2P8PB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide leldkwaslw[n-ac]
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
221
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, and anion-binding site.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords nmAb 2F5, light chain
total genus 33
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p8pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p8pB01
1YEIL 4JB9H 5TF0A 5B38G 1OAXH 3ARGA 3LKNA 3IVKA 3G5VA 5EU4B 4ELMA 2BNRB 4Z77B 1JZ6A 1QBMH 3BX7C 4P4RA 4GKSB 3F7YB 4NBZB 4I4WA 3U82B 5GGTL 1YC8A 5J56B 2IFGA 3LZFL 1FAIL 1N8ZA 5DFVD 4JZNA 2PNDA 3C5SB 3L5WA 1MY7A 3MV8D 5D5ME 2R2HA 3FOLB 3RVUC 3IFNL 4EI5C 1KC5L 4OQ1A 1GRWA 4KMQA 1Q9LB 3MV8B 4LMQE 5AYQA 3KS0J 2OXHA 4LCYB 3DMMA 3MV9B 4OCMC 43CAB 3PHQA 1ZA3B 1U8KA 4ZUSB 1OM3H 4HJGB 2FDBP 3MV9D 1AGEA 3L3JA 3B83A 1JNNH 5FDYA 4QNPE 2VKWA 3ARSA 1KCUH 4NKDA 4OGYH 3GGWB 2JTDA 3LY6A 1G9MC 3AREA 4DGYH 3C60C 4EEEA 3GMRA 1YMMB 2Y36L 5SWZA 4FTVD 3V7MA 4D0CA 4JVPA 4HZLA 3QXAB 3L1OL 4Q6IA 4GKOA 2W59A 4OF6A 1T0NA 3F7VB 3MZGB 2EKJA 4XH2A 3QAZC 4RBPK 2QQLH 2YHGA 3HNSL 3VFSA 2HN7B 5HI4D 3MRNB 4GXVL 2NY7H 2C1PB 4M1DH 3ULSB 4CMHC 3UPCA 5DVMA 3V4PL 3QQ4A 3L3GA 2VIRB 2GTWA 4NKMA 3BFOA 1TJGH 4MXWH 1S7VB 4LSSL 3T4AB 3N9GL 2D31A 4OZIF 5DQ9B 3DX8A 1K8DA 5TH2B 1ZLSL 4U6HB 3D3VD 4X4XA 1AO7D 4ZXBC 1BECA 1NGPL 2EH8H 1MI5D 1RIUL 4JFHE 4I13B 5D71H 1NMCC 3CX5J 3VG9C 2DLFL 5DRWB 1FSKB 1R0AL 1RZ7L 5F93C 2UWEE 1OSPH 2ARWA 3CFCH 1JN6A 4NO2B 1UM6L 5GRUH 3CFEA 1BD2E 4TSBL 4ZO7A 4WW1A 4MJIB 3MRJA 1ZLVH 4TOYH 2NCMA 5FGBA 3MLVL 5ITFA 1OAZH 4BELD 1MCCA 5EFIA 5MEQB 2X4OB 4PJ8A 4ERSL 5T1DL 2A9MH 1PG7X 2AP2A 3K8LA 3O6FA 1INQA 1IILE 4K3DL 1ED3A 4PJFF 1S7UB 1OWWA 1JPST 2ICEA 2HWZH 3ULUE 5GJTL 5E5MB 5E2TL 2PYEA 3SQOL 5GSVA 2EDYA 5D5MF 3PHOB 3BW9B 1I85A 1DQLL 4GAGH 1T5WA 1OQOA 3BUYB 4L9LC 2P5WE 1A6AA 4TVPH 4KVNL 1F58L 3QH3A 3BXNA 3QZWG 4U7MA 5F89A 2G9HA 2OL3L 5ACZB 3I9GH 1V7MH 2Y5TA 4Q0XH 1UB6B 43C9A 4LHUD 3WKML 3PDOA 1HXMA 2FWOB 4CN4A 3SO3B 2Z91B 4RISL 4ORGA 2OP4L 2DQFB 4XPFL 2CDGB 2FSEA 1P53A 2OR8A 4MNGB 4M03A 1MFAH 2BNQD 4QTIL 1KGCD 3JV5A 4NO2A 4X7EC 4M6ML 3T2NH 4KTYA 2H1PH 1ZGLP 2DQHH 2QV2A 3TO2A 3C87A 2IG2H 3HZMB 4HXAL 4Y88A 1MRFL 3IDMB 1ADQL 1U8MB 1AHWB 4X7FC 1Q9WB 3SDAD 2GT9B 4PJ7A 1KPUB 1Y0LA 4R0LC 1MFBL 2OZ4H 5JPNB 2YA1A 4XVSL 2DQEL 1D5BA 4L4TB 3I3DA 5DI8A 3MC0A 2UZYB 2Y72A 1EDQA 4JRXD 5IVNA 1Q0XH 3B5GA 3N1GC 3RY5A 3S5LB 3S98A 1A0QH 1YPZF 4ELKA 5HI4C 5I66B 3RZCB 2VDOL 1TVHA 5TE4L 1HQRA 2I9LA 2WAHA 1R3LA 3MNZA 2D0GA 4ZD3L 3DVGB 1KIRB 1XGYH 3MLRH 3O6FD 1P7QB 4Q6IB 2HP4A 5E5MA 4LARL 4YH6A 5BRZB 4WUUE 4D0CB 2FX7H 4F58L 3OBAA 4PG2C 4HCRL 4EQ2A 4H0GA 2H9GA 5FGRA 1FL3B 2QJDA 5HD8C 4DGVH 4NDMA 5I15L 4K7PH 1OCWH 4OZFG 2FECL 1ZA6B 4R3SA 3T65A 5TDPA 3QEHB 1HDMB 4JY5L 3C6SA 1OW0C 3TH4T 3BEVA 3SCMD 3FB5B 4OZFH 1LD9A 3IDIA 4HC1H 3GNMH 1PKOA 2W9DH 2F19H 5JLZB 3G9AB 3ARDD 5DRXB 2DICA 2B4CH 2P5EB 5A3ID 3CZFB 5I8KL 2F54E 5KTEH 4GBXC 