2P8IA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia xenovorans LB400 at 1.40 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords Putative dioxygenase
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2p8iA00
2PEBA 2P8IA 2NYHA
chains in the Genus database with same CATH superfamily
2BACA 2FVCA 3IWNC 5ETNA 1D8ZA 4A8FA 3MAHA 1D9FA 1FNOA 4PEOA 3BBBA 4DI6A 2UXCJ 2LU1A 3BPSP 4GMKA 4F4XA 2XO7A 3BPDA 3QJLA 4X4NA 4DPXA 2QLFB 1DTQA 3EICA 3T5JA 4K50A 5ETQA 1SKWA 4KQZA 5ADZA 3KMQA 1CC8A 2M7SA 2ZHAA 3Q8YA 2VODA 2MYFA 3EZUA 4C8MA 3CJ0A 3DDKA 2VA2A 3ZNJ1 2J7WA 3M6VA 2GC8A 4TY8B 2D69A 1F1BB 3DRSB 5HANA 3P3DA 3GCXP 3S01A 4ZVTB 3UD5A 1M0SA 3QFHA 5A8WA 2O66A 2FJEB 3AD8C 3MMBB 3AT1B 4WTOB 4DCPB 2ZBQA 5J1EB 4QU7A 2QRRA 4FVCA 4ZVFA 4KHRA 2ZD1A 3CIZA 1FNXH 2A18A 2DH8A 2DKOB 3D1HA 3QT7A 2CQ3A 2B6AA 3CC7S 4CM2A 3MGJA 5B0AA 2ASJA 1OJ4A 1NK5A 4DN0A 2IM0A 2B9XA 3ETMA 3ILOA 3CTRA 4ID5B 2VJUA 4DUYJ 4LF4F 4PZVA 4PWWA 3F41A 1RYSA 2IMWP 4I2PB 4DPWA 3SDEA 4K0KJ 1WJ9A 2EVZA 3H59A 3HLUA 2W4DA 2Q66A 4OI2A 4QW8A 4RUAA 1T8EA 1GT8A 5DJBA 1RACB 4RUBA 3JSMA 1HNXJ 4GC7A 3D0GE 3MCNA 2CQCA 4Q8EA 3DXSX 1N33J 3CJKB 3TA1A 4EO8A 2D1CA 5CYJA 3KJVB 4HL9A 3M2UA 1DAXA 3VVUA 2DR8A 1W25A 1OS5A 5J2QB 4O3RA 1DHMA 2QO3A 2VZ9A 5CH7B 4F0HA 1K44A 2F4FA 3CDBA 2XULA 1S0OA 1GMVA 3DCAA 1M5OC 3M2RA 2DR5A 2OHDA 4DPTA 1CJTA 2CZVC 1VHFA 1Q0NA 2Z2LA 3J7YU 2ZZMA 4DV6F 4DPOA 3OVBA 3WBZA 2OIHA 1R8BA 4CIOA 3W63A 5THWA 2CIMA 1FJ7A 1P27B 1TL1A 2DEIA 2HZAA 2IRYA 3TOQA 2MQMA 1DBDA 3MMJA 1JJ2R 4FYDA 1T9YA 4NPOA 4YQWA 1GTEA 3TX0A 2XLJA 4PQAA 1K47A 2MMYA 4OJ1A 4A4JA 5BYSA 2H4WB 4UQGA 3AXMA 3R3TA 4DOZA 2G4BA 1I1GA 2VFVA 1J2VA 5L1KA 3IO1A 3D0HE 3S8SA 3NY0A 1CS4A 3PDNA 1FD8A 3H42A 3K5MA 3PRVA 2ILYA 3OD2A 5DM7Q 1U02A 3R1LA 3RB4A 3BZQA 4UOFA 4J9KA 1AYEA 5HL7Q 3FEYB 4B3TJ 3FK4A 4F2RA 2R7SA 1RWNB 2CPEA 1UVKA 3PIOQ 4WFBQ 2NQPA 1NHVA 3QIPB 4A8YA 3BGOP 2RNEA 3PX0A 1FFSB 5B0EA 1DLOA 1CJUA 1RT6B 4K7QA 4LT6A 4ILLA 2ZHOA 4PWDB 3AY0A 1A6LA 3DMJA 4AFFA 1HWIA 3KYLA 4A8XA 1YKWA 2DY1A 2IM1A 2MTLA 1ZZNA 1VQNS 1RHRB 4HTJA 2MKCA 1N56A 3HT3A 2MZQA 5A8KB 1YJTA 4O3NA 1A7GE 1WSVA 3HSJA 1RT1B 3MEKA 1LWEA 3A8JA 4OLOA 4EO6A 3E51A 4ECVA 1VQOS 4KHPF 1RTJA 4ED5A 1JKHA 3B54A 4R0EA 2XNQA 2R7QA 4MKVA 1Y3KA 4Z7YA 3M8QA 3GMGA 3PTWA 5KFEA 3EX7B 3NAHA 3ZZRA 1JB0C 3I4HX 3ITHB 3AOAA 5LSRA 3C6TA 4JI7F 3ZZOA 2UUBJ 4DL5A 2R7VA 1HYSB 1T05A 1WTFA 4R8UA 3PZPA 2CVIA 3POTA 5F8NA 2HQIA 4B9VA 3JSRA 2BJ7A 3D6MB 5U47A 3HX9A 1QSYA 3ISZA 3R5CA 4QIVA 2IAJA 3UDCA 3FCHA 5DRKA 5A6PA 1FA0A 1Q8BA 3IG1A 1RTJB 3D6FB 3DOKA 2IHR1 4RW6A 3KLVA 2QFIA 1X4AA 1LW0B 5L1LA 4LR7A 2F3JA 1KVKA 2V2QA 3FBFA 4NRUA 5AXLA 2HQFA 3MMAA 5JXSA 5EWEA 4FS1A 3PW0A 4JB8B 2C2RA 2OMLA 3AOCA 3SEOA 3SQGB 1ITPA 2KT2A 1NK8A 4DBQA 4ALZA 4JI6J 3IBWA 3VR1A 4O0NA 1XEZA 5M2PA 5GAGI 5GMKa 1ZBTA 5C2GA 3TARA 3JAMY 1SBRA 2NS1B 2G0JA 1UP1A 4WKYA 1XMBA 1U7LA 4P73A 3OL8A 2M8HA 3IAS9 4URSA 3R5AA 2RSQA 1D9AA 4QWDA 3KHRA 2HBRB 3AB2B 3VGTA 5IQ6A 1S4FA 2HNDA 4LBIA 2MZ1A 1VBYA 2CG8A 1HBNA 3PNIA 2JNJA 4I4BA 3DU5A 4OYAA 4WP3A 2XS5A 1HA1A 1HWKA 1Q53A 3K7RA 1JXLA 1AUSL 4KO0A 2MGZA 4AQYJ 2OGUA 1T3NA 3IBFB 2MKKA 2LEBA 2K06A 3R8YA 4WU2A 1W2BR 4FZVA 2DGQA 1HFEL 3MF5A 2QLBB 4USHA 2KRBA 2AX0A 4K2XA 4KGMA 3BGRA 1RJJA 2DNPA 3ZTPA 5HQ8A 1UVLA 3ZXWA 1B0PA 3D3BJ 1NXIA 4JBCA 3KK1B 2FLLA 2DK2A 2JLEA 2LU2A 2EG2A 1NK4A 1VRUA 1ZAWA 2CQ1A 2BE9B 1M5HA 1Z4UA 1U2FA 2P5VA 3QYYA 5EGYA 4FF3A 4BHQA 3VV2B 1RAAB 4ED6A 2O3DA 4ZCIA 1RTHB 4NZ6A 4CNYA 1MG7A 4J9OA 3RBXA 3RRKA 3KJVA 3PCOB 3HZGA 3HF5A 3LP0A 1Y5LB 5BJRA 3CMES 1FRJA 2KVIA 2R8HA 4F4WA 5K14A 3CMAS 1IKYA 1T7PA 3UVJA 3RU0A 3NOGA 4RPFA 3TA0A 5B08A 2JDJA 2IA0A 3HD1A 3AQOA 3HVTB 3N5BA 1PJ5A 4F7VA 2AYGA 4ZLPA 5J2PB 4QWBA 2UV8G 5IT0A 2YWHA 2JVOA 1SVDA 1U2RA 3TJ8A 1RK8A 3IRXB 3S6EA 2XO6A 2R7XA 1JJCB 1OYEA 2NUHA 1SL1A 4NLGA 4D3HA 3CJRA 1SV5B 3ZZTA 4DSFA 1C1BA 2W9BA 1UFWA 1BXNA 4KYZA 4USKA 1LWCA 2B6AB 2ZOGA 5IV3A 4Q43A 2W9AA 2C2OB 2F8HA 3N28A 4Y65A 4DR3F 1YITS 2HHHF 4GKJJ 3ENWA 2JEGA 1QDUB 2NR0A 4RKUC 5KFNA 5DG7A 3R7BB 3OHBA 2ZH2A 1O51A 3L9ZA 2J0QD 2NZ4A 2WZ1A 2C28A 2VOPA 2ZVSA 2JHEA 2NZCA 2HAFA 3MTJA 2VOOA 4K0KF 2O5DA 3MWBA 4H4KC 2D3ZA 9RUBA 1NB7A 4ETXA 3GILA 3SZ2A 3UNYA 2M70A 2OD4A 5E3PA 2HKEA 5B0BA 2Y8YA 1R3NA 1YSJA 1N8RT 1HKAA 2WTFA 2MPUA 4QW9A 4OYWA 2Z2MA 3L7OA 4PWUA 2JWNA 2V69A 2AGOA 3JQJA 3UI3A 4X66F 2O1PA 3DOLA 2OPPB 1S79A 3LF0A 3P4UB 1RT7B 4DR1J 2LA4A 1Q81T 1RKIA 3QMQA 1N34J 2LFVA 5GADU 3J7Z5 2KH9A 1HNIB 4MKYA 2CQGA 1VISA 2QX0A 3CPWR 1TMJA 3LOUA 3BGUA 2CDRB 4K2JA 1YZ6A 3BS9A 4RW8A 4OV6A 4ELVA 3D3CJ 2EXUA 1RAEB 1VDHA 2LP4A 1N0UA 2KXFA 3E3XA 4LFCJ 1XR7A 3FCWA 2HHHJ 4QYZK 2RAQA 4I6YA 4FYXB 3P6YC 4B08A 2MKSA 2RQMA 5CA5A 1E6VB 2X7IA 2HHUA 3RJMB 4DR5F 3G8QA 4KHMA 1QY7A 2H4YB 2HYIB 3GONA 4DQQA 4GVBA 3GFYA 1HNZJ 5CYQB 2F4VJ 3ZTSA 2ASYA 3MEDB 2EC0A 5DZ7A 1SC4B 2JC0A 2VFTA 1RT1A 3QFWA 4QIGA 3BQ0A 1NKBA 4XAKA 1CG2A 5IWAJ 1FFGB 2XSFA 4F3MA 1X9SA 3QIDA 4OHYA 1XJWB 2DNQA 4R0JA 1Q78A 3BBCA 1NZ8A 3FUYA 3ONQA 1VRTB 2VF3A 2YY3A 3OTBA 1EZZB 1KOOA 1KFDA 2J7UA 2HMIA 1DFDA 3FSXA 2B4VA 1DRZA 3DHXA 3IAM9 2BUNA 3MEGB 3T1HF 1IWAA 3M8YA 3MAAB 4TQSA 3TJAA 2I1RA 4PG4A 3A12A 4LF6F 2HFNA 4ZPTR 5IXUA 2FVQA 3DOLB 4DR7F 2XMKA 1S9GA 2FVSA 2ZE2A 3QGPA 2J6TA 3VZHA 7AT1B 2C2DA 1CSJA 1GXLA 3HFVA 2N82B 2B51A 1G2EA 2XQCA 4FXVA 5J1PA 2U2FA 2DRAA 3BF4A 5IWAF 1SUQB 1ELOA 3AH6A 3FMWA 1FVSA 4RW7B 3W2WB 3QJPA 4USUA 4ZKAA 4Y3CA 1IBLJ 2I8EA 4ES2A 5AT1B 4Q7AA 2QN6B 1AFIA 3UDLA 1U1PA 2LQ8A 1U1LA 3GYGA 2WOMA 2PGCA 2FJDB 4N77A 4TKTA 2QGFB 4WFYA 3PX6A 2VBXA 3PHTA 1S10A 2J6UA 3V2UC 2QA2A 4O3SA 3R7SB 2KG0A 1VR6A 1YBTA 2FLOA 3FQLA 4PCQA 3CE8A 5E0OA 3G82A 2ALYB 1N48A 2ZVIA 1DARA 2F1FA 1JNRB 2DITA 4X65F 2OFHX 3QQCD 2CUYA 3J81U 3OR2A 1S72S 4B3RF 3B4MA 4L6V3 2MZRA 3DRRB 2KT5A 1NJZA 1QAYA 1WOOA 1W26A 2L9DA 1IM6A 1PJ7A 1RU1A 4DR4F 1VLOA 1XTZA 4N56A 1WOSA 5HJXA 2HBYB 4KT0C 3G71S 4MYUA 1S76D 3HO1A 1BC6A 1WEZA 1IBMF 3KLGA 2X1AA 1V3RA 2MZJA 4L73A 3WDOA 4F0MA 8RUCA 3UVJB 5A2QU 3NCRA 1QSSA 4I6WA 2IJFA 3NCQA 1RQ0A 4ECQA 2UZAA 4Q0BB 5G4DA 2PFDA 5DZ6A 1Q16B 4DV1J 1GX6A 5KFTA 5H9EJ 2IC3B 2QC3A 3I4PA 4DX5A 2ZZNA 1KBRA 4A8KA 5LXYA 1H2TZ 5HVFA 4ZPBA 2ROEA 1UL3A 3EPGA 1RA7A 4LQ9A 3G82B 4CLPA 3R5DA 1FWKA 1R7IA 2I9SA 2XNRA 3TJ9A 4FXDA 3CO0P 4KKOB 1NDLA 2PO4A 1SC3B 3M1VA 2XGPA 2W2PP 2GMJA 3HI9A 2EWHA 1JLAA 1CC7A 1TKXB 1ZPVA 2K1RB 3GSIA 2Y1RI 1U8WA 5CHCB 5KFOA 1N6QB 3R2CJ 1UVMA 3PJ9A 2GQQA 2QA1A 5SZTA 4LRCA 1LK5A 2BKPA 3W2WA 2E5GA 4ATNA 3T5HA 3NNAA 5F8IA 5IT9Y 2GJIA 1WNEA 2YQ3A 4M63A 1VGYA 2GJFA 2M5YA 3NNHA 1EB0A 3W66A 2ZE2B 3RZAA 2LKZA 1CQNA 1HQEB 1MLAA 3MM7B 3NLCA 4X4PA 4LJMA 4YDDB 4F4ZA 4DF8A 3G8TA 3VALA 1JNZB 1GH8A 3EPIA 2MKIA 1QSLA 1S59A 3OSNA 1KFSA 2JX2A 3D9BA 5J1NA 3WX8A 3KOAA 4MTPA 1S1XB 1VI7A 2BEFA 4F0KA 1OPIA 3D28A 4USVA 4UZCA 3RRHA 5A0YA 2FJWA 1XERA 3LP2A 2HBZB 3EJMA 5D4LA 3PV8A 4OYZA 5J2MB 2HWHA 2GVDA 4QIEA 4RUHA 2R2TA 3DLGB 2JZ5A 3PEHA 2NSBA 3EVWA 4ECYA 1FRHA 1FDBA 2YNHA 2A10A 2LQBA 2MLYA 1X4DA 1UA1A 4KTQA 3BDEA 5HP1A 2E29A 1U6ZA 4YR2A 1Q7YT 3J80Y 4I69A 2IAJB 4USIA 1KSPA 2RJZA 5CAAA 4ZIVA 4CLUA 2G2ZA 3CC2S 3OXGA 1ZAVA 3TQ1A 4P2MA 1HARA 1UEVA 5HBMA 1YDLA 3DLKB 2BJ9A 4OI4A 4TNOA 5SUHA 3SQOP 5AXMA 2YWKA 4C3KA 5F8MA 2OJ3A 4M95A 4WIIA 2HS0A 3SIPB 3J7AN 4WZQA 1IKVA 2C3OA 2GW8A 1YRXA 3DLKA 4HI2A 2MZSA 4FN5A 2E7XA 3V4IA 3PYFA 3M8ZA 2CJ9A 2ACMA 2WAQD 1MNEA 3HVWA 4IFYA 5CABA 4XPCA 1R6VA 2W24A 3DRPA 2DGTA 3B4DA 2E7WA 4JI3F 4I67A 2J9DA 4YOEA 1RWXB 1RWOB 1KONA 3QSIA 5FIIA 2V9WA 2AYBA 3D67A 3FNNA 3ILLA 3LAMA 3W1YC 5AXNA 1CJKB 4NLRA 2DNLA 4DG1A 4F25A 2DEJA 1RHQB 2FQQB 3MPVA 4FDFA 4PXCA 1RZMA 1FD2A 2RB7A 3HVAA 3NMAA 5IT9U 5BR8F 5D78A 3EWGA 1WACA 4XDCA 1SL2A 1XMOJ 4IUFA 2E1MC 2IBOA 2XZDB 1B70B 4ZOSA 4BC7A 4ZK7M 4DU8A 3RB0A 3C46A 2LEAA 1U26A 2PEBA 3MCMA 3CEDA 2QV6A 4R25A 1O8BA 1R8PA 2HG4A 2ALZA 1H73A 5B0DA 3PR4A 4IRDA 4WK1A 2QA4G 2CWXA 1S7HA 1WEYA 2BANB 3MM6B 3JSBA 4HVZA 3TA2A 4ZLNA 2VQFF 3CVKA 3G6VA 1XN9A 2ZNZA 3SMZA 1SKRA 4N8OA 5IFMA 4W98A 4ZP8A 1RHMB 3OXFA 4I56A 4L75A 4PKDB 5I3QA 4NWBA 2DPJA 5IZHA 3BREA 3US5A 1H0HB 1ZS6A 3QRRA 1JLAB 2WCXA 3AJ2A 4U8YA 2GO8A 4ZLJA 5DG8A 4NLWA 3K57A 3JB9k 1IQZA 1S6OA 2DISA 4J9RA 1TKTA 1WELA 1B0TA 4BBYA 1R43A 4U67Q 4YR0A 2CPXA 1RUSA 1NK6A 1AA1B 3VF0B 2EI5A 1U09A 4DZ6A 4AXJA 5A2QY 4X2BA 3D5MA 5BR8J 2XHCA 2Y1LB 5F0WA 4ZVUB 4DLGA 4IQXA 2QMWA 5IC4B 5DQHA 3OJUA 3VAIA 3H5UA 4I2QA 3UQSA 1Q95G 2ZEJA 4LIWA 3MM8A 4RBTA 5DQGA 5GAEI 2W9CB 1C0TA 3KDNA 4OFZA 5LM7E 4CH7A 4YFUA 1WI6A 3OLAA 2POKA 4KIAA 2PT0A 4O44B 2I6WA 3VAFA 3GCWP 2KHDA 2XMUA 3U1LA 4DUTA 1C0TB 5FLXY 2W2OP 3M9OB 3KUGA 1YIJS 3VAKA 1H2VZ 4QR2A 2B7CB 2BKOA 4UOGA 3M8SA 1FRKA 3IFEA 2UVWA 3CULA 5IV4A 1Y11A 2I5JA 2HWTA 1S7IA 4JI0J 2KZZA 4JI5J 2VB6A 5D3GA 1PJ6A 3SDEB 3BN4A 1JK9B 1VOMA 2KM8B 3OFFA 2LA6A 3C6UA 2P6TA 4NYOA 2ZH9A 1LK7A 3KJFB 3CCES 2NLWA 4ZJOA 2ILZA 5F8HA 1TUGB 4CLSA 2DNYA 3TW0A 1NKEA 1NAQA 1YHQS 2OO4A 2A2CA 4J9VA 2DB1A 1YTYA 4IRKA 4OZ3A 1U1MA 2OSQA 4U95A 4K5RA 1C4CA 2YPZA 1T11A 1IKWB 1EP4B 1RWMB 2C3UA 3Q83A 4JV2A 2YTCA 1SC1B 4OX9J 2UXBJ 2MGZB 3OL7A 2VKZG 4WIQA 3QWUA 3RB3A 4OZ1A 3T9ZA 2CAJA 2K3IA 3V6HA 4ANEA 2UU9J 4A8SA 4DSLA 4C97A 2CJKA 3IM9A 3LTOA 1HBNB 5CYMA 1J5EJ 4DEZA 3FFIB 2HNDB 3I5AA 4RX6A 5KFVA 4JI0F 2E1AA 4PXBA 5KFXA 1FX4A 5A8RA 2XS2A 4MK7A 4DV5J 1JJ4A 2K2PA 3TZXA 3R5JB 3WX4A 1FK9B 3L09A 2ZNYA 3KUEA 2XY5A 3I87A 1G7CB 1NO8A 2IJRA 3K17A 4FKXA 4IRCA 1ZM9A 1HWUA 5DO2A 5BYRA 2W7PA 3A3NB 4CQ1A 4O0IA 3RTVA 2UUBF 3MMAB 2G2YA 3R27A 2P2CB 4N41A 1BWVA 2J9EA 3M05A 2FJAB 3N6MA 4EUVA 1Q86T 2DNOA 4OYXA 1RYRA 2E5LJ 2V2KA 3GIIA 5DDRC 3UN2A 1T3OA 3UNGC 1MN7A 2HHQA 2E5HA 5B0GA 1F2HA 1X9MA 4C0OC 1CJVA 2EC2A 4K4XA 5G0RA 2V34A 1S4EA 4UW2A 4NLOA 2LEPA 1ZZFA 3DC2A 4JI6F 1H7XA 1QAIA 1NSPA 4DV0F 1BMQB 1UWBB 2HLTA 2WSCC 3M2VA 5ETMA 5F8LA 1HPZB 4GVBB 1TP7A 3MAQA 3BJYA 5LSOA 4C8LA 1N5VA 5I42B 5AE2A 1RHUB 2VL1A 2OPSB 2SXLA 3BGFA 3GFXA 3M2VB 2FUG9 