2P8PB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide leldkwaslw[n-ac]
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
221
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nmAb 2F5, light chain
molecule tags Viral protein
publication title Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, and anion-binding site.
pubmed doi rcsb
total genus 33
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p8pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p8pB01
1RHFA 1FYHB 3RDTB 1MFAH 4F7MA 1MI5B 4JO2L 2LTQC 2EH8L 3OMZA 1XGPB 1RPQA 5JPMA 3TBSA 5IB3A 1JGUH 4RX4A 1MRFL 1CICA 3T3PF 4EDXA 1KB5B 4PJFE 3ZT7A 5E8EB 3V4UL 2NY1C 5DTFB 1JUFA 1OAZL 2WSKA 4RMSA 2KZWA 3VXQA 3U9UA 2MQ3A 4J1UB 3V5HB 1KG0B 1XMWA 4TULL 1HNFA 4GQ9L 4YHIB 2PXYA 1PX4A 3MRLA 2AEQL 1BQLL 3IXAA 2ZPKL 2M1KA 2ZG1A 3UYPA 3SGJC 4WGWB 1SBSH 5KANI 1MRFH 1U2CA 3IFPA 1JPTL 1LEGB 5I8EB 4X5LA 4XXCA 1BOYA 3GSNH 5E00B 3HB3C 3O6FB 4OD2A 4X6FA 3CMOH 4ELKB 3GHEL 2VB5A 4Y0GA 4R2GB 4L8DB 1MJUL 2VH5H 4YWGL 5IW1B 4Y4KD 1IEAA 4RAHA 3LZFL 4GS7C 5C0ND 1FFQA 3BP4A 3R1GL 5C08D 1Z9OA 4JM2C 4NQCE 2ZUXA 5D7IE 4OD1H 1I1AA 4CDHA 5EIIB 1UVQB 3OR7B 2VISA 1O5DT 2Z4QB 3B9KB 3SDAD 4E9LA 4PTTA 3WSQH 2NY0B 3F7VB 2HH0L 4JY6A 4KJPD 4F7TA 4J4PC 3NCEB 3CFCH 2FJHB 1S9XA 4YBLC 4WHDA 4X80H 4N0FB 4ZAKC 5T3ZL 5J13B 4X4XA 1NBZA 3CFDB 2VWEE 1JGDA 3QNYB 4YR6B 5EA0L 4NKMB 3TA3C 1T6VN 5BVJB 3PP3K 2AXGA 2H9GB 1X7QB 2FGWH 3QXWA 3ZTNL 3GSVA 1RUPH 4P2RE 2F5AL 3SY0B 2Y5TA 2GQHA 4HKBA 2B2XH 2VLMD 4PJBB 1ED3B 4PJCB 4Y1AE 4YHZL 2FECL 1CBVL 3HE7D 3LN5A 3N1GC 2X89A 3WD5H 4HXAH 1QLFB 2YPLB 5D6CB 1HN1A 5BV7C 8FABA 3GK8L 5DVLA 5D5MB 4HKXA 5E4EB 4N0RA 5CBEB 5IM7B 2UVEA 3PWVA 5KVMC 3V5DA 3VDCA 5B22A 1QFWH 3S5LB 3VFRA 3W0WA 1PY9A 1QA9B 4JM2F 3CUPA 4G9FE 4CMMB 3KPPB 1VA9A 4NKIL 5IMOB 4QT5B 4FZEH 5F1NB 3TYFA 5SWZB 4YXHL 1QUNA 4LSVL 1K8DB 4HH9B 4NPYA 4CJ0A 4JFQA 4CVZA 3EOAA 3VXPB 3SGDI 4Z7WF 1CDYA 2DTMH 2H3NB 5CZKA 4DEPB 5E6IB 4W4NA 1JWSA 5DJZB 1M05A 1PFCA 4UTBL 4I4WA 5JHLH 1XIWA 2E6QA 4EJ1C 1KIPB 3HNVH 1FFNB 2F58L 4G8IA 4HLZG 1INQA 25C8H 3F58L 5D93C 4LDLB 4PUBH 4OF7A 4NYLB 1RZ8A 1IQDA 1JPSL 1Z5LB 3ARBB 4WY7L 3MOQA 3BT2H 1W0WA 5I1IH 1AFVL 2A6KA 1BBDH 1G7IA 4XMLL 3E2HC 5GGSY 4E5XA 3T8XA 5B38A 4M43L 4OI9A 4R3SB 1AKJA 1MUJA 4MJ5B 2JJUA 2X42A 4PJ5E 1OAYL 2FX9L 4ZD3H 2WUCH 4AIZA 4HUWA 3UTQB 5HI5D 3MJGX 3DURB 4NKQB 1NC2A 2I25N 1LNUA 5J9PB 3ESUF 2O93L 1P5UA 4MCYB 1K6QH 3W0WE 1ZA6B 3VFGH 4Q2ZA 5I1AB 2ARJQ 4RISL 4Y5VA 5D70H 5JOEA 1NCBL 1IGFH 1L4IA 3UJTH 1RUKL 2X4NB 4OFIA 1J0ZA 3U82B 1ORSB 3ZKND 1S9YA 5BW7C 4LFHG 4OLWL 2LU4A 4V2CB 5H2BA 2OJZH 5HYSB 1HYSC 5FM8A 3WKNA 4L8CB 2XWBA 3E6FA 3JWDH 3O6KH 3RWDA 3PJSA 4UILL 1KPUB 1VPOH 4FTVB 4JRYA 3I3DA 1D5XA 4LLMA 1MFBH 4PJHE 3MRNA 3HAEG 5I8KH 1XGRA 2HA1A 4ODTL 3ZDYF 5GRVK 2XY2A 1J05B 1OF2B 2BNRB 2OL3A 4H0GA 5ILTH 1R3LB 5IIEA 5KSUA 3SGEH 1OB1A 5C3LD 1E6OL 1A9BA 5J12B 4DFHA 4IIQB 4WW2F 1WK0A 1X5ZA 2GSGB 3AU1A 4PRHE 2EXWD 4WTXA 3TCXA 2B8OT 3GMRB 4PR5B 3H42H 3GMOA 2XI9A 1UZ8B 1NKRA 4M6OL 1VPOL 3EYQC 4X4ME 1TVBB 4XNYL 4HWBH 4IOFD 2X7LB 5J6GA 1EJOH 5F93C 5F9WB 5GS3A 3Q6FB 1F3DJ 1FO0A 3IAQA 1OL0A 4XHQA 1H8NA 3BGMA 3BPLC 3RY4A 4XVUD 3FB6B 1QKZH 1K2DB 4LCCB 5I1EL 3H7LA 4JM2A 4K3EL 4LLQB 2HTLD 3PHQB 1E6OH 2PW2B 1F3JB 3OTTA 3DMMD 3CFJA 4WI4A 4C59B 1C5BH 2GJZA 3UZQA 3K2UH 4Z7UA 3VFVB 3WBDA 2HVJA 4XXCC 2OZ4L 3FT3B 3PHOB 1EVUA 5DT1L 4XNZC 4KK6D 2ENSA 4M7JL 2BXZA 4LRNH 4X6EB 3VWKC 4JDZA 5B8CB 3GBNL 4NN5C 5EIVA 1C1EH 5BCAA 4PGCA 4OLZL 4KUZH 1A14H 3MRDA 5MI0B 3BP5A 2X4QB 4Z6AT 3UO1H 2R56H 2X1QA 3RU8L 2R4SL 4TTDC 4X0KA 4PJ7B 4DKDC 4ENED 3QFDB 4OF5A 4U1KB 1ROWA 3HPLA 1CICD 3L5JA 3TBYB 1MOEA 5HYSG 5J06A 3U4EA 4P23D 5LWYL 2R0LL 3KDMB 2A6IB 3B4NA 4IRJA 5IHLB 1BQSA 4ZO6A 3UJJL 4OLZH 4Q7DA 3ECBA 4M6AA 3K4ZA 2NX5B 3UBXA 4YDKH 1BFSA 2JK5A 4OFVA 1YMMB 2NY6D 1JYXA 4DUVA 1FNSL 1A6ZB 3LKOA 1ZHNB 3T65B 5BRZB 4H0IA 1CD9B 4TQEL 2GUOA 3QPQC 3Q3GA 1KELL 2AABL 1CFNB 5MERB 2VAAB 1AC0A 4GMTH 2VXSH 1AP2A 1M4KA 3OGCA 5IK3A 2EXWC 1WUNT 1JYVA 2AAVA 4IJ3C 4KI1A 2BOCB 4PPTA 5CJXA 3QHFH 1Q9WB 4LLYB 3EDEA 1R3JB 2A73A 2HT2D 4J12A 4AIXA 3DETD 3QG7L 3VXOB 1D5ZA 1T83C 2XQBL 4IRSA 4YPJA 3OKMB 1RZJH 1VACB 1XR9B 2X6MA 2BNQB 1QZ1A 4BYHA 4GBXD 4ZUTA 3NGBC 3MNWB 5FYKE 4O4YH 5DHVH 4G7VH 2UV3A 4UT9L 3OF6A 4JFFB 3TJHD 3CZFA 4X4ZA 4M7JH 4BFGA 4YHKL 5A3ID 2H26B 3I6KB 3D39D 3QDMD 2FR4A 3CU1A 3WO4B 5GISL 3ARED 3VFUB 5LBSH 1RJCA 1F11B 3QUMH 1FPTL 3JWNC 3BPLB 4WUKH 4FFVC 4LKXA 1MY7A 3L7FA 1Y6KR 4JE4B 1YNKL 1QO3B 4JN1H 5CJOH 5HPMB 5CKGA 2B5IB 1NC4A 4HWEL 4YO0A 3CLFH 3RVVC 4DTGL 4UIMA 4DW2H 4XCEB 1OAXH 3MJ8B 5DEFA 2FATL 1RIVL 1RJZA 4Y2DB 1IGCL 4JPKL 1NDMB 4I18B 2EKSA 3CZJA 3IRZA 4JAMA 4MJ5A 3M1BB 3HKFA 1FNGB 4KY1H 3SJVB 3ARFD 5HYJB 2FJGA 3T09A 1AD0B 3BPOC 1Z5LA 2X1OA 3GJFA 1YEIL 5D7IA 1NEUA 5EZJB 5HGDA 4NM4L 1QSEE 4UINH 5HGHB 4BSVA 2DD8L 5CUSL 1FQ9C 1A6UH 1YA5A 4G8IB 4GW4A 2XTLA 3BP7B 2HKHL 4X8JB 4CL7A 3ZMRA 3T1WA 3PWNB 3DVGA 2CK0L 3QRGH 5D4QA 4GSDL 3K3QA 1BF2A 2Q8BL 2XACC 4G43A 2LAGB 3FTGA 3IDMA 3MLRH 3ZYOA 2Q8AH 3VJ6A 1QG3A 4OCNC 3QUYA 1JFQH 