3V6FA 5E4EB 5TE7L 4NQED 1T2QL 4WNQA 1IJ9A 3FRPA 3VXPB 4PJBF 1AHWC 1S8DB 2VAAB 2XIDA 5ICYB 2VDML 2D7TL 1G6RB 3MCKB 4G7VH 5HGDA 3CVIH 3LKPA 5ANME 3REVB 1T1XA 3BI9X 1BQLL 3RKPA 2VDNH 5FO9A 5GSRB 3PV6A 2X70B 2QKIB 2EEDA 4PJXF 2D9CA 4JLRA 4XBPB 1LO4L 1QKZH 3O11A 1LK3H 4AZ8A 3OKKA 4OCXL 1CGTA 4LF3B 3VDBA 1A6UL 5F1OB 2VZUA 4O02H 2P7TA 4Z78A 15C8H 1F45A 1MIEL 2XFXA 4L4VD 4WGWB 1IQDA 1YY9C 5KG9B 4J3XA 4PRHD 3GSOB 4HUVA 4U6XA 4F9PC 1F4WH 5LCVH 5CEYB 5EO1B 5C07B 5BZDA 3U83A 3TJEL 2ZOLB 1QD0A 3DXAD 5D1XD 5IESH 4NQEB 3DUSB 3IKKA 1QRNB 5FGBC 4UAOC 4YDJB 1JGLH 3FRPG 2BSSA 4I3SH 3H3BC 3PGDA 1QRND 5CSZB 4JFOB 1UCBL 4HDIA 5T1KB 5ELIA 4B53A 3GJFB 4KK6D 4C56B 4BZ2H 1K2DA 3QDJA 1BBJB 2DL2A 2DI8A 3U4BH 3O81A 5JA8B 3MXVL 1ONQA 4TNWF 1IKNC 3VXTB 3UXFA 1G6RL 3B2UD 1N7ML 1UEMA 1WFNA 4JRYA 3BAEL 2X4PA 1D9KD 2YSSB 4M5YH 1QSED 3QUXC 4DW2H 1INDH 5FKAB 2BY1A 5IROC 5I9QC 4YXKH 1QSEB 1MRCL 5C09D 5GS1C 2JB5L 4OF5A 1XF1A 3MLUH 5ID1A 3HCVA 5C0RL 1QO3A 5IEKA 5ISZE 4QXUL 2VLJE 4DAGH 2XTLA 3ZDXF 4P3DB 4QHUA 2GAZA 5CHNA 4JFYA 2QHLA 2ATPA 2B7DT 2NY3B 3OZ9H 4L8CA 3QWOA 1DR9A 4TPRH 5GS0C 3QUZB 3VXRB 3L3DA 2APWA 2WANA 3KDMA 1VKXB 1QR1A 2BVEA 2X4UA 3RY6C 2YPLD 4Z78B 1WC7A 2VLLA 4Q9BA 4YHLH 2F5AH 1MOEA 4IDJH 1UQSB 2XPGA 3S96B 1J5OH 4HUWB 1W72H 4O2FA 1WIPA 1JZ2A 3I75A 4X6EB 3FQUB 4LKCA 3PP4H 2AKRA 3WN5B 3BIAX 1C5CL 1BF2A 3QA3A 2R15A 4QHLB 2WBWB 4GRLA 4MA7L 1YEJL 2IWGA 4IRSB 1AI1H 3ORJA 4IRSA 4PTUA 1IEBA 3R8QA 1QSFB 4GS7C 4JJHA 3N50A 4LSRH 3RIFK 5T33L 3TF7C 1UM6H 1BGXH 5DURD 5EN2A 3UBXB 4UUJB 3LQMA 4K2UL 3HTLX 4TVSa 3WNPA 2D4DA 1UA6L 1LP9A 3L7FA 4NQSA 5CGTA 1RZJH 5KANI 1XCTA 4FP8L 1ZGLB 2NXYB 3GMPA 4Q7DA 4DFHA 2ZUQC 4P49A 2XN9E 3HB3C 3HI5L 4G80B 1S8DA 3QI9C 3QIWB 1DLFL 1WBZA 1IGIL 3LKPB 1HZHH 3NAAL 3ES6B 5JUEH 4MB5A 4Y5YC 5IWLA 3VD3A 5MEOA 1JP5A 3CFDB 2P5EA 3PXHA 3CLEH 4EJ1C 3V6FB 3QWQB 5JIKA 2X4SA 3K1DA 1L0YA 4JREB 5FYJU 2YRPA 4JHWL 2EDRA 5EU6E 2KBGA 4OD1H 2F53E 3FFCA 1KFAH 1FFNA 1QSEA 4LHJB 1PW3A 4NZJA 2IQAA 2J5LC 3VXOB 4Q0XL 3CU7A 4PB0L 1NPUA 2H9GB 4TVPE 4NGHL 1I1FA 3QEUB 1ZAGA 3O4LE 3HAEB 5HHXL 2VL5A 1XAUA 4HUNB 2CKBB 3JUYA 3WS6A 1S7QB 1TETH 1AGCB 4NJ9L 3QRFM 4ZUWA 3EOAB 3ESVF 4OCWL 4PLOB 1MRDL 4DVRL 3VXMA 4U1LB 4WO4B 2UV3A 3EUUA 5LXGH 1CU4H 3PQYA 3ZT7A 4PJHA 4PFEA 4PGEB 1OB1B 1CR9H 1EVUA 3C5JB 3Q3GA 4ZUUA 3ZE1E 5KVFH 1G7MB 1AKJA 3K2UH 5JXAH 2AV7A 3AU1A 3RVVC 4P57A 4Y4FB 4PJDF 4FFWD 4XHJD 5CD5D 2R4RH 4X5XA 5KN5B 1BZ9A 4NQTA 3DVIA 2WP3O 1XH3A 2D0HA 3UBXI 1HHGA 5ETUB 3MLPA 3RUGA 1M05A 3ULVH 1VACB 2DQUL 1QG3A 1U92B 3O0RH 1YEKL 3GBNH 1KTKE 4N8CL 1RUQL 1TJIH 2CLRB 1PEZA 1S7TA 2EC9T 4HUUA 5DMJB 1U95B 5CZKA 4MJIE 4LRIC 4N0CC 4QLRA 1T20A 2HFGL 1E27B 4X4MA 1G0DA 2O5YL 4N0FB 5I30L 1CZ8L 2NW3B 3C6LD 3MJ8B 1DN2A 2A9NL 2HJKA 4NRYB 2R69L 4XCYA 4GJTB 1OF2A 2ZUWA 2CDGA 3GKWL 1NC4D 4MD4A 1JF5A 5DVNA 3WNNA 1QHPA 3IKCA 1I7RA 1DE4B 2P5WD 6FABL 4JFQA 4O00A 3TYFB 4N5ED 3QUKA 1BMGA 1WWCA 3MCKA 4YDIH 3RQ3A 1A8JH 2H32B 4HLZH 5I1CL 32C2B 4OGZA 4MAYB 2HT4C 