV7 B;  3Q22 A;  3FGV A;  4QW8 A;  3HPO A;  2KM8 C;  3BR8 A;  4EO6 A;  3K0J A;  3M2V A;  4USJ C;  1CC7 A;  2IHR 1;  3TVK A;  3MFH A;  4AL5 A;  5LXY A;  2JLF A;  2KH9 A;  3JYT A;  2F4V J;  3UCU P;  2BQ3 A;  3M6V A;  3FDS A;  2JLG A;  2RF2 B;  2ZC3 A;  2HG4 A;  2WBM A;  2IFX A;  2R8H A;  2FLL A;  2HZV A;  2HFN A;  4JB8 B;  4RWW A;  2GJF A;  4ELU A;  2E5H A;  2MY8 A;  1F5C A;  2GJI A;  2HAF A;  5HBM B;  4WTY A;  3KHG A;  3CDW A;  2AHO B;  2CDQ A;  3R5A A;  3UI3 A;  2ZVI A;  3V5R A;  2HS0 A;  3OL6 A;  4FXV A;  3K7R A;  5LMU J;  4KHP F;  1KLN A;  2GCF A;  3JAM U;  6FD1 A;  1ZZN A;  2OMO A;  2RML A;  2WON A;  4X4V A;  4Q8E A;  3I0R B;  3CJ8 A;  4TN2 A;  2K2P A;  1CLF A;  2ZD1 A;  2OFH X;  3BSC A;  2KL8 A;  4FKY A;  2ZHO A;  2NSB A;  4W4M A;  3LAL A;  1SIW B;  5KFT A;  8RUC A;  2NYI A;  3MAA A;  4DLG A;  2IY5 B;  4Y2C A;  5ADZ A;  2BQR A;  3FCH A;  3R5G A;  1SJ4 P;  4CLZ A;  3PJX A;  1BQN B;  1TQL A;  2DCU B;  5I3Q A;  3DRS B;  3PW2 A;  3MMB B;  5KG2 A;  3KK2 B;  4B3S F;  4JI1 F;  2ILY A;  4HTJ A;  1V5V A;  4WFY A;  1Q95 G;  3K8W A;  1TK5 A;  4OI3 A;  3BGU A;  1FEH A;  3K17 A;  1PC5 A;  1JLC B;  2KZM A;  2LLZ A;  2VG6 B;  4ED2 A;  2AV5 A;  2VFV A;  1LWF B;  2MZS A;  2XNQ A;  4PEO A;  3BO4 A;  1J5E F;  1EQM A;  1WSR A;  2Z58 B;  4WP3 A;  5FJ4 A;  1XK8 A;  1O5J A;  2VB6 A;  4A8S A;  5M2P A;  5HAT A;  3US5 A;  2E5J A;  5KFG A;  4XO0 A;  1VQP S;  3G4S S;  1YG0 A;  3FEZ A;  2FPH X;  2HQG A;  1WOS A;  2B8P A;  2V8H A;  2VBZ A;  3HHL B;  2M9K A;  4DV4 F;  1D1U A;  8ATC B;  4KH0 B;  2IPO B;  4E8U A;  1LW2 B;  4DSJ A;  4DOZ A;  2R7T A;  1KD1 T;  3HFV A;  4X66 J;  4DF8 A;  1VRQ C;  2LEC A;  2CA9 A;  5AJ3 F;  4NOH A;  4LF8 F;  4ES3 A;  3PRD A;  4KSE B;  4ZDN A;  2Q6B A;  4DV5 J;  3J81 U;  3M2U B;  3T1H F;  4HH0 A;  3CDA A;  1AW0 A;  2FZK B;  3R7S B;  4DV6 J;  5A76 A;  4NLG A;  2XMW A;  5KFU A;  1IBM J;  5KT6 A;  2C3O A;  1NAQ A;  1ZM9 A;  1UVM A;  2I5J A;  2ZUA A;  1YJR A;  1WKL A;  2CQ1 A;  2PA3 A;  2ZVS A;  3M7V A;  4NML A;  4CNZ A;  2BDP A;  3P6Y C;  2YNH B;  1BQN A;  2KT3 A;  3NS7 B;  4K5R A;  3GIL A;  2HHW A;  1WOR A;  2HVI A;  5KFB A;  4F4Z A;  3EE3 A;  4LRA A;  2FJA B;  1CQN A;  4OYB A;  5EX0 A;  3OL7 A;  3MR6 A;  5CXT A;  1JKH B;  1MNE A;  3L7P A;  1QSY A;  4JI4 J;  1FRM A;  4NCG A;  1T0T V;  1HI8 A;  3BPD A;  3QIP B;  2ACM A;  2WW8 A;  4ETX A;  2ZHA A;  1NHK L;  1X7V A;  4B9L A;  3W2V B;  2DXE A;  3LP2 A;  1XIQ A;  3KG4 A;  3NCP A;  4NA2 A;  5ETL A;  4LF9 F;  2Q43 A;  1KWM A;  3TEH B;  3ULH A;  1S1W A;  2AEM A;  2RSQ A;  4NRT A;  1YQH A;  2LXI A;  1EHW A;  3IN5 A;  1NJI T;  2QLJ B;  3JTO A;  4C6A A;  1B99 A;  4A8Q A;  3CE8 A;  3CCE S;  2VUG A;  3A8J A;  1M0S A;  2UUT A;  1YDL A;  4DQR A;  1HNX F;  5KFV A;  1HQ2 A;  3H59 A;  4PG4 A;  1IKV A;  5A2Q U;  1NK8 A;  4K4Z A;  4N41 A;  4KY3 A;  3T1A A;  1WEX A;  1T9W A;  2IJN