1S6QA 1JKHB 1RSCA 2XWXA 3SCKE 5L39A 3NBPB 2ZH7A 3RAQA 1YJNS 2Z2ZA 4NE9C 5B0FA 2E1CA 4H54A 3DI6B 4NI2B 4OJHA 4A8OA 1RT4A 5LT5A 3HMJG 3OR1B 2G13A 2F63A 2BJ8A 3CCRS 2D7SA 1Q8KA 4B17A 4EBCA 1ZYQA 3PO5A 5A0YB 1QUVA 1RT5B 2GCFA 5KG5A 4K4UA 1J27A 4O4GB 1RT6A 3AQPA 1UTAA 3ILJA 2JSXA 1FX2A 2J8AA 4CZCA 4RNMA 4J9SA 2FHKA 2GNKA 3I0SA 2H5EA 4MIBA 3EGVA 4MFBB 1HR0F 2E1PA 2E5IA 5I4MA 3GTYX 1VBKA 2A3JA 3M30B 3PHEA 5DDOC 4ED1A 1OO0B 2NXJA 4YDXA 4ECRA 1UFLA 4LSNA 5KFQA 2HZCA 2UVUA 2YKMB 2BQUA 4DCOB 4NXNF 5HSPA 3MPUB 4JOUA 3G9CA 3N5FA 4NOHA 1SJFA 2YKOA 3GJSB 4NYZA 1FKOA 2AHOB 4B3OA 1RABB 4OI6A 2DNRA 4NMLA 2N4DA 4BWMA 4KR0B 3G87A 4KV8A 1U0HA 1XBWA 1N33F 3TR5A 1VQPS 2B3TB 2R8GA 5AJ3F 2UUTA 3MURP 1FO1A 2AX1A 3FZ2A 1KHVA 2WVEA 2J7KA 4OLPA 4DS4A 3KNGA 4PUOA 1U1NA 3H2VE 4UUWA 3H98A 4DR2F 2GZOA 2A0FB 1M5KC 3HHNB 2AZ1A 2YWWA 3WZ0A 3CO9A 4NL5A 4A47A 4ZLLA 5KFRA 3M2UB 1G1XA 2W4CA 2RS2A 1WC3A 4ELTA 2B9YA 2HNZA 3V81A 3MMCA 2VG5B 1NZAA 1RAGB 3H4BA 2FLNA 4K4VA 4UQTA 2VU5A 4F4KA 5LMNJ 2W25A 2YNIA 3ENQA 4YB7A 1EETA 1Q7LB 3RGIA 3LP0B 1OSDA 3RR7A 4LF9J 4OX7A 2F9DA 3KK2B 1HI0P 5DM6Q 1EETB 3AAWB 4IG0B 3QO9B 4ID5A 3KLEA 4NLUA 1WI8A 5T14A 1ZA1B 4U6PA 3KLHB 1HNWJ 4OJGA 3AJ1A 3C14B 3MECB 1Q79A 2HLUA 1TQLA 2ZITA 1X5TA 3H8YA 1SPBP 3ZZ0A 4F36A 3QT5A 3M9MB 2UUWA 1X31C 4PUOB 1HQUA 1Z1ZA 4ZP9A 1LW2A 1KQSR 4ID8A 5CZVA 5J1EA 1PBUA 1TKTB 2MQ8A 3JXOA 3MMBA 1GMUA 4KV8B 4WP8A 1NCLA 3CDUA 2ZOMA 3OFHA 3R6LB 4DFMA 4GO7X 1ZOTA 1DZ5A 3KHLA 1KLNA 2V8GA 3N6NA 1REGX 1FFWB 2E7VA 3BKTA 2Z4PA 4ZCLA 4C11B 4CCHA 3CJTA 4DR6J 4F67A 5KT6A 2DNNA 3PFOA 4DV1F 3EXCX 3MM6A 4WP9A 1N4LA 3T19A 3WIVA 3OTCA 1S48A 1UKUA 1XR5A 4RR5A 3W61A 1T95A 3PKMA 3CJ8A 2G0CA 3MPYA 4IO1A 2E44A 1KVIA 5CZXA 3MXHP 3W62A 2DXEA 1WF2A 1HD0A 3I0SB 3TEGA 4FS2A 1HWLA 3RAXA 1RAIB 8AT1B 1IBMJ 2BXJA 5E3QA 1KKHA 1RLCL 3UPFA 4KPYA 4ZCKA 2BMBA 1HNZF 5DS7A 2PIIA 2ROGA 4N7TA 1KQFB 5CCLA 3D6TB 1YI2S 3KDOA 1D8YA 2Z0GA 3GSDA 2B8QA 1NSKL 3EDRB 4KE5A 3WQPA 5KFMA 1A0OB 1F5AA 2OAUA 1B4SA 2UVRA 1V3SA 4QU6A 4ILMA 3TYTA 3VAGA 3NBPA 4RBVA 1KR4A 2IVYA 1RHJB 4LBPA 5KFUA 2ZDOA 2R8JA 3QBCA 3O3LA 3IR5B 1J5OB 3N6LA 3UD3P 4R5PA 5E33A 4DSJA 1I3OB 1U0SA 2AMCB 2OI2A 4MAKA 5KFJA 3LWMA 5KG1A 3IXQA 1E6VA 1FWPA 4NCAA 3TVYA 2DO0A 3AA8A 1N88A 2RU3A 1F9FA 3KJNB 4K4TA 4LRDA 3H25A 3ITHA 1FJGJ 1V6HA 1UJ6A 2LMIA 5T7LA 4F02A 1WEXA 4UOCA 2BYCA 1WHXA 2R4FA 1X8DA 4W4MA 1VQMS 2BOPA 2HVDA 2YNHB 3GE9A 3KFWX 4Y00A 3Q86A 3OTOF 1S6PA 2K7KA 3WIUA 2BVZA 2R3VA 4DL7A 5HVHA 5L46A 2LXIA 3JTPA 1V3ZA 2CNKB 4QOTA 4DCJB 5CD4A 3LP2B 4F4AA 2KU7A 2UUCF 2DIUA 4C48A 3UCZP 1DY3A 4CLLA 2Y8WA 1FVQA 2HHXA 1HNIA 1CLFA 3N4WA 4Z37A 3MOJB 4X4UA 1NUEA 1X5OA 2YWGA 2QMXA 3W64A 4IO9Q 3H5XA 3JTOA 2RRBA 4NEYA 3O44A 3G6XA 2FHOB 1EAYC 1RCXB 4EYIB 2HHTA 2HAIA 2GIFA 2LXFA 3HULA 2BBEA 2CQ4A 2R7TA 4DPYA 4RW4B 4FKYA 2ZJRQ 3BSNA 3R2DJ 3OBIA 1FE4A 2GHPA 1PGZA 3LANA 1RAHB 3RW7A 1DJ0A 2EBGA 3C66A 2RT3A 2VG7A 5D4NA 4LFBJ 5LMUF 2CYYA 2W9BB 1VMBA 3ENVA 4I1TA 4P6QA 3BEGB 3PKYA 1VQSA 1F3VA 1X4FA 1JLBB 3M1VB 1XNRJ 4C8KA 3MUMP 5C7PA 3GPAA 1TL1B 5HMZA 1WHYA 2VONA 1BWEA 2DNKA 4B9SA 2BRKA 1S1UA 5J2PA 4IH6A 4PPZA 3OL9A 3LGHA 4XPEA 1KTVA 2B0GA 1AZSA 2WK4A 3VTIA 1QAXA 3H5SA 1UJ4A 4J90A 3MECA 2FJVA 3UCUP 4ANCA 4C98A 2CPIA 3X1LB 3U27A 4K4YA 4ELUA 3AFGA 3GJTB 4QR0A 3J80U 2D9OA 1L3KA 3V6DB 1D09B 4DV3F 3JS9A 2YBVA 3SSRA 3NS6A 2OSRA 1QTMA 4LRAA 1VJQA 2J5AA 2KB2A 2F7VA 4ZVEA 5DLGA 3HHLB 4DR6F 1N54B 2HBQB 2VG5A 4DSIA 1AW0A 1FI4A 4IOBA 3W8PA 4GC6A 1N5QA 4O23A 1OMSA 2MHNA 4NZ7A 2CJAA 1S1UB 3CGIA 1VBXA 5EX3A 4O44A 4CH1A 3MUVP 3IN5A 2P9CA 3T5KA 5DG9A 4Y0FA 2FTRA 2RS8A 1S0MA 3OPKA 1BHNA 2FZGB 2IM2A 2EFQA 3M7VA 5M2RA 4TU9A 4CWBA 3G8SA 2KI2A 1VC0A 2W1BA 4DFJA 4X62J 4IFVA 2J8SA 3PJXA 4RU2A 3QLHA 4FYWB 2COLA 1MMLA 2GFFA 4TYBA 5C42A 4ECZA 2HFSA 1KWMA 1WORA 2B56A 2JL9A 1YVFA 1F60B 3C8YA 3W2VA 5C5JA 1MSWD 4KBIA 4J9LA 2V8HA 3CDEA 3TQEA 3HHEA 3W5ZA 2F65A 4RW4A 2HVEA 2WOMB 2AQ4A 1IR2A 2DHHA 2ACYA 2FGCA 3ULHA 2XY6A 1UVNA 2RE1A 3GYXB 3L3CA 3MPDA 3H2LA 4IYQA 2Y9HA 1S6UA 4QIFA 3ZC4A 3FBBA 3FBEA 2MY8A 2NSCA 2IM3A 3OT9A 1IKXA 3QGIA 1RT3A 2OMOA 3HSZA 3BO2A 2YWEA 4J9PA 1TTHB 4LR8A 4DR5J 5H9EK 2AJFE 2GJ2A 3RAMA 3CD6S 3RBDA 3B6BA 4GKKF 1NHUA 3PY8A 3UE2A 1S9GB 1VYAA 4EFAC 4X62F 4C8OA 2Z57B 4DJBA 1LW0A 3VCDA 4QZVB 1SIWB 3MEGA 3CIMA 1OIAA 4YB5A 3DNCA 3MHYA 4LMZA 1TL7B 2N7YA 2ZH6A 1RT5A 3HSDA 3NGUA 1U8SA 2ZZTA 4KY3A 2OEMA 4RWWA 4O3QA 4F4YA 3SFGA 2UUAF 1OYDA 4G1IA 3PEJA 5H9FK 4DG1B 4M1KA 1NB2A 1N5YA 4NI2A 3T1HJ 2JEFA 3VGUA 4RW6B 4R8UB 2DGWA 5LXRA 1ZTTA 4ZVOB 2Z58B 2Z8QA 3CJ5A 5HBMB 2PMHA 4ZS6A 2UUCJ 2BOAA 3BSCA 2ZUAA 5MLCV 4DR7J 3GIKA 2BX6A 1G3OA 2HFZA 1AXQA 2K8GA 2KYXA 3A13A 3PJWA 3T6BA 5LSLA 3VGVA 2A1BA 4RBUA 1XC9A 5IS2A 5LJ3Y 1T05B 2QYCA 2X51A 1GQEA 2J0XA 3ICLA 3TEHB 3GG0A 3EE3A 3UDEA 4WXOA 4YMEA 1PYOB 2CQPA 2OEJA 3KG4A 2GV1A 4J37A 4W90B 2UXDJ 4M94A 1S1XA 3GV8B 4HT5A 3ET6B 3BR9A 1UETA 4O3OA 2QFJA 2DH7A 3JTNA 4ZN1A 3KHGA 3J7A1 4DFKA 4OYOA 4JI4F 1PSDA 1MWYA 1UCNA 3J7YI 2D9PA 3I6PA 3IWLA 4P7TA 3DGPA 4ECXA 1T9UA 2JLGA 1ZH5A 4C3MA 3DMJB 5E3CA 1ZTWA 3NL0A 2AYMA 4KJIA 4ZPAA 1PO6A 1IKXB 1M5VC 3UFCX 4JV5J 4HEA9 1B64A 1XMOF 3QIPA 1YBUA 2I0XA 4QPXA 5K20B 3IMQJ 1FDNA 3MD1A 4JI5F 1OY8A 4ECSA 1HQEA 1S9FA 1Q8IA 4J7CA 3SFUA 2K1RA 2JVRA 3GP9A 5EHHA 2QSWA 4B02A 3HPOA 4CP5A 3BB5A 3BKUA 3PW2A 2DNGA 4L3NA 1EHWA 4Y2MA 2V8DA 4LF8F 3E8OA 3NG8A 4NASA 3GR0A 3MR6A 3D1OA 2AJ1A 1LWCB 2FDNA 2C2MB 2W4PA 3GU0A 2XHWA 1FNMA 3C3LA 2AEMA 3BM7A 5ETRA 5DGAA 2QT7A 4WWSA 1H72C 2ZJPQ 2PI5A 1GMWD 1S1WB 4QYZJ 2FY1A 4IG0A 3KLEB 4LF7F 2QE5A 1LW2B 7FDRA 1LV5A 2WSEC 5HK4A 1FJEB 3I96A 2C42A 3S7RA 1UW9A 4EI2A 4EBDA 3NMRA 4PAAA 1B7YB 1R89A 1S5ZA 1UFKA 3HHLA 3BQ2A 5IM0B 1TUWA 2PMWA 3DGVA 4CT8A 5LJ5Y 1HBOA 2V4RA 1VQ5S 1YX2A 2CQ0A 4NXNJ 1JLFA 2CZ4A 2M9KA 4I2PA 3ZZPA 1JJHA 5HAOA 1TAQA 2KXHA 5C2CA 1FERA 3MM9B 2DXFA 5FDLB 5KFSA 3CCQS 2VD3A 1Q5YA 2OFGX 2VQFJ 1LEOA 4C9DA 2FYXA 2G1HA 5GAEU 2U1AA 2CDQA 4DV7F 1AZSB 3T6JA 2YNGB 1PC5A 3O6QA 4W92B 3RBZA 1JX4A 1UW4A 2ZD1B 1WG1A 3OUYB 2HQ3A 1SJ1A 3VAMA 3T1AA 3MUTP 3K59A 2KZMA 4DSKA 2N7CA 4OHWA 3TWZA 5KG0A 4NXMJ 3GJRB 2KXNB 1RT2B 1FWLA 1IR1A 5L38A 4V19X 3MR7A 3VVTA 4U96A 2RQKA 3ZZYA 4JI8J 1LNQA 2ZWOA 2M4MA 5E3RA 3OW2R 3IBCB 4B3SJ 3PRDA 4C3LA 3HFKA 4NA2A 4UZBA 3RYLA 2O01C 1Q4RA 3WHIA 5HN0A 4LF7J 2AF6A 3GZ7A 3GFHA 5KAKA 3NRBA 2CPFA 5K8NA 2J0SD 5ETOA 2QLJB 1FRMA 2CJQA 3NGSA 2C3MA 2W7OA 3MD3A 2YH1A 2YKMA 1U24A 1AROP 2BJ1A 1M1GA 4H4OB 4LSNB 1RWKB 4NLSA 2PC6A 4KGKA 3PX4A 2MQLA 1PCAA 4KSEB 4DQSA 4FF1A 1VQ6S 3DGPB 1JXEA 1A9NB 2R9LA 3LP1B 3GQCA 3QZ8A 4IOCQ 3I9V9 1S9EA 2XWYA 2VQEJ 2VG6B 1M5SA 2GHVC 4HTIA 1HNWF 1KEKA 1R27B 2XG8A 2V63A 1S6QB 2DD8S 4X4VA 3PRBA 3SV3A 2VDIA 2ZC4A 4WK3A 4ED7A 1VRTA 3DFEA 3FGVA 3LQVA 2HMIB 2HGMA 4B3SF 1U6BA 3W9HA 2R42A 2B5JB 3OR1A 2MJNA 1FKPB 3AJDA 3CCVS 3DLJA 1IN0A 3IM8A 2D74B 1HLWA 4UT4A 4O4RA 5ETKA 3TP2A 2OPSA 2FIUA 2HIQA 1SB6A 2HWIA 5I42A 4P2SA 2YVSA 2N3OA 4YY3F 3PACA 4LRFA 1TV6A 1SKSA 2VH7A 4EYHB 3HT0A 4A8QA 1UWBA 2QL7B 1HW9A 2RKIA 1CVJA 4GKKJ 2AP6A 3K5PA 1W7WA 2J76E 2Q79A 4V19J 2PDAA 4ERDA 1HWJA 5J2NB 5KFCA 2HK2A 2ZBCA 1R0AA 1L3SA 1KLMA 4HHHA 2XLIA 3DLGA 2EK6A 5JJBA 1QTNB 4FNHA 3B8HA 4LUBA 5T41A 2OPRA 2YH0A 2LDYA 3DYAB 3HJVA 1NBEB 3HKWA 3NOCA 4MMOA 4FBUA 4DL2A 3DLLQ 2XC9A 1YG0A 1LQ9A 2EFNA 2Z56B 4H4OA 2OEKA 4YS2A 1DQAA 2DGSA 1LXJA 2ZUGA 2AIRB 5I3UB 1TAUA 5KFYA 4ZVSB 1K0VA 4XIUA 4ED2A 2ZJQQ 2DH9A 3FFIA 4OL8A 2MZTA 3ISND 1KD1T 3OHAA 4LSZB 3EUNA 2XMAA 3IR6B 1O0PA 1UPPA 5KTQA 1RT3B 4MKBA 3IS9B 3D68A 2Y0SD 1DTTA 3M6WA 2DNMA 1HNXF 1EQMA 2CJXB 2JEJA 1Y4ZB 2HEKA 3I82A 2CKWA 4ICLB 3MFIA 2KJWA 4KFBA 2WRMA 5ETVA 1HBUA 2BJEA 4MJKA 4X84A 3R9LA 4EU0A 3A1YG 5LOQA 3G4SS 1N6QA 3BKFA 4EZ6A 1SJ4P 5FJ4A 5KG2A 5EWGA 4UY85 2DR9A 4CO4A 4KKOA 3JYTA 1P1LA 4RW9A 2HNYA 1YGYA 4LIRA 3W2VB 1YJRA 3DLEB 2M8DB 5KFBA 3OL6A 2V5HG 5DQIA 1BY9A 1WOPA 2HVZA 5KOXA 1RISA 4IFVB 4OJ3A 3RB6A 2WW4A 5RUBA 3WC2A 3EMTA 1NPPA 2F8EX 2CADA 2NXEA 1N5TA 2EEYA 2Q6CA 4LR9A 4ANDA 4CLZA 4LRBA 4Q0BA 3QO9A 4G6VB 2C1EB 3KLHA 4KC5A 4ER8A 5B7WA 3HK2A 4JV5F 4CTAA 3W3SA 4ZN3A 3R5GA 5I3PA 5HMYA 1G4CA 2W9CA 2YNIB 4DDFA 3HVTA 4F8RA 2QA4S 4ES3A 2HFUA 2R7UA 3EVMA 5KT2A 4B9TA 3OV7A 4EZ9A 2AWZA 3PYEA 5F41A 2E1RA 5HLFB 4P71A 5DDPC 1T0TV 1WHWA 4OZJA 3CDWA 3CJQA 4HYKA 1D1UA 3GWCA 1FRLA 3B78A 3DDNA 4FP9A 1S1WA 4M5KA 3BYPA 1TL4A 5E3AA 2OTLS 1YJUA 4ED3A 3V6KA 1HHTP 2V67A 1MROB 3MPWA 4NX9A 3SV4A 1HMVB 2JRSA 4NYPA 5KFWA 5F9NA 1U49A 1HNVA 1B3TA 1WF0A 5FLXU 4YR3A 1MU2A 2CPJA 2VUGA 2DJWA 4A8WA 4F3OA 3UR0A 2GIRA 2C3YA 2MQQA 1T03A 2DBBA 1ZM3A 3OQ2A 5JVGQ 2XCPA 3QJJA 2KHCA 1S77D 2BANA 4OX6A 2CFXA 3A8IA 2LQJA 1X0PA 3DM2A 1IM4A 4AYBD 1X60A 2KM8C 3MEEB 3AHPA 3B82A 4FPIA 2M0GB 3CDAA 3W65A 4XDDA 3JQMA 2IMOA 2DYAA 2HFVA 2ZC3A 3NGRA 2BM1A 3HD2A 3M32B 2XGQA 3CCJS 4ZITA 4LF4J 2M52A 3CMQA 2LCWA 4HACA 3OTOJ 3CJ2A 4CDIA 3QAUA 2MHEA 3M30A 4IR9A 4TXSA 1UVIA 3Q89A 2GQ2A 2B4PA 3FEZA 1HI1A 2CQHA 3L7UA 4DV7J 1D0EA 2CG4A 5L9NA 2GIQA 3IA0A 4OX8A 4IOAQ 3RBEA 2YQ0A 4ES1A 2RUGA 3K2YA 4AL7A 1SQEA 4Q45A 3H20A 4MYTA 2VPZB 5ETPA 4NLYA 4RU9A 4CM0A 3CUNA 2UXCF 3CT9A 1KTQA 3O8WA 3EYZA 2CJYB 2OPRB 3DRPB 2HSEB 1TUVA 2LQ5A 2YKNB 1OY9A 2WB1D 4DLEA 2ZBIA 3TANA 2P9GA 4C7QA 4DU7A 5BYQA 4HH0A 2WW8A 2BDPA 2WBRA 3KLIB 3PYDA 4EBEA 2D3UA 1VQ4S 3CWJA 3IG1B 3MEDA 1QJHA 5CYQA 1VIXA 2KKHA 4USJC 1HPZA 2CZ9A 1NK9A 2B8PA 1RTZA 4BLGA 1NH7A 3UD4P 2PA3A 2MLXA 1H7WA 3HDSA 1ZPWX 2IIHA 3KJQB 4TVAB 4WE1A 3U02A 4DS5A 1IJEB 3KTQA 1RBAA 3PW5A 4J9UE 1FKPA 4WXWA 5KG4A 2FC8A 2DGVA 3ZO7A 2KJVA 3M6UA 5KFPA 4YHHF 2UUAJ 1URNA 2YKNA 2HRYA 4WKRA 3FMBA 3R7NB 1ZETA 1O5JA 3THVA 2RDDA 2R2UA 2NXUA 1NJXA 1FE0A 1C1CA 1CJUB 1YJ7A 5MAOA 3EZ5A 6FDRA 2VPWB 1FT8A 4KH0B 4PG5A 1T9VA 4MIWA 5HO4A 3MR2A 1UZDA 2OKQA 2VG6A 2JFDA 4WU3A 1FXRA 4G1PA 2E9RX 3BN7A 2OPQB 4B9MA 4ECWA 3RRGA 1H2UX 1TR0A 1KHWA 4KPCA 3VWSA 2MQOA 5IOLA 1KP6A 4PWDA 3L7PA 1DLOB 1FK9A 5KFLA 1AT1B 1W2IA 1T9TA 1NSAA 