2YN5A 3CSBA 4LAQL 5T33L 1G9EA 3AFLA 3ZKQD 1MEXH 1D5BA 3SE3A 3MCKB 4P2RA 3MGTB 5JORB 1R3HA 5I1HL 1DLFH 3O4OB 5GGQH 2W92A 4QRPB 1CFQB 4M4RA 4NFBA 5EC2B 1YY9D 3IJSB 3WSQL 4MNQA 2X41A 5KTEH 4TSAL 1JVKA 5L6YH 3L3KB 2NTSP 1NGQL 3SDCA 4FABH 4CW1A 3I50L 1FDLH 2IMNA 4ISVA 3ZO0A 1RHHB 1AR2A 4JAMB 2ICWA 4JFYB 3AGVA 4Z95L 4UMGA 3WL9A 2P7TA 3RVTC 4G6KH 5C0EB 2ADGB 1T04A 4UIMB 5F7EH 1QFOA 2YMXL 3ZT6A 1DLHA 5HPMA 5KG9B 4HAGA 5DJ0A 1PJ9A 4TSAH 3QUYB 3S37L 3VJ6B 1FGNL 3BN9C 2B7DT 4HLJA 2VQ1A 5T1KA 2JCCA 3IRPX 3QAZB 4OZHF 1UB6B 1RZKH 1OAKH 3IETA 1X4XA 4X7SH 2ZSVB 4L3AA 3I02B 5KVFL 4HWZA 3AB0B 5KVGH 1JE6A 2BJML 1ETZA 2VZUA 3SDDD 1HXMA 3HMXA 2YMXH 1D5MB 4APQD 4X6DB 2VZ3A 1ZANL 3AM8A 4L4JA 3BH8A 3VXMB 4KWUA 5KSAC 2AK4D 5IBLC 2J1KA 3KYNA 4I18C 1Z6JT 2FHCA 2WWKO 4G6JL 3ALWA 1F4WL 5FUZH 2NZ9D 4MGXA 4JJ5A 1QLRB 2BY1A 2JTDA 4JQVC 4JVWA 1I8MB 5E1AA 4LDEB 4PJ5A 3LD8B 1RJZB 3RVXD 5DEFB 4HJ0D 3VG0L 3VXME 1J8KA 3JWOL 3GSWB 3FAWA 4XC3L 2IAMD 3QWOA 1E4XH 4U1GB 1LQSR 1TZGH 4YXKL 3C5JB 3H9SE 4J6RL 4O2FA 4O51B 2NY6B 4KK9C 4HBCH 3V5HA 4Y4HD 4O2EB 1J1XH 3P73A 4MXQC 5TDNA 3ISWA 4PRAB 3QRFM 1HDMA 3HR5B 5IFAL 4FS0A 3LPFA 1PSKL 1S7UB 1CGSL 5D5ME 3M8OH 3UC0H 3PGCA 3FQRB 4Z0BH 5DRXB 3R0NA 1FCCA 3RDTA 3P73B 4U1KA 4U6TA 4X98A 2V2TB 3PIQB 4FXGB 5HYQB 1GOFA 3OKDA 1UWXK 1JNNH 2W0KA 3IKCA 4G6FD 3VXUB 3S7GA 1YUHB 2O5XH 2APTA 4N8CL 4WDIA 1U6AH 5ITFA 4X6EA 2Y07H 4ELMF 1ES0A 3QDMB 3D39B 4UT7H 1GZQA 3Q3GB 3LEYL 3J7HA 1S7QA 1L6XA 2ESVB 3BJLA 4RFOL 1EAPA 3TN0C 4OZFG 3WUZA 1QRNE 3BKYL 1LO3H 4D3CH 1JRHH 4ZUSB 3RWGB 1QLEL 4Q9CA 3K8MA 1FZOA 2O5XL 1WAAA 4EI5C 1BPVA 3ESVF 3ZZ1A 4Q6IB 3WNMA 2MKLC 5BQ7A 4M7LH 1BZ7B 3ZDXF 3ULUD 1JN6B 3CVIL 3H9SA 5ETUA 1KTKE 3G5YA 3FQTA 5EIQA 4M1GH 4NGHL 1JGVH 3IDIA 4FQJL 4ZUWB 4IMLB 3MA7B 4HWZB 4HJGA 4JZNA 4MD0B 3D18B 4K9EL 2CXGA 3PE9A 1IAIL 1II4E 4PJ8D 3L3JA 4NN6B 1I9RH 4XP4H 5D1ZC 2DQFA 5EN2A 3KPRE 5AG8A 3CFBB 5SX5H 1NUDA 1JNLH 2Y6SC 5JXAH 1FFPB 3VRIA 4ODUB 4ZSOA 3L3HA 3BEWB 3BWAA 1T1WB 2PYEE 3GRWA 4L9DA 2QQNH 1J05A 2OL3B 3QNXA 2GITB 1NLDH 4ZPVA 5I74B 2YRLA 4LVNC 2P5EE 4QHMA 3DMMA 3V9FA 1XF2A 4U7MA 3EW3B 3IDGA 3DARA 1G0YR 3M17A 2A1WH 1PKQE 3CDGB 2PCPB 15C8H 3V0WH 2ITCA 1OGAE 1M7DB 4I9WE 3TEUA 1U93A 4XPAL 5DK2A 3IF1B 5ESAB 3TO2A 3BDBA 2DWEB 1Q38A 1BX2A 4GS7B 3BRFA 1N5AB 1PZ5B 3DUUA 2QV2A 3FB6A 2VDOH 3VD4A 5HJ3B 3KPSE 2P8PA 3OZ9H 4OGXL 5ALCL 1FIGL 4Q2ZB 1IGMH 1BWWA 1UJ3B 3G08A 4R9HA 4I3RL 1FNEB 3VXRE 5C08A 4WW2C 15C8L 1QFHA 1RK1B 1JPFB 1P7HL 1IGJA 1AGEB 4HIXL 5C86A 4U4BA 3WMSA 5MP6L 1IAIM 4OM1H 3UBXG 5IIEB 4ZO7A 5EZIH 1S9WB 3MOAL 1RZFH 3SGKA 5HVFB 2ZUQC 2AJYH 4HX1B 2OJEA 5D2NA 1OWWA 4C56E 4HMDA 3BP7A 3QUZA 3BI9X 4QYOA 1RUMH 3GDBA 5CINH 1KXTB 5IKCA 1EHXA 4PJ9D 3O2DH 2EH7H 4NZTL 3SDXE 3JZ7A 5TQ0L 3GO1H 5JIIA 5IKCB 1VFAB 2VLKD 4WUUD 1MFCL 2R0KL 2OR7A 2E7BA 4NC1E 3REWA 3X11B 5MP6H 3SE8H 2DAVA 5C2BL 4WWKC 1J0IA 4ODWA 3TGXA 1ZT7A 1O7VA 3HC0B 2FEDC 2BRRH 2AJZB 3FB8A 2XFXB 4ELMA 4M5ZH 4FP8H 5D71L 1J8HD 2VDRH 2R1WA 3D85B 5E0QA 2XY1A 1CD0A 1OAZH 4R97B 5HHNA 2P8LA 1BMGA 4JKWA 1YEKH 4CU8A 4LIQH 1DEEA 4ONOA 4Q6IC 4G80B 4A6YB 2XICA 4R0LA 4OCWL 3MBEC 1CLYL 3O8XC 1S78C 3D85A 5KS9B 1ZHKB 1A4KB 1KN4L 3KPSB 5IUSA 1HOCB 1EUUA 3NZHH 3CFEB 1NEZA 2W59A 2DICA 4KPHL 1GC1C 1YNTA 4XPFL 3QDJB 1MCWM 1JI1A 2VR4A 4TUOA 1BJ1J 1W0WB 4M7KH 1Q0XL 1K3IA 3MA9L 1G6RL 2GJ6D 5A40E 3E8UH 2ZCKL 1CT8A 3W11D 5KBNC 5LCVH 2LV4A 1W8OA 3TESA 3TWCL 4EUPA 1GRWA 3LHPL 4ZUTB 4LVNB 3S37H 4D0CA 3IDGB 4R2GC 2OJEB 5D2NB 3BX7C 4TUJA 1V3MA 2HFFA 3QG6A 3SEPA 5GGVH 3A6BL 2DBJA 1FFPA 3BQUB 3WLWC 4RGNC 3V4UH 3EYSL 3V2AR 4NDMB 1OHQA 1UM4L 2MQ0A 4ETQA 4G8EB 5EU3B 2HRPL 4PJXE 2NY0C 3HG1E 5DJXA 4QT5A 3OAYK 4HX1A 4MJIA 1AH1A 4JDVA 4YHYC 4ODHH 2VAAA 2FJHA 1IAKA 5HHXH 4YDIH 1YMMA 1JN6A 1T7YA 4PLNC 1A6UL 3IXTA 5FUOL 4YHLL 4FP8L 5IWLA 3IDYB 5HHPA 3ALXA 3IFNL 3E3QE 3P30H 3OG6B 4W6WB 1G7JA 2ZNXA 4LCWE 3MUGA 4R4FL 5JO5B 4L8DA 1W0VA 4Y5XC 5DD1L 3WLBB 3P77B 2FEDD 4PTUA 1N4XL 3NOIA 3LZFH 2D0HA 3ZKMC 3OL2A 4ZAKB 4LVHB 3UTSB 2YSSB 3DWTA 1BX2B 3D1MC 1J1OL 1LEGA 5C07B 2IBBA 5JHDE 5FV2A 3OKNA 5DR5L 4AL8L 4M1CC 5F7HA 3GSVB 3S8WA 1J0JA 4C55A 1IGTB 1VADA 1U3HB 5IB4A 5IWLC 4RZCB 3RWEA 5ACMA 3CFCL 4ODTH 1KYOJ 1AD9B 2CPCA 4R4BB 1KG0A 1UG9A 3TP4A 4JPIA 4XMKL 3PDGA 4P5TD 2D03H 1KPRB 1JHTA 4M61A 3BWAB 3BISA 3RA7L 4L9LC 1NGWB 4UT6L 3QO0B 2PTTB 3PP3H 1JRHI 4XCYA 2AERT 4WFGD 4PRAA 2HJLA 1TZIB 5D7SH 1JF6A 3L5WB 4LSTH 1DBJL 2F54A 3FONB 2NW2A 2G5BA 4WRLA 4GMSH 4ZO8A 5CZXC 4M1CD 4PRID 4R0LC 4X6BA 5AZEH 4ELKA 3WNKA 1F42A 5C3TA 3ZDZF 1OTUD 1A2YA 2EIZB 3HAEA 1YEJL 4HC1H 5I8EA 4J3SA 4PRNB 3Q5OA 1CN4A 4GAGH 1H9VA 5DRWB 5DJXB 4JHBA 4NCC1 4FQLH 4ZOAA 4EIZC 1J8HE 3F5WA 4BK5A 4ERSL 4WDIB 3WXVL 1EJ6A 1DUZB 2GT9B 3MLXL 5D7LE 3BZFA 2E5EA 2B1HL 2DQIH 3B2VH 1NCDH 1IEBA 4TUJB 2O26U 3V5KA 4JZJB 1XGRB 2V2TA 2D9CA 2VLKE 4QGYA 2IPKB 5DTFA 3VFMA 4B50A 4RGNB 5GS2D 4QGTA 2PTTA 1YPZE 1TQCC 3ZDZE 3EOTL 5GPRA 1DSFH 2CLVA 5F1KC 3TVMC 1LO4L 4YHYB 1CG9A 1ZTXL 4LBEB 5DJ2A 3VI3F 2FJFA 5F9JB 4O2EA 1T2XA 4OZFA 1AGFA 3IDUA 1KTDB 4NM4H 4DQOH 4ZXBD 3HE6B 5ENWB 2K7PA 4CGTA 3RWEB 3KPLA 