A;  3GYG A;  3ITH A;  2HWH A;  3HHL D;  1RP5 A;  3SDE B;  1S1X A;  3WZ0 A;  1Q7Y T;  2DGW A;  5LMN F;  3IR5 B;  1NDL A;  3BR9 A;  4XIU A;  4LBP A;  2HEK A;  2CPX A;  2B9Y A;  4OZ5 A;  3BYP A;  3KHR A;  2UXC J;  1IJF B;  5HJY A;  3OV7 A;  3R1L A;  3M32 B;  3QNW B;  3HZE A;  2MSS A;  1MW7 A;  2Q6C A;  5K8N A;  5KT3 A;  3OUY A;  3JSM A;  4ED1 A;  1SJF A;  3UNY A;  3CIM A;  3ITH B;  4P2F A;  4AFF A;  1RAG B;  3DI6 A;  3GIK A;  4Q2L A;  4YP3 A;  1IKV B;  3TJA A;  4A8W A;  3MWB A;  4J5O A;  1VCT A;  4Z2X A;  1CVJ A;  2QSF A;  2EI5 A;  2IIH A;  3QYY A;  1TUW A;  2LVW A;  4CLK A;  4FBT A;  4KHP J;  3W1Y C;  3OR2 B;  3TJ9 A;  3CNQ P;  3KJV A;  2O01 C;  3AAW B;  4NLV A;  1HI0 P;  5HLF A;  2M7S A;  3ENW A;  4IR9 A;  1YK9 A;  4WII A;  3C2P A;  3TVY A;  3RAQ A;  1S1W B;  1TKD A;  1JNZ B;  5DQI A;  4HYK A;  5E7O B;  2CG8 A;  2FHK A;  3FMB A;  3GCW P;  3IS9 A;  4G1I A;  5IZH A;  4AQY F;  2ZH5 A;  3SQG B;  2QSW A;  4KGM A;  2M8H A;  1S76 D;  3QT7 A;  1LWC B;  1JKH A;  3UQS A;  4DI6 A;  4Q45 A;  3RRG A;  3CUN A;  1ZZF A;  1IWA A;  2F9D A;  4KB7 A;  4Y2I A;  2NYH A;  3I0S B;  1N48 A;  2KXF A;  2Z2Z A;  3NAI A;  2MYF A;  4DX8 H;  4DV7 F;  2JZ5 A;  3JB9 k;  4TY9 A;  3UDE A;  2KT5 A;  1WEL A;  3AOA A;  4H4O A;  5D0E A;  3ISZ A;  2RHQ B;  4DR2 J;  4B3O B;  2QO3 A;  1BQM A;  2KO1 A;  3MPW A;  4WK3 A;  2GO9 A;  3BF4 A;  3QT8 A;  4DUY F;  3EVM A;  2VKZ G;  3ILI A;  2DIS A;  2BE9 B;  2X7I A;  3X1L B;  5SUH A;  1KP6 A;  4RNN A;  2ZEJ A;  4K0K F;  2BAB A;  2WVB A;  2EG1 A;  4YHH J;  1KVK A;  3RZA A;  5KFR A;  4EO8 A;  3KLE B;  1NRK A;  1NXI A;  2CYY A;  2HNY A;  3OXF A;  4F04 B;  4AXJ A;  3DGP B;  1NB2 A;  3KLI B;  3TEG A;  1YWX A;  2B51 A;  1PAU B;  3K8V A;  4EYH B;  3EGN A;  2Z30 B;  5K8M A;  2CPY A;  3CW2 C;  1NEE A;  1YBU A;  2GW8 A;  3FEX B;  3NBP A;  5KT2 A;  2VPW B;  4FVM A;  4XPE A;  1LWF A;  1KQF B;  3GZ7 A;  4F4W A;  4LSN A;  3D7S B;  5CH7 B;  4RW6 A;  1ZM3 A;  2GC8 A;  3MMC A;  4USK A;  1IN0 A;  1HBN A;  2B8Q A;  3MM7 A;  1H2T Z;  3EXC X;  2JHE A;  3UFC X;  5L9X A;  4KC5 A;  4OZJ A;  1BWE A;  2N4D A;  1RTD A;  2LKZ A;  1H3D A;  4UT4 A;  3JSB A;  1EIY B;  4KYZ A;  1XNR J;  2KHD A;  4G1Q A;  1L3T A;  1N0V C;  4OX9 F;  3QZ8 A;  5D4N A;  3BZQ A;  1JLF B;  2AGO A;  4ELV A;  4MAK A;  2WOM A;  2D1C A;  3KHH A;  5B0G A;  1VQN S;  3AQP A;  1U49 A;  4LSL B;  4I6W A;  1R43 A;  3BGR B;  2C28 A;  2ATC B;  1ZM2 A;  2QYG A;  2HWI A;  3K5N A;  1X4H A;  4M5D A;  4C8K A;  4RW8 A;  2CQ3 A;  3CVK A;  4YUD A;  4V19 J;  1E6V A;  4F8R A;  4ILL A;  5E41 A;  1HQE B;  4X4N A;  3IO1 A;  4PG7 A;  1IBM F;  1YJ9 S;  4LFB J;  1AFI A;  4KR0 B;  1RT2 B;  4F25 A;  1TAQ A;  3BRE A;  2V2K A;  1HHS A;  3BKU A;  3AH6 A;  1NPP A; 
#chains in the Genus database with same CATH homology
 2NYH A;  2PEB A;  2P8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...