5CQGA 2RQ4A 5EX0A 2BV3A 3QRQA 1BUXA 2ERRA 3D54A 3QNWB 1V5IB 4OYBA 2RF2A 2RUSA 3DM2B 1KQGB 4X64F 3T5LA 1GFWB 3BH7B 1U45A 4QWAA 3UWTA 2KFNA 1YRTA 2PEHA 1SJRA 1PAEX 3R6GB 2DIVA 2OP5A 3OTEA 5JUMA 2DHSA 1SIZA 4CO0A 1F9HA 4DV2F 3HXMA 2FJXA 1RT2A 2C2EA 3CCUS 2FY8A 1CJTB 1MROA 2GMHA 2V8VA 2WVFA 2M2BA 4NLPA 5JMNA 5D0HA 4X4RA 5K8PA 1YQHA 3QATA 2CXEA 2ZWPA 1VBZA 1PILA 5A6WA 5F3ZA 2DNHA 3IWXA 2A2DA 3LA0A 3OVAA 3KK3B 1HQUB 1GNKA 2K7JA 2AZ3A 3P8BB 5A76A 3QSYB 4BS2A 1RTIB 2YNGA 4IR1A 2B4OA 2CQDA 2FB0A 1P8GA 1Y9OA 2X3GA 3TUJC 3JSMB 4JV1A 5K14B 2IC3A 3D0IE 2YQ1A 4LFAJ 2XYHB 2HPUA 4CO2A 4NLXA 3H5YA 3FSIA 1PYSB 3KWMA 4ZVGA 1MW7A 2X3DA 1SH2A 5KFKA 2XEXA 3ENAA 5GVQA 4DZDA 1VQ9S 1OSCA 4I2QB 2HNZB 2IVFB 3V81B 3E2EA 5CXTA 2C2KB 4FVMA 1PYTA 3BV8A 3VHQA 1FTRA 1C0UB 3MM5A 3KK3A 1U4BA 4B9NA 2XSJA 3N9UC 3T1YJ 1XNRF 1X4BA 4DL3A 1IBKJ 1GXTA 1JLBA 2B43A 3D6HB 3OR2B 4CH0S 4X65J 4ZVHA 4RNFA 3G6ES 4J9MA 2EKNA 3VAJA 4LFBF 4M5JA 1AB8A 4L76A 1KRPA 2DPIA 1QLNA 4KFBB 2HW3A 1PKUA 3N79A 4ICLA 3LAKA 3CCSS 3GR1A 2FLPA 4UUXA 2L41A 2F4VF 1SUQA 1S57A 1NDKA 2RDIA 3EGNA 1P9QC 1CEZA 4LVOP 4QWCA 3P45B 2UP1A 3TUPA 3QT6A 2XYPB 3GV5B 3OSPA 3F56A 4KB7A 2XBPA 4B3RJ 5EN1A 3P49B 3H0PA 2WBMA 1N32F 3EZOA 4TY8A 4K59A 3K5OA 1TKZB 1T02A 2BQRA 3DLBA 5ETSA 1VQYA 3A8EA 3M6XA 4PYAA 1DTQB 3U1MA 3C16B 1U25A 3V5RA 5GAGU 5F8GA 2XY7A 3TAPA 1F0XA 4GVLA 3SQGA 3TAQA 4ECTA 4RUCA 4H4MA 3TUZC 1R0AB 4WPAA 2BQ3A 1SL0A 1FTCA 4IG3B 1I51B 4B9UA 1JMTA 3TUIC 1B99A 2QZ8A 3I5BA 1TVRB 3CCMS 4CLTA 2VKRA 1TV6B 4OI1A 5ITHA 2Y0BB 2BW2A 3SYZA 5KG7A 4OZ2A 1R0BG 5B0CA 3HSGA 5GMEA 3C19A 2CQ2A 2VBZA 4YEAA 4JUZA 3PW7A 4LF2A 4TN2A 2GVZA 4F26A 1GAOA 5GAHU 4M5LA 2KVQE 3FSYA 3TO8A 3HCXA 4A8MP 4WE1B 1YWXA 4Y6IA 4NZ0A 4LBHA 1Q5VA 4ZPWR 2DY9A 3GIRA 4LVNP 2B5JA 4M8LA 3PR5B 1MMNA 1JLCB 4CNZA 1K73T 3F44A 3QGHA 1RKJA 4FNIA 5HQMA 1RP5A 3LWLA 2HK3A 4DV4F 5ETTA 3DHWC 2YX4A 1T9XA 2NYHA 4WCEQ 4CO3A 2E5JA 2OPPA 2IPOB 5J2MA 2BZ2A 2AYEA 1LWFB 5IC6B 5C24B 5D6GA 4DL6A 1Y5IB 5KG3A 1M5PC 2XLKA 5EUHA 4RLEA 2GGPB 3W5YA 3Q0AA 1NRKA 2F40A 2C2ZB 5AXKA 1FRXA 1RHKB 2VFUA 2AJ2A 4RNHA 5LMNF 4DR1F 2MKYA 5B09A 2FGOA 2LYVA 1YJ9S 5KFAA 1RE1B 1F5BA 2CPYA 1M90T 1WC1A 2VDHA 1U1RA 2MXYA 1YLXA 2RHSB 4IH7A 5F9LA 4OYIA 4LREA 4WFXA 1S0NA 2XZWA 4HACB 1BQMB 1VHIA 3MCOA 4DL4A 4P52A 3EGZA 2RU9A 4P2FA 4PG6A 4ZCMA 4M5HA 2XB2D 5A8RB 2EW9A 3TZYA 1UA0A 3H4DA 2DNZA 4WJBA 4HH1A 4J9QA 3Q2SC 3BSOA 3BYRA 1JIHA 4L72B 1X4HA 1ZAXA 2K3KA 3A4TA 5HATA 5F3TA 2V2ZA 5DDQC 1EKRA 1PAUB 3HHLC 2FHJA 4DX8H 4F2SA 2XI3A 1S1TB 3DDIA 1R8CA 3V4MA 4B9LA 3ADAC 5GADI 1IKWA 1EP4A 3M8PA 4D3GA 3SBMA 1WTBA 2FPHX 1X5PA 3OLBA 4P7VA 1FCAA 2YX7A 1C2PA 4ZJLA 1LFWA 4TU7A 2C22A 1PG5B 3C15B 6FD1A 4AQYF 3KLFA 4M5DB 4WZMA 2P9EA 2ZBRA 4WYLA 1XMQF 4U7UK 4NXMF 1SH3A 3DOMA 4PPDA 4WFAQ 1FXDA 2CPHA 1DURA 1LKZA 1QE1A 1WC6A 2V4JA 3CW2C 2CRLA 2AW0A 3I32A 1HBOB 3GV7B 2EBEA 4IQMA 2W8LA 5D3GB 5IM0A 2QYGA 4NCBA 2GA7A 4DV2J 2NUUG 1U47A 1HR0J 5F0UA 2PI4A 5EDWA 3MMCB 1UZHA 2AT1B 4C4WA 1VRUB 2D3OR 3KLGB 3CCLS 3RR8A 1B7FA 2DR7A 3R5BA 2V50A 2HGLA 2ASLA 5K8MA 3KK1A 2O67A 4J9NA 3HM9A 4AL6A 5AE1A 3DRRA 3MM8B 4RNOA 2HRTA 2H9ZA 3R1HA 2EFGA 1EIYB 2P6SA 5DETA 4Y2IA 3FCVA 1L5UA 2F8MA 2DO4A 2ASDA 4CI0B 2IFXA 1RLDA 4MH8A 1FHTA 2BJDA 1V5VA 4OI0A 1M1KT 1TELA 3W9IA 2V4QA 2AJQA 1VC5A 1TFYA 4KO0B 3FDSA 1OY6A 4U7UD 1RI7A 1APSA 1H98A 2HVIA 3ETOA 1KS2A 2ZKTA 3FVYA 2CNOB 4DX7A 1MWQA 2X1GA 1NMEB 4DR2J 3U1NA 4FPRA 3EDQB 4TU8A 2RQCA 4B3OB 2G1DA 4I7FB 3D2WA 4NA3A 3SI8A 4JI7J 2EKYA 3UO0A 1DTTB 2BABA 1I94F 1NDCA 4X4QA 1I5OB 1T9WA 5E2QA 3UCGA 3CJ3A 3ZTOA 1X0FA 4XO0A 1ZM4A 4JI2F 4Z2XA 2IDLA 4DUYF 4DR3J 4L74A 2HS3A 5GMDA 4X4SA 1NK7A 4HDHA 4JI3J 2AGQA 4MFBA 2WONB 1IQTA 1DQ9A 3K5LA 3K89A 3K0JA 4MT1A 2XI2A 2AJ4A 3ET6A 1SCJB 1U48A 4FF4A 4DWIA 2V94A 1FJGF 4HR2A 4P72A 3L4BC 3E01A 4LSLA 3WC0A 1VQ8S 4FF2A 4LF5F 3U7JA 2L48A 1BQNA 1RT4B 2MSTA 5D0GA 1TK8A 4QWEA 1S6PB 3F73A 1JWWA 2D3O1 4B3TF 4BWJA 5H9FJ 1WG4A 5L1IA 2OLWA 2YPYA 3LUYA 3PVXA 1E6YB 1TMMA 2FZCB 2RKIB 1S99A 2XCAA 3FQKA 2UU9F 1S49A 3M8QB 2OTJS 1R0CB 2W2MP 4IFYB 2YX1A 2J9DE 3GB0A 3V4IB 1GTHA 2F5GA 4ZMMA 1H74A 3H2UB 3POTB 1WG5A 2ABYA 2IRXA 2VBYA 4I68A 4IDKA 2VQEF 4LF5J 2XYGB 1WF1A 3CJSA 2Z2YB 2V2VA 3NKYA 2ZHBA 1R31A 1BQNB 3JSYA 2OH2A 5A8KA 2QL9B 1CJVB 4F3QA 3ZTRA 1YBAA 4RW8B 2PFFB 2CNLB 4ETZA 2E5LF 1TL7A 2ROPA 3N01A 1F5CA 5KFDA 2VFRA 4ZPCA 4YUDA 1S97A 4OHVA 2H1YA 2Q43A 3VGSA 2IA6A 1DQ8A 1RT7A 1FJCA 2GVDB 5DGBA 3DLHA 1XR6A 4DHVA 3DRXA 2VJVA 2BA9A 1VFJA 4Y2CA 3ZZUA 3C16A 3KNAA 3Q8RB 1RWUA 4OHZA 2KFYA 2DR6A 1HQ2A 1RBLA 2BRLA 4PYDA 1RAJA 4NRTA 4RL1A 5HI7A 5BXIA 1TKZA 1RCOB 3FZBA 2D41A 3O5TB 4RO0A 5E7OB 4PR6A 3HVRA 3DU6A 4OZ5A 1QM9A 2QLXA 2NXNA 3MM7A 2R8IA 2PE8A 5CYMB 2MB0B 1FESA 4YB1P 4ZPVR 3BH6B 2FJBB 4FYYB 2A6MA 2HHPA 4DMZA 4USMA 3F0NA 4YY3J 2PD1A 4YB6A 2IRUA 4S0MA 2NCKL 5HQLA 1MU2B 2DCLA 1IJFB 5KFZA 1QUPA 1UPMB 2GHWA 3MR3A 1UWAA 5F8JA 5KT4A 4O3PA 3T41A 1TKXA 2QG9B 1L3TA 1REVB 2MQNA 3TVKA 2N3LA 1URRA 3IP0A 3IRXA 3O2IA 3GIMA 2GX8A 1NJIT 3Q8VA 2YKPA 4AUKA 3OUYA 1VQKS 4M5MA 2ZOFA 1JLGA 4OX9F 5E41A 2UXBF 1ICEB 2V68A 4E2FB 3HJFA 2CA9A 4P75A 1VLYA 1D9DA 3OJSA 2L9NA 1EX8A 4KH1B 4DXLA 4ZP6A 2ZH8A 2X1BA 5J2QA 1L3UA 2H54B 4UF4A 3TVZA 4CLWA 1N5YB 3PYGA 5FD1A 1NSQA 4CLKA 1XK8A 3V6DA 3DOMB 3NNCA 1JLFB 3QAEA 3CJKA 2J0WA 1RADB 5KFGA 3W5XA 4M5NA 1Y3JA 2Q1LA 4MKAA 3X3UA 2IYIA 2BE2A 1F6TA 3OXLA 1Q82T 2RIJA 4TLRA 2JEIA 3AB4B 4A48A 2FHMA 2PA8D 4M5GA 4ITSA 1JLGB 3CCZA 2B4UA 3QGGA 4CT9A 4LF8J 1IBLF 1HBMB 2KL8A 4E0DA 4QBUA 3KLFB 1Q1KA 4A46A 1QVGR 3DN9A 1SJ3P 1REVA 4DV3J 1NHKL 2EPIA 2DRDA 2CWKA 2W2NP 4H4KA 2YXLA 3BSAA 2W01A 3RW6A 1JLEA 2M88A 1OWXA 1O6XA 2NREA 4BDPA 4LF9F 3SCLE 1KQKA 4G3IA 2H5IB 4BC9A 3QPIA 2HRUA 3BGLA 2GQCA 5CD4H 1BQMA 3CC4S 2VC1A 5A8WB 2E66A 2JOQA 3PO4A 1U6FA 2EFOA 2RRNA 3MCSA 4NLQA 1RAFB 4I64A 2R8KA 1GXUA 3TX8A 4CLYA 1MMDA 4ECUA 2DXDA 3Q8UA 2DTJA 2XZTB 4TY9A 3SSSA 4ZPDA 3W8GA 4U7CA 3UN3A 2IVMA 2QIFA 7FD1A 3HHDA 3Q2TC 4WF9Q 2UXDF 2KTQA 2KDOA 1LOUA 3UR3C 2GGPA 2BR0A 1K8AT 1CBKA 3DYAA 2XMVA 3HFZB 4PXDA 3J7ZT 1FKAF 1XIQA 4JI4J 1CJKA 1VCTA 1HIYA 3I5CA 2AD9A 2KT3A 4DFPA 4NA1A 4OYMA 4CYUA 2V0NA 4P10A 3QWPA 4Y34A 2JH3A 5KFHA 1S12A 4DQIA 4JP8A 4OZLA 2FC9A 4ZHRA 3ELHA 4HI1A 3BO4A 3VZIA 4ILRA 4Q5VA 4XTTA 1OQ3A 1KC8T 2QMUB 2CNNB 2ZKUA 3DXBA 4K4ZA 4QIWD 2FHJD 3IC1A 1Y10A 2QJ3A 4ZP7A 3C6TB 3DKDA 4DPUA 4DQPA 4JI2J 1CPZA 1RDRA 2L3MA 3NGTA 4OQJA 4L3KA 2V8PA 1H38A 3M8RA 2QL5B 3TZWA 4R5PB 1SQFA 1IXKA 1JLCA 4ED4A 3VQSA 1I94J 4LQ3A 1CULA 2XTJP 1K9MT 2XS7A 1D3WA 5L1JA 2HQCA 2KN4A 4UTGA 4GO5X 4CYUB 3FRZA 4DUZF 4B3MF 3AA9A 1WD6A 1HD1A 1QAJA 3R97A 2YNFA 1S9EB 2NPIA 2EG1A 3A3PB 5G0RB 3THTA 1HW8A 5KT5A 3LH2S 3KMSA 1PBAA 3RG6A 1BGXT 5D0RA 2RMLA 4ZHRB 2H51B 3J81j 5JVHQ 3I9ZA 4HDGA 1RWPB 2DRBA 2VHGA 4PG7A 2DHAA 4FBTA 2L08A 3FJ2A 4HHJA 4DSEA 3BO3A 2H5JB 2WVDA 4IG3A 1JXVA 1VK3A 1NU4A 1X5SA 2H65B 2MJUA 4KGXB 2GMLA 3IGNA 3AD9C 4NMXA 2WONA 4RJVA 3D1QA 1NPRA 3TAMA 4ZIWA 4ZJQA 2HGNA 3PW4A 4K4WA 5AE3A 4OMFG 2DCUB 5IT4A 2XMMA 3G6YA 1X4GA 1JLQA 6AT1B 4LFCF 1GK8A 1LWXA 3HZEA 3PM9A 3THPA 1NJYA 3T1YF 1CS4B 3M32A 3CXCR 4C11A 3J81Y 2FVRA 2FVPA 1KVJA 1N52B 3FEXB 4C2MA 2QEXS 2KFZA 4I7FA 2V9KA 4Q2LA 2XMTA 1GEHA 3D7SB 3G2XA 2RDJA 2HVHA 1IUJA 2NXCA 2W8KA 4IKAA 1TL3A 2P8IA 4DN9A 1EJ7L 1RA6A 2C3PA 4DV6J 4OIXA 3OFGA 4N8NA 2PN6A 5EWFA 1RTDA 1LXNA 3A3OB 2MDAA 4TQRA 1XNQJ 2YKQA 4LFAF 4UY8T 1L3VA 1WDTA 2G9OA 5C42B 4JV0A 5KG6A 1H6KX 3QLHB 2ZBPA 3SSQA 2H48B 1EQ0A 2HFOA 2MKJA 4K5SA 2E9TA 5D77A 3M2RB 4MK8A 1SV5A 3QT8A 4C0BA 4WFNQ 2AJ0A 2WVCA 1SI9A 1TL5A 3HHKA 3I0RA 5HVGA 2ZH3A 3MM9A 4OZNA 5FDLA 3TZZA 1HBMA 1TZ0A 2XM3A 2ZH5A 2UVVA 3C6UB 4FXWA 1Y00A 5HLFA 2ADBA 1J5EF 2J9CA 1ACMB 2ZH1A 2WHOA 4BCAA 1WC5A 1TK5A 2HHSA 3AOBA 3PFEA 3NXZA 1JQGA 2BE2B 2CVEA 2MEWA 3NAIA 4F04B 1IKYB 3D66A 3L95X 4MIAA 1SXLA 1NK0A 4OYPA 1Y0HA 1RTIA 3P5TL 2CPDA 2JC1A 4P9SA 4TLQA 3K58A 3T3FA 2V4JB 4DQRA 1HI8A 3OFEA 4JI1F 3C2PA 3OVSA 4USTA 4YP3A 2AV5A 3MTKA 1N5SA 1XNQF 2VV5A 1RTHA 1BQXA 4HT7A 1FDAA 3I0RB 4MK9A 4XK8C 3Q8QB 4PRFA 2RHQB 4DX6A 1RU2A 2HIYA 4EEYA 4Q8FA 1KDNA 2DT9A 5KFFA 3MFHA 2R7WA 4ZVPB 1Y7PA 4ED8A 1TU0B 1AFJA 2NPFA 2EK1A 5H1SV 5KOWA 2PSZA 1XMQJ 3MI7X 1VIOA 1S1TA 2OD6A 3KG1A 3JYTB 3CF5Q 1Y5NB 3FRYA 3NWGA 3UN5A 1GX5A 1U0HB 1OQ6A 1TL3B 3ISNC 1NEEA 5K8OA 2LDIA 2RF2B 3JAMU 4JI1J 3CD0A 1BD6A 1M1HA 3DRSA 4CLFA 4DV4J 3M9NB 3PIPQ 1KNZA 1VJWA 3EXYA 2OUGA 3GJQB 1WC4A 2VC0A 3SCIE 1X9WA 3P5BP 1F2GA 1ZA2B 1U2CA 1Z2ZA 4NEZA 5D4OA 4ENOA 4I0WA 1RWWB 2E9ZA 1GMWA 1LFPA 2W7AA 2R7OA 2HZVA 5HROA 2DVIA 8ATCB 2JJ4D 1RGVA 4PXEA 4Y28C 2I38A 4OZ0A 4YN3B 3Q24A 5I3UA 5D8HB 2ADCA 2QLWA 3BBFA 4PQUB 5L8RC 3FBCA 5IQQA 2W2QP 5DLFA 3G96A 4AL5A 3HHLD 5HMWA 1Z2LA 1RAOA 1EARA 3CD5A 4DUZJ 1P9YA 4B3MJ 2G2OA 2FZKB 3K8VA 1IBCB 1F3FA 2OPQA 3PXGa 3KG0A 4IH5A 2AEJA 1I6JA 2LLZA 1K1SA 1OPZA 4LF6J 4NCGB 5J2NA 2R7RA 3BDPA 5D15A 3DOKB 1ULRA 2LECA 1G6BA 1C1CB 1S1VA 1ZM2A 3W60A 2KYZA 1UEKA 2CJBA 3M8WA 3DRYA 4EMDA 2ZDPA 5C25A 2WSFC 4EWTA 3CD7A 5KFIA 5T7LB 2VICA 4QQBA 4RZRA 2XMWA 4X64J 5C25B 2BE7D 3LPYA 1IKVB 4IDKB 3ZNUA 2MKHA 1WKJA 2VASA 5GAHI 5LMUJ 2ATLA 1HYSA 2KG1A 1X7VA 1V9OA 1NKCA 1SH0A 4DV5F 1SJQA 3OTDA 4RWXA 3HP6A 3ZTQA 3EGWB 4CO1A 4DF4A 2MQPA 2EFVA 1KOHA 3TRGA 1HHQA 1UJ5A 2WB4A 2BJ3A 2DHGA 4UOHA 1TK0A 2V6AA 1S1VB 1T94A 2IJNA 2XMJA 4J5OA 4QJVA 1YJVA 1LWEB 1RWVB 3PG9A 4AXIA 2G0IA 1SQGA 2HQDA 1X4CA 3GFZA 1F9EB 4P2XA 2KO1A 3M4XA 2JLFA 2RRAA 1N36J 1XWLA 2APOA 4CO5A 5HROB 4QR1A 2Q6BA 2EFPA 5KT3A 3ILIA 4NLVA 4QYRA 4PQUA 3EM1A 3GYNA 2CQBA 4YHHJ 4KRWA 1N34F 3KXDA 2DGUA 3TI0A 3HKZD 4C8NA 1U1KA 1IR0A 3CSKA 1FEHA 2MY7A 4WTYA 1KN6A 1UAWA 4AE5A 2JFKA 5HJYA 4E98A 4EK2A 5M2UA 3KKFA 1U1QA 3BR8A 2AEFA 5E5NA 3MOZA 1WKLA 3H7HB 3RUBL 4EGLA 3IR7B 2VIHA 4X4OA 2RH3A 4Q2MA 1Q8LA 4HHUA 2MSSA 1YRUA 3QZ7A 1JLEB 3D4JA 2ZM6J 3MEEA 1HNVB 2B9EA 3V6JA 1QVFR 3SCJE 1HMVA 3H40A 1WHVA 1C1BB 1R8HA 3LGMA 2LQ9A 3AODA 4CRJA 4JI8F 3GIJA 3W9JA 