5KJRH 1W8OA 2J2ZA 4G7YH 3L5HA 4Q2ZB 5EZOH 5J8OA 3D39B 5CGYC 4CL7A 1RSFA 1DUYB 2J6EA 5DUML 3P73A 2Y7QA 3D39D 4PJAB 3IDIB 3MRQA 1AE6H 3IS1X 3B6SA 3BHBB 1RUAL 1U8OB 4ODVH 1UJ3A 1ZHKB 3REWB 2VZ1A 1QLEL 5INCA 4XT1C 4MAUH 3BP5A 5SX5K 2C9AA 2VXQL 3R06B 3ZYOA 1QZ1A 3AXLB 3BPOC 2PXYC 3K8MA 1EO7A 1IC1A 4G6FD 3BJLA 1LEIA 1AH1A 4PRPD 2BVOB 2BRQA 3NFNB 2X09A 4Y4KD 2OQJB 5E00B 1BPVA 3P4MA 1QBML 2O26U 5FGCB 3D5OF 1L6XA 5F6IC 5LGKA 4P3WA 4D8PB 2XT1B 3BKYL 3FQRB 5HPMB 1BVKB 4NQCB 3KWWA 4Z7UB 1BIIB 3LQAH 3B9KA 4AIOA 4NZUH 4O9HH 2YWYA 5DUBA 3S36X 3SKNB 2AJXL 3RVXC 3VD4A 4K3HA 1DQML 4OQTH 2VZ3A 4WWKD 3T3ME 3IDYB 3T4AA 1F11A 4LASH 1EO8L 1CD0A 3QQ4B 2Y1VA 4ONHA 1JPSL 3UDWC 4AH2A 1EFXD 5L7XL 4ODXA 4ODXB 3T0ED 5IB1A 4P5TB 1X4ZA 1Y6NR 5KN5A 3DV6A 4GMSL 5IVZB 1FORH 3GMMA 4X7SH 1RK0B 1TDQA 2XKNA 3KPRB 2MJWA 3QI9A 3SDXA 3HE7A 4NQVA 4Z0BL 3UCRA 2FECI 4IRZH 2NTFB 3B9KB 2G75A 35C8L 5D93B 2WBJB 3L3KA 3RHWK 3WMSA 5FHBH 5C0NC 1QQDA 4Z5RB 3VH8G 2VISA 5DRZA 2R1WB 4V2BA 3ISWA 3SOBH 3Q6GH 2IADA 3K0WA 5GQBA 3BH8B 2NY7L 3VXSD 3WIHH 2FSEB 2Z93B 3RGVC 4APQA 5EOCJ 4DEPB 4Z7WE 1Q8MA 4Y8DC 2P24A 3RBGA 3SE8L 4O5LL 3KYNA 3OJMB 2UZXB 4G8FA 2F54B 4LIQH 2E8YA 3WD5L 1LO5A 3V0WH 2Q3AA 1WJ3A 4M5YL 4U1MB 3VCLA 2QL1A 1K4DB 2C3VB 2VLKA 2V9RA 1TZIA 1YMME 4HG4J 3NIGE 4QRPE 3G08B 3O3AB 1RUML 1S5IL 3L5WB 1CIUA 2KZWA 5FCUL 1N6VA 2F53D 4DAGL 3WFEH 2E9BA 4JO3H 2OTUA 1A7OH 4UB0L 4UQ2B 4I4WB 1X9QA 3DRTB 4OM0H 2V2TA 2APBA 4ZOEA 1LILA 5JDSA 4MJ4A 1E0OB 4P2OC 1I75A 1NFDE 3DWTA 3IVKB 4KROB 3RP1A 3RWDA 4KWUA 1JNHA 1ZLWH 2PO6D 4OSUL 5T1DH 2NXZB 4Y16A 1FG2A 3IKCB 2M2DA 5T1LB 2CH8A 1F6AA 2DL9A 4WVRA 4KK9D 1D5MB 4RDQF 1LWRA 5EZJB 4GSDL 1INEL 4RMSA 3V4UH 1J5OL 1R3IL 4Y5XA 4TNVF 2N7BA 1NMBL 5E2TH 3HNTL 3VXSB 5C0FB 4DK6A 2GJ6A 1EFXA 1BJ1J 3E8UH 3TN0B 5IHZA 3MRCB 4ZFOL 3QI9D 4WFHE 3KJ6L 3U7AA 1F3JB 2DQIH 4YDLC 2IAMB 2CR3A 4PJ5D 1C1EL 2HT2D 5C0GA 1T1YA 4JB9L 3BMVA 1K8DB 2EE9A 3A67L 4DWHA 5B8CB 3CX2A 1YMHB 1I9JH 5ETUA 2A83B 3RDTB 1DQJB 2I07A 3LS5H 3P9MB 1QHOA 2RB8A 5ADPL 4PRNA 5E9DE 5TGBA 3L3GB 3IAQA 4PRDA 4NFCA 4P23B 5EUOF 1HI6A 4MYWB 3OL2A 3IDJA 4WWKC 4NUJA 5HDQL 4H1LG 1KB5A 5J12B 4ZO9A 4TUOB 4RQQA 5I1KL 2DYPB 1F2XK 3T0BA 1MCWW 1S7XA 2IAMC 1HK6A 5K9QG 3KPLA 3VGBA 4NN5C 3QP3A 1S9XB 3D18A 3VRLF 2RIKA 4HXAH 3OPZL 1FC2D 3T2QA 5IFAL 2ADGA 2A6KB 3ARFD 1CICD 4PRBB 4XGZA 3MOBL 3C60D 2YPLE 4HK0B 1I1FB 4J3OC 1A7BA 4RGNE 4LCCA 5D96B 3S3JA 3CH8A 1FYTE 2DS4A 4PB0H 1JTOA 5DJ6B 5HYQA 1KYOJ 1T80A 2NZ9C 1KJ3H 4OD2B 3GSWA 3CSPA 1MCDA 2R2EA 4FFZL 4GUPB 4FTVB 4HJJH 3HAEG 5C86A 3AFLA 3LPGA 4CW1B 5D72L 2VUOA 1EZVY 4PLKD 3U9PL 4DVRH 1XGUA 5KSAB 4MNGE 4ZUSA 2FLBT 4KTDH 5I2IA 4AEHL 4YE4L 2IALA 5T1KD 2NX5E 1YDPB 3HRPA 4R26H 3C08L 2B5IB 5MERB 4ZUVA 3DHJA 1RI8A 5JW3L 2R2HB 3FFCD 2Q6WB 4YHKH 3V4PH 3D9AH 1BLNA 2IANE 1MHCB 4P4KD 4RAVA 3QQ3A 3SN6N 2X4RB 2WMPA 2W0LA 1IMHC 3X14A 3N9GH 5ECJE 3MX0A 1RJLA 3MYZA 3VMNA 3BGMB 3UYRL 1CGUA 4LCCB 1ZLSH 1LP9B 3L7FB 2CRYA 3ARVA 5HJ3A 4G9DA 4DGVL 1T83A 3THMH 