4U1MB 5I8KL 5IB5B 4E0RB 5HHOE 5IJKC 3HB3D 1CK0H 4RGMC 1DEEB 2RB8A 5DSCA 1T2QL 1KEMH 2YPKB 4W81A 3TO4C 2D3VA 4A6YH 2X4SB 5EOCL 1ZLSL 5CD3A 2RJMA 3MXVH 5GS2H 4NOBA 5E1AB 1V3KA 3QXAA 1JP5A 5ID1A 3BDYL 3QHZL 2Y5EA 1YECH 5J12C 5JDJA 3JWDC 4H88L 1CIUA 2J4WL 2XZCL 2OP4L 4J3UA 1NGZA 5C0BB 2JJSA 3U4BL 3TVMD 4WU5B 3V95A 2ZUYA 1C12B 4HKZB 4ZS7L 3BN3B 3VH8A 1DBML 2VLRD 2UUDK 4K3EH 3QNZA 2F5AH 1M71A 5EZOH 1DN0B 3WFCH 4XP5L 1R3HB 3X14A 4NZRL 5IW6A 4MQXD 5DJZA 1EFXD 4MA8H 1H3TA 3RL1B 1N6QL 3ILQC 5D1ZA 3S34H 1AXSA 4MXWL 4U1NB 4NDMA 5T1LB 3DROB 4HHAA 1I1CA 1AXSB 3DUSA 4RAUB 2HTKC 3V7AG 1UWXH 5A2KH 3HN3A 4M6ML 5F9WC 3EOTH 4GG6F 2HLFC 2J8OA 4XPBH 5F7MC 3SE9H 3EJZD 2BSED 3CUPB 2ICWB 4CMMA 3SE8L 3LKNA 4XBPA 1E27A 2XTJE 2H41A 4UAOB 4JGUA 5A2LH 4Y2DC 4MA8L 2WP3T 4P46B 1RZJC 3EYVA 3LS4H 4WJ5B 4BFIB 3FN9A 3VGGA 1T5XA 5JIKA 4PLOB 1G7QA 3MLPA 4QXUH 1T5XB 3SJVA 4MQXC 3IJSA 4FXLA 1DQDL 3CVHH 3O11B 4FG6D 4NQDE 4X8XA 4LSQL 5E8DH 5KS9A 1B4JL 4JN2B 1A6PA 4RNRB 3DGGB 4G6AC 4X99A 5HVGB 2RAMA 4MHHG 2E9BA 3I6GA 3CAFA 5TH2A 5C0CE 4K2UL 4E0RA 1MRDL 5MI0C 5K9QI 1XF3B 2D7PA 3CFBA 3OQ3B 1M6OB 1EEZA 4QRPA 1NGXB 4GMTL 1B2WH 2HKHH 4Z77A 1ZWIA 3DGCR 4KI5E 3THMH 1FYTA 2IBZY 5ITBL 4QHUB 4ZMAT 1QFUH 4GW4B 1AO7A 2VABA 4PJAB 1KJ2A 3HI5L 3VH8B 2CUHA 4LNVA 4WI8A 4XI5C 2XQYK 4AK1A 3W81A 5F8QC 4KZEH 5IW6B 1H8SA 3BRDA 2ZCHH 3H9SD 4PGEB 4YFDB 5D7LB 4HMEA 5DI8B 1ZS8B 4BSVB 5T1LD 4D9LH 5BS0E 2HYMA 3FFDB 4YAQA 4HMCA 5E9DB 3MV11 1A3QA 3IU4L 1RMFL 4WU5A 2OYPA 2F8VA 3IFPB 3SOBL 4OKDA 4NZJA 4OZ4A 1ZLWH 3H6JA 5H37G 4WUKL 2AJSH 3G5XB 4HCRH 4XVSH 4HXBH 4B0MM 2HTLC 3T3PE 2VERN 1MCCA 2EKSB 5E95B 4LKXB 1QRNA 4JEGB 3UAJD 3MYZA 3UDWA 3OKDB 4WWKD 5JW3H 3QDAA 2VLKA 1EXUB 5LXGL 4HH8A 1T0MB 4YO0B 2I60H 5F7YC 3VMNA 5IQ7L 5C0CA 4NWUH 3TF7C 5IB5A 1EDQA 4MD4A 1F2QA 2QLVB 4LP4A 4YPGB 3VXNB 2IG2L 1W0YT 4KY1L 1RZKL 4FQXD 1CLZH 1N59B 3VRJB 2DQDL 3A6CL 4YX2L 5SWZD 2ZOKB 4YEFA 4JFZL 5GRJH 5KSAA 2BNQE 3K4DA 4RRPG 4UAOC 2P47B 5B38G 1HH9A 1J1PH 3BP5B 1D5ZB 2H1PH 3NN8A 4PGBA 4D9QE 3EYQD 3UJJH 4PJEF 3MJ9H 3OKYA 1JPGB 3R1GH 1RJYB 3T04D 5BVPL 4ZSOE 2NW3B 4LP5A 1YN7B 1MIML 4NP4L 5CKAA 4LHJB 2CDFA 3PV7A 4XWGL 4W4OA 3L3JB 4NWTH 5DD5H 2FX7L 1I1AD 4MAUH 3UPAA 4DGIL 3PWJA 3K8LA 4HJGB 4JZNB 4MA7L 3A6CH 1YQVL 3SGKC 1MHPH 1QLRA 5CEZH 3P77A 4Q97A 5I1LB 3MLSH 3KYNB 2FX8H 2BVOA 4LFHD 2DYPA 3D69A 1S78D 3C2SA 3PXHA 4DKEL 3T0VA 4P99A 1OAYH 2Y72A 3P9WB 4OGZA 4Q9QH 3HAEB 2VL5A 5DJAA 4KUZL 5ICZB 3MROA 4LLQA 2A6IA 3MRFB 3QISA 5CZVH 5DUPH 3HZMA 4F58H 4GLRH 4MLSA 2YPLE 2D7QA 4JO1L 4TOYL 1BGXL 5GS0H 3RIAF 4N0YL 1B0GA 1NBYA 5DA0B 5EH1A 4N8VA 3Q0HA 2B1HH 4PJXF 3HG1B 3OKEB 4BZ2L 1A9EB 4TUKL 1OGTA 5DC4B 2AJUH 4JFDA 4KHXL 4UDUA 3JTTA 2X05A 4R2GD 1NGWA 4RZCA 4U1SB 1RJYA 1NGPH 1VSCA 4XNUL 4I8DA 1V8HA 1MCOL 3MLWL 5H35A 3VWJC 3TFKC 4KZDH 2GSIB 1A7QL 1WZLA 2VE6A 4FQ1L 5C07A 5CWSB 5BJTA 2WNGA 2DQHH 2NY0D 4HS3B 3QO1B 5DZLA 4GXVL 1AR1D 1U3HA 1QNZL 5FIEA 3VWJA 3DYOA 5EO9B 2W38A 4XTRC 4GAJH 1CGXA 5GJSH 1A22B 3L9RB 4YPGA 5I76B 4GRMB 5BVPH 1HH6B 4JFFE 1QSVA 3AS0A 1KIQB 2AK1L 2EZ0D 1YNTB 3ZL4H 4NIKB 4JHWL 2W65A 2IQ9L 1N59A 4I2XB 2B20A 1EA9C 3TIDB 4F33B 3RUGE 1FAIH 5KS9E 2ZUVA 1MLBA 4M02A 3VDAA 3G5VB 2X89D 2YZ1A 5I1AA 1MJ8H 3G5XA 3OKKB 4FQIH 2PW2A 3D2UD 3GSWA 3MV8B 1SYSA 4UINL 5I18H 3MGAA 2XZAL 4LCIH 4MLIA 3O3EA 4OB5H 3WS3B 5MEOB 5B39B 3ARSA 1BBDL 4XMLH 3ARFC 4L4TD 5M7QA 2AK1H 1MUJB 1AKJB 2VLLB 4JJ5B 5JQHC 5CEYA 2NR6D 5D7LA 5TPWH 4JDVB 3KPMB 1BP3B 2R0ZL 2DLGA 1RU9L 4ODSH 5C8JB 1I1RA 3TZVC 4YGVB 2VZVA 3RIFF 5F3BB 4X6DA 1IC7H 2NW3A 4EXKA 4JKKA 1ZLVH 4P3DB 4NQSA 5MEND 4F2MA 5KSAB 4DVBB 3O4LD 4YGVA 4TUOB 2AGJH 3I02A 5D70L 4Q9BA 1GVIA 5CGMA 1BIHA 4NNPH 4OCYL 5CFHA 4NNXA 4HC1A 2IH3B 4KQ4H 3VMPA 1RU9H 2EDRA 2ITDB 4PRHA 5FYJU 4Z7QF 4H1LB 1JZ2A 1VCAA 4JG0L 3TPUB 2R9HC 4L3EE 4EZMA 3MV8A 3VH8G 1GPOH 1UJ3C 2DJUA 1EXUA 2X40A 1ZAGA 4RA0C 5GGVL 5C6TL 1NEZB 3NIFF 1FORL 1ZWIB 1BM3H 4U6YB 4XHJC 2NY7L 3ZTJH 1INDH 3HCVA 4X6CF 4ODXA 4KJPC 1WIUA 4G7YH 1PZ5A 5B38B 2H45A 3I6GB 4HZLA 2MWCA 2A6KB 5T3ZD 3ILQD 3WIHL 3RGHA 2P8MA 3ARBA 3PWPD 4MNQB 3AREC 4WI7A 1FN4A 1FBIL 4P3DA 1B88A 3S88L 1QLFA 1LMKA 4LL9A 1Y18A 3UPCA 3FRPG 5GSVB 5EBWA 2XG4A 4Y16C 4PJCE 4Y1AB 3IJHB 1PG7W 3D2UB 1UADC 3WNLA 2BNQA 1A6WH 1F90L 4AENA 5INDB 1PSKH 3BN9D 3O2DL 1FYTD 3C08H 3U46A 4XCCL 4J4PD 1NMCC 4PJAA 3QUXD 2AEQH 3GMMB 3KXFA 4K7PY 3T0EB 2IH1B 4L8SA 3ARTA 1HQRB 5F9AC 4A2LA 2MCPL 4M5ZL 1XZ0A 4HW6A 3SGEI 3MV9E 2GTZB 5CLWA 2B39A 3BQUD 5GGUB 3GMNA 5FYJL 4FTVD 3QEUB 4OV5A 3DNKA 2XNAA 2VDLH 5GIRB 1WCQA 4X6CB 1KIQA 3FO9A 1QBMH 4X99B 5J0BA 2YXMA 4WTZA 4Y16D 2XN9E 4V1DD 4ETYA 4J6RH 4OLUL 5FKAA 1A02N 4X9IA 5E5MA 4UQ3A 3C60D 3MO1B 5DRZA 4K23L 1ZV5A 3E6HA 4NUJB 4PJGE 3IF1A 4XNXH 1U93B 1UZ6E 2JJWA 2GSIA 4FFYH 4FFZH 2EDYA 4FQ2L 3KYKH 3IDNB 1N3NA 3KPOB 3QCTH 1BBJA 5E2UL 4EUPH 3G6JB 4IOIA 4YHIA 4HBQA 1IKNA 3CH8A 4PJCA 4OIIL 4QRPE 5CZXD 4RIRA 5GRUL 1SEQH 4XGZB 1L0QA 3DUHA 4X98B 4QXWA 4CADA 1T1WA 3DJ9A 1KCSH 1JUFB 5JZ7C 1CG9B 4LBEA 4HHAB 1FL6A 4QCIB 1FRGH 1QFWM 3F7VA 4PYHA 3QXVA 5HDBE 4JFZH 4S11A 1JHKH 3TBSB 2VISB 3ET9F 