2LXUA 3NCPA 3GG1A 4PABA 1BE4A 1T03B 3BQ1A 2XSJB 2DGXA 4U9RA 4GKJF 4M5IA 1C0UA 2CQIA 3LGNA 3MM5B 3AXKA 4ZDNA 2HHVA 1N32J 2I5JB 5KT7A 4ED0A 2YKAA 2HHWA 2ATCB 3C14A 4PG8A 1IBKF 3I55S 5CCMA 1HHSA 4ZVRB 2Y1IA 2NYIA 2AGPA 2BKNA 1NJWA 1BLUA 4JYAJ 1K0TA 1QE1B 3G86A 5K5MA 4DL0C 1C4AA 3KK2A 5HMXA 4CTAB 4Q44A 5D4PA 4Z7CA 3CJ4A 2ZH4A 4OI3A 3UW1A 4M5DA 2H3EB 2YWFA 1YK9A 2L9WA 2GO9A 3MR5A 1MN9A 2C2NA 4KGZB 4USWA 1AUDA 1VQLS 2R2SA 1UVJA 1TFWA 1S0VA 2Q3PA 3K8WA 3K5NA 1TKDA 1RB0A 3CNQP 1U1OA 4N5SA 2I2YA 1VRQC 1NLKL 1R8AA 1VK8A 4X66J 4X4TA 1WKKA 1VS3A 1FEEA 4U8VA 2QSFA 3CCWA 2Z30B 2HNYB 1WUUA 3BGRB 4HLBA 2ZM6F 4P74A 1YJWS 2LVWA 1RTDB 2IBKA 3C15A 2RD5C 3MDFA 4NLDA 5L9XA 5LL6d 3TNVA 4DV0J 1HBUB 4FYVB 4JYAF 2IY5B 2PMZD 1B0VA 2VG7B 4K8RA 4Y2AA 1NNDA 1HL6A 3M8PB 4ZA1A 3JQKA 4URGA 2AU0A 4LF1A 3DLEA 3GLJA 3VAHA 4RW9B 1FXLA 1FDDA 2RVJA 3IS9A 5K9FA 4WYWA 3NGKA 1PIEA 4E8UA 2BW7A 3H90A 3NGDA 3A8KA 3Q8SB 3ZZZA 2B7BB 1NPKA 1FKOB 1ROFA 1WWHA 4Y2KA 4KHPJ 4GRSA 4DR4J 4RW7A 2Y1JA 3I56S 3MZIA 2DHXA 2A6OA 2ZFHA 1WC0A 2QTWA 3KUHA 2VPXB 2GS8A 1N36F 1PC4A 3LPEA 3UDVA 1JLQB 4C0HA 4K4SA 4I6AA 4KAIA 4QCLA 1RXOB 3NP5A 1LWFA 3KHHA 3Q23A 2MLZA 4KGVB 2BM0A 4WFZA 4RNNA 3TAMB 4TYAA 4F50A 2YNFB 3LW5C 2CPZA 3NS7B 3MAAA 1NH8A 4AT1B 4G65A 1N0VC 2UV8A 1QD1A 3NWRA 1R6YA 4URQU 2IDEA 3LALA 4O4GA 5ETLA 3FKBA 2N4CA 3P96A 4NLTA 4WBFA 2J6SA 2AKWB 2R2RA 4N76A 4V1Ak 2HURA 5C24A 4J91A 9ATCB 2M3DA 1KLMB 4OHXA 2IYGA 3Q8PB 2F9JA 2RILA 2GAGC 3DI6A 4C8ZA 1VC6A 3FC9A 3CB4A 1H3DA 1RBOB 1UEUA 1XQIA 2B9WA 2VFSA 1FRIA 2VA3A 4HKQA 4G1QA 5D0EA 2X1FA 3IGVA 1CULB 2GAHC 1IVZA 2KRRA 3SXLA 2Y3YA 5AJ3J 1J5OA 1P1TA 3EVOA 1X4EA 4G1QB 3T9NA 5HP1B 4C6AA 1E6YA 1FF2A 1MWZA 1WSRA 3CCTA 3VQTA 2WVBA 1UMJA 3W7BA 4C8YA 2HQGA 3NS5A 2DGOA 3KLIA 2GVZB 2OELA 1SKUB 3O1LA 2VPYB 4NCGA 3I31A 4H4MB 2HS4A 3QRPA 4QPTA 3ZFVA 3LO3A 1K1QA 3N0VA 1SC6A 1WDDA 3LP1A 3E01B 3NEKA 4LSLB 4ZVQB 1CQMA 4AD6A 3Q22A 2FD2A 4N47A 3S1TA 3AD7C 1VQ7S 1TVRA 1NDPA 1YZ7A 4OV1A 1EKSA 1NM2A 1P6TA 2VBWA 3IRWP 1IWGA
chains in the Genus database with same CATH topology
2PEBA 2P8IA 2NYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEB A;  2P8I A;  2NYH A; 
#chains in the Genus database with same CATH topology
 2BAC A;  2FVC A;  3IWN C;  5ETN A;  1D8Z A;  4A8F A;  3MAH A;  1D9F A;  1FNO A;  4PEO A;  3BBB A;  4DI6 A;  2UXC J;  2LU1 A;  3BPS P;  4GMK A;  4F4X A;  2XO7 A;  3BPD A;  3QJL A;  4X4N A;  4DPX A;  2QLF B;  1DTQ A;  3EIC A;  3T5J A;  4K50 A;  5ETQ A;  1SKW A;  4KQZ A;  5ADZ A;  3KMQ A;  1CC8 A;  2M7S A;  2ZHA A;  3Q8Y A;  2VOD A;  2MYF A;  3EZU A;  4C8M A;  3CJ0 A;  3DDK A;  2VA2 A;  3ZNJ 1;  2J7W A;  3M6V A;  2GC8 A;  4TY8 B;  2D69 A;  1F1B B;  3DRS B;  5HAN A;  3P3D A;  3GCX P;  3S01 A;  4ZVT B;  3UD5 A;  1M0S A;  3QFH A;  5A8W A;  2O66 A;  2FJE B;  3AD8 C;  3MMB B;  3AT1 B;  4WTO B;  4DCP B;  2ZBQ A;  5J1E B;  4QU7 A;  2QRR A;  4FVC A;  4ZVF A;  4KHR A;  2ZD1 A;  3CIZ A;  1FNX H;  2A18 A;  2DH8 A;  2DKO B;  3D1H A;  3QT7 A;  2CQ3 A;  2B6A A;  3CC7 S;  4CM2 A;  3MGJ A;  5B0A A;  2ASJ A;  1OJ4 A;  1NK5 A;  4DN0 A;  2IM0 A;  2B9X A;  3ETM A;  3ILO A;  3CTR A;  4ID5 B;  2VJU A;  4DUY J;  4LF4 F;  4PZV A;  4PWW A;  3F41 A;  1RYS A;  2IMW P;  4I2P B;  4DPW A;  3SDE A;  4K0K J;  1WJ9 A;  2EVZ A;  3H59 A;  3HLU A;  2W4D A;  2Q66 A;  4OI2 A;  4QW8 A;  4RUA A;  1T8E A;  1GT8 A;  5DJB A;  1RAC B;  4RUB A;  3JSM A;  1HNX J;  4GC7 A;  3D0G E;  3MCN A;  2CQC A;  4Q8E A;  3DXS X;  1N33 J;  3CJK B;  3TA1 A;  4EO8 A;  2D1C A;  5CYJ A;  3KJV B;  4HL9 A;  3M2U A;  1DAX A;  3VVU A;  2DR8 A;  1W25 A;  1OS5 A;  5J2Q B;  4O3R A;  1DHM A;  2QO3 A;  2VZ9 A;  5CH7 B;  4F0H A;  1K44 A;  2F4F A;  3CDB A;  2XUL A;  1S0O A;  1GMV A;  3DCA A;  1M5O C;  3M2R A;  2DR5 A;  2OHD A;  4DPT A;  1CJT A;  2CZV C;  1VHF A;  1Q0N A;  2Z2L A;  3J7Y U;  2ZZM A;  4DV6 F;  4DPO A;  3OVB A;  3WBZ A;  2OIH A;  1R8B A;  4CIO A;  3W63 A;  5THW A;  2CIM A;  1FJ7 A;  1P27 B;  1TL1 A;  2DEI A;  2HZA A;  2IRY A;  3TOQ A;  2MQM A;  1DBD A;  3MMJ A;  1JJ2 R;  4FYD A;  1T9Y A;  4NPO A;  4YQW A;  1GTE A;  3TX0 A;  2XLJ A;  4PQA A;  1K47 A;  2MMY A;  4OJ1 A;  4A4J A;  5BYS A;  2H4W B;  4UQG A;  3AXM A;  3R3T A;  4DOZ A;  2G4B A;  1I1G A;  2VFV A;  1J2V A;  5L1K A;  3IO1 A;  3D0H E;  3S8S A;  3NY0 A;  1CS4 A;  3PDN A;  1FD8 A;  3H42 A;  3K5M A;  3PRV A;  2ILY A;  3OD2 A;  5DM7 Q;  1U02 A;  3R1L A;  3RB4 A;  3BZQ A;  4UOF A;  4J9K A;  1AYE A;  5HL7 Q;  3FEY B;  4B3T J;  3FK4 A;  4F2R A;  2R7S A;  1RWN B;  2CPE A;  1UVK A;  3PIO Q;  4WFB Q;  2NQP A;  1NHV A;  3QIP B;  4A8Y A;  3BGO P;  2RNE A;  3PX0 A;  1FFS B;  5B0E A;  1DLO A;  1CJU A;  1RT6 B;  4K7Q A;  4LT6 A;  4ILL A;  2ZHO A;  4PWD B;  3AY0 A;  1A6L A;  3DMJ A;  4AFF A;  1HWI A;  3KYL A;  4A8X A;  1YKW A;  2DY1 A;  2IM1 A;  2MTL A;  1ZZN A;  1VQN S;  1RHR B;  4HTJ A;  2MKC A;  1N56 A;  3HT3 A;  2MZQ A;  5A8K B;  1YJT A;  4O3N A;  1A7G E;  1WSV A;  3HSJ A;  1RT1 B;  3MEK A;  1LWE A;  3A8J A;  4OLO A;  4EO6 A;  3E51 A;  4ECV A;  1VQO S;  4KHP F;  1RTJ A;  4ED5 A;  1JKH A;  3B54 A;  4R0E A;  2XNQ A;  2R7Q A;  4MKV A;  1Y3K A;  4Z7Y A;  3M8Q A;  3GMG A;  3PTW A;  5KFE A;  3EX7 B;  3NAH A;  3ZZR A;  1JB0 C;  3I4H X;  3ITH B;  3AOA A;  5LSR A;  3C6T A;  4JI7 F;  3ZZO A;  2UUB J;  4DL5 A;  2R7V A;  1HYS B;  1T05 A;  1WTF A;  4R8U A;  3PZP A;  2CVI A;  3POT A;  5F8N A;  2HQI A;  4B9V A;  3JSR A;  2BJ7 A;  3D6M B;  5U47 A;  3HX9 A;  1QSY A;  3ISZ A;  3R5C A;  4QIV A;  2IAJ A;  3UDC A;  3FCH A;  5DRK A;  5A6P A;  1FA0 A;  1Q8B A;  3IG1 A;  1RTJ B;  3D6F B;  3DOK A;  2IHR 1;  4RW6 A;  3KLV A;  2QFI A;  1X4A A;  1LW0 B;  5L1L A;  4LR7 A;  2F3J A;  1KVK A;  2V2Q A;  3FBF A;  4NRU A;  5AXL A;  2HQF A;  3MMA A;  5JXS A;  5EWE A;  4FS1 A;  3PW0 A;  4JB8 B;  2C2R A;  2OML A;  3AOC A;  3SEO A;  3SQG B;  1ITP A;  2KT2 A;  1NK8 A;  4DBQ A;  4ALZ A;  4JI6 J;  3IBW A;  3VR1 A;  4O0N A;  1XEZ A;  5M2P A;  5GAG I;  5GMK a;  1ZBT A;  5C2G A;  3TAR A;  3JAM Y;  1SBR A;  2NS1 B;  2G0J A;  1UP1 A;  4WKY A;  1XMB A;  1U7L A;  4P73 A;  3OL8 A;  2M8H A;  3IAS 9;  4URS A;  3R5A A;  2RSQ A;  1D9A A;  4QWD A;  3KHR A;  2HBR B;  3AB2 B;  3VGT A;  5IQ6 A;  1S4F A;  2HND A;  4LBI A;  2MZ1 A;  1VBY A;  2CG8 A;  1HBN A;  3PNI A;  2JNJ A;  4I4B A;  3DU5 A;  4OYA A;  4WP3 A;  2XS5 A;  1HA1 A;  1HWK A;  1Q53 A;  3K7R A;  1JXL A;  1AUS L;  4KO0 A;  2MGZ A;  4AQY J;  2OGU A;  1T3N A;  3IBF B;  2MKK A;  2LEB A;  2K06 A;  3R8Y A;  4WU2 A;  1W2B R;  4FZV A;  2DGQ A;  1HFE L;  3MF5 A;  2QLB B;  4USH A;  2KRB A;  2AX0 A;  4K2X A;  4KGM A;  3BGR A;  1RJJ A;  2DNP A;  3ZTP A;  5HQ8 A;  1UVL A;  3ZXW A;  1B0P A;  3D3B J;  1NXI A;  4JBC A;  3KK1 B;  2FLL A;  2DK2 A;  2JLE A;  2LU2 A;  2EG2 A;  1NK4 A;  1VRU A;  1ZAW A;  2CQ1 A;  2BE9 B;  1M5H A;  1Z4U A;  1U2F A;  2P5V A;  3QYY A;  5EGY A;  4FF3 A;  4BHQ A;  3VV2 B;  1RAA B;  4ED6 A;  2O3D A;  4ZCI A;  1RTH B;  4NZ6 A;  4CNY A;  1MG7 A;  4J9O A;  3RBX A;  3RRK A;  3KJV A;  3PCO B;  3HZG A;  3HF5 A;  3LP0 A;  1Y5L B;  5BJR A;  3CME S;  1FRJ A;  2KVI A;  2R8H A;  4F4W A;  5K14 A;  3CMA S;  1IKY A;  1T7P A;  3UVJ A;  3RU0 A;  3NOG A;  4RPF A;  3TA0 A;  5B08 A;  2JDJ A;  2IA0 A;  3HD1 A;  3AQO A;  3HVT B;  3N5B A;  1PJ5 A;  4F7V A;  2AYG A;  4ZLP A;  5J2P B;  4QWB A;  2UV8 G;  5IT0 A;  2YWH A;  2JVO A;  1SVD A;  1U2R A;  3TJ8 A;  1RK8 A;  3IRX B;  3S6E A;  2XO6 A;  2R7X A;  1JJC B;  1OYE A;  2NUH A;  1SL1 A;  4NLG A;  4D3H A;  3CJR A;  1SV5 B;  3ZZT A;  4DSF A;  1C1B A;  2W9B A;  1UFW A;  1BXN A;  4KYZ A;  4USK A;  1LWC A;  2B6A B;  2ZOG A;  5IV3 A;  4Q43 A;  2W9A A;  2C2O B;  2F8H A;  3N28 A;  4Y65 A;  4DR3 F;  1YIT S;  2HHH F;  4GKJ J;  3ENW A;  2JEG A;  1QDU B;  2NR0 A;  4RKU C;  5KFN A;  5DG7 A;  3R7B B;  3OHB A;  2ZH2 A;  1O51 A;  3L9Z A;  2J0Q D;  2NZ4 A;  2WZ1 A;  2C28 A;  2VOP A;  2ZVS A;  2JHE A;  2NZC A;  2HAF A;  3MTJ A;  2VOO A;  4K0K F;  2O5D A;  3MWB A;  4H4K C;  2D3Z A;  9RUB A;  1NB7 A;  4ETX A;  3GIL A;  3SZ2 A;  3UNY A;  2M70 A;  2OD4 A;  5E3P A;  2HKE A;  5B0B A;  2Y8Y A;  1R3N A;  1YSJ A;  1N8R T;  1HKA A;  2WTF A;  2MPU A;  4QW9 A;  4OYW A;  2Z2M A;  3L7O A;  4PWU A;  2JWN A;  2V69 A;  2AGO A;  3JQJ A;  3UI3 A;  4X66 F;  2O1P A;  3DOL A;  2OPP B;  1S79 A;  3LF0 A;  3P4U B;  1RT7 B;  4DR1 J;  2LA4 A;  1Q81 T;  1RKI A;  3QMQ A;  1N34 J;  2LFV A;  5GAD U;  3J7Z 5;  2KH9 A;  1HNI B;  4MKY A;  2CQG A;  1VIS A;  2QX0 A;  3CPW R;  1TMJ A;  3LOU A;  3BGU A;  2CDR B;  4K2J A;  1YZ6 A;  3BS9 A;  4RW8 A;  4OV6 A;  4ELV A;  3D3C J;  2EXU A;  1RAE B;  1VDH A;  2LP4 A;  1N0U A;  2KXF A;  3E3X A;  4LFC J;  1XR7 A;  3FCW A;  2HHH J;  4QYZ K;  2RAQ A;  4I6Y A;  4FYX B;  3P6Y C;  4B08 A;  2MKS A;  2RQM A;  5CA5 A;  1E6V B;  2X7I A;  2HHU A;  3RJM B;  4DR5 F;  3G8Q A;  4KHM A;  1QY7 A;  2H4Y B;  2HYI B;  3GON A;  4DQQ A;  4GVB A;  3GFY A;  1HNZ J;  5CYQ B;  2F4V J;  3ZTS A;  2ASY A;  3MED B;  2EC0 A;  5DZ7 A;  1SC4 B;  2JC0 A;  2VFT A;  1RT1 A;  3QFW A;  4QIG A;  3BQ0 A;  1NKB A;  4XAK A;  1CG2 A;  5IWA J;  1FFG B;  2XSF A;  4F3M A;  1X9S A;  3QID A;  4OHY A;  1XJW B;  2DNQ A;  4R0J A;  1Q78 A;  3BBC A;  1NZ8 A;  3FUY A;  3ONQ A;  1VRT B;  2VF3 A;  2YY3 A;  3OTB A;  1EZZ B;  1KOO A;  1KFD A;  2J7U A;  2HMI A;  1DFD A;  3FSX A;  2B4V A;  1DRZ A;  3DHX A;  3IAM 9;  2BUN A;  3MEG B;  3T1H F;  1IWA A;  3M8Y A;  3MAA B;  4TQS A;  3TJA A;  2I1R A;  4PG4 A;  3A12 A;  4LF6 F;  2HFN A;  4ZPT R;  5IXU A;  2FVQ A;  3DOL B;  4DR7 F;  2XMK A;  1S9G A;  2FVS A;  2ZE2 A;  3QGP A;  2J6T A;  3VZH A;  7AT1 B;  2C2D A;  1CSJ A;  1GXL A;  3HFV A;  2N82 B;  2B51 A;  1G2E A;  2XQC A;  4FXV A;  5J1P A;  2U2F A;  2DRA A;  3BF4 A;  5IWA F;  1SUQ B;  1ELO A;  3AH6 A;  3FMW A;  1FVS A;  4RW7 B;  3W2W B;  3QJP A;  4USU A;  4ZKA A;  4Y3C