3S34L 1TJIL 1NBZA 5F7KC 1FFOB 1NFDF 4NC2B 3FCTB 2AEQL 3P30L 3ABZA 5HI5D 5I19H 5C0BE 4QNPF 3NACH 1YEFL 4LHUG 3DROB 5F7YC 4J3VA 3SE4C 1A4KA 2DYPA 4RGOL 5DJYA 2A6IB 1WCBA 1WIOA 2DBLL 2P8PA 1R5IA 2BSTB 4LDLB 4JFXB 5DD1L 1F8TH 1CXLA 4O2FB 4MHHG 2EICA 4NFBA 4TYUA 4FFVD 4Z7OE 2ICWA 3DYMA 3BVNA 3OB8A 4O4YH 5DZLA 1FE8L 3M45A 1X5FA 2JB6B 1AR1D 1AR1C 5GZNC 2LU7A 4HKZA 5I1GH 3KDMB 1VKXA 3MV9E 4WI4A 3QDGE 5E24E 3F12A 5SX4I 2EIZB 3FO1A 1P2CB 5SWSE 3SDDB 4YHZL 3DURB 1CLOH 5F1IA 5GS3A 5I8EB 4YDIL 1DQLH 5IBUG 1J8HB 2YEZA 5I74C 4Y7MA 3SDDD 3WSQL 2NPLX 3CUPB 3GSRB 4DKFL 4WHTA 5IHZB 5KJRL 3ARQA 3TFKC 2FIRT 2V2WB 4TVPL 5AYUH 4OCXH 1RHHB 1A6VH 4F33A 1KENL 5C0FA 4RWYH 3TIDB 1NBVH 5JHLL 3U7WL 5E2WH 4ETQB 3V6BR 3I9GL 1KNOA 5F9OH 4D9LL 5DC4B 3OKNA 4XMPH 4UQ3A 3PXJA 3JV0A 1KJ2A 1AIFB 3BEWA 3GSUA 4XPTH 5I16A 4I9WE 4X9FA 5D2NC 2C3XA 2VXQH 4JO4L 2V17L 5ANMB 4GW5A 3C2AL 2OJZL 2WUCH 2NY1C 3K2MC 4HS3B 3RWFA 3V6OE 3MCLH 2V9QA 1N3NA 4LCUA 3NFPA 3T2NL 5EC1A 1JGUH 2FIKB 4CDGC 3RWIB 3CLFL 3ZDYF 3V95A 5KZCB 2ZCHH 4O58H 2B1HL 1I9RL 4NO0D 4YDJA 3JWDC 1JTPA 4Z6AT 4U31A 5I75B 3CVHH 5E95B 4HIIB 5JHDB 3I84A 1HI6B 4IDLA 5HVHB 1HKLH 1CDYA 1FZJB 1LO5B 4HIHA 3X3GL 3TBWB 4J6RH 5E8EB 1YMHA 2QQKH 3ARED 4UV7L 4LASL 5FKPA 4AEFA 3VMPA 3FZUC 4PS4H 2BMKA 5E0QA 2GT9A 4PJ7B 4PY8I 2F54D 1G9NC 1FO0H 3PIQA 1B6UA 3TBVB 3AMKA 4O2CA 1N7MH 4P9HH 4UT9H 4QF1B 1B4RA 2XFXB 1QFPA 4JJ5B 4X0KA 4H20H 1U3ZA 1WBXA 4Y19B 4Z18A 4NQEE 5JR1L 4FA8A 4DKEH 1UB5B 3EKCA 3W0WA 2Z35B 1IGCH 3FHQA 1JIBA 1U6AH 1VPOL 2RAMA 4DFIA 4LF3A 1T1ZB 5JDJA 1CK0H 3DIFB 2YD1A 5DR5L 4PYGA 3Q6GL 3OZ9L 5CAYB 3SKMA 3U6RA 4EDWH 5IVXE 5T1LD 3JUZA 4OT1L 3QHTC 3UTQB 3EYSH 3NIDF 4FN0A 1CG9A 4JANA 5AUMB 3SE8H 3HI1A 3QFDB 4YQXH 5JMOC 1RZIB 2AEWA 2W60B 1S3KH 3ZKNC 2HJFA 2WWMC 2AEPH 1NGXB 5CIPA 2Z92A 4OZFB 4LLUA 5HVFB 1OAYL 1HINL 1IC4H 3IETA 4R0LA 1T5WB 2VLRA 1KB5H 3CIQA 1FL6B 3IJYB 3ROOB 4KQ3H 3BD4A 5IV2B 3D85A 1FNAA 3C8KB 4EIGB 4U1MA 4DVBA 3MA7A 1KGCE 5GGVL 1IM3A 1C12B 4JDTL 4OZ4A 4R3SB 3DETD 1I7TA 4MDJB 3GFUA 1T0MA 4C83B 2A6DB 5IB2A 5BO1L 5E2JA 3LQAC 3TZVD 3GMNB 1EGJA 3T65B 5BW7A 3Q2CA 1MNUL 5GISH 4URTB 1OGTA 2AAVA 1T0MB 4MJIA 2OX5A 3VFUA 1LEGB 1QSZA 3MV11 4S1QH 2PR4L 5KOVC 3GBLA 5GGUB 3G5ZB 1IGYB 5L2KD 1W0WA 4J3WA 1HSBA 4HS6B 3S6CA 5T3ZH 1DL7H 3U46B 1UKSA 1MPAH 3KHOA 1LK2B 3W0WE 4OZFA 2C4FT 1AY1L 4LCWD 5JOFB 4KZDH 2NTFA 5IW1A 1JE6A 4KROD 1J1XL 3CH1B 1T1WA 1AQKL 4UNVA 5HHOB 1OM3L 3MV7E 2E7MA 4OD1L 12E8H 3LKQA 5GZOC 4PJEF 4BQ8A 3PJSA 1UYWH 1PX3A 2R0ZL 5C09E 2DQIL 1DBKL 1H8NA 1SJXA 2ZCKH 3FQNA 1BJMA 2NY6C 3W81A 4ODTL 3A67H 3HI6L 1PLGL 1SYSA 4JO1L 4L4TA 5A16B 1T22B 1SEBA 5E1AB 3GSQB 4ZSOB 4HWBA 1X5JA 2NNAB 1Q9WA 3S88L 1ZT4A 1HH9B 2Y36H 4MA8L 1Y0LB 2HT3C 1JTTA 5E7FA 4NJ9H 4XH2B 4IJ3B 2EZ0D 2RQ8A 4PRID 3MJ8A 5EZLA 5B38A 3B8SA 1JWMA 2HFFA 3F58H 3M8OH 4WTZA 3T1FA 5I1KH 5D7JA 1JGDB 4UI2A 3STZB 2DOCA 5JXAL 3LPWA 4BZ2L 1M7IA 4IS6B 3O3BB 3HMXH 4ZOBA 2Y06H 1NEZB 2QQQA 3MXVH 1IGFL 2JELL 1IC5L 1BQHB 1JZ3A 1KCRH 