3R06A 5IFHH 3MROB 1HQ4B 5ICZA 3C60C 5ALBH 2ZUUA 3BGAA 4XX1G 3WHXB 3QG7H 1QQDB 3V5KB 3MRMA 4QF1A 1WVZA 2FX7H 3G5YB 1MEXL 3WKML 4Y8DC 5JW4R 3VXOA 3MRFA 2YD1A 2EEAA 4PG9B 1CGTA 4CN1A 2NY2C 4TNVK 5FKPB 1ZT1B 4CVXB 5IVNA 5DHXB 3VFMB 2GJ6E 1QD0A 4OZ4B 3P9LB 5JOFA 1RK0B 5D1ZD 4GT7A 3CC5B 4L4TB 5GRZA 4AMKH 4I0PB 1BLNA 4WWKB 1A9BB 4PG9A 1Q94B 5TF0A 2RHEA 4K9EH 4ZXBC 1HH9B 3C5ZD 4OLEA 4WWKA 1CK0L 4MS8D 1UM6L 3D39A 3QDMA 4PJEA 4LIQL 2AJXH 5TDPB 1SBSL 3TBWB 5BRZD 3NTCH 2ZKHL 2YPKA 5DURD 4X6DE 2YPVL 3QIBA 3VRJA 4JVUA 2HJLB 4AEIL 2R2BB 4U1MA 3NA4A 3L3IA 1A8JH 1ZSDA 4X7CC 1FJ1A 4DZBA 4XNXL 4ZTOL 1XR8A 3T2QA 3BKCH 4L8CA 3VA2C 4XPFH 3QCUH 2FCBA 5JR1H 5TDNB 2YA0A 2R8SH 1F6LL 5EUOF 3LEYH 2YN3A 4GBXA 3PGCB 5JMOC 1CE6B 3OB8A 2VQ1B 1EHLH 2Z31A 2I24N 5EOQH 5HXMA 3WIIL 4PIRF 5EZOL 3G6JA 4IOIB 5CD5C 3MLYH 4L3EA 4WW2A 3IDNA 1Y6NR 2GK2A 4RWYH 4GUPB 5GGTL 1K4CA 5KAQF 2OLDA 4NN7B 1G0XA 5C09E 2P7TB 2CDGB 3M45A 2YD2A 3BAEL 3E6HB 4FQHA 5EU6E 1PG7L 4PTUB 1A7BA 1I7RB 4TSBL 3F5WB 2W9DL 4QHNB 3U30B 1DQLL 3O6FC 4ISVB 4H8WH 1MI5D 1FAIL 5F7FA 3S36X 1UH4A 3GI9H 3CXHK 4BQBA 5TFSH 1YYML 4YHZH 4KDVA 4GRWH 3FFDA 4YAQB 4YQXL 1JZ5A 1T22A 4CJ1A 3B9VA 2GHWB 1KCVH 3ULVC 1T80A 4PJEE 5ANME 3U1SL 4NT6A 4C83B 3MV7A 3S35L 3U0WL 1TQCB 2ZUTA 3GMPB 1NCWL 3MCKA 3TVMB 5ACZB 3QI9C 1WSST 3ETBF 4XPTL 2CR3A 1UZ8A 2H3NA 2IH1A 2NXYB 4L8SB 3R06B 4MWFA 4UV7H 1NMBH 3OJDA 1OSPH 4MNQD 12E8L 3U46B 4CADB 4FG6C 3DX9B 4PGDB 4YHKH 3R8BB 1VEOA 3MBED 3O8XD 4R6UA 3WL9B 4P23B 1Z9LA 2QSCL 2FB4H 5DJ8B 1EJOL 4PG2C 4LSRL 1U8OB 1FH5L 3WYRA 2PYED 1QA9A 1RHHA 1K5NB 1AE6H 5DJ0B 1PEZA 3C6SA 1NLBH 2P8MB 2DQEL 3OKNB 1BREA 1I75A 2P5EA 3UTSA 2VLJE 3G5ZA 4NO2A 4Z7VE 5L2KE 4ESKA 4JY5L 25C8L 4Y1AA 2BERA 4DTGH 4DW2L 5DRZB 3MO1A 1HOCA 1ACZA 4OAWA 2Y9RT 5FKAB 1EO8H 5T1KD 1CGUA 2VXQH 4M1DL 5EOTB 3GBML 4OZHE 1IL1B 1UXSB 1VGKA 3SGJA 4KZDL 1XGUB 3HMXH 4NKDB 5IT2L 5AWNL 4PGZA 4I1NB 1CD1A 4HK0A 3LQAC 3RX5A 4RFNB 4BZ1L 1ODAA 3OPZL 5ANMA 4WTZG 5FYKL 2DQTH 5C2BH 2IH3A 2IPTL 3TH4T 4GKOA 4R0LB 2R56L 4N0FA 5H94B 5I1JH 4GAJL 3RDTC 5F9JA 2LTQB 3U7YH 5SV4A 4K3DH 3IDJA 4KJWC 4LHUA 3REWB 4W4OC 4WW1B 4G3YH 3VG0H 2ITDA 2NY4B 4AYFA 3FHQA 1Q0YH 5D93B 2D03L 3RNQA 3NFSH 4NJ9L 1I1FA 4G6ML 3RBSA 2XKUA 4GRWE 4TVPD 5DMKA 4NT6B 2DKUA 1CLOL 5E5UB 1JWUA 4U0RC 4OZIF 5HGHA 3U30C 3QXAB 2M26A 3HE6D 2AQ2A 1ZHLA 4KH2A 2HFTA 4QNPE 4YDJA 2MTPA 3O3EB 2NYYC 3IDJB 1AQKL 1XF5B 2IANB 3IAGC 2EDNA 5F9OH 4HFUH 1H8OA 4N9OB 5BV7L 3WFHB 5A2JH 2LFGA 3ZHKA 1N7MH 3H42L 2PUQT 3EO9H 1NBQA 2NX5A 4HK3J 3UBXB 5C92A 1QR4A 1LE5A 4IRJC 3MXVL 3TO2B 4L3EB 3ARBD 4B7LA 3K1DA 5JLZA 3LV3B 3ZKMD 1WWAX 4HGMA 4NRZB 5DMGD 3TO4B 4CRPA 1FE8H 3GGWA 4FFYL 3U4EB 4YWGH 5E9DE 1PW3A 4F7MB 3M17B 4YBLB 4IRZL 4OGYL 4YHMH 1KXQE 4O5LH 2IPKA 5C0DA 1IE5A 1CIDA 2DQTL 2EDDA 4NQXB 4P23C 1JNHB 1JTOA 4UT6H 4QRTA 5CZVL 2JF1A 4HQQH 4Y4HB 3BZFB 3G6JE 5EO9A 1ZSDB 4XAWL 3F65A 3IFNH 2FEEL 4BH8A 4P48A 4J3VA 5C7XL 3SGDH 3SCMA 1WEJH 3DV6A 5EWIL 1KGCD 4LNRB 3I75B 2WW8A 1VACA 1XR9A 4M1GL 4NGHH 2IFGA 4H8WC 3S36L 1XIWC 3KPTA 3NH7H 5D5MF 1J12A 3I3EA 4LLYA 2J6EL 1WZ1L 5D2LF 5IQ9A 1BLNB 1WFUA 2Z4QA 3B9KA 4JFDB 4MWFB 3P9LA 5EULV 4PJCF 3DRTB 1I1AB 5AG9A 3QHTC 3HPJB 1YEFH 1Q8MA 4XPGL 1CFNA 3G08B 5FDYA 4KTDL 3DRTA 4DN3L 2P8PB 1TQBB 4GRWB 1TCRB 2DDQH 3GSRB 3C2AL 3LKRA 3T65A 3CFIC 4KK9D 4KVNH 5IBUG 2EDTA 4OM0L 1NJ9A 4GQPH 1IAKB 3JUYA 5CJ8A 2MNUA 5DJAB 5L2KD 3FB5B 4GRLA 3C8KA 4P2OC 3LEVL 5F7NC 2XYCA 3R0MA 5HGAA 3KLHD 1BF8A 1A21A 2PCPA 3TBYA 5B8CC 2PXYB 4GJTB 1FL6B 3IKKA 3P0VH 4Y4FB 2X9WA 3NN8B 3EZJB 4M93B 4LNRA 2ZOKA 4WIQA 4CDGC 3VXQB 2YEZB 3AS1A 3LRSB 5AZEL 2P45B 2IQAB 1UKSA 1IAII 2DQUL 3UYRH 5HVWA 2WZPD 1ERNA 5IB3B 3AXLA 3VFVA 1FC1A 3RBGA 3RWIB 3LDBC 4WEBL 2UYLB 4GG6E 4QXGH 5TF1H 4N8CH 4NQXA 3D18A 2F58H 4FA8A 1NCUA 1OP5K 5FM5M 4HPOH 2CK2A 3LKRB 4O51A 4O2FB 1QP1A 4FNLH 3O0RL 1Z0NA 3SQOH 2VTFA 3LN4A 1P9MA 1CDHA 4K55A 4Q6IA 4WVRA 1R24A 4OFYD 2DQUH 5LGKA 4LASH 1T0MA 4H20H 3DURA 2GJ6A 4KJYA 2DJ4A 5D72L 3QUXB 5T3XL 2YOCA 3BGMB 3Q5TA 5I16A 4Z8FH 4KRPB 2AQ1A 3PWJB 2YD5A 3HC4L 1Q9LA 3CLFL 2FO4B 1V7NH 2UWEE 3H7BA 1N4XH 1K6QL 1QSFE 3P4OB 4D0CB 2W60B 3P11L 5IESH 4YDJB 5TE7L 4BH8B 3TT1L 5MHSE 1YUHA 1BVKA 3DX6A 3JVGA 3VXSE 3PJSB 2G60L 4GLRI 5DI8A 3EYFA 5IHZB 4XNQA 2AQ3A 4QRTB 4NBYB 1E4KC 5IOPB 1RULL 4QHUA 2JELH 1MH5A 2XA8L 1CBVH 1G84A 3FQRA 1Y18B 2CRIA 4Z77B 1QYGH 1YPZA 4NCDA 1ETZB 5D9SB 3HR5A 1AGEA 4MA1C 1P4BL 4JR9L 5EO0B 2ZSVA 4M8QA 5HI3C 4RQQB 2Z8RA 2VLKB 1NANH 3Q1SL 1TQBC 1S7XB 4G9FB 5C09A 4ODXB 2ERJB 1HKFA 2ADFL 1G0DA 5BRZE 1I9IL 1NGXA 4J3OC 3RX7A 2OS7A 2QSQA 1LGVA 4TSCL 3GI8L 2NX5E 1ZT7B 3T8XB 2A9ML 3CIQA 5TH2B 4PB9L 2WM0A 4HS8L 3X11A 3F8UB 1UXSA 3A67L 4NUJA 1MRCL 4WFFE 5E9DA 4Y5YA 5ESQB 2CUIA 1KC5L 3Q6GH 1JF1B 3TJEH 3S9DB 5E5MB 2NXYD 3BD3A 3OPZH 3QUZB 4FMFA 4CW1B 3CLEL 3MLYL 3O81A 4QHMB 1M05B 2SEBB 2IPTH 3DX9A 1TJGL 4MDJB 4PGDA 2IG2H 4F2MB 3EDKA 1KCUL 5DLMH 4JFQB 3QJHB 4WW1A 3B8SA 5BXFB 1NBZB 3ALPA 3MGTA 5JORA 1GZPA 2BCKA 4I0PD 1H3XA 4JDTL 4XNMA 4LHQB 1UB6A 2IAMA 3TM6A 3DVGB 1NCCL 5BZDA 5CEYB 2BCKB 1VERA 1ND0A 4HIHB 3RAJH 1IC5L 4PJ9A 