A;  1IBL J;  2I8E A;  4ES2 A;  5AT1 B;  4Q7A A;  2QN6 B;  1AFI A;  3UDL A;  1U1P A;  2LQ8 A;  1U1L A;  3GYG A;  2WOM A;  2PGC A;  2FJD B;  4N77 A;  4TKT A;  2QGF B;  4WFY A;  3PX6 A;  2VBX A;  3PHT A;  1S10 A;  2J6U A;  3V2U C;  2QA2 A;  4O3S A;  3R7S B;  2KG0 A;  1VR6 A;  1YBT A;  2FLO A;  3FQL A;  4PCQ A;  3CE8 A;  5E0O A;  3G82 A;  2ALY B;  1N48 A;  2ZVI A;  1DAR A;  2F1F A;  1JNR B;  2DIT A;  4X65 F;  2OFH X;  3QQC D;  2CUY A;  3J81 U;  3OR2 A;  1S72 S;  4B3R F;  3B4M A;  4L6V 3;  2MZR A;  3DRR B;  2KT5 A;  1NJZ A;  1QAY A;  1WOO A;  1W26 A;  2L9D A;  1IM6 A;  1PJ7 A;  1RU1 A;  4DR4 F;  1VLO A;  1XTZ A;  4N56 A;  1WOS A;  5HJX A;  2HBY B;  4KT0 C;  3G71 S;  4MYU A;  1S76 D;  3HO1 A;  1BC6 A;  1WEZ A;  1IBM F;  3KLG A;  2X1A A;  1V3R A;  2MZJ A;  4L73 A;  3WDO A;  4F0M A;  8RUC A;  3UVJ B;  5A2Q U;  3NCR A;  1QSS A;  4I6W A;  2IJF A;  3NCQ A;  1RQ0 A;  4ECQ A;  2UZA A;  4Q0B B;  5G4D A;  2PFD A;  5DZ6 A;  1Q16 B;  4DV1 J;  1GX6 A;  5KFT A;  5H9E J;  2IC3 B;  2QC3 A;  3I4P A;  4DX5 A;  2ZZN A;  1KBR A;  4A8K A;  5LXY A;  1H2T Z;  5HVF A;  4ZPB A;  2ROE A;  1UL3 A;  3EPG A;  1RA7 A;  4LQ9 A;  3G82 B;  4CLP A;  3R5D A;  1FWK A;  1R7I A;  2I9S A;  2XNR A;  3TJ9 A;  4FXD A;  3CO0 P;  4KKO B;  1NDL A;  2PO4 A;  1SC3 B;  3M1V A;  2XGP A;  2W2P P;  2GMJ A;  3HI9 A;  2EWH A;  1JLA A;  1CC7 A;  1TKX B;  1ZPV A;  2K1R B;  3GSI A;  2Y1R I;  1U8W A;  5CHC B;  5KFO A;  1N6Q B;  3R2C J;  1UVM A;  3PJ9 A;  2GQQ A;  2QA1 A;  5SZT A;  4LRC A;  1LK5 A;  2BKP A;  3W2W A;  2E5G A;  4ATN A;  3T5H A;  3NNA A;  5F8I A;  5IT9 Y;  2GJI A;  1WNE A;  2YQ3 A;  4M63 A;  1VGY A;  2GJF A;  2M5Y A;  3NNH A;  1EB0 A;  3W66 A;  2ZE2 B;  3RZA A;  2LKZ A;  1CQN A;  1HQE B;  1MLA A;  3MM7 B;  3NLC A;  4X4P A;  4LJM A;  4YDD B;  4F4Z A;  4DF8 A;  3G8T A;  3VAL A;  1JNZ B;  1GH8 A;  3EPI A;  2MKI A;  1QSL A;  1S59 A;  3OSN A;  1KFS A;  2JX2 A;  3D9B A;  5J1N A;  3WX8 A;  3KOA A;  4MTP A;  1S1X B;  1VI7 A;  2BEF A;  4F0K A;  1OPI A;  3D28 A;  4USV A;  4UZC A;  3RRH A;  5A0Y A;  2FJW A;  1XER A;  3LP2 A;  2HBZ B;  3EJM A;  5D4L A;  3PV8 A;  4OYZ A;  5J2M B;  2HWH A;  2GVD A;  4QIE A;  4RUH A;  2R2T A;  3DLG B;  2JZ5 A;  3PEH A;  2NSB A;  3EVW A;  4ECY A;  1FRH A;  1FDB A;  2YNH A;  2A10 A;  2LQB A;  2MLY A;  1X4D A;  1UA1 A;  4KTQ A;  3BDE A;  5HP1 A;  2E29 A;  1U6Z A;  4YR2 A;  1Q7Y T;  3J80 Y;  4I69 A;  2IAJ B;  4USI A;  1KSP A;  2RJZ A;  5CAA A;  4ZIV A;  4CLU A;  2G2Z A;  3CC2 S;  3OXG A;  1ZAV A;  3TQ1 A;  4P2M A;  1HAR A;  1UEV A;  5HBM A;  1YDL A;  3DLK B;  2BJ9 A;  4OI4 A;  4TNO A;  5SUH A;  3SQO P;  5AXM A;  2YWK A;  4C3K A;  5F8M A;  2OJ3 A;  4M95 A;  4WII A;  2HS0 A;  3SIP B;  3J7A N;  4WZQ A;  1IKV A;  2C3O A;  2GW8 A;  1YRX A;  3DLK A;  4HI2 A;  2MZS A;  4FN5 A;  2E7X A;  3V4I A;  3PYF A;  3M8Z A;  2CJ9 A;  2ACM A;  2WAQ D;  1MNE A;  3HVW A;  4IFY A;  5CAB A;  4XPC A;  1R6V A;  2W24 A;  3DRP A;  2DGT A;  3B4D A;  2E7W A;  4JI3 F;  4I67 A;  2J9D A;  4YOE A;  1RWX B;  1RWO B;  1KON A;  3QSI A;  5FII A;  2V9W A;  2AYB A;  3D67 A;  3FNN A;  3ILL A;  3LAM A;  3W1Y C;  5AXN A;  1CJK B;  4NLR A;  2DNL A;  4DG1 A;  4F25 A;  2DEJ A;  1RHQ B;  2FQQ B;  3MPV A;  4FDF A;  4PXC A;  1RZM A;  1FD2 A;  2RB7 A;  3HVA A;  3NMA A;  5IT9 U;  5BR8 F;  5D78 A;  3EWG A;  1WAC A;  4XDC A;  1SL2 A;  1XMO J;  4IUF A;  2E1M C;  2IBO A;  2XZD B;  1B70 B;  4ZOS A;  4BC7 A;  4ZK7 M;  4DU8 A;  3RB0 A;  3C46 A;  2LEA A;  1U26 A;  2PEB A;  3MCM A;  3CED A;  2QV6 A;  4R25 A;  1O8B A;  1R8P A;  2HG4 A;  2ALZ A;  1H73 A;  5B0D A;  3PR4 A;  4IRD A;  4WK1 A;  2QA4 G;  2CWX A;  1S7H A;  1WEY A;  2BAN B;  3MM6 B;  3JSB A;  4HVZ A;  3TA2 A;  4ZLN A;  2VQF F;  3CVK A;  3G6V A;  1XN9 A;  2ZNZ A;  3SMZ A;  1SKR A;  4N8O A;  5IFM A;  4W98 A;  4ZP8 A;  1RHM B;  3OXF A;  4I56 A;  4L75 A;  4PKD B;  5I3Q A;  4NWB A;  2DPJ A;  5IZH A;  3BRE A;  3US5 A;  1H0H B;  1ZS6 A;  3QRR A;  1JLA B;  2WCX A;  3AJ2 A;  4U8Y A;  2GO8 A;  4ZLJ A;  5DG8 A;  4NLW A;  3K57 A;  3JB9 k;  1IQZ A;  1S6O A;  2DIS A;  4J9R A;  1TKT A;  1WEL A;  1B0T A;  4BBY A;  1R43 A;  4U67 Q;  4YR0 A;  2CPX A;  1RUS A;  1NK6 A;  1AA1 B;  3VF0 B;  2EI5 A;  1U09 A;  4DZ6 A;  4AXJ A;  5A2Q Y;  4X2B A;  3D5M A;  5BR8 J;  2XHC A;  2Y1L B;  5F0W A;  4ZVU B;  4DLG A;  4IQX A;  2QMW A;  5IC4 B;  5DQH A;  3OJU A;  3VAI A;  3H5U A;  4I2Q A;  3UQS A;  1Q95 G;  2ZEJ A;  4LIW A;  3MM8 A;  4RBT A;  5DQG A;  5GAE I;  2W9C B;  1C0T A;  3KDN A;  4OFZ A;  5LM7 E;  4CH7 A;  4YFU A;  1WI6 A;  3OLA A;  2POK A;  4KIA A;  2PT0 A;  4O44 B;  2I6W A;  3VAF A;  3GCW P;  2KHD A;  2XMU A;  3U1L A;  4DUT A;  1C0T B;  5FLX Y;  2W2O P;  3M9O B;  3KUG A;  1YIJ S;  3VAK A;  1H2V Z;  4QR2 A;  2B7C B;  2BKO A;  4UOG A;  3M8S A;  1FRK A;  3IFE A;  2UVW A;  3CUL A;  5IV4 A;  1Y11 A;  2I5J A;  2HWT A;  1S7I A;  4JI0 J;  2KZZ A;  4JI5 J;  2VB6 A;  5D3G A;  1PJ6 A;  3SDE B;  3BN4 A;  1JK9 B;  1VOM A;  2KM8 B;  3OFF A;  2LA6 A;  3C6U A;  2P6T A;  4NYO A;  2ZH9 A;  1LK7 A;  3KJF B;  3CCE S;  2NLW A;  4ZJO A;  2ILZ A;  5F8H A;  1TUG B;  4CLS A;  2DNY A;  3TW0 A;  1NKE A;  1NAQ A;  1YHQ S;  2OO4 A;  2A2C A;  4J9V A;  2DB1 A;  1YTY A;  4IRK A;  4OZ3 A;  1U1M A;  2OSQ A;  4U95 A;  4K5R A;  1C4C A;  2YPZ A;  1T11 A;  1IKW B;  1EP4 B;  1RWM B;  2C3U A;  3Q83 A;  4JV2 A;  2YTC A;  1SC1 B;  4OX9 J;  2UXB J;  2MGZ B;  3OL7 A;  2VKZ G;  4WIQ A;  3QWU A;  3RB3 A;  4OZ1 A;  3T9Z A;  2CAJ A;  2K3I A;  3V6H A;  4ANE A;  2UU9 J;  4A8S A;  4DSL A;  4C97 A;  2CJK A;  3IM9 A;  3LTO A;  1HBN B;  5CYM A;  1J5E J;  4DEZ A;  3FFI B;  2HND B;  3I5A A;  4RX6 A;  5KFV A;  4JI0 F;  2E1A A;  4PXB A;  5KFX A;  1FX4 A;  5A8R A;  2XS2 A;  4MK7 A;  4DV5 J;  1JJ4 A;  2K2P A;  3TZX A;  3R5J B;  3WX4 A;  1FK9 B;  3L09 A;  2ZNY A;  3KUE A;  2XY5 A;  3I87 A;  1G7C B;  1NO8 A;  2IJR A;  3K17 A;  4FKX A;  4IRC A;  1ZM9 A;  1HWU A;  5DO2 A;  5BYR A;  2W7P A;  3A3N B;  4CQ1 A;  4O0I A;  3RTV A;  2UUB F;  3MMA B;  2G2Y A;  3R27 A;  2P2C B;  4N41 A;  1BWV A;  2J9E A;  3M05 A;  2FJA B;  3N6M A;  4EUV A;  1Q86 T;  2DNO A;  4OYX A;  1RYR A;  2E5L J;  2V2K A;  3GII A;  5DDR C;  3UN2 A;  1T3O A;  3UNG C;  1MN7 A;  2HHQ A;  2E5H A;  5B0G A;  1F2H A;  1X9M A;  4C0O C;  1CJV A;  2EC2 A;  4K4X A;  5G0R A;  2V34 A;  1S4E A;  4UW2 A;  4NLO A;  2LEP A;  1ZZF A;  3DC2 A;  4JI6 F;  1H7X A;  1QAI A;  1NSP A;  4DV0 F;  1BMQ B;  1UWB B;  2HLT A;  2WSC C;  3M2V A;  5ETM A;  5F8L A;  1HPZ B;  4GVB B;  1TP7 A;  3MAQ A;  3BJY A;  5LSO A;  4C8L A;  1N5V A;  5I42 B;  5AE2 A;  1RHU B;  2VL1 A;  2OPS B;  2SXL A;  3BGF A;  3GFX A;  3M2V B;  2FUG 9;  1S6Q A;  1JKH B;  1RSC A;  2XWX A;  3SCK E;  5L39 A;  3NBP B;  2ZH7 A;  3RAQ A;  1YJN S;  2Z2Z A;  4NE9 C;  5B0F A;  2E1C A;  4H54 A;  3DI6 B;  4NI2 B;  4OJH A;  4A8O A;  1RT4 A;  5LT5 A;  3HMJ G;  3OR1 B;  2G13 A;  2F63 A;  2BJ8 A;  3CCR S;  2D7S A;  1Q8K A;  4B17 A;  4EBC A;  1ZYQ A;  3PO5 A;  5A0Y B;  1QUV A;  1RT5 B;  2GCF A;  5KG5 A;  4K4U A;  1J27 A;  4O4G B;  1RT6 A;  3AQP A;  1UTA A;  3ILJ A;  2JSX A;  1FX2 A;  2J8A A;  4CZC A;  4RNM A;  4J9S A;  2FHK A;  2GNK A;  3I0S A;  2H5E A;  4MIB A;  3EGV A;  4MFB B;  1HR0 F;  2E1P A;  2E5I A;  5I4M A;  3GTY X;  1VBK A;  2A3J A;  3M30 B;  3PHE A;  5DDO C;  4ED1 A;  1OO0 B;  2NXJ A;  4YDX A;  4ECR A;  1UFL A;  4LSN A;  5KFQ A;  2HZC A;  2UVU A;  2YKM B;  2BQU A;  4DCO B;  4NXN F;  5HSP A;  3MPU B;  4JOU A;  3G9C A;  3N5F A;  4NOH A;  1SJF A;  2YKO A;  3GJS B;  4NYZ A;  1FKO A;  2AHO B;  4B3O A;  1RAB B;  4OI6 A;  2DNR A;  4NML A;  2N4D A;  4BWM A;  4KR0 B;  3G87 A;  4KV8 A;  1U0H A;  1XBW A;  1N33 F;  3TR5 A;  1VQP S;  2B3T B;  2R8G A;  5AJ3 F;  2UUT A;  3MUR P;  1FO1 A;  2AX1 A;  3FZ2 A;  1KHV A;  2WVE A;  2J7K A;  4OLP A;  4DS4 A;  3KNG A;  4PUO A;  1U1N A;  3H2V E;  4UUW A;  3H98 A;  4DR2 F;  2GZO A;  2A0F B;  1M5K C;  3HHN B;  2AZ1 A;  2YWW A;  3WZ0 A;  3CO9 A;  4NL5 A;  4A47 A;  4ZLL A;  5KFR A;  3M2U B;  1G1X A;  2W4C A;  2RS2 A;  1WC3 A;  4ELT A;  2B9Y A;  2HNZ A;  3V81 A;  3MMC A;  2VG5 B;  1NZA A;  1RAG B;  3H4B A;  2FLN A;  4K4V A;  4UQT A;  2VU5 A;  4F4K A;  5LMN J;  2W25 A;  2YNI A;  3ENQ A;  4YB7 A;  1EET A;  1Q7L B;  3RGI A;  3LP0 B;  1OSD A;  3RR7 A;  4LF9 J;  4OX7 A;  2F9D A;  3KK2 B;  1HI0 P;  5DM6 Q;  1EET B;  3AAW B;  4IG0 B;  3QO9 B;  4ID5 A;  3KLE A;  4NLU A;  1WI8 A;  5T14 A;  1ZA1 B;  4U6P A;  3KLH B;  1HNW J;  4OJG A;  3AJ1 A;  3C14 B;  3MEC B;  1Q79 A;  2HLU A;  1TQL A;  2ZIT A;  1X5T A;  3H8Y A;  1SPB P;  3ZZ0 A;  4F36 A;  3QT5 A;  3M9M B;  2UUW A;  1X31 C;  4PUO B;  1HQU A;  1Z1Z A;  4ZP9 A;  1LW2 A;  1KQS R;  4ID8 A;  5CZV A;  5J1E A;  1PBU A;  1TKT B;  2MQ8 A;  3JXO A;  3MMB A;  1GMU A;  4KV8 B;  4WP8 A;  1NCL A;  3CDU A;  2ZOM A;  3OFH A;  3R6L B;  4DFM A;  4GO7 X;  1ZOT A;  1DZ5 A;  3KHL A;  1KLN A;  2V8G A;  3N6N A;  1REG X;  1FFW B;  2E7V A;  3BKT A;  2Z4P A;  4ZCL A;  4C11 B;  4CCH A;  3CJT A;  4DR6 J;  4F67 A;  5KT6 A;  2DNN A;  3PFO A;  4DV1 F;  3EXC X;  3MM6 A;  4WP9 A;  1N4L A;  3T19 A;  3WIV A;  3OTC A;  1S48 A;  1UKU A;  1XR5 A;  4RR5 A;  3W61 A;  1T95 A;  3PKM A;  3CJ8 A;  2G0C A;  3MPY A;  4IO1 A;  2E44 A;  1KVI A;  5CZX A;  3MXH P;  3W62 A;  2DXE A;  1WF2 A;  1HD0 A;  3I0S B;  3TEG A;  4FS2 A;  1HWL A;  3RAX A;  1RAI B;  8AT1 B;  1IBM J;  2BXJ A;  5E3Q A;  1KKH A;  1RLC L;  3UPF A;  4KPY A;  4ZCK A;  2BMB A;  1HNZ F;  5DS7 A;  2PII A;  2ROG A;  4N7T A;  1KQF B;  5CCL A;  3D6T B;  1YI2 S;  3KDO A;  1D8Y A;  2Z0G A;  3GSD A;  2B8Q A;  1NSK L;  3EDR B;  4KE5 A;  3WQP A;  5KFM A;  1A0O B;  1F5A A;  2OAU A;  1B4S A;  2UVR A;  1V3S A;  4QU6 A;  4ILM A;  3TYT A;  3VAG A;  3NBP A;  4RBV A;  1KR4 A;  2IVY A;  1RHJ B;  4LBP A;  5KFU A;  2ZDO A;  2R8J A;  3QBC A;  3O3L A;  3IR5 