3BDYL 4MXWL 4W6WB 4RMQA 5FHAL 1HXMB 4K23H 1WZ1H 1NANH 5C0ND 3UC0H 4K07A 4QHNA 3GJEA 1NQBA 1F90H 4OLYL 3WEXA 1DFBL 2DQDL 4QKXB 4F57H 3B9KD 4FFZH 2R23B 1YEEH 3CZJA 2UWEA 3ZLQC 2MSPA 4MDIB 4JZNB 1N8ZB 4R8WL 3LEVH 5GJSH 3CFCL 3BUYA 5GRUL 3C5JA 4G5ZL 1KB9K 4KMTL 2NY0B 3VDAA 1BZ7A 2QQNL 4K94C 4HUMB 4P2OD 2R29H 3QZWB 2KQMA 2A9NH 1DBBL 4JCLA 3HAEA 2A9ML 1ED3B 1NSNL 5F44A 5IWLC 2Y07H 5JIIA 3UYRH 2A0LD 1A7PL 2GKIA 3FFDA 2EXWD 1MHEB 5FYKE 3RFZC 4JRXA 2PXYB 1I8IB 3QDMD 3QNXB 4PG9B 2BCKB 3LIZH 5DK2A 3PWVB 1TTFA 5DJDB 4ORZC 3MA7B 4LP4A 1UJ3C 3TVMB 4NN7B 1G7LA 2FJGB 2HG5B 4N0RA 1YQVH 1UA6H 3HFMH 2Z92B 4POUB 1QRNE 4JKLA 4X6BA 2HJFB 4XC1H 3WHE1 4PRIA 2KDGA 3RIAF 3DX8B 1A02N 4KJWD 1BVZA 1NCBH 3OKEB 3NAAH 4F15B 3BVNB 4POZC 2QADB 3STLB 2GTWB 4NKMB 5I74B 2W0FB 5CSGA 3G6DL 3BPNB 3MBEB 3MRNA 4M8VA 3PP3H 1L0QA 1CLOL 3QXTA 4P2QD 1A4KB 1LE9B 3VFMB 1ROWA 2P8MA 3ARFC 1PGRB 5FEBA 4KDTC 1Y6MR 3BKYH 4MDIA 1UB5A 2K7QA 1KENH 5JHLH 3QA3B 1AD9A 4ODWA 3TM6A 4NNPH 3UMTA 1FNSH 3RHWF 2YUVA 5BCAA 1YEGL 3WFBL 4FQCL 2BXYA 4PJAE 5EO9A 3AAZA 3LN4A 1ZS8B 1WLHA 2ERJC 4XZUB 2ADJB 4HGWB 3BPCB 1LO2L 1ZE3C 2DAVA 1QFUH 1TETL 4WEMB 4MAYC 1RY7B 2BRRH 4MNHB 3RNQB 3HR6A 4YNYA 3SPVA 4WV1A 4FNLH 1EJ6A 3I6KB 4HQQL 1U8KB 1OP5H 3RVVD 4NJAH 1MCBA 4PLJD 5BW7C 3EFFA 3MACH 3NABL 4JFYB 3OGCB 2NY4B 5HYSG 3CSYB 2EEBA 2BVUA 5I2IB 5D7JB 3X17A 1HHKA 1XGYL 5IEKB 2J6EH 1DEDA 5KVGL 1T66D 4V1DA 1VGKA 4X83A 4WW2B 2ZSWB 1AKJD 5LWYH 4LBEB 4P4RB 3O2WH 3JZ7A 5DHVA 4CVZB 4MJ5A 1VFMA 4RCAA 4YPGB 4U7SA 3BP7A 1YEKH 4ZUTB 3RPKA 4HGMA 5DVLA 1SEBB 4QRSA 4Y5VC 2J12B 2RFXB 3I6GA 5JQ6H 3BD3A 3EYVB 1QSFE 4JPVL 4M6AA 1OY3B 3DNKA 2NTSP 3QEQE 3BESR 4KHTL 1P69B 2VH5L 3EJYC 4OCNC 3KPLB 2HFGH 2UVEA 4PJBE 1A7QH 2YA2A 3HS0A 4XVTL 3UJIL 2O5YH 5HI3C 4XP5L 5A43C 5FYJH 4EI6A 1I4FA 5IOPA 3Q1SH 1IAOA 4WHTB 4NQDB 1VPOH 4X8XA 3WJLA 3GKWH 3RDTA 1QR1B 4QRQA 1GC1H 5DR5H 5KSVB 5CEYA 4JN2A 3WKNA 3IJHA 1UM5H 4PUBL 1DLHA 4EN3B 2PUQT 1OAQL 2IPKA 4HHAB 1ZTXH 4LLVB 4X8JB 5I0DA 2GITA 4NKIH 3L3IB 1GGIH 2IBZY 1LO4H 1QKZL 3NCYP 2X4QB 4XNXL 2E7LA 3IT8D 5FM8A 3JWOH 2HT2C 1L9NA 2A74A 3HMWH 2B0SL 3MRGA 1P4IL 4LAQH 2YBRA 1R3HB 5E6IA 1RUAH 5J1AB 1R3KB 5DMYA 5E08L 3E3QC 4NHCL 4NPYA 2CIKB 2PYFB 1U8PB 4YHOL 4Q58C 4MQSB 3RWGA 2FYYA 5KS9E 4NT6B 1C5DA 3MBXL 3BZFB 3C09C 1NFDB 3X12B 2H3NA 3RTQD 5I73B 4CRPA 4DZ8B 3IF1B 4KRPC 1OAKL 3LRGA 3PWJA 4MCZA 4OIIH 4AENB 1H3XA 2QR0B 1CFSB 4JN1L 5IMKA 2W0KA 1PY4A 1X5XA 1XF4B 1T1ZA 3D2UB 4I3SL 2FATH 4U1SB 4WFED 1ZOXA 4XAKE 5CLTA 5FK9B 5IM7B 3B5TA 3TBTA 5BRZD 1GYAA 1YDPA 3ELAT 1AY1H 4QO1A 2VDPH 1NEUA 2Q86A 1YN6A 3AREC 4R4BB 4APQC 5F9JA 3WFDH 2DQCH 5H35A 4CGTA 2AABH 4R2GB 3KPRD 3OPZH 5IFAH 3SJVA 5KVMC 5EUKB 1HKFA 2R2EB 3QCVL 3TA3D 3MYJB 2BMKB 4GMSH 3VWKD 4D0DB 4J7RA 1GZQA 1FZOA 4F37F 1CD8A 1U58B 2F58L 1KJ3L 1D6VL 1UWGH 4ISVA 5T5FH 1A22B 4G8GE 3H9HB 3ZE0F 5GIRA 3IDUA 4OIBA 1KIRA 3RU8H 2C7UB 5D1QA 4LPCA 1FYHB 5D7LE 3IDYC 2DLHA 4TUOA 3QRGH 2BVQA 4L8BA 2EYTB 8FABB 1WVZA 3CGTA 3DX7B 2FJFB 