3MA7A 2Q86B 4YUEL 5E99L 5HJ3A 4JFDD 4BQ6A 5HYIA 1G9NL 4AT6A 2OM5A 2JB5H 1KJVA 3MMEB 1N5AA 3DUUB 5FO7B 1A3LL 2C4FT 3H3PH 5C0AE 3U6RA 5GZOC 2EDJA 2M8XA 3PWVB 1XGUA 4KGJA 5C0EA 5FK9A 1AD0A 3FO0L 4UU9B 3KPPA 5HPOA 4JN2A 4NC0B 4NJAL 8FABB 2IANE 2YUZA 2QTEA 4KRPC 4F33A 5CJBA 1S7WA 3QQ4B 3KJ4B 2H2SD 4JZOA 5IM7A 5J3HC 3LH2L 3SDCC 4PS4L 1FNSH 1I9RL 3IB4A 3R4DA 1QBLL 3VWJB 4UB0L 4P46A 1FO0L 1RZIB 1X5JA 2DYPD 1CFVL 3JBG7 4J3XA 5C09B 1G7PA 1F11A 3T0EC 3UTZB 3VFUA 3OR6B 2CJUH 4ZFGH 2O5YH 4RAUA 1TLKA 1CICC 5DRXA 4DGYH 5D9SA 3IDIB 5TE4H 2BMKA 1QBAA 1JGDB 3QIWC 3VW3L 5E08L 4M3JA 1RJLB 4JG1L 1A9EA 7FABL 1TIUA 1EO8L 3F6LA 4OZFB 2ED8A 1F97A 1YQVH 1FYTE 3UDWC 2KPNA 4AEIH 2H2SC 3MNVA 3QIUD 2IAND 5IOPA 1CL7L 2IEPA 4KRNA 5DO2C 4PJEB 5JDSB 4F37F 5BO1H 2O5YL 2D7MA 1IKFL 1DP0A 1VFMA 1IGML 4WHYG 5E99H 4KJWD 3P4LA 1N0XL 2CRMA 5FYLD 5DUPL 4OCYH 3RWGA 4ZUSA 5T3ZE 4P9MH 3KPMA 3KS0H 3SDAA 1EMTL 3MXWL 2YKLH 4U3CA 1BAFH 1UA6L 2MFNA 4FQIL 3D9AL 4J1UA 3MJ8A 1DQDH 3CVHL 3VXMA 2CDFB 2D9QB 1FORH 5HHME 1TZIA 3W9DB 1PYWB 1R24B 5MERA 1CXHA 3NCFB 2BSSA 1D9KD 1F8TH 4JRXD 3RNKA 43C9A 3X3FH 3MBXH 2DM4A 4LK4A 1I8IA 3QFJA 2D7OA 2V17L 5TQ0H 1MI5A 3B9AA 3L3GB 2D4DA 4GBXB 3RKPA 3MRJB 1S5IL 1FO0H 3CMOL 4I3GA 4EBQL 2FECI 1QNZH 3IDXH 32C2B 4YQXH 2JCCB 4AG4L 1CXFA 1A3RL 1NUFA 3SBWC 1E4KA 4K8RD 1KCKA 4M9PA 4PGCB 3FMGL 2VDML 1N3NB 3INUL 3LPGA 5M95B 4N90D 5JXEA 3CSYA 4HDIB 1UFUA 5DFVD 3L3DA 1WLHA 2KQNA 1FIEA 1OTSC 1X4YA 5SX4I 2A6DB 1J5OH 1EO7A 5ISZE 1TENA 1R3JA 2A73B 4LCUA 1YEEL 4Y8AA 2FSEB 2VXSL 2DS4A 3NAAL 4L4VE 2D0FA 1LO2L 4UTAL 1DCLA 4H5SB 3SDCB 4U6HB 1NFIB 1OGAD 2A38A 3C8KB 3PHOA 1ZT1A 3PGFL 2Y4SA 3IXTB 2P1YA 3N50A 4PG2A 2G75B 4CU7A 4IRJD 1DQTA 1RZJL 4KK6C 1A7NH 1FZJA 5HD8C 4FQ1H 4NUGH 4M5YL 5HVHC 3FOLB 1QQDA 5JO5A 1E6JL 4X9BA 3O6ML 2B0SH 5C0RH 4Y4KC 1XZ0B 1X5AA 3LKPB 3HPJA 2LVCA 3WD5L 3RWJB 4J8RA 1OP3K 3BD4A 3D69B 4DGVL 1V7NL 3OXSB 1TITA 5T1MA 1GGBL 4G8EA 4BZYA 4HPYL 2AKRA 3KG5A 2EE9A 5C0IA 1AO7B 1NBVH 3GMNB 4PLJC 4P4RA 4Q0XL 4G43B 1H3PL 1W72H 1JGLL 4JFPB 4L5FL 3T2OA 3MFFB 4NFCA 2IAMB 3LB6C 4XGZA 4ZQKA 1ZGLP 5EOQL 5D1XC 2CMRL 3GMMA 3KXFB 3T0EA 1EGJA 1XGYH 4R4BA 3W2DH 2YK1H 3QPXH 4BZ1H 2NYYD 4F37K 4TNWK 2A9NH 4KTDH 5EBWB 5SWQA 1MJ8L 2Y7QA 4GKNA 1JPGA 1SJXA 3FJTA 1CT8B 1JK8B 1K4DA 2V7HB 4WO4A 2HWZL 4QRRE 5C0BE 3P4MA 3L3KA 4YHLH 1AXIB 5INDA 3DGGA 3O2DA 4WFED 2HKFH 4RMTA 3N1QC 5F44A 2X4NA 3RL2B 2NZ9C 4J4PA 4KUCD 4NBZB 1Q0YL 1DQML 3BPCA 5T3XD 4Y5YB 5ALBL 5ESQA 1MFCH 1HHGB 1KV3A 4PRDB 2FBJH 3DTXA 2VZSA 1YEEH 1HZHL 3GIVA 3F58H 3CCHB 1FBIH 3PHQA 2VKWA 4XB7A 5FO7A 3U6RB 1KCVL 3LIZH 4NOFA 3DVFA 1VKXA 3UX9B 2OR9H 4XBPB 3KPSA 3B9KC 4YE4H 1F90H 3O2WH 1ND0B 1GXEA 3WFHA 2CQVA 2NXZD 1KIUA 1X9QA 4RGND 3PWNA 1DQMH 2CLZB 2GYSA 4PD4J 4X8JA 2XTJC 2VL4A 1GZPB 2FR4B 1A7RL 1NMAH 2GSGA 1VFAA 5C9KA 1F6AA 2C7UB 5CILH 3IDMB 3UO1L 4O2CA 3I2CH 3ARYA 1QOKA 1FFNA 3RL1A 4UOJA 4ZXBB 5DMKB 1BM3L 3MUZ1 1INDL 3SKMA 4ZXBA 1G6RH 5HDBF 4U1IB 3DX7A 1RUPL 3ZYZA 5C0GA 4DCQB 3VGFA 1INQB 1P4IH 1BEYH 3T3MF 1N6VA 1CTOA 1VFUA 5EA0H 3VXMD 4Z7UE 3BIBX 5CILL 2DQJL 4R97C 1IM9D 3C8HA 4G6JH 1ORSA 5AZ2H 5KZCB 2RR3A 5GRXG 1ZHKA 1MLBB 5BRZA 4OZHA 1RFDH 4FQQB 3NCJH 1RUAH 4XCEA 1JPFA 5GJTH 5SWZA 2H1PL 4WV1B 3VGBA 4M8QB 1HCVA 1U36A 3CCHA 1OPGL 3RTQA 1UJ3A 2XA8H 3SPVB 3ARQA 5IBTH 1M7DA 1HZHH 2EH8H 3WFZA 5C0FB 2YPLA 3CZFB 4FZEL 5DD5L 4NM8L 2LABA 2HTKD 2E9IA 3FB8B 2NY4C 4JQVA 3VGAB 2ATPB 4E5XB 3MRHA 2F5BL 4O02L 2EIDA 1X6LA 4JREB 5DJDB 3D85D 2UYLA 4S1SL 2JKXA 2CGRL 2H8PB 5EORL 1K4DB 3QQ3B 3MLZL 4OLYH 3MRDB 1LP9E 3VRIB 4UTBH 5JHLL 2YD6A 4U0RB 4ZODA 5HDQH 4YR6A 3JVGC 3QO1A 1URLA 1DTUA 2LE9A 5C2UB 1AHWA 3LKNB 3BQUC 3RY5A 1BQHG 1UENA 3MR9A 4TSCH 3LQAH 4EOWH 3MV7D 5C07E 2AK4B 4Z9KB 5TGBA 3ABZA 1Y6MR 4ZPVB 5E6IA 1H15B 1KNOA 2E7MA 4JFEE 4JFPA 1S9WA 1UCBH 2F5BH 4FRWA 1PG7X 5MENB 3B43A 3TT3L 4GOSA 2CR6A 1WITA 5MEOA 1K8DA 4HH9A 4Z7UB 1QFPA 1OQOA 3MSPA 5BQ7B 1IKFH 3ULVH 1HHIA 2Z93B 3BAEH 1T3FB 4IRJB 2E7LA 3GJFK 3P3YA 1F58H 5I2IA 3GEWB 1M71B 1I7UB 1FZJB 2V6HA 1YMME 1CE1H 2YXFA 5D6DC 5GXBB 3SKNA 2NY7H 5F7UA 2C5DC 1GGTA 3BW9B 4S2SB 3RWIA 3KDMA 2DYPB 1NCCH 1DBBH 4D0BB 4IMKA 2WWMC 2I60L 1YQ2A 4Y4HC 2DTSA 5KSUB 4NZUL 1U3HC 2PNDA 1ZA3A 3BKJH 4M61B 3DMMB 3U36A 4X0KB 1E4WL 2VDPL 1RQ5A 3PIQA 5EOCJ 3FQNB 3DV6B 5I8OH 1OP9A 4LQ1A 3OAZH 1NL0H 4RCAA 2Q8AL 2ARJA 4MCZA 3IVKA 1YN7A 4J7RA 2BY3A 1WQVT 2JJSC 1S7UA 2IGFL 3TBVB 1LO0L 5B8CA 6FABH 5EUKB 3QEQB 2P24A 4ZAKA 1RUML 4DWHA 4IMLA 2Z35B 1MFEH 2CLVB 2ESVD 5I1GH 4LRIC 4HAFA 3AMKA 1I3GH 4HLZH 2AJ3B 3TH3T 4Y5VB 2YPVH 1U0QA 2BSSB 1UVQA 5JXED 2VL5B 2D7NA 4KTEH 5DS8A 1FZOB 1NC2B 3KR3L 1F3DH 1JHLH 5DD3H 3Q2CA 2OQJB 5I1LA 4R7NA 3B83A 3F62A 5GISH 4KQ3H 4UNVA 2KQMA 4EI5D 3CPLB 3QEQE 1R3LA 5JTWA 1BQLH 3OGOE 4MA3B 4I0PA 2XKSA 4OF3A 4PGEA 4JRYE 4F8QA 1Z3GH 1RK0A 1KB5H 2CKBL 1IZJA 2F53D 1ZLSH 4OCSL 5DC0A 3VFWA 4XC1L 3MRLB 5TQ2L 4PJ7F 1UCTA 2WUBL 5FM4A 4JG0H 2ADJB 4BZ2H 3BQUA 1I8MA 5IJKA 4RWYL 4BQ8A 2Z8SA 5GGTH 2H2PC 3H8NA 4LRNL 3VXUA 1DDHA 5MEQB 5BO1L 4ZFOA 2FL5A 1OAUL 3QP3A 5D2NC 5HYQA 1KIPA 3LDBB 4JKPL 5DEGA 1V3JA 3L5WA 