B;  1J5O B;  3N6L A;  3UD3 P;  4R5P A;  5E33 A;  4DSJ A;  1I3O B;  1U0S A;  2AMC B;  2OI2 A;  4MAK A;  5KFJ A;  3LWM A;  5KG1 A;  3IXQ A;  1E6V A;  1FWP A;  4NCA A;  3TVY A;  2DO0 A;  3AA8 A;  1N88 A;  2RU3 A;  1F9F A;  3KJN B;  4K4T A;  4LRD A;  3H25 A;  3ITH A;  1FJG J;  1V6H A;  1UJ6 A;  2LMI A;  5T7L A;  4F02 A;  1WEX A;  4UOC A;  2BYC A;  1WHX A;  2R4F A;  1X8D A;  4W4M A;  1VQM S;  2BOP A;  2HVD A;  2YNH B;  3GE9 A;  3KFW X;  4Y00 A;  3Q86 A;  3OTO F;  1S6P A;  2K7K A;  3WIU A;  2BVZ A;  2R3V A;  4DL7 A;  5HVH A;  5L46 A;  2LXI A;  3JTP A;  1V3Z A;  2CNK B;  4QOT A;  4DCJ B;  5CD4 A;  3LP2 B;  4F4A A;  2KU7 A;  2UUC F;  2DIU A;  4C48 A;  3UCZ P;  1DY3 A;  4CLL A;  2Y8W A;  1FVQ A;  2HHX A;  1HNI A;  1CLF A;  3N4W A;  4Z37 A;  3MOJ B;  4X4U A;  1NUE A;  1X5O A;  2YWG A;  2QMX A;  3W64 A;  4IO9 Q;  3H5X A;  3JTO A;  2RRB A;  4NEY A;  3O44 A;  3G6X A;  2FHO B;  1EAY C;  1RCX B;  4EYI B;  2HHT A;  2HAI A;  2GIF A;  2LXF A;  3HUL A;  2BBE A;  2CQ4 A;  2R7T A;  4DPY A;  4RW4 B;  4FKY A;  2ZJR Q;  3BSN A;  3R2D J;  3OBI A;  1FE4 A;  2GHP A;  1PGZ A;  3LAN A;  1RAH B;  3RW7 A;  1DJ0 A;  2EBG A;  3C66 A;  2RT3 A;  2VG7 A;  5D4N A;  4LFB J;  5LMU F;  2CYY A;  2W9B B;  1VMB A;  3ENV A;  4I1T A;  4P6Q A;  3BEG B;  3PKY A;  1VQS A;  1F3V A;  1X4F A;  1JLB B;  3M1V B;  1XNR J;  4C8K A;  3MUM P;  5C7P A;  3GPA A;  1TL1 B;  5HMZ A;  1WHY A;  2VON A;  1BWE A;  2DNK A;  4B9S A;  2BRK A;  1S1U A;  5J2P A;  4IH6 A;  4PPZ A;  3OL9 A;  3LGH A;  4XPE A;  1KTV A;  2B0G A;  1AZS A;  2WK4 A;  3VTI A;  1QAX A;  3H5S A;  1UJ4 A;  4J90 A;  3MEC A;  2FJV A;  3UCU P;  4ANC A;  4C98 A;  2CPI A;  3X1L B;  3U27 A;  4K4Y A;  4ELU A;  3AFG A;  3GJT B;  4QR0 A;  3J80 U;  2D9O A;  1L3K A;  3V6D B;  1D09 B;  4DV3 F;  3JS9 A;  2YBV A;  3SSR A;  3NS6 A;  2OSR A;  1QTM A;  4LRA A;  1VJQ A;  2J5A A;  2KB2 A;  2F7V A;  4ZVE A;  5DLG A;  3HHL B;  4DR6 F;  1N54 B;  2HBQ B;  2VG5 A;  4DSI A;  1AW0 A;  1FI4 A;  4IOB A;  3W8P A;  4GC6 A;  1N5Q A;  4O23 A;  1OMS A;  2MHN A;  4NZ7 A;  2CJA A;  1S1U B;  3CGI A;  1VBX A;  5EX3 A;  4O44 A;  4CH1 A;  3MUV P;  3IN5 A;  2P9C A;  3T5K A;  5DG9 A;  4Y0F A;  2FTR A;  2RS8 A;  1S0M A;  3OPK A;  1BHN A;  2FZG B;  2IM2 A;  2EFQ A;  3M7V A;  5M2R A;  4TU9 A;  4CWB A;  3G8S A;  2KI2 A;  1VC0 A;  2W1B A;  4DFJ A;  4X62 J;  4IFV A;  2J8S A;  3PJX A;  4RU2 A;  3QLH A;  4FYW B;  2COL A;  1MML A;  2GFF A;  4TYB A;  5C42 A;  4ECZ A;  2HFS A;  1KWM A;  1WOR A;  2B56 A;  2JL9 A;  1YVF A;  1F60 B;  3C8Y A;  3W2V A;  5C5J A;  1MSW D;  4KBI A;  4J9L A;  2V8H A;  3CDE A;  3TQE A;  3HHE A;  3W5Z A;  2F65 A;  4RW4 A;  2HVE A;  2WOM B;  2AQ4 A;  1IR2 A;  2DHH A;  2ACY A;  2FGC A;  3ULH A;  2XY6 A;  1UVN A;  2RE1 A;  3GYX B;  3L3C A;  3MPD A;  3H2L A;  4IYQ A;  2Y9H A;  1S6U A;  4QIF A;  3ZC4 A;  3FBB A;  3FBE A;  2MY8 A;  2NSC A;  2IM3 A;  3OT9 A;  1IKX A;  3QGI A;  1RT3 A;  2OMO A;  3HSZ A;  3BO2 A;  2YWE A;  4J9P A;  1TTH B;  4LR8 A;  4DR5 J;  5H9E K;  2AJF E;  2GJ2 A;  3RAM A;  3CD6 S;  3RBD A;  3B6B A;  4GKK F;  1NHU A;  3PY8 A;  3UE2 A;  1S9G B;  1VYA A;  4EFA C;  4X62 F;  4C8O A;  2Z57 B;  4DJB A;  1LW0 A;  3VCD A;  4QZV B;  1SIW B;  3MEG A;  3CIM A;  1OIA A;  4YB5 A;  3DNC A;  3MHY A;  4LMZ A;  1TL7 B;  2N7Y A;  2ZH6 A;  1RT5 A;  3HSD A;  3NGU A;  1U8S A;  2ZZT A;  4KY3 A;  2OEM A;  4RWW A;  4O3Q A;  4F4Y A;  3SFG A;  2UUA F;  1OYD A;  4G1I A;  3PEJ A;  5H9F K;  4DG1 B;  4M1K A;  1NB2 A;  1N5Y A;  4NI2 A;  3T1H J;  2JEF A;  3VGU A;  4RW6 B;  4R8U B;  2DGW A;  5LXR A;  1ZTT A;  4ZVO B;  2Z58 B;  2Z8Q A;  3CJ5 A;  5HBM B;  2PMH A;  4ZS6 A;  2UUC J;  2BOA A;  3BSC A;  2ZUA A;  5MLC V;  4DR7 J;  3GIK A;  2BX6 A;  1G3O A;  2HFZ A;  1AXQ A;  2K8G A;  2KYX A;  3A13 A;  3PJW A;  3T6B A;  5LSL A;  3VGV A;  2A1B A;  4RBU A;  1XC9 A;  5IS2 A;  5LJ3 Y;  1T05 B;  2QYC A;  2X51 A;  1GQE A;  2J0X A;  3ICL A;  3TEH B;  3GG0 A;  3EE3 A;  3UDE A;  4WXO A;  4YME A;  1PYO B;  2CQP A;  2OEJ A;  3KG4 A;  2GV1 A;  4J37 A;  4W90 B;  2UXD J;  4M94 A;  1S1X A;  3GV8 B;  4HT5 A;  3ET6 B;  3BR9 A;  1UET A;  4O3O A;  2QFJ A;  2DH7 A;  3JTN A;  4ZN1 A;  3KHG A;  3J7A 1;  4DFK A;  4OYO A;  4JI4 F;  1PSD A;  1MWY A;  1UCN A;  3J7Y I;  2D9P A;  3I6P A;  3IWL A;  4P7T A;  3DGP A;  4ECX A;  1T9U A;  2JLG A;  1ZH5 A;  4C3M A;  3DMJ B;  5E3C A;  1ZTW A;  3NL0 A;  2AYM A;  4KJI A;  4ZPA A;  1PO6 A;  1IKX B;  1M5V C;  3UFC X;  4JV5 J;  4HEA 9;  1B64 A;  1XMO F;  3QIP A;  1YBU A;  2I0X A;  4QPX A;  5K20 B;  3IMQ J;  1FDN A;  3MD1 A;  4JI5 F;  1OY8 A;  4ECS A;  1HQE A;  1S9F A;  1Q8I A;  4J7C A;  3SFU A;  2K1R A;  2JVR A;  3GP9 A;  5EHH A;  2QSW A;  4B02 A;  3HPO A;  4CP5 A;  3BB5 A;  3BKU A;  3PW2 A;  2DNG A;  4L3N A;  1EHW A;  4Y2M A;  2V8D A;  4LF8 F;  3E8O A;  3NG8 A;  4NAS A;  3GR0 A;  3MR6 A;  3D1O A;  2AJ1 A;  1LWC B;  2FDN A;  2C2M B;  2W4P A;  3GU0 A;  2XHW A;  1FNM A;  3C3L A;  2AEM A;  3BM7 A;  5ETR A;  5DGA A;  2QT7 A;  4WWS A;  1H72 C;  2ZJP Q;  2PI5 A;  1GMW D;  1S1W B;  4QYZ J;  2FY1 A;  4IG0 A;  3KLE B;  4LF7 F;  2QE5 A;  1LW2 B;  7FDR A;  1LV5 A;  2WSE C;  5HK4 A;  1FJE B;  3I96 A;  2C42 A;  3S7R A;  1UW9 A;  4EI2 A;  4EBD A;  3NMR A;  4PAA A;  1B7Y B;  1R89 A;  1S5Z A;  1UFK A;  3HHL A;  3BQ2 A;  5IM0 B;  1TUW A;  2PMW A;  3DGV A;  4CT8 A;  5LJ5 Y;  1HBO A;  2V4R A;  1VQ5 S;  1YX2 A;  2CQ0 A;  4NXN J;  1JLF A;  2CZ4 A;  2M9K A;  4I2P A;  3ZZP A;  1JJH A;  5HAO A;  1TAQ A;  2KXH A;  5C2C A;  1FER A;  3MM9 B;  2DXF A;  5FDL B;  5KFS A;  3CCQ S;  2VD3 A;  1Q5Y A;  2OFG X;  2VQF J;  1LEO A;  4C9D A;  2FYX A;  2G1H A;  5GAE U;  2U1A A;  2CDQ A;  4DV7 F;  1AZS B;  3T6J A;  2YNG B;  1PC5 A;  3O6Q A;  4W92 B;  3RBZ A;  1JX4 A;  1UW4 A;  2ZD1 B;  1WG1 A;  3OUY B;  2HQ3 A;  1SJ1 A;  3VAM A;  3T1A A;  3MUT P;  3K59 A;  2KZM A;  4DSK A;  2N7C A;  4OHW A;  3TWZ A;  5KG0 A;  4NXM J;  3GJR B;  2KXN B;  1RT2 B;  1FWL A;  1IR1 A;  5L38 A;  4V19 X;  3MR7 A;  3VVT A;  4U96 A;  2RQK A;  3ZZY A;  4JI8 J;  1LNQ A;  2ZWO A;  2M4M A;  5E3R A;  3OW2 R;  3IBC B;  4B3S J;  3PRD A;  4C3L A;  3HFK A;  4NA2 A;  4UZB A;  3RYL A;  2O01 C;  1Q4R A;  3WHI A;  5HN0 A;  4LF7 J;  2AF6 A;  3GZ7 A;  3GFH A;  5KAK A;  3NRB A;  2CPF A;  5K8N A;  2J0S D;  5ETO A;  2QLJ B;  1FRM A;  2CJQ A;  3NGS A;  2C3M A;  2W7O A;  3MD3 A;  2YH1 A;  2YKM A;  1U24 A;  1ARO P;  2BJ1 A;  1M1G A;  4H4O B;  4LSN B;  1RWK B;  4NLS A;  2PC6 A;  4KGK A;  3PX4 A;  2MQL A;  1PCA A;  4KSE B;  4DQS A;  4FF1 A;  1VQ6 S;  3DGP B;  1JXE A;  1A9N B;  2R9L A;  3LP1 B;  3GQC A;  3QZ8 A;  4IOC Q;  3I9V 9;  1S9E A;  2XWY A;  2VQE J;  2VG6 B;  1M5S A;  2GHV C;  4HTI A;  1HNW F;  1KEK A;  1R27 B;  2XG8 A;  2V63 A;  1S6Q B;  2DD8 S;  4X4V A;  3PRB A;  3SV3 A;  2VDI A;  2ZC4 A;  4WK3 A;  4ED7 A;  1VRT A;  3DFE A;  3FGV A;  3LQV A;  2HMI B;  2HGM A;  4B3S F;  1U6B A;  3W9H A;  2R42 A;  2B5J B;  3OR1 A;  2MJN A;  1FKP B;  3AJD A;  3CCV S;  3DLJ A;  1IN0 A;  3IM8 A;  2D74 B;  1HLW A;  4UT4 A;  4O4R A;  5ETK A;  3TP2 A;  2OPS A;  2FIU A;  2HIQ A;  1SB6 A;  2HWI A;  5I42 A;  4P2S A;  2YVS A;  2N3O A;  4YY3 F;  3PAC A;  4LRF A;  1TV6 A;  1SKS A;  2VH7 A;  4EYH B;  3HT0 A;  4A8Q A;  1UWB A;  2QL7 B;  1HW9 A;  2RKI A;  1CVJ A;  4GKK J;  2AP6 A;  3K5P A;  1W7W A;  2J76 E;  2Q79 A;  4V19 J;  2PDA A;  4ERD A;  1HWJ A;  5J2N B;  5KFC A;  2HK2 A;  2ZBC A;  1R0A A;  1L3S A;  1KLM A;  4HHH A;  2XLI A;  3DLG A;  2EK6 A;  5JJB A;  1QTN B;  4FNH A;  3B8H A;  4LUB A;  5T41 A;  2OPR A;  2YH0 A;  2LDY A;  3DYA B;  3HJV A;  1NBE B;  3HKW A;  3NOC A;  4MMO A;  4FBU A;  4DL2 A;  3DLL Q;  2XC9 A;  1YG0 A;  1LQ9 A;  2EFN A;  2Z56 B;  4H4O A;  2OEK A;  4YS2 A;  1DQA A;  2DGS A;  1LXJ A;  2ZUG A;  2AIR B;  5I3U B;  1TAU A;  5KFY A;  4ZVS B;  1K0V A;  4XIU A;  4ED2 A;  2ZJQ Q;  2DH9 A;  3FFI A;  4OL8 A;  2MZT A;  3ISN D;  1KD1 T;  3OHA A;  4LSZ B;  3EUN A;  2XMA A;  3IR6 B;  1O0P A;  1UPP A;  5KTQ A;  1RT3 B;  4MKB A;  3IS9 B;  3D68 A;  2Y0S D;  1DTT A;  3M6W A;  2DNM A;  1HNX F;  1EQM A;  2CJX B;  2JEJ A;  1Y4Z B;  2HEK A;  3I82 A;  2CKW A;  4ICL B;  3MFI A;  2KJW A;  4KFB A;  2WRM A;  5ETV A;  1HBU A;  2BJE A;  4MJK A;  4X84 A;  3R9L A;  4EU0 A;  3A1Y G;  5LOQ A;  3G4S S;  1N6Q A;  3BKF A;  4EZ6 A;  1SJ4 P;  5FJ4 A;  5KG2 A;  5EWG A;  4UY8 5;  2DR9 A;  4CO4 A;  4KKO A;  3JYT A;  1P1L A;  4RW9 A;  2HNY A;  1YGY A;  4LIR A;  3W2V B;  1YJR A;  3DLE B;  2M8D B;  5KFB A;  3OL6 A;  2V5H G;  5DQI A;  1BY9 A;  1WOP A;  2HVZ A;  5KOX A;  1RIS A;  4IFV B;  4OJ3 A;  3RB6 A;  2WW4 A;  5RUB A;  3WC2 A;  3EMT A;  1NPP A;  2F8E X;  2CAD A;  2NXE A;  1N5T A;  2EEY A;  2Q6C A;  4LR9 A;  4AND A;  4CLZ A;  4LRB A;  4Q0B A;  3QO9 A;  4G6V B;  2C1E B;  3KLH A;  4KC5 A;  4ER8 A;  5B7W A;  3HK2 A;  4JV5 F;  4CTA A;  3W3S A;  4ZN3 A;  3R5G A;  5I3P A;  5HMY A;  1G4C A;  2W9C A;  2YNI B;  4DDF A;  3HVT A;  4F8R A;  2QA4 S;  4ES3 A;  2HFU A;  2R7U A;  3EVM A;  5KT2 A;  4B9T A;  3OV7 A;  4EZ9 A;  2AWZ A;  3PYE A;  5F41 A;  2E1R A;  5HLF B;  4P71 A;  5DDP C;  1T0T V;  1WHW A;  4OZJ A;  3CDW A;  3CJQ A;  4HYK A;  1D1U A;  3GWC A;  1FRL A;  3B78 A;  3DDN A;  4FP9 A;  1S1W A;  4M5K A;  3BYP A;  1TL4 A;  5E3A A;  2OTL S;  1YJU A;  4ED3 A;  3V6K A;  1HHT P;  2V67 A;  1MRO B;  3MPW A;  4NX9 A;  3SV4 A;  1HMV B;  2JRS A;  4NYP A;  5KFW A;  5F9N A;  1U49 A;  1HNV A;  1B3T A;  1WF0 A;  5FLX U;  4YR3 A;  1MU2 A;  2CPJ A;  2VUG A;  2DJW A;  4A8W A;  4F3O A;  3UR0 A;  2GIR A;  2C3Y A;  2MQQ A;  1T03 A;  2DBB A;  1ZM3 A;  3OQ2 A;  5JVG Q;  2XCP A;  3QJJ A;  2KHC A;  1S77 D;  2BAN A;  4OX6 A;  2CFX A;  3A8I A;  2LQJ A;  1X0P A;  3DM2 A;  1IM4 A;  4AYB D;  1X60 A;  2KM8 C;  3MEE B;  3AHP A;  3B82 A;  4FPI A;  2M0G B;  3CDA A;  3W65 A;  4XDD A;  3JQM A;  2IMO A;  2DYA