5DT1H 3UBXG 5FO8B 1NLDH 5ERWB 2C5DC 4TPRL 4DZ8A 4X6DF 2WSKA 1T1XB 3D9AL 2FYYB 1IC5H 4F7PB 3GSNA 3BDYH 1LNUB 4PRIB 4HW6A 1OAUH 1JI1A 3T0XA 5F7MC 5D7KD 3H9ZA 3B9KC 1F90L 2UUDK 3QUMH 4D0BA 3HC3H 4RZCA 4M6OH 3GHBL 5E2VH 1U93B 5EOCL 3GMOA 2BHZA 2FZ3A 4H88H 5JLZA 5DJZB 2XWBB 1S78D 3FMGL 4HK3J 5HI5C 2PETA 4WV1C 1CVRA 4PLNC 1JPTL 3O9WC 1HE7A 1S9VB 1Q38A 1T7ZA 5SWQB 5GS2H 4NRXA 2BC4A 3GMLA 4LLVA 3MRKB 2DQFA 1BWMA 3MQIA 4E9LA 2YPVL 3FO1B 3UJTL 5JW4M 5KSVA 4LLMB 4JM2F 1JF1A 3SDXF 3DYOA 3DO7B 1NDGB 5A2KH 2VDQH 4NBXB 2XZQL 1A1OB 4JM2D 3KPOA 5DD3L 5C8JA 2IBZX 1YJDC 4PJ9C 1A3RL 1RV6X 4K3JH 4I77H 1G9NL 2OTUB 2XTJE 4KI5C 3MNZB 1NUFA 5I71B 3V0VB 3E8UL 3ALWA 1MCOH 4AIZA 1XMWA 4AG4H 5F88B 3VXUE 5FB8B 4XNMB 4Y4HA 2YD5A 4RGND 3JV6A 5ACLA 5HTSA 3NCCB 1NCAL 2ZOKB 1YA5A 3BW9A 2VO5A 2DQTL 2E27H 1UZ6E 3D69A 5DC9B 5F1NB 4QY8B 5IBTL 4QHKI 3T04D 4ZSOE 5K9OA 1A6PA 4Y4KC 3OHXA 4DEPC 3STBA 1JNLL 2MHAB 3RVUD 1EJOH 1P1ZA 2AJSL 1I9JL 2AS5M 4BFIA 4XRCA 1OD7A 5FAAA 2XYCA 1MJ8H 3MYJA 1JYVA 4M7ZC 2FEDC 5C1MB 4QGTA 4TQEL 2X5PA 2ENSA 3EOTH 1HWHB 1CR9L 1RUPH 3MOAL 5ICXA 4YXHL 1XF2A 1I1CA 2ZUYA 3G5YA 1FH5H 5D93C 4MSWB 4Z7WB 2PW2B 4ZNEE 4P2RE 4KRPD 1QPXA 2I5YH 3PE9A 3IDXL 1KN4L 4OZHA 4P3CH 5IM7A 2JJVA 4WDIB 1J1OL 2NY2B 5TF1L 3NCMA 1UENA 1U3HB 5DJXB 3WLWC 3LRHA 3CCHB 3EO1B 3O4LA 2DF3A 4M62L 1A6ZA 4YBQC 2ADJA 4HGWA 3DXAA 3QHZL 1M05B 2R2BA 2VYRE 3FQNB 1JI2A 3SDAA 4M7ZB 3EYFA 1A14H 3SDYL 2VSDA 4X6DA 2VIRA 4G8IA 3VMOA 3DBXB 4HV8B 1P5VA 3R0NA 3T2PA 5D4QA 3EJZD 4QOKE 1T1WB 2I60L 4HT1H 4IOSD 4F7TB 2K1MA 5MENA 1P6AB 2ZJSH 3VWJA 2GJZB 1UG9A 1S7WB 4E5XA 1TVDA 5FUZH 4R97C 3SQBA 2CKNA 5IQ9B 5GGRY 3DECA 3U79A 4NUJB 2R8SL 3VI3E 1X3DA 2X9YA 5SWZB 1OTSC 1ULVA 2W65A 4M48H 1IAIM 5DEZA 1MF2H 4GXUM 2KPNA 5M7QA 4JGJA 3BGFC 4WWKA 4GBXD 3S3SA 4WI6A 1WFTA 3A6BH 3AUVA 3FTGA 4JFPB 4X6CE 4QRTB 4WFHD 3KLHC 2AEQH 3SCMC 1FPTH 3T0EA 2AQ3A 4JR9L 5C0AE 2AJVH 3CFBA 4N0YH 1FQ9C 4ZFFA 1RJZB 3M1BA 4YQXL 1P4BL 4LLDB 4HFUL 3MRCA 2NXZC 3VD7A 1DBML 5DYOB 1AQDB 4YLQT 5FYLL 3K81A 5ENWA 4AIXA 2PO6C 5E9DB 3U2SB 1KSRA 1J05B 4IOFD 4LU5L 4V1DD 1EEYA 2HFTA 4X4XB 4JRWA 3MODL 5F9WC 1SEQH 5D1QC 2ED7A 3E1F1 4X80L 1N59A 1F6AB 3UP1A 1XR9B 2BNRA 4HWBH 2NZIA 3GIZL 5C70A 1BJ8A 4DN4L 1RAMA 1IM9B 4I5BB 4APQD 3LDBC 4LFHD 4LK4A 4JM4L 4D9QE 3LKSA 3IFLH 3QUYA 4NKIL 2BFVL 4ZFOA 1ZK9A 1A4JB 1PKQE 2WIIB 3LKOB 3O4LD 1A7RL 4UT7L 3F7VA 5T3ZE 2EE2A 5D6CB 4R90H 1Q72H 4XPHH 3G08A 3I75B 3O3AA 3WYRA 5F9OL 5ENWB 4IMKC 3O6MH 5B39B 3MJ9L 4QF1A 1CIDA 1AQKH 1EO8H 1YEDA 1U95A 3GGWA 5E56A 3O2DA 2NY2C 3T3MF 4GW4A 3LAFA 4LOUD 3SEPA 4YHOH 3MZTA 4J3TA 2OR9H 4OI7A 2OJZH 4WGVB 3QWRD 2ATPB 3FTGB 5CEXB 1ZANL 1YEDB 3NIDE 1U2CA 1WGOA 3QUXB 4BH8A 2AW2A 4PY7B 2NY5C 1GGUA 3CLFH 4LCYA 1HCVA 2X89A 1UH4A 2RBLA 5I8OL 1JL8A 2R9HC 4YO0B 5B3JE 2Y6SD 1H3UA 3ARBC 3AU1B 1CL7H 2FO4B 3A6OA 3ZSSA 3AROA 1J0JA 2PTTB 1NCTA 2VERN 4P48A 1VFAA 4MJ6B 4HBCH 4HF5L 4OF7A 1CVSC 1JWUA 2G75B 4DGIH 1CGSH 1NH6A 1AXTH 5CBAA 3H7BB 3VXMB 1SY6H 4R7DB 4KFZC 