3WDHA 5H2BB 1UYWH 5EU7C 5D8JH 3EBAA 2ZCHL 2G9HA 3ARDA 3MQIA 4EDXB 5DQDH 4XCYB 3VXPA 1M1SA 5M94B 4PJAE 3BZEA 1KJ2B 1DUYB 4QRSB 4F15C 4MD4B 1SJEB 4PY7B 4V1DA 4LF3A 4PJIB 3C6LC 1UXWB 1MCFA 3NABL 1SY6L 4RNRA 3JSSA 3QZWB 4HS6A 4JFYA 5C09D 1XAUA 1BWMA 1KLFA 3C5JA 1EZVX 1BBJB 5SWZE 4YZFE 1LNUB 2PO6D 1DLHB 2WQ8A 4XXDA 3RVVD 1IM9A 1G7QB 1O7SA 5FYJE 2J6EH 3SDXF 3WFEH 2FNBA 1JF5A 2JCCE 3EYVB 4OAWB 4BFIA 4ZG1A 1D6EA 3LN5B 3EO9L 1X5YA 2XZAH 4LCIL 3WLBA 3DMMC 3FQWB 3H3KA 2EIEA 4HKBB 4UU9A 3HAEH 4G3YL 4OBRA 2F19H 3RVUD 1ZKAA 5FA4B 5J89A 3LY6A 3NGBB 4YK4C 3DVIA 1Z2KA 2XNAB 5E7FA 5K59F 3L5IA 2VR5A 4XVJH 4PFEA 4ZTPL 5FO8A 4L9LA 4QY8A 1Q72L 5IMOA 1D5BB 3WO4C 1NSNL 4LPXA 5EBMA 2EDBA 1MCBA 4L9LB 4QY8B 1LK3H 3MLTB 3MODH 5BXFA 5FYKU 4P4KC 2VDKL 5MEPB 1HYRC 3P4NB 2ICWJ 2IJ0C 1KOAA 1XF3A 4G6KL 4U1NA 1I1AC 1OD9A 3ZE1F 3T3ME 1QKZL 4HK0B 2A74B 5E2UH 4P57B 4Y4FC 2IALB 5C0BA 2ADFH 3ARPA 2NY5L 5HHQA 1IL1A 3X14B 1C5BL 3DVNA 1ADQH 3TN0A 4MDIA 3MV7B 4RDQF 5LBSL 1Q1JH 5I1JL 3PF2A 4PJIE 1AY1H 1MCLA 5HGDB 4U6VL 1AFVH 2BVYA 1FRGL 3BP6B 5CINL 2ADIA 2UUDH 5D5MA 4NRXA 2QADD 4NZDA 4NZTH 3C2AH 4U2ZA 4L3CA 3HI6L 1YEGL 3HZKB 4KMTL 3LS5L 3UJIH 4JO3H 4YHML 1OPGH 3GMQB 3ZYJA 1A4KA 3UXFA 4X7FC 4P23A 3ZHLA 1PGRB 1NCAL 5K9KA 2Q87A 4PJ9C 3QNXB 3RVTD 5EU4B 1S9XB 1AY1L 3O2VL 5KW9L 5D71H 2AXGB 2H9GA 4OV6F 2R15A 5LG1A 3UMTA 4PRHB 1YPZB 5F7WC 1PLGH 4U1JA 4HWBA 4Z7WB 2Z31B 2VH5L 4ELMB 3GK8H 3UTTB 1JMZA 1CYGA 2L7UA 1WBYA 5JW4Q 2XZZA 3GMPA 1F5WA 3VRLF 3HE6C 1KN4H 1DN0A 3BE1H 1T0NA 3EJYC 3J8F7 3QIUA 4IRSB 1QFWL 1D9KA 4PD4K 5ICXA 4PP2B 2HP4A 1BVKB 2Y25A 1IT9L 1KCLA 1TXKA 1DUZA 2GT9A 3VXTA 2B1AH 5B4MC 3KYMA 2ORBH 3QIBB 1HHHB 3RKDD 4DQOL 5FA3A 1PKOA 5FF6B 2K1MA 1ZOXA 5DD1H 4PRNA 5T1DL 3V4VL 4I2XE 1I7RA 5KTEL 2ICEB 5IEKA 2DI8A 3RUGF 3O6FA 4I18A 4X6FB 2XRAL 3DRQA 3FONA 4LSPL 2F54B 1DQQB 2XQYG 4LPCA 4WO4D 4YDLB 4Y88A 1GC1L 5HHOB 1FL3A 5C0AD 1UH2A 1RIUL 1FSKC 4U7KA 5E8EA 4R26L 3ME0A 1A2YB 2EIZA 2H6PB 5FKPA 3T4YB 4CVXA 4WHTB 4M9OA 1SMAA 1NCDL 5F7EL 2QHRL 2QQKL 4G42B 5DEZA 2IFFL 4DUXA 1U8MB 3S6CA 2Z35A 1U8IA 2AI0L 5TE7H 3GFUA 2CDEB 1CWVA 4ZS7H 2V5SA 1XH3A 5EBGA 4Z5RA 4EI6B 4P4KB 3PDOA 2ITCB 1X5IA 4WI2A 5F7LB 3TBVA 1QLEH 4KVCL 4HUVB 1MHEB 5GHWL 4MA1B 3QO0A 1JNJA 2QKIB 1IM3A 4MYWB 4NNYA 1CU4H 1XF2B 1WWBX 2VQTA 3S5LG 3QUZC 3S34L 4K71B 2R2HB 2ZP0T 4IDJH 4KAQL 3FT3A 4BH7A 4PRBA 1G7HA 4R4ND 4IBLT 4QRRA 5JA9A 1OTTD 1JPST 4JDZB 4K94H 1G7JB 1CZ8H 2CRYA 5DRWA 3OKEA 3UTSE 1OLZA 1KJ2L 5K9JH 1JZ4A 3MLXH 2YSSA 3GSNL 4TVPH 4JFEB 2CGRH 2VLME 1NLDL 3FQTB 2G5BB 3UZVB 4MS8C 4FXKA 5B3JE 5A2FA 1FO0B 4KROC 2BY2A 1LHZA 3S4SB 5MENE 3CK0H 4I3SH 4A2MA 3A6OA 2D4FA 4JHAL 3VXSB 3SDXA 1MRCH 5HGBA 1F4XH 4ZPTA 1V05A 2FBOJ 3GMOB 3ZHDA 4X6CA 4I9WD 4YFLF 3WFCL 4JRYD 4OV5B 1AGDB 1FVDA 3QH3B 2HFFB 4JPWL 3WS6A 1YN6B 4WCYH 2QJDA 5TGBB 3BKCL 2P43B 2VXTH 4RIRB 3P40A 2VRAA 3VFGL 1GHFH 4HT1L 1V7ML 2P46B 3QUKA 4UQ2B 2HLAA 5D2LE 4MVBD 3U0PA 4GAGL 4PLKD 4PREB 1KENH 5EBLB 2D7TH 3WDJA 3CU7A 1MPAL 4XP1H 5EO1A 4AENB 1R5VB 1ZHBA 4U1LA 4P2OA 4XZUA 3CXDH 4HV8A 4ZUVA 1F4AA 2E8YA 4WCYL 1T1XA 4KJQC 1P69B 5DF0A 1EIBA 4YBQD 1FN4B 5KOVC 3TO4A 5DJCA 3EOYG 1MCSA 5IP4A 5ADOL 1U6AL 3EJZC 5IBUB 2HFGL 5FYLH 2PO6A 4EI5B 4NKOB 5DUML 2DKMA 2QEJA 3G6DH 4NJ9H 1BQUA 1LO4H 4LMQE 1QPXA 5F9DC 2FZ3B 3TLRA 2JELL 4X4YA 4R3SA 1J0KA 4CN6A 5LGJB 3HC0A 3D5OF 3B5HA 4FQPA 4PJFA 5GS1A 1J7VR 1HQRA 4G80A 4TULH 5AZ2L 2C4XA 4GQ9H 3W9EB 1ACYH 4BA8A 5HHNB 4NN6C 3AU1B 3TZVB 1R3IL 1PX3A 4YJZL 2OL3H 3MX0A 2HG5A 3OX8B 1ZS8A 1DQJA 1T2QH 1A5FH 3BSZH 1YMMD 2X1PA 2MMXA 1CLYH 4KROD 5I6XB 1NFDE 4KRPD 3GHEH 2VLRA 4N5EC 2KKQA 4KDTA 1RVFL 2X4TA 4BQ9A 1CDJA 2P48B 3T0AA 2HKFL 4EXPX 2DBLH 3O9WB 3CNKA 4KQ3L 2VABB 5DXWA 3X17A 2QQLL 1I4FB 4MSWA 4BUGA 5HYSA 4HZLB 1P4LA 5LCVL 4O58L 3GBNH 1FNEA 2NY2D 1MFDH 2ARWA 3EOAB 1EEZB 3HRZB 1OW0C 5CIPA 5I71B 1FP5A 1MREL 3B6SB 2Z9TA 1N6QH 1T04B 2FH8A 4XVSL 3MJ7A 1UCBL 1A0QH 5ESAA 2I9LA 1H3GA 4NO3A 4PRDA 1KFAH 3ZT5A 3HZVA 2YUVA 1YMHA 2C3GA 1RUQH 1JGEA 3O11A 5CSZB 5JZ7D 1HE7A 4PB0L 5EPMB 3OWEA 4PJ8B 2NX5D 3JWDL 3O6KL 1IQDB 2WIMA 4K8RC 2WIIB 3O2VH 4KI5C 4HIXH 4XAKE 5KW9H 2VXUH 1KELH 1E27B 2AABH 3MNWA 5JW4M 2CKNA 4X4XB 3HUJA 3CVHB 4GW5B 5BJTB 2OL3L 1NFDA 5HVHB 3QSKB 2GW5A 3QIWD 4LARH 2OTWA 2VLLA 2OK0H 1C08A 1L7TL 1RULH 1Q9WA 3GIZH 4S1QL 5FB8A 4PTTB 4YC2C 5EN2B 4NPYB 1VB9A 1DQLH 3L1OH 4H8WL 1IMHC 3V79C 1GGYA 2VDRL 1AP2B 4N8VB 4Y19E 3KJ6L 3BHBB 2VJXA 3G5VA 4ZUWA 3WV0A 4C83A 3BPNB 1W72A 1IGYA 1A6ZA 1N26A 5GJSL 5KVDL 4QRUB 2XZCH 5EZJA 3RDTD 4I77L 5K9OA 1V5JA 5IBTL 3BVNA 5F96H 4JREC 1P7KA 5E1HB 2OSLB 3O3BB 1OP5H 4RMUA 4EIGB 4QHNA 4YFLI 5AD0A 2OCFD 3QI9D 3MRPB 2B0SL 4HS3A 5C0RL 3DOSA 1L9MA 2JJVA 3P0YH 4Y2DA 2R69H 3O4LA 5BOZG 3L3DB 5EORH 2N4IA 2GITA 3UTTD 5KVDH 4KHXH 2DIBA 4PJHB 4UOW1 1KIRA 4DKFL 4XWOD 1FVEB 1N5YH 1WFTA 3FOMA 4AEHH 1KB5A 3OAZK 1TJGH 3RQ3A 1CI5A 4NRYA 3L7FB 1OGTB 4OLXL 3KYOA 2W1NA 32C2A 3U9UB 4XAWH 3MREB 5IFAH 3STZA 1NGQH 4NQVB 1MWAL 1O0VA 2HVJB 4UTAH 4Z0XA 3RNKB 1FJ1B 4DZBB 4JRWA 5EIIA 5TE6H 4BQCA 1PYWA 2EDLA 1WZ1H 3QWOB 4H25B 5KVEL 3NBNA 3SKJH 1F2XK 3LEXB 