A;  2HFV A;  2ZC3 A;  3NGR A;  2BM1 A;  3HD2 A;  3M32 B;  2XGQ A;  3CCJ S;  4ZIT A;  4LF4 J;  2M52 A;  3CMQ A;  2LCW A;  4HAC A;  3OTO J;  3CJ2 A;  4CDI A;  3QAU A;  2MHE A;  3M30 A;  4IR9 A;  4TXS A;  1UVI A;  3Q89 A;  2GQ2 A;  2B4P A;  3FEZ A;  1HI1 A;  2CQH A;  3L7U A;  4DV7 J;  1D0E A;  2CG4 A;  5L9N A;  2GIQ A;  3IA0 A;  4OX8 A;  4IOA Q;  3RBE A;  2YQ0 A;  4ES1 A;  2RUG A;  3K2Y A;  4AL7 A;  1SQE A;  4Q45 A;  3H20 A;  4MYT A;  2VPZ B;  5ETP A;  4NLY A;  4RU9 A;  4CM0 A;  3CUN A;  2UXC F;  3CT9 A;  1KTQ A;  3O8W A;  3EYZ A;  2CJY B;  2OPR B;  3DRP B;  2HSE B;  1TUV A;  2LQ5 A;  2YKN B;  1OY9 A;  2WB1 D;  4DLE A;  2ZBI A;  3TAN A;  2P9G A;  4C7Q A;  4DU7 A;  5BYQ A;  4HH0 A;  2WW8 A;  2BDP A;  2WBR A;  3KLI B;  3PYD A;  4EBE A;  2D3U A;  1VQ4 S;  3CWJ A;  3IG1 B;  3MED A;  1QJH A;  5CYQ A;  1VIX A;  2KKH A;  4USJ C;  1HPZ A;  2CZ9 A;  1NK9 A;  2B8P A;  1RTZ A;  4BLG A;  1NH7 A;  3UD4 P;  2PA3 A;  2MLX A;  1H7W A;  3HDS A;  1ZPW X;  2IIH A;  3KJQ B;  4TVA B;  4WE1 A;  3U02 A;  4DS5 A;  1IJE B;  3KTQ A;  1RBA A;  3PW5 A;  4J9U E;  1FKP A;  4WXW A;  5KG4 A;  2FC8 A;  2DGV A;  3ZO7 A;  2KJV A;  3M6U A;  5KFP A;  4YHH F;  2UUA J;  1URN A;  2YKN A;  2HRY A;  4WKR A;  3FMB A;  3R7N B;  1ZET A;  1O5J A;  3THV A;  2RDD A;  2R2U A;  2NXU A;  1NJX A;  1FE0 A;  1C1C A;  1CJU B;  1YJ7 A;  5MAO A;  3EZ5 A;  6FDR A;  2VPW B;  1FT8 A;  4KH0 B;  4PG5 A;  1T9V A;  4MIW A;  5HO4 A;  3MR2 A;  1UZD A;  2OKQ A;  2VG6 A;  2JFD A;  4WU3 A;  1FXR A;  4G1P A;  2E9R X;  3BN7 A;  2OPQ B;  4B9M A;  4ECW A;  3RRG A;  1H2U X;  1TR0 A;  1KHW A;  4KPC A;  3VWS A;  2MQO A;  5IOL A;  1KP6 A;  4PWD A;  3L7P A;  1DLO B;  1FK9 A;  5KFL A;  1AT1 B;  1W2I A;  1T9T A;  1NSA A;  5CQG A;  2RQ4 A;  5EX0 A;  2BV3 A;  3QRQ A;  1BUX A;  2ERR A;  3D54 A;  3QNW B;  1V5I B;  4OYB A;  2RF2 A;  2RUS A;  3DM2 B;  1KQG B;  4X64 F;  3T5L A;  1GFW B;  3BH7 B;  1U45 A;  4QWA A;  3UWT A;  2KFN A;  1YRT A;  2PEH A;  1SJR A;  1PAE X;  3R6G B;  2DIV A;  2OP5 A;  3OTE A;  5JUM A;  2DHS A;  1SIZ A;  4CO0 A;  1F9H A;  4DV2 F;  3HXM A;  2FJX A;  1RT2 A;  2C2E A;  3CCU S;  2FY8 A;  1CJT B;  1MRO A;  2GMH A;  2V8V A;  2WVF A;  2M2B A;  4NLP A;  5JMN A;  5D0H A;  4X4R A;  5K8P A;  1YQH A;  3QAT A;  2CXE A;  2ZWP A;  1VBZ A;  1PIL A;  5A6W A;  5F3Z A;  2DNH A;  3IWX A;  2A2D A;  3LA0 A;  3OVA A;  3KK3 B;  1HQU B;  1GNK A;  2K7J A;  2AZ3 A;  3P8B B;  5A76 A;  3QSY B;  4BS2 A;  1RTI B;  2YNG A;  4IR1 A;  2B4O A;  2CQD A;  2FB0 A;  1P8G A;  1Y9O A;  2X3G A;  3TUJ C;  3JSM B;  4JV1 A;  5K14 B;  2IC3 A;  3D0I E;  2YQ1 A;  4LFA J;  2XYH B;  2HPU A;  4CO2 A;  4NLX A;  3H5Y A;  3FSI A;  1PYS B;  3KWM A;  4ZVG A;  1MW7 A;  2X3D A;  1SH2 A;  5KFK A;  2XEX A;  3ENA A;  5GVQ A;  4DZD A;  1VQ9 S;  1OSC A;  4I2Q B;  2HNZ B;  2IVF B;  3V81 B;  3E2E A;  5CXT A;  2C2K B;  4FVM A;  1PYT A;  3BV8 A;  3VHQ A;  1FTR A;  1C0U B;  3MM5 A;  3KK3 A;  1U4B A;  4B9N A;  2XSJ A;  3N9U C;  3T1Y J;  1XNR F;  1X4B A;  4DL3 A;  1IBK J;  1GXT A;  1JLB A;  2B43 A;  3D6H B;  3OR2 B;  4CH0 S;  4X65 J;  4ZVH A;  4RNF A;  3G6E S;  4J9M A;  2EKN A;  3VAJ A;  4LFB F;  4M5J A;  1AB8 A;  4L76 A;  1KRP A;  2DPI A;  1QLN A;  4KFB B;  2HW3 A;  1PKU A;  3N79 A;  4ICL A;  3LAK A;  3CCS S;  3GR1 A;  2FLP A;  4UUX A;  2L41 A;  2F4V F;  1SUQ A;  1S57 A;  1NDK A;  2RDI A;  3EGN A;  1P9Q C;  1CEZ A;  4LVO P;  4QWC A;  3P45 B;  2UP1 A;  3TUP A;  3QT6 A;  2XYP B;  3GV5 B;  3OSP A;  3F56 A;  4KB7 A;  2XBP A;  4B3R J;  5EN1 A;  3P49 B;  3H0P A;  2WBM A;  1N32 F;  3EZO A;  4TY8 A;  4K59 A;  3K5O A;  1TKZ B;  1T02 A;  2BQR A;  3DLB A;  5ETS A;  1VQY A;  3A8E A;  3M6X A;  4PYA A;  1DTQ B;  3U1M A;  3C16 B;  1U25 A;  3V5R A;  5GAG U;  5F8G A;  2XY7 A;  3TAP A;  1F0X A;  4GVL A;  3SQG A;  3TAQ A;  4ECT A;  4RUC A;  4H4M A;  3TUZ C;  1R0A B;  4WPA A;  2BQ3 A;  1SL0 A;  1FTC A;  4IG3 B;  1I51 B;  4B9U A;  1JMT A;  3TUI C;  1B99 A;  2QZ8 A;  3I5B A;  1TVR B;  3CCM S;  4CLT A;  2VKR A;  1TV6 B;  4OI1 A;  5ITH A;  2Y0B B;  2BW2 A;  3SYZ A;  5KG7 A;  4OZ2 A;  1R0B G;  5B0C A;  3HSG A;  5GME A;  3C19 A;  2CQ2 A;  2VBZ A;  4YEA A;  4JUZ A;  3PW7 A;  4LF2 A;  4TN2 A;  2GVZ A;  4F26 A;  1GAO A;  5GAH U;  4M5L A;  2KVQ E;  3FSY A;  3TO8 A;  3HCX A;  4A8M P;  4WE1 B;  1YWX A;  4Y6I A;  4NZ0 A;  4LBH A;  1Q5V A;  4ZPW R;  2DY9 A;  3GIR A;  4LVN P;  2B5J A;  4M8L A;  3PR5 B;  1MMN A;  1JLC B;  4CNZ A;  1K73 T;  3F44 A;  3QGH A;  1RKJ A;  4FNI A;  5HQM A;  1RP5 A;  3LWL A;  2HK3 A;  4DV4 F;  5ETT A;  3DHW C;  2YX4 A;  1T9X A;  2NYH A;  4WCE Q;  4CO3 A;  2E5J A;  2OPP A;  2IPO B;  5J2M A;  2BZ2 A;  2AYE A;  1LWF B;  5IC6 B;  5C24 B;  5D6G A;  4DL6 A;  1Y5I B;  5KG3 A;  1M5P C;  2XLK A;  5EUH A;  4RLE A;  2GGP B;  3W5Y A;  3Q0A A;  1NRK A;  2F40 A;  2C2Z B;  5AXK A;  1FRX A;  1RHK B;  2VFU A;  2AJ2 A;  4RNH A;  5LMN F;  4DR1 F;  2MKY A;  5B09 A;  2FGO A;  2LYV A;  1YJ9 S;  5KFA A;  1RE1 B;  1F5B A;  2CPY A;  1M90 T;  1WC1 A;  2VDH A;  1U1R A;  2MXY A;  1YLX A;  2RHS B;  4IH7 A;  5F9L A;  4OYI A;  4LRE A;  4WFX A;  1S0N A;  2XZW A;  4HAC B;  1BQM B;  1VHI A;  3MCO A;  4DL4 A;  4P52 A;  3EGZ A;  2RU9 A;  4P2F A;  4PG6 A;  4ZCM A;  4M5H A;  2XB2 D;  5A8R B;  2EW9 A;  3TZY A;  1UA0 A;  3H4D A;  2DNZ A;  4WJB A;  4HH1 A;  4J9Q A;  3Q2S C;  3BSO A;  3BYR A;  1JIH A;  4L72 B;  1X4H A;  1ZAX A;  2K3K A;  3A4T A;  5HAT A;  5F3T A;  2V2Z A;  5DDQ C;  1EKR A;  1PAU B;  3HHL C;  2FHJ A;  4DX8 H;  4F2S A;  2XI3 A;  1S1T B;  3DDI A;  1R8C A;  3V4M A;  4B9L A;  3ADA C;  5GAD I;  1IKW A;  1EP4 A;  3M8P A;  4D3G A;  3SBM A;  1WTB A;  2FPH X;  1X5P A;  3OLB A;  4P7V A;  1FCA A;  2YX7 A;  1C2P A;  4ZJL A;  1LFW A;  4TU7 A;  2C22 A;  1PG5 B;  3C15 B;  6FD1 A;  4AQY F;  3KLF A;  4M5D B;  4WZM A;  2P9E A;  2ZBR A;  4WYL A;  1XMQ F;  4U7U K;  4NXM F;  1SH3 A;  3DOM A;  4PPD A;  4WFA Q;  1FXD A;  2CPH A;  1DUR A;  1LKZ A;  1QE1 A;  1WC6 A;  2V4J A;  3CW2 C;  2CRL A;  2AW0 A;  3I32 A;  1HBO B;  3GV7 B;  2EBE A;  4IQM A;  2W8L A;  5D3G B;  5IM0 A;  2QYG A;  4NCB A;  2GA7 A;  4DV2 J;  2NUU G;  1U47 A;  1HR0 J;  5F0U A;  2PI4 A;  5EDW A;  3MMC B;  1UZH A;  2AT1 B;  4C4W A;  1VRU B;  2D3O R;  3KLG B;  3CCL S;  3RR8 A;  1B7F A;  2DR7 A;  3R5B A;  2V50 A;  2HGL A;  2ASL A;  5K8M A;  3KK1 A;  2O67 A;  4J9N A;  3HM9 A;  4AL6 A;  5AE1 A;  3DRR A;  3MM8 B;  4RNO A;  2HRT A;  2H9Z A;  3R1H A;  2EFG A;  1EIY B;  2P6S A;  5DET A;  4Y2I A;  3FCV A;  1L5U A;  2F8M A;  2DO4 A;  2ASD A;  4CI0 B;  2IFX A;  1RLD A;  4MH8 A;  1FHT A;  2BJD A;  1V5V A;  4OI0 A;  1M1K T;  1TEL A;  3W9I A;  2V4Q A;  2AJQ A;  1VC5 A;  1TFY A;  4KO0 B;  3FDS A;  1OY6 A;  4U7U D;  1RI7 A;  1APS A;  1H98 A;  2HVI A;  3ETO A;  1KS2 A;  2ZKT A;  3FVY A;  2CNO B;  4DX7 A;  1MWQ A;  2X1G A;  1NME B;  4DR2 J;  3U1N A;  4FPR A;  3EDQ B;  4TU8 A;  2RQC A;  4B3O B;  2G1D A;  4I7F B;  3D2W A;  4NA3 A;  3SI8 A;  4JI7 J;  2EKY A;  3UO0 A;  1DTT B;  2BAB A;  1I94 F;  1NDC A;  4X4Q A;  1I5O B;  1T9W A;  5E2Q A;  3UCG A;  3CJ3 A;  3ZTO A;  1X0F A;  4XO0 A;  1ZM4 A;  4JI2 F;  4Z2X A;  2IDL A;  4DUY F;  4DR3 J;  4L74 A;  2HS3 A;  5GMD A;  4X4S A;  1NK7 A;  4HDH A;  4JI3 J;  2AGQ A;  4MFB A;  2WON B;  1IQT A;  1DQ9 A;  3K5L A;  3K89 A;  3K0J A;  4MT1 A;  2XI2 A;  2AJ4 A;  3ET6 A;  1SCJ B;  1U48 A;  4FF4 A;  4DWI A;  2V94 A;  1FJG F;  4HR2 A;  4P72 A;  3L4B C;  3E01 A;  4LSL A;  3WC0 A;  1VQ8 S;  4FF2 A;  4LF5 F;  3U7J A;  2L48 A;  1BQN A;  1RT4 B;  2MST A;  5D0G A;  1TK8 A;  4QWE A;  1S6P B;  3F73 A;  1JWW A;  2D3O 1;  4B3T F;  4BWJ A;  5H9F J;  1WG4 A;  5L1I A;  2OLW A;  2YPY A;  3LUY A;  3PVX A;  1E6Y B;  1TMM A;  2FZC B;  2RKI B;  1S99 A;  2XCA A;  3FQK A;  2UU9 F;  1S49 A;  3M8Q B;  2OTJ S;  1R0C B;  2W2M P;  4IFY B;  2YX1 A;  2J9D E;  3GB0 A;  3V4I B;  1GTH A;  2F5G A;  4ZMM A;  1H74 A;  3H2U B;  3POT B;  1WG5 A;  2ABY A;  2IRX A;  2VBY A;  4I68 A;  4IDK A;  2VQE F;  4LF5 J;  2XYG B;  1WF1 A;  3CJS A;  2Z2Y B;  2V2V A;  3NKY A;  2ZHB A;  1R31 A;  1BQN B;  3JSY A;  2OH2 A;  5A8K A;  2QL9 B;  1CJV B;  4F3Q A;  3ZTR A;  1YBA A;  4RW8 B;  2PFF B;  2CNL B;  4ETZ A;  2E5L F;  1TL7 A;  2ROP A;  3N01 A;  1F5C A;  5KFD A;  2VFR A;  4ZPC A;  4YUD A;  1S97 A;  4OHV A;  2H1Y A;  2Q43 A;  3VGS A;  2IA6 A;  1DQ8 A;  1RT7 A;  1FJC A;  2GVD B;  5DGB A;  3DLH A;  1XR6 A;  4DHV A;  3DRX A;  2VJV A;  2BA9 A;  1VFJ A;  4Y2C A;  3ZZU A;  3C16 A;  3KNA A;  3Q8R B;  1RWU A;  4OHZ A;  2KFY A;  2DR6 A;  1HQ2 A;  1RBL A;  2BRL A;  4PYD A;  1RAJ A;  4NRT A;  4RL1 A;  5HI7 A;  5BXI A;  1TKZ A;  1RCO B;  3FZB A;  2D41 A;  3O5T B;  4RO0 A;  5E7O B;  4PR6 A;  3HVR A;  3DU6 A;  4OZ5 A;  1QM9 A;  2QLX A;  2NXN A;  3MM7 A;  2R8I A;  2PE8 A;  5CYM B;  2MB0 B;  1FES A;  4YB1 P;  4ZPV R;  3BH6 B;  2FJB B;  4FYY B;  2A6M A;  2HHP A;  4DMZ A;  4USM A;  3F0N A;  4YY3 J;  2PD1 A;  4YB6 A;  2IRU A;  4S0M A;  2NCK L;  5HQL A;  1MU2 B;  2DCL A;  1IJF B;  5KFZ A;  1QUP A;  1UPM B;  2GHW A;  3MR3 A;  1UWA A;  5F8J A;  5KT4 A;  4O3P A;  3T41 A;  1TKX A;  2QG9 B;  1L3T A;  1REV B;  2MQN A;  3TVK A;  2N3L A;  1URR A;  3IP0 A;  3IRX A;  3O2I A;  3GIM A;  2GX8 A;  1NJI T;  3Q8V A;  2YKP A;  4AUK A;  3OUY A;  1VQK S;  4M5M A;  2ZOF A;  1JLG A;  4OX9 F;  5E41 A;  2UXB F;  1ICE B;  2V68 A;  4E2F B;  3HJF A;  2CA9 A;  4P75 A;  1VLY A;  1D9D A;  3OJS A;  2L9N A;  1EX8 A;  4KH1 B;  4DXL A;  4ZP6 A;  2ZH8 A;  2X1B A;  5J2Q A;  1L3U A;  2H54 B;  4UF4 A;  3TVZ A;  4CLW A;  1N5Y B;  3PYG A;  5FD1 A;  1NSQ A;  4CLK A;  1XK8 A;  3V6D A;  3DOM B;  3NNC A;  1JLF B;  3QAE A;  3CJK A;  2J0W A;  1RAD B;  5KFG A;  3W5X A;  4M5N A;  1Y3J A;  2Q1L A;  4MKA A;  3X3U A;  2IYI A;  2BE2 A;  1F6T A;  3OXL A;  1Q82 T;  2RIJ A;  4TLR A;  2JEI A;  3AB4 B;  4A48 A;  2FHM A;  2PA8 