3U9UA 1AFVH 4PJDA 2X1PA 2X40A 2Y06L 4G8IB 4WHCA 2VDKH 4PRHE 2FX8L 1OTTD 5C3LD 1X6LA 1K2DB 3OJVC 4KK5D 4LIQL 3RI5F 3MRMB 5I71C 1FL5B 1WAAE 2DQDH 3KPQA 3TNMA 1AP2A 4PBWD 1UKTA 2VN4A 2AQ1A 3MFFA 4WDIA 1IE5A 1X5YA 2LTQB 5DLMH 3MGOA 1HHIA 2VZSA 3LEYL 4HS6A 1C16B 5IUSA 1S5IH 3OX8A 4WHDA 4PJCF 5EUOE 4HH9B 1BVKA 3FQRA 2B8OT 3AY4A 5SWSB 3TVMA 3V5DB 5ICXB 3TBSB 4X4ZA 4EUPA 1GGBH 1IC7H 5DK2B 4KI5D 4OZIB 2EIZA 3SO3C 5HXMA 1MCPH 4ZPTB 1Q9KA 3WUWG 1FFPB 1BFSA 1DBBH 4N0UB 3H8NA 4Z9KB 3BKJH 1WBZB 1NCCL 3GSNH 1S3KL 3CMGA 2ICWB 4NM8L 2AERT 4GSDH 4ZFZA 1D6EB 4Z0XB 2YZ1A 5T3XL 1KCLA 2HLAA 1O5DT 5EN2B 1C5BH 3UBXA 2E7LC 4G8EB 3PHSA 1P9MC 3N06B 4PP2B 2J3SA 3P9LB 2OLDA 3ILPA 1X5AA 1MREH 3MROA 4X4YA 4OB5H 2V2XA 4XBEL 2IMNA 3HI1B 4IMLA 4G8GA 5I1EL 4Z95H 3T0AA 1I9IL 1UQSA 4GAFB 5E99L 4GKNA 5DJ8B 5IHUL 3X14B 3ARTA 1EUUA 2VLRE 4UIMB 1OPGL 3BKCH 3QG6B 1NGZA 4ONGH 2XZQH 3G6JF 4YXLH 5DD3H 1CLYL 5TDNA 4CN1A 3HPLA 2J7LA 5C0AA 3ECBA 4NP4L 3L3OA 1DBAL 1TLKA 4ZTOH 3MLXL 2ADFL 5B4MC 4Y2DA 5F6HJ 2ADIB 2Q20A 3LDBB 4N0FA 3O4OB 4LSPH 5EWIL 1VESA 2F5BL 1E6JL 2ESVD 4JY4A 1E27A 2XKUA 4Z7NF 5KBNC 1HSAB 1H5BC 1JPGA 5IEHB 4JFFB 1KLGA 5IBTH 4W70A 2ZCKL 4Q6IC 1FNSL 4X99A 1T2JA 2VXTH 2EDQA 3W39A 1EMTL 4RRPG 5CMAA 3QXDB 2MHAA 2A6KA 1LO2H 4I0CC 1J88A 5D7LB 2BRRL 2OTWB 3AC0A 1ZEAL 4PTTB 4NO0A 4TQEH 1KT2B 1ZHNB 5F7EH 5T3XD 4YDKH 4ALAL 3MTRA 3ZTJH 1D3CA 5C7XL 1ZHLB 5EA0H 5FYLD 1CGVA 3VFOB 2ZSVA 1RUPL 5ISZA 2DQGL 3FO9A 5D1ZA 5CSZA 2UUDH 1FRGL 4AQ1B 4Z7QE 2IQ9H 2JCCF 1OP3H 3FB7A 1ZVSB 5JOEA 3DJ9A 2A73A 3P9MA 4K23L 3UC0L 4W6YB 5I16B 3BEWB 3GSUB 4HIEB 1PQZB 5HD8D 1T1YB 2DM3A 1QOKA 2EKSB 4BSJA 2WQ8A 5J6GB 5HYEA 1RIHH 3BWAB 2HYMA 4JG0H 1L9MA 3QO0A 3R0MA 4RX4D 3MJ9A 5ICZA 3LN9A 4GLRI 1DDHA 1HSAA 4C83A 5DFTA 5L9DL 5FYLE 4N68A 3GRWL 5DD1H 5DD6B 2BHUA 2BNRE 4XP5H 1RZGA 3D85B 5K9JL 5FYJL 1DVFD 3F65A 1R5VB 3F7PC 3QHFL 4GAJH 5KSAD 3EYOB 3K4AA 1DUZB 2FD6H 1Z3GL 4XNQB 3BO8B 3PWJB 5HHNB 4QRPA 1IZKA 5EPMA 5IHBA 4F7PA 5FFLA 4MA3A 2H3NB 1A7PH 1NMAL 1X5IA 3MLZH 4NT6A 3IAGC 4UBDD 5ACZA 4YHZH 2P47B 4QWWC 3TYGL 3WSQH 2F53A 5H2BB 4HEPG 2VWEC 5MEND 4XNXH 1W0VB 4KUCD 4UILH 1MQKL 1A6VL 1D7FA 3FO2B 4FOMA 1TZGL 3T77B 5E2WL 2PYEB 3NCEB 2Z35A 1K4DA 2C3VA 2W9EH 4PP2A 1A7NH 2DRUA 5DD6A 4JQIH 1PAMA 4Y16D 5C9JA 3QPXL 4LKCB 4Z0XA 5E08H 2NY6D 5HVHC 3BGMA 1SEQL 2O61A 1F4HA 3UZEA 2JIXA 4XP1H 4UINH 2MFNA 4NWTL 4UTAH 4FQ1H 4XX1E 1O7SA 3NN8B 4ZPTA 4CADB 5F9AC 3S35L 5L88L 3BH8A 1VERA 3MBXH 1OAXL 2OS7A 3WV0A 5I6XC 4P9MH 2DI7A 1VFOA 3P0VL 3VFNB 1FYTD 1J8HE 4GT7A 1SY6A 4OZIA 2DBJA 2WWKO 3V5KA 3SDCA 1R3JB 1BD2D 2HFEB 4EDXA 3PDGA 2W07A 3K3QA 3VRIB 3BKMH 3WE6A 2RCSL 2VQUA 2CUHA 1SYVB 2LABA 2FEDD 4U6HA 4G3YH 2GSIA 4UOW1 3L5IA 1BFVH 2JCCB 4FRWA 4ODSH 4K94H 3IXAB 3P77B 4P2CG 4PB9L 1Z0NA 3WFDL 2N4IA 3VFGL 1YN7B 2BOBB 4JRYD 4Y0GA 1AGFB 1KCSL 5IG7B 2EDHA 5EIIB 1DCLA 2ZPKL 5BVJB 1Q0YH 1XIWD 3H7BA 2BJML 4LHUB 3VW3L 3QCVH 5C0CB 2DMCA 2VZOA 4JG1H 4D9RE 3OJDB 3T3PF 4G6KH 4OZGB 4PJCA 5HY9A 4CVUA 3MR9B 