1S9VA 3ARGD 3VFOB 1OLLA 3IFOB 5F72S 4QOKE 2F54D 1T4KA 2YD3A 4N0YH 1ZXQA 4Y5XB 5ABDE 1C16B 4N0CD 5LKNA 1WBZB 2GY5A 1IGIL 1TVBA 5KAQG 4NQCB 4JB9H 1S3KL 2DDQL 1CFSB 1ZE3C 4M62L 1VEPA 5JOFB 4Q9RL 1J1PL 5HD8D 3OHXA 4QOKD 3OF6D 3G9AB 4IIQA 5ITFB 3P30L 5I9QC 1NAML 3BKJL 4K7PX 2PETA 4PS4H 1IAOA 1KTLB 2NTFB 4H1LH 1OF2A 3V6BR 5ADPL 2HMIC 4FHBD 1L9NA 2DLTA 4QXTA 3WHXA 2VLRE 4GXVH 3D3VD 1FLRL 5GGRY 3WE6A 1R0AH 1D5XB 3I50H 2BP3A 4MNQE 1CLOH 4XVTL 5T1KB 3D48R 1CGYA 5CJXC 4H88H 3MRQA 3PV6A 1BFOB 5D1XD 1SQ2N 3VI4F 3U0WH 1KGCE 4O02H 4QCIA 4MJ6B 2AJVL 2P4AB 1H5BA 3FQUA 5TE4L 1F4HA 1VGEL 4AM0A 3V6OC 1JZ8A 3BUYA 4FZ8H 2VXVH 1AXTL 4GW1B 4JPIB 1DVFD 1KPVB 3RZWA 1GC1H 3MLRL 1IEHA 1N8ZA 5F89B 4DFIA 4N90E 1T2JA 2A83A 2Y06L 1RZ7L 3FZUC 4M03A 4MCYA 1Q72H 2NNAA 3VCLB 3KNBA 1GGBH 2VQUA 5DRNB 2LVEA 5DJ6A 1OOAA 4AIZB 5K33A 4JRXA 2R4SH 4XCFH 4WFHE 3MRBA 3G6DL 1NGYA 5IGXH 1IFHL 4BSJA 4Z8FL 2FEEI 2GJZB 3STLB 1JZ3A 1EEYB 1T66C 1CVSC 5I0ZA 4YHOH 4KKAC 1YEIH 1I8KA 3EKCA 5DWUH 1U8JB 2VDOL 4JM2B 4MVBC 4TRPH 1WZKA 2HVKA 4ONGH 5EC2A 4AT6B 1OTTC 1OTSD 5CBAA 3WFDL 3QEUA 2R23B 2HN7A 2W0FA 2O5ZL 1U8NB 5CCKL 2X7LA 5J6GB 1FYTB 2GTZA 3KVQA 5D7LD 3MRCA 2Q8BH 3MOBH 3RY6A 1WCBA 4KJQD 3EO1B 4ETQB 3ROLB 1U3JA 4Y2OA 4KTYA 4TVPE 3SKOB 3PGDA 2PF6A 3G9VA 4APQA 3TA3D 3H0TB 5T33H 5KG9A 1U92A 1IKNC 5GRYA 1OQXA 1OVZA 1HHJB 4JM2D 1ITCA 3JXAA 4PRIE 2FJGB 3QDJD 4R4NC 3EOBA 1PDKA 3IU3B 2E9WA 1QTYT 5CEZD 3IJHA 1LK2B 3VXRA 5I75C 3NCJL 3I6LD 2R0ZH 4ZFGL 2J8HA 4WFGE 4FQJH 4OIAA 5CEXB 1LILA 3DXAB 3MLVH 1QBML 3RWDB 3FT4B 1EHAA 3B9DA 4OF6A 1WIOA 1A4JA 1FGVH 3BIAX 2Y06H 2VMFA 2W07A 4Z7VA 3TA3B 2JB6B 4XP4L 4G8FA 4K3JH 2FRGP 3KLSA 4YNYA 2OP4H 3L3OA 3VU2A 5IG7B 1CXIA 3HLAA 4X5XB 4PP1C 4PJBA 4R90L 5DQJB 2WLYA 3DPBA 1TJHH 4XPHL 3SY0A 4S10A 3QHZH 3WCYA 3LCYA 5FHAL 2FD6L 5J1SC 3TJEL 3ZE2E 4ZFOL 5J9PA 3H9HA 4NUGL 2WBJA 3K7UA 4HFWA 1YNLH 2Q6WB 3I6KA 5T1LA 3RI5F 1MHCB 2XZQH 1NDGA 3FTGB 3WN5A 2UWEB 5GRUH 4NNXB 1KBGL 4KPHH 2KH2B 4EDWL 4ONFH 2BC4B 2C3WA 2J88L 4ONGL 2DB8A 4XCNB 1YDPA 4RGOH 4RGNE 4R26H 2OR8A 1NUNB 2FIRT 5DJ2B 5FUCE 5L9DL 4DVBA 1J88A 3RJQB 1T66D 2FD6H 4P9HH 1S7TB 4M6MH 4RFEA 4OBSA 4NQSB 3RTQC 5CD5D 5SWSB 1BFVH 1C12A 1YPZF 3LHPH 4O9HL 3PP4H 3AREA 2A0LD 3EIFA 4POYA 5C8JA 4P49A 3EYUH 3KAAA 3S88H 5EZLA 2VLJB 4K9EC 1SVCP 1FNGA 1GIGL 2MJWA 3WKMH 1AQDB 3V52H 4HIIA 3E2HB 5T3XE 5C9JB 1T03L 4PBXA 3EHBD 4XBGB 3ARXA 4WI9A 3N06B 3DXAE 2EE2A 4QXUL 3DX8B 5JXAL 1A6WL 1T89A 2VDQL 5DDHB 3B2VL 3QIBD 1PD6A 3OSKA 5E70A 1MAKA 4AEFA 1FZMB 2R2EA 3QCTL 4P5TB 3LOWA 4KMTH 3ARGA 4UBDC 2RIKA 3P11H 5IESL 3F7YB 4I5BB 3KPLB 4NSKA 4YXKH 1MFAL 1OP3H 1IRAY 3TH2T 4FMKA 1D6VH 3DSFH 1A6VL 1FZKA 4M6OH 1ZHNA 2G60H 4F80A 4H1LG 4PY8I 4PJ5D 1AGFB 2W65B 2DBLL 1XGQA 1IC7L 1MHPL 4GG8A 5GGQL 1ZT4B 3MGOB 2DOCA 3LKSB 4O58H 3MRGA 5DD6B 5TDOA 3DBXB 3TBTB 4JFFA 3CDGA 4Q74A 3ZE0F 2EDXA 3DIFA 4ZDHB 3HPLB 4OFYA 1MNUL 4HF5L 1B2WL 2CSPA 3V8CA 3TIEB 1HIMH 2F9BT 1FDLL 3N85L 3HUJE 3ULUC 3QIBC 2X4UB 3MPCA 2OTUA 4S1RL 1X7QA 1QRKA 5EOCH 2FHBA 2J3SA 3O6LH 1G9MC 4HUXB 3UCRA 4P9HC 3PWPE 2PO6C 3GI8H 3MOAH 1P4LB 2ICES 3RJDA 3EGSB 5DFWH 4JFOB 5HYFA 4GRLB 1S5HA 3S4SG 1F3JA 3RWCA 5HDOA 1NBYB 2GY7B 4L4VD 2EYRA 1WT5A 3C8DA 4QEGA 1WAAE 3SKJL 2WV3A 4Z7VF 3QXDB 4OFPA 2C1PA 1OSZB 2E8ZA 1TVHB 4EVNB 2A77L 1KEGH 3NFPB 2DI9A 2F8XC 5TQ2H 1G7LA 2CUMA 2FDBP 1Q1JL 2EDOA 4UDTA 4YDVA 4Q9RH 1RUAL 5GJTL 3C60A 1ZGLM 3GSNB 1F4YL 4WFHD 1GOGA 5FDWB 3GBMH 1ZEAH 1P1ZA 4N5ED 2GEEA 3Q6FA 4AZ8A 4OCLC 5GSRA 1JHTB 5LVEA 1YY8B 4AH2A 3B3IB 3SHSA 3O4LE 5E6ID 3BH9A 4P2RD 3KJ6H 4DOHB 4KTEL 4FTVA 4JRYB 3X13A 2APXA 5LQBL 1J11A 4Y4HA 3X3GL 4OJFL 4U1HB 3QG6B 1EX0A 4Y4KA 4Z18A 3ULVF 5ELIA 2H32B 4Q58C 2FLRT 4NQDB 1ZEAL 1KLUA 4I48B 5J7CC 1DJSA 2J5LC 4URTB 1G7MA 5DYOA 4XT1C 3B8YA 4EUPB 1MWAB 1I85A 2GCYA 3DXAD 1ZGLB 3VFPA 4L4TE 1LDPH 5HHMB 3KPRB 3PWPA 3L7EA 3GI9L 3C6LD 4XNZB 4OCRH 3MJ9A 4OZFH 2BSTB 4XWOC 5HHPB 3QDJA 4ZTOH 3BO8B 5C08E 2YR3A 4NWTL 3SKUD 3L5HA 1A7PL 3NPSC 1AI1H 3K81A 1YJDC 1FG2A 1FIGH 2E27H 2ESVE 5D1QB 1MJ7L 4U3XA 2QQLH 1YEHL 1ZA6A 2QADB 3HTLX 5J6HB 1LDPL 1A7NL 2EC9T 3FO2A 1YEGH 4NCC2 3WIIH 3BKMH 4LLUA 3SBWA 4FQCH 4HUWB 5JMRA 5HYEA 1WGOA 3GSNA 2R1WB 2JE8A 3S37X 1H3UA 1GPOL 3KGRA 4K3GA 3H2WA 1MREH 1UKTA 2AJZA 2BNRA 2AXFA 2AJYL 5C1MB 4PB9H 4HPYH 3KPNA 3MV8D 3LB6D 4I0KA 4KI5F 5EUOB 1DE4B 2ILLA 2C3VB 2BJMH 3T2PA 1D5MA 3CSPA 1LE9A 1A7QH 1YJDL 2BNRD 4PY8J 5CHNB 4PJFF 3RWCB 4R8WL 1I7ZA 1KYOK 2LAAA 3BOVA 1XIWB 5E2WH 4X5WA 1MJJA 4HKJB 4TVSa 5HI4C 2P5WB 1LO5B 5L88L 4KKCD 5JPNB 2R0WL 3JV5A 4JY4A 2YPLD 3I6LE 4GKSA 5IEHB 3Q48A 5C0JB 1NCWH 2ERJC 3ZLQC 4YDLC 1IAIH 3V5DB 3MBEA 3O8XA 1KCRH 3GJEB 3PWUB 2DM7A 2VSDA 4NKDA 4P59H 5C08B 2Q76A 3NH7L 3PDDA 5DMGC 5E8PA 5E8NB 3WJLA 4JQIL 5E2WL 4JFDE 1R3KB 3PABB 3EO0A 5FUOH 3RGVD 3O45B 5C0AB 4ODWB 1MFBL 3GMLA 3P9MA 1XGQB 2OR9L 1K8IB 4ZNEA 1U8MA 3WN5C 5DK2B 3E8UL 3V7MA 4FZ8L 2FIKA 2AV7A 1BECA 2C1OA 4LPUA 4Z7OE 1K85A 2B5IC 3W0WD 1A64A 4XPAH 1BZ9B 1MAMH 2XZQL 5C70A 1U8LB 1RZ7H 4K71C 2MCG1 3W39A 4Y19D 1A1OA 1JWSB 3UBXI 2PN5A 4F7EA 4WI3A 3A6BH 3DX8A 2XXMB 3L3HB 4R96A 