D;  4M5G A;  4ITS A;  1JLG B;  3CCZ A;  2B4U A;  3QGG A;  4CT9 A;  4LF8 J;  1IBL F;  1HBM B;  2KL8 A;  4E0D A;  4QBU A;  3KLF B;  1Q1K A;  4A46 A;  1QVG R;  3DN9 A;  1SJ3 P;  1REV A;  4DV3 J;  1NHK L;  2EPI A;  2DRD A;  2CWK A;  2W2N P;  4H4K A;  2YXL A;  3BSA A;  2W01 A;  3RW6 A;  1JLE A;  2M88 A;  1OWX A;  1O6X A;  2NRE A;  4BDP A;  4LF9 F;  3SCL E;  1KQK A;  4G3I A;  2H5I B;  4BC9 A;  3QPI A;  2HRU A;  3BGL A;  2GQC A;  5CD4 H;  1BQM A;  3CC4 S;  2VC1 A;  5A8W B;  2E66 A;  2JOQ A;  3PO4 A;  1U6F A;  2EFO A;  2RRN A;  3MCS A;  4NLQ A;  1RAF B;  4I64 A;  2R8K A;  1GXU A;  3TX8 A;  4CLY A;  1MMD A;  4ECU A;  2DXD A;  3Q8U A;  2DTJ A;  2XZT B;  4TY9 A;  3SSS A;  4ZPD A;  3W8G A;  4U7C A;  3UN3 A;  2IVM A;  2QIF A;  7FD1 A;  3HHD A;  3Q2T C;  4WF9 Q;  2UXD F;  2KTQ A;  2KDO A;  1LOU A;  3UR3 C;  2GGP A;  2BR0 A;  1K8A T;  1CBK A;  3DYA A;  2XMV A;  3HFZ B;  4PXD A;  3J7Z T;  1FKA F;  1XIQ A;  4JI4 J;  1CJK A;  1VCT A;  1HIY A;  3I5C A;  2AD9 A;  2KT3 A;  4DFP A;  4NA1 A;  4OYM A;  4CYU A;  2V0N A;  4P10 A;  3QWP A;  4Y34 A;  2JH3 A;  5KFH A;  1S12 A;  4DQI A;  4JP8 A;  4OZL A;  2FC9 A;  4ZHR A;  3ELH A;  4HI1 A;  3BO4 A;  3VZI A;  4ILR A;  4Q5V A;  4XTT A;  1OQ3 A;  1KC8 T;  2QMU B;  2CNN B;  2ZKU A;  3DXB A;  4K4Z A;  4QIW D;  2FHJ D;  3IC1 A;  1Y10 A;  2QJ3 A;  4ZP7 A;  3C6T B;  3DKD A;  4DPU A;  4DQP A;  4JI2 J;  1CPZ A;  1RDR A;  2L3M A;  3NGT A;  4OQJ A;  4L3K A;  2V8P A;  1H38 A;  3M8R A;  2QL5 B;  3TZW A;  4R5P B;  1SQF A;  1IXK A;  1JLC A;  4ED4 A;  3VQS A;  1I94 J;  4LQ3 A;  1CUL A;  2XTJ P;  1K9M T;  2XS7 A;  1D3W A;  5L1J A;  2HQC A;  2KN4 A;  4UTG A;  4GO5 X;  4CYU B;  3FRZ A;  4DUZ F;  4B3M F;  3AA9 A;  1WD6 A;  1HD1 A;  1QAJ A;  3R97 A;  2YNF A;  1S9E B;  2NPI A;  2EG1 A;  3A3P B;  5G0R B;  3THT A;  1HW8 A;  5KT5 A;  3LH2 S;  3KMS A;  1PBA A;  3RG6 A;  1BGX T;  5D0R A;  2RML A;  4ZHR B;  2H51 B;  3J81 j;  5JVH Q;  3I9Z A;  4HDG A;  1RWP B;  2DRB A;  2VHG A;  4PG7 A;  2DHA A;  4FBT A;  2L08 A;  3FJ2 A;  4HHJ A;  4DSE A;  3BO3 A;  2H5J B;  2WVD A;  4IG3 A;  1JXV A;  1VK3 A;  1NU4 A;  1X5S A;  2H65 B;  2MJU A;  4KGX B;  2GML A;  3IGN A;  3AD9 C;  4NMX A;  2WON A;  4RJV A;  3D1Q A;  1NPR A;  3TAM A;  4ZIW A;  4ZJQ A;  2HGN A;  3PW4 A;  4K4W A;  5AE3 A;  4OMF G;  2DCU B;  5IT4 A;  2XMM A;  3G6Y A;  1X4G A;  1JLQ A;  6AT1 B;  4LFC F;  1GK8 A;  1LWX A;  3HZE A;  3PM9 A;  3THP A;  1NJY A;  3T1Y F;  1CS4 B;  3M32 A;  3CXC R;  4C11 A;  3J81 Y;  2FVR A;  2FVP A;  1KVJ A;  1N52 B;  3FEX B;  4C2M A;  2QEX S;  2KFZ A;  4I7F A;  2V9K A;  4Q2L A;  2XMT A;  1GEH A;  3D7S B;  3G2X A;  2RDJ A;  2HVH A;  1IUJ A;  2NXC A;  2W8K A;  4IKA A;  1TL3 A;  2P8I A;  4DN9 A;  1EJ7 L;  1RA6 A;  2C3P A;  4DV6 J;  4OIX A;  3OFG A;  4N8N A;  2PN6 A;  5EWF A;  1RTD A;  1LXN A;  3A3O B;  2MDA A;  4TQR A;  1XNQ J;  2YKQ A;  4LFA F;  4UY8 T;  1L3V A;  1WDT A;  2G9O A;  5C42 B;  4JV0 A;  5KG6 A;  1H6K X;  3QLH B;  2ZBP A;  3SSQ A;  2H48 B;  1EQ0 A;  2HFO A;  2MKJ A;  4K5S A;  2E9T A;  5D77 A;  3M2R B;  4MK8 A;  1SV5 A;  3QT8 A;  4C0B A;  4WFN Q;  2AJ0 A;  2WVC A;  1SI9 A;  1TL5 A;  3HHK A;  3I0R A;  5HVG A;  2ZH3 A;  3MM9 A;  4OZN A;  5FDL A;  3TZZ A;  1HBM A;  1TZ0 A;  2XM3 A;  2ZH5 A;  2UVV A;  3C6U B;  4FXW A;  1Y00 A;  5HLF A;  2ADB A;  1J5E F;  2J9C A;  1ACM B;  2ZH1 A;  2WHO A;  4BCA A;  1WC5 A;  1TK5 A;  2HHS A;  3AOB A;  3PFE A;  3NXZ A;  1JQG A;  2BE2 B;  2CVE A;  2MEW A;  3NAI A;  4F04 B;  1IKY B;  3D66 A;  3L95 X;  4MIA A;  1SXL A;  1NK0 A;  4OYP A;  1Y0H A;  1RTI A;  3P5T L;  2CPD A;  2JC1 A;  4P9S A;  4TLQ A;  3K58 A;  3T3F A;  2V4J B;  4DQR A;  1HI8 A;  3OFE A;  4JI1 F;  3C2P A;  3OVS A;  4UST A;  4YP3 A;  2AV5 A;  3MTK A;  1N5S A;  1XNQ F;  2VV5 A;  1RTH A;  1BQX A;  4HT7 A;  1FDA A;  3I0R B;  4MK9 A;  4XK8 C;  3Q8Q B;  4PRF A;  2RHQ B;  4DX6 A;  1RU2 A;  2HIY A;  4EEY A;  4Q8F A;  1KDN A;  2DT9 A;  5KFF A;  3MFH A;  2R7W A;  4ZVP B;  1Y7P A;  4ED8 A;  1TU0 B;  1AFJ A;  2NPF A;  2EK1 A;  5H1S V;  5KOW A;  2PSZ A;  1XMQ J;  3MI7 X;  1VIO A;  1S1T A;  2OD6 A;  3KG1 A;  3JYT B;  3CF5 Q;  1Y5N B;  3FRY A;  3NWG A;  3UN5 A;  1GX5 A;  1U0H B;  1OQ6 A;  1TL3 B;  3ISN C;  1NEE A;  5K8O A;  2LDI A;  2RF2 B;  3JAM U;  4JI1 J;  3CD0 A;  1BD6 A;  1M1H A;  3DRS A;  4CLF A;  4DV4 J;  3M9N B;  3PIP Q;  1KNZ A;  1VJW A;  3EXY A;  2OUG A;  3GJQ B;  1WC4 A;  2VC0 A;  3SCI E;  1X9W A;  3P5B P;  1F2G A;  1ZA2 B;  1U2C A;  1Z2Z A;  4NEZ A;  5D4O A;  4ENO A;  4I0W A;  1RWW B;  2E9Z A;  1GMW A;  1LFP A;  2W7A A;  2R7O A;  2HZV A;  5HRO A;  2DVI A;  8ATC B;  2JJ4 D;  1RGV A;  4PXE A;  4Y28 C;  2I38 A;  4OZ0 A;  4YN3 B;  3Q24 A;  5I3U A;  5D8H B;  2ADC A;  2QLW A;  3BBF A;  4PQU B;  5L8R C;  3FBC A;  5IQQ A;  2W2Q P;  5DLF A;  3G96 A;  4AL5 A;  3HHL D;  5HMW A;  1Z2L A;  1RAO A;  1EAR A;  3CD5 A;  4DUZ J;  1P9Y A;  4B3M J;  2G2O A;  2FZK B;  3K8V A;  1IBC B;  1F3F A;  2OPQ A;  3PXG a;  3KG0 A;  4IH5 A;  2AEJ A;  1I6J A;  2LLZ A;  1K1S A;  1OPZ A;  4LF6 J;  4NCG B;  5J2N A;  2R7R A;  3BDP A;  5D15 A;  3DOK B;  1ULR A;  2LEC A;  1G6B A;  1C1C B;  1S1V A;  1ZM2 A;  3W60 A;  2KYZ A;  1UEK A;  2CJB A;  3M8W A;  3DRY A;  4EMD A;  2ZDP A;  5C25 A;  2WSF C;  4EWT A;  3CD7 A;  5KFI A;  5T7L B;  2VIC A;  4QQB A;  4RZR A;  2XMW A;  4X64 J;  5C25 B;  2BE7 D;  3LPY A;  1IKV B;  4IDK B;  3ZNU A;  2MKH A;  1WKJ A;  2VAS A;  5GAH I;  5LMU J;  2ATL A;  1HYS A;  2KG1 A;  1X7V A;  1V9O A;  1NKC A;  1SH0 A;  4DV5 F;  1SJQ A;  3OTD A;  4RWX A;  3HP6 A;  3ZTQ A;  3EGW B;  4CO1 A;  4DF4 A;  2MQP A;  2EFV A;  1KOH A;  3TRG A;  1HHQ A;  1UJ5 A;  2WB4 A;  2BJ3 A;  2DHG A;  4UOH A;  1TK0 A;  2V6A A;  1S1V B;  1T94 A;  2IJN A;  2XMJ A;  4J5O A;  4QJV A;  1YJV A;  1LWE B;  1RWV B;  3PG9 A;  4AXI A;  2G0I A;  1SQG A;  2HQD A;  1X4C A;  3GFZ A;  1F9E B;  4P2X A;  2KO1 A;  3M4X A;  2JLF A;  2RRA A;  1N36 J;  1XWL A;  2APO A;  4CO5 A;  5HRO B;  4QR1 A;  2Q6B A;  2EFP A;  5KT3 A;  3ILI A;  4NLV A;  4QYR A;  4PQU A;  3EM1 A;  3GYN A;  2CQB A;  4YHH J;  4KRW A;  1N34 F;  3KXD A;  2DGU A;  3TI0 A;  3HKZ D;  4C8N A;  1U1K A;  1IR0 A;  3CSK A;  1FEH A;  2MY7 A;  4WTY A;  1KN6 A;  1UAW A;  4AE5 A;  2JFK A;  5HJY A;  4E98 A;  4EK2 A;  5M2U A;  3KKF A;  1U1Q A;  3BR8 A;  2AEF A;  5E5N A;  3MOZ A;  1WKL A;  3H7H B;  3RUB L;  4EGL A;  3IR7 B;  2VIH A;  4X4O A;  2RH3 A;  4Q2M A;  1Q8L A;  4HHU A;  2MSS A;  1YRU A;  3QZ7 A;  1JLE B;  3D4J A;  2ZM6 J;  3MEE A;  1HNV B;  2B9E A;  3V6J A;  1QVF R;  3SCJ E;  1HMV A;  3H40 A;  1WHV A;  1C1B B;  1R8H A;  3LGM A;  2LQ9 A;  3AOD A;  4CRJ A;  4JI8 F;  3GIJ A;  3W9J A;  2LXU A;  3NCP A;  3GG1 A;  4PAB A;  1BE4 A;  1T03 B;  3BQ1 A;  2XSJ B;  2DGX A;  4U9R A;  4GKJ F;  4M5I A;  1C0U A;  2CQI A;  3LGN A;  3MM5 B;  3AXK A;  4ZDN A;  2HHV A;  1N32 J;  2I5J B;  5KT7 A;  4ED0 A;  2YKA A;  2HHW A;  2ATC B;  3C14 A;  4PG8 A;  1IBK F;  3I55 S;  5CCM A;  1HHS A;  4ZVR B;  2Y1I A;  2NYI A;  2AGP A;  2BKN A;  1NJW A;  1BLU A;  4JYA J;  1K0T A;  1QE1 B;  3G86 A;  5K5M A;  4DL0 C;  1C4A A;  3KK2 A;  5HMX A;  4CTA B;  4Q44 A;  5D4P A;  4Z7C A;  3CJ4 A;  2ZH4 A;  4OI3 A;  3UW1 A;  4M5D A;  2H3E B;  2YWF A;  1YK9 A;  2L9W A;  2GO9 A;  3MR5 A;  1MN9 A;  2C2N A;  4KGZ B;  4USW A;  1AUD A;  1VQL S;  2R2S A;  1UVJ A;  1TFW A;  1S0V A;  2Q3P A;  3K8W A;  3K5N A;  1TKD A;  1RB0 A;  3CNQ P;  1U1O A;  4N5S A;  2I2Y A;  1VRQ C;  1NLK L;  1R8A A;  1VK8 A;  4X66 J;  4X4T A;  1WKK A;  1VS3 A;  1FEE A;  4U8V A;  2QSF A;  3CCW A;  2Z30 B;  2HNY B;  1WUU A;  3BGR B;  4HLB A;  2ZM6 F;  4P74 A;  1YJW S;  2LVW A;  1RTD B;  2IBK A;  3C15 A;  2RD5 C;  3MDF A;  4NLD A;  5L9X A;  5LL6 d;  3TNV A;  4DV0 J;  1HBU B;  4FYV B;  4JYA F;  2IY5 B;  2PMZ D;  1B0V A;  2VG7 B;  4K8R A;  4Y2A A;  1NND A;  1HL6 A;  3M8P B;  4ZA1 A;  3JQK A;  4URG A;  2AU0 A;  4LF1 A;  3DLE A;  3GLJ A;  3VAH A;  4RW9 B;  1FXL A;  1FDD A;  2RVJ A;  3IS9 A;  5K9F A;  4WYW A;  3NGK A;  1PIE A;  4E8U A;  2BW7 A;  3H90 A;  3NGD A;  3A8K A;  3Q8S B;  3ZZZ A;  2B7B B;  1NPK A;  1FKO B;  1ROF A;  1WWH A;  4Y2K A;  4KHP J;  4GRS A;  4DR4 J;  4RW7 A;  2Y1J A;  3I56 S;  3MZI A;  2DHX A;  2A6O A;  2ZFH A;  1WC0 A;  2QTW A;  3KUH A;  2VPX B;  2GS8 A;  1N36 F;  1PC4 A;  3LPE A;  3UDV A;  1JLQ B;  4C0H A;  4K4S A;  4I6A A;  4KAI A;  4QCL A;  1RXO B;  3NP5 A;  1LWF A;  3KHH A;  3Q23 A;  2MLZ A;  4KGV B;  2BM0 A;  4WFZ A;  4RNN A;  3TAM B;  4TYA A;  4F50 A;  2YNF B;  3LW5 C;  2CPZ A;  3NS7 B;  3MAA A;  1NH8 A;  4AT1 B;  4G65 A;  1N0V C;  2UV8 A;  1QD1 A;  3NWR A;  1R6Y A;  4URQ U;  2IDE A;  3LAL A;  4O4G A;  5ETL A;  3FKB A;  2N4C A;  3P96 A;  4NLT A;  4WBF A;  2J6S A;  2AKW B;  2R2R A;  4N76 A;  4V1A k;  2HUR A;  5C24 A;  4J91 A;  9ATC B;  2M3D A;  1KLM B;  4OHX A;  2IYG A;  3Q8P B;  2F9J A;  2RIL A;  2GAG C;  3DI6 A;  4C8Z A;  1VC6 A;  3FC9 A;  3CB4 A;  1H3D A;  1RBO B;  1UEU A;  1XQI A;  2B9W A;  2VFS A;  1FRI A;  2VA3 A;  4HKQ A;  4G1Q A;  5D0E A;  2X1F A;  3IGV A;  1CUL B;  2GAH C;  1IVZ A;  2KRR A;  3SXL A;  2Y3Y A;  5AJ3 J;  1J5O A;  1P1T A;  3EVO A;  1X4E A;  4G1Q B;  3T9N A;  5HP1 B;  4C6A A;  1E6Y A;  1FF2 A;  1MWZ A;  1WSR A;  3CCT A;  3VQT A;  2WVB A;  1UMJ A;  3W7B A;  4C8Y A;  2HQG A;  3NS5 A;  2DGO A;  3KLI A;  2GVZ B;  2OEL A;  1SKU B;  3O1L A;  2VPY B;  4NCG A;  3I31 A;  4H4M B;  2HS4 A;  3QRP A;  4QPT A;  3ZFV A;  3LO3 A;  1K1Q A;  3N0V A;  1SC6 A;  1WDD A;  3LP1 A;  3E01 B;  3NEK A;  4LSL B;  4ZVQ B;  1CQM A;  4AD6 A;  3Q22 A;  2FD2 A;  4N47 A;  3S1T A;  3AD7 C;  1VQ7 S;  1TVR A;  1NDP A;  1YZ7 A;  4OV1 A;  1EKS A;  1NM2 A;  1P6T A;  2VBW A;  3IRW P;  1IWG A; 
#chains in the Genus database with same CATH homology
 2PEB A;  2P8I A;  2NYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...