1J8HB 2GFBA 2VC2H 2AGJL 2HJFB 2WINA 3GKWL 3HNVL 3DROA 3LQZB 5EU5B 3NVQA 3OJDB 4KRMB 4NKMA 3CDFA 2MKWA 5FO9A 5IT2H 2R69L 3ARFA 3SJVE 2OI9B 4PJGF 3HC3H 2AEIT 3ULVE 5J11B 5F7DB 4IDJL 4DGYL 2BZDA 3C5ZB 4PRIA 3T0DA 1KACB 2N1KA 4PP2A 2NZIA 4ZOEA 5D1QC 3O3AA 1S7SA 1SEQL 2YD8A 1RZFL 1P5VA 4N68A 4ODVL 1U58B 3E3QC 2QADC 5KSVA 4HKZA 1BZQK 1YDPB 2XWTB 4S0SD 5CBEA 3T0XA 1CDCA 4APQC 3D0VA 1A6TA 4U1JB 5IW1A 3IXAB 4EN3C 1MHCA 4WGVB 5TE6L 3V0AC 3CK0L 4I3SL 3PQYD 2ICCA 4HC1L 1WBXA 4L4VB 4MMXC 4UZGA 43CAB 4F7CA 2R39A 1MFNA 1QSEA 2JLLA 3ZKXB 4C4KO 1G9MH 35C8H 2CDGA 4Y16B 5CD3B 2DWDA 1A6VH 2W0LA 1T1ZB 4S0TD 3MV01 1MLCB 4P9ML 1EO5A 2X10A 2HFEB 5T3XH 2AJSL 4XHJD 2GTWA 4ZSOB 1DFBL 5E03A 4Y4FD 1ADQA 2QQQA 4KKLC 1IZKA 2DQFB 1QVOA 4JJHA 1NCNA 4OGAD 4JFFD 1NMCB 4M62H 5I17B 2P49B 2DMKA 3BP6A 3MLVL 2Z91A 1BJMA 3N9GH 3QT2A 5L7XL 1TMCB 3JV4A 2FJFB 2K3TA 3RA7H 5IROA 3UTPD 5CMAA 3KLAA 2VIRA 3VMOA 3O3AB 1P7QB 5DHYB 1XR8B 2F54E 3O41B 1UEYA 5ESVB 3JV6A 2R2BA 4R90H 4N0UA 5EB9A 2GIYA 4NQED 1QACA 2UZIH 5D7KD 1A3RH 4YXHH 4JZJA 1DANU 2F53E 1W2KT 1S7QB 2ESVA 4IRZH 4OGYH 5FOBB 2WINB 3CH1B 2R8SL 3MLTA 1SM3L 5F6IB 3DYMA 3DV4A 5E00A 3PNWA 4I3RH 1P4BH 4JR9H 5FYLL 1MIMH 3QEQD 4JLRA 3RVWC 3AB0C 4ZFZA 3BRGC 5FO8B 5DHVB 5IK3B 4Z76A 1I7ZB 1Q9KA 5GRVL 1OARL 1A6AA 2CKBA 4PJ5B 4O4YL 2GUOB 4FABL 1MCEA 1WFNA 2XTJD 2XKNB 3WUWA 5EWIH 5EU7E 3HZYA 2X4PA 2RQ8A 1UH3A 2FHFA 1MQKH 9CGTA 2IBGA 4E41B 2WBKA 1BIIA 1EBPA 3PGFH 2X4OB 1PG7H 3HUJF 5B4MD 5CAYB 2BVQA 4LLAA 3TT1H 3UTPE 2Q7YB 3D25A 4GRWF 1EH9A 5KN5A 3B9EA 3O9WC 1E4WH 4K3HA 2HJKB 5E94A 4XP5H 3OB0K 1MI5E 2X9XA 3O6MH 2VITB 5L2KA 1HDMB 3IETB 4WI5A 3GRWL 1AIFA 3QQNA 4PJ7A 3WDIA 1BQHB 5FM5O 5I71C 3MYJA 1KT2A 1MQKL 5IEHA 4LCWA 4BSWB 2XPGB 3EFDH 2I26N 1S7VB 1VADB 5IB4B 1W72L 1YEKL 4JDTH 3PQYE 2NY2B 3GSUB 1ONQB 4KRLB 3BDXA 2B4CH 4ZAKD 4V1DB 3OJMB 1DVFB 2ADGA 2XXCB 2ZUWA 4BKLA 1EEQA 5E2VH 2I07A 3NZ8A 3ZDXE 4XRCB 2ORBL 2ICWI 4RMVA 2QQNL 4OCXL 3ARDB 1U3HD 3VFPB 4TPRH 1UB5B 2APVA 5F1IA 4IOSD 4RMQA 1TDQA 3MUGB 3BT2L 3EFDL 3FO9B 1NAMH 2NPLX 3IAPA 3V6OE 1LP9B 3JWOH 1NAKL 2PYEA 4MNGA 3T0WA 1SJHB 3L95A 4PJBE 3ULVD 1VFOA 2GAZA 4NZRH 3CX5K 1CFBA 1RVFH 1RD6A 2YZ8A 2ATKB 5KSBF 3QJFA 1WBZA 1KCUH 5DGQA 1I3RA 5BS0D 4ALAL 4MA7H 4OZGA 4XH2A 3KLDA 4R7NB 3RFZC 1SVZA 4G8GE 4XP9L 3OB0H 2G2RB 5DMIL 4NO5B 4XPHH 1NAMA 4FQXC 1TJIH 2V7NA 3UC0L 5I1KH 1BD2A 4ERSH 4CKVX 3BPNC 4U0QB 4JO2H 4OZIB 1GH7A 3PL6B 2IPUK 4Q6YA 2Z92A 3IJYA 4HIJB 2CIIA 1N0LA 3QXUA 3V6ZB 5D7JC 1T20B 3QXDA 4HUUA 2VSCA 3GJFB 4QLRA 5D7IB 5ID0A 5CSBA 1FVCA 1CE1L 2E9JA 2F74A 3KYAA 4MD5B 3KYOB 5DQ9B 5DMIH 3VG9C 1FL5A 1FV1B 4ZS6D 2V9RA 3T1FA 3MJ6A 2B4CL 1XF1A 1CFQA 5SX4H 3IVKB 2X44D 3CLEH 5I74C 1NDMA 3ZE1E 3HS0A 1A14L 4F9LA 3QXTA 1N0XH 3B2UC 4NP4H 1IC4H 4OCXH 2QR0B 5ICYB 1AHWC 1RIHL 4A6YA 1LO3L 5E5RB 4TYUA 3QI9B 1KCSL 1P1ZB 2QHLA 1FFRA 4L8SC 2NXYC 5IHUH 2WK2A 4FQXA 5KVGL 2Q7NA 4D0BA 3JTSA 5HI5C 5FXCH 5L2JB 4M3KB 2FX8L 3LKSA 5AYQA 1LO0H 4NHUB 2EDFA 2BNRE 4ELME 3OKOA 1KB9J 4OZGE 1FAKT 4JM4H 3BESR 4RMWA 5E2TH 3VD5A 4BFBD 3IGAB 2PW1A 1W72B 2C1PB 4JPWH 3K1KC 1WICA 2X09A 3MV8E 1AGCA 2EYRB 7FABH 4JO1H 2P5WD 1U8KA 4F3FB 1TETL 1N2RB 2AEPL 2VDKH 4QYOB 1MIEL 1LEKB 3LRGA 1U95B 1OGAA 1ITBB 1FLTX 5J56B 3HFML 1IQWL 1P6FA 4GMSL 1KJMA 3T2NL 3QQ9C 2JIXA 3M1BA 3RHWK 5I1KL 5SWSE 4KK8C 4N1HB 2ZUQB 4CVZB 2JIXB 4HF5H 3LH2H 1KNOB 5B39A 1PY4A 3K8KA 2ZJSH 4LU5L 1DBAL 3WS3A 3HMWH 3V7AE 1IGJB 4ODVH 1C7TA 1NC4B 4UB0H 4L29B 1TPXC 4ZDHA 4ZYKA 2D31A 2CXKA 4P5KA 1U8HA 3RGVB 1D9KC 4QWWC 3MACL 4K7FB 5L8LB 3D9AH 5J1TC 4J3TA 4RFEB 4KDWA 1S7TA 1X44A 3DHJA 3S5LA 3VFRB 1ORQB 3W0WB 4DKEH 5FUCC 2YD4A 3LKQB 1QR1B 4FOMA 1MQ8A 3HNTL 3MRHB 4FFWC 1FCGA 1HH6A 2DWEA 3FL7A 3GM8A 3LKQA 1QR1A 1J9CT 4MAYB 1G9NH 4OLUH 1E4JA 5D8JL 3RX8A 3UAJC 1PEWA 4OLXH 4MB3A 2ZUSA 3NIDE 4QRRD 3REVA 4PLJD 1HXYB 4JANB 1ED3A 1U8QB 4XP6L 4OFKA 1FGNH 5LGHH 5HHOD 1PLGL 2Y5TB 3C09B 3HI1B 1EFQA 4CBPA 2CO6B 1I7TA 4H26B 5CIPB 4P59L 5BZWB 3BEWA 5ERWB 3BFOA 3HLAB 2EEDA 1RAMA 3QZWG 1K3ZA 4PV9B 3RU8H 4XWGH 2F53B 5HY9B 1PBYA 3MNZB 1X5GA 4KV5F 1I4FA 4MSWB 3CX2A 4KKNA 3W2DL 1EEUA 1I9IH 4MD0A 5TFSL 1B0GB 3V6FA 2HT3C 2N7BA 5LGHL 2OZ4A 1YEDB 3FFCE 4MZ2A 3DECA 2HMID 1VEMA 4WY7H 2YUWA 3RWFB 4X9GA 1BZ7A 4GAFB 1K9TA 2GK0B 3ROOB 3BMWA 4WO4C 3WXWH 3ECBB 4X83A 4M4PA 4Y19A 3GZKA 4OIBA 3QEGL 1IEAB 3K2UL 3RI5K 3RWHA 3SE4C 4NNPL 4O2CB 2V2WA 3PGDB 2C7UA 1EAPB 4K8RL 2V2XB 5DVOA 2EEBA 1PQZA 2EICA 2FBJL 1JNLL 3AS2A 4OD2B 4RAVA 3C87A 3OBAA 4BUHA 12E8H 3NZHL 2XA3A 3V4PH 2EYSB 4XVTH 3VD7A 4FN0A 4K3JL 3VGHA 4P2OD 5DD3L 1IARB 4D9LL 4MXWH 3IS1X 5J57B 3MCLL 4OQTH 2VDNH 3QULA 4B41A 3HNTH 1Q0XH 4F57H 1HILB 3O3UN 4Q0XH 1EK3A 2HT3D 1OB1B 5B39G 4JFHE 5TPWL 5IW3A 3IKCB 4G9FD 2PO6B 1EEYA 4RBPH 1IC5H 2E7HA 1HHGA 4OCSH 3TC9A 4NQTA 3HS0B 5I75B 3MRNB 4GRLC 3OV6A 2Y36L 1WT5C 3UPRA 4YXLH 2AXJA 4TTGA 1EGJH 1KPUA 4MNHA 5FECB 5I15L 4HSQA 4XRCA 4OZIA 2XWBB 3E6FB 1KLUB 4I48A 5DJ6B 1WIPA 3GSQA 4JPVH 2BFVH 3MZTA 4Y7MA 4Z7UF 3QWRA 4QO1A 3RGVC 4RRPA 3TJHC 4DVRH 1JI2A 3FFCA 5HHMD 5ECJE 2DQCH 3KPSD 4OD3L 3SDDA 2O61B 2A77H 5K9JL 4LOUD 1QHPA