1D6VH 1HOCA 3UPRA 4IHOB 5D7JD 1AHWA 2ED8A 1VFBA 4BK5A 3KLAB 1KNOB 4FQJL 1VFAB 5HPMA 5D2LB 1XFPA 3Q5TA 5JHDE 3VFWB 3OR7B 2C4FU 4M6NH 5ALBL 4OLEA 4YO0A 2NW2B 1NEZG 5TGBB 5DUPL 5ESQB 2O5ZL 4QXGH 4M93B 5CJBA 5C0AB 4WFFE 1J11A 2J8UE 3HE6A 3QAZB 3RL1A 3KXFD 1MH5A 3ARDA 2YRZA 3RKDC 1JK8B 4EDWL 3BP5B 3L3JB 2BSRB 4NM4H 1X4XA 3D0VB 5DTFB 4P4KC 2HT3D 4JHAL 3B6SB 3BHBA 4YHPB 3SE9L 5FYKU 5D70L 1BEYH 4QYOA 1Q9LA 3MV8A 2P44B 3ARDC 2G9HB 2HVJA 1RZKC 2XXCB 4XI5C 3BXNB 3DVNB 3Q1SL 2V2XB 2N7AA 5GGVH 1XZ0B 1U3JA 4EBQL 3L6FB 3CD4A 4LIQE 4PREB 4I48A 3FMGH 1P7KB 4G8EA 2QSVA 1OSPL 3O11B 2BSED 3WNMA 1FLRL 1SVCP 3NOIA 1D6EA 1MCPL 4JAMA 3BUTA 4XCNA 4F9LC 5FCSH 4U1JB 4M7JL 5GGRB 3UJTH 1JHKH 2V2TB 4LFHG 4XCCL 4CVZA 2PR4H 5D6DA 3F6IA 3MRDB 1UVQA 5L8JB 1TTUA 3HG1E 4JZJC 5FA3A 1DL7L 3JWOL 1RHFA 4TTDC 5GJTH 2B0SH 2ZG2A 4G6JH 3EO0A 5DJ2B 2YRLA 3CFEB 3QJFB 2Y23A 3V5DA 2FGWH 1I3RB 5EU7E 4PJHF 1ZSDA 3E6FB 4GRWH 5HSFA 4OFKA 4OLVH 5GGTA 4WI2A 3QBTB 2BX5A 4YNYB 4H5SA 1BOYA 2OXGA 3WO4B 4LRNL 5J13C 5CP7B 1B6DA 4M1GH 1CF8L 1V7NL 4APQB 3HC4L 5EUOA 4GH7B 5EORL 5DQ9A 3HE6B 1MWAL 3QISA 5FGSA 1OAKH 4JZJB 1HHGB 1X5ZA 1WWWX 2HTLC 3D3VA 5EO9B 3AY4C 4RFOH 4KDTA 1MCFA 4RMUA 3O8XA 4P9HC 4HK0A 2UY7A 4NRZB 1MFEH 1WEJH 3I2CL 3LN5A 3KXFA 4LSVL 4M9PA 4OFVA 3MLXH 3ZYIA 4M6MH 2VDPL 1WUNT 1YY8B 2PTTA 5LGJA 5HHOE 2VITB 4NRZA 3HMXL 1FV1B 4N0CD 3R4DA 3RZCA 3LN5B 1RIVL 3IDJB 2VL5B 1KCRL 4KXZH 1PSKL 3EYFB 4J12A 4FQ2H 1U41A 2YPKA 3ALPA 4P23A 4HPYH 5EH1A 4NN5B 4M62H 1IGTA 3NZ8B 4YR6A 1IAKB 4MD0B 5HDLA 5I1HH 4NQDE 2YXMA 5ESVA 1R24B 3VWKA 1I3GL 4OLZL 3S37L 1XF5A 3V6ZA 4P46A 5C92A 3AB0C 4QOKA 4OGAC 1U3HA 1C08B 4IRJA 1CXEA 3E6HA 3D0LA 5K59E 2WINB 2AVGA 1VEMA 3IDMA 4FFWC 3CSGA 4X6DE 4WENB 5EULV 4G5ZH 1MCKA 4N0UE 1ZSDB 3TN0A 1KXTB 3MCG1 4P2RB 2CUIA 3UYPA 4X5WB 1MHEA 2CPCA 4YAQA 4Y5XB 1HNGA 2AXHA 1T3FB 1I8MA 3F7YA 4M48L 1IAII 5F7LB 3T08A 1QFOA 1CE6A 1RMFH 2ZKHL 4GRWE 4J8RA 4PGDB 4PJ5E 4U1JA 5I15H 2B39A 5F1NA 4P5TD 1KBGH 3MNVB 1H3VA 4H88L 2LU3A 4GQ9H 3HNVL 3CVHA 3FO2A 3QIBA 3D39A 2JJWA 3ZO0A 4PREA 4W68A 3RWHB 1T04A 2CGRH 5H2BA 3F6LA 2V5SA 3DSFL 4F3FB 5AWNL 5GRJL 5C6TH 1WC7B 2YPVH 1GL4B 3BMWA 3M1BB 3MRHA 3ZT6A 2IFFL 2FD6L 1K6QL 4TUKL 2DB8A 2Q8BH 5KAQG 1S78C 3L3DB 1INQB 1PYWB 2D7TH 5DSCA 3TWCH 2P4AB 4QRTA 1B0RB 4KAQH 2MCG1 2VDNL 3TO4D 2IGFL 1JK8A 3RJDA 4F8TA 1CFBA 5F96H 4RX4A 2A6DA 3LKRA 4WW1B 5JW5A 1WIUA 2XWBA 3B9EA 4YIQB 4Z76B 1JWMB 4HH8A 3KHQA 2X41A 4UT7H 5IQ7L 1V05A 4S1RL 1FFQA 1NCAH 3VD5A 3UAJD 4JKMA 1AGBB 4NNPL 3DPBA 3UO1H 3DX6B 1Q72L 2EO1A 4MS8D 4JQIL 1AJ7L 4O2EA 5LAXB 1TIUA 4JRYB 2AJSH 1HOCB 4F7TA 3NGBB 5JW4Q 5L2KB 2DKUA 1VACA 3U7YH 1I9EA 5B21A 3RJQB 4UNTA 4HGKC 2M8XA 3W2DH 3QDJE 3TCXA 4OM1H 1MJJA 5DEFA 4ODUB 2GSIB 4N5UA 4YXHH 2BZDA 3ALXA 2CRZA 3GHEH 5D2NE 3B3IA 2GFBB 4KRMB 4JFED 1RZ8B 3CX5K 1YPZE 5D1QB 4S1SH 4Q9RL 3L1OH 3RWCB 1HSBB 5LWYL 3SJVD 4PTTA 4L4JA 3MXWH 4HJ0C 4MQXC 4NQCA 4UOJA 1IL1B 5A2LH 4HBCL 3CPLA 3HZKB 4HF5H 4XNYL 4XPAL 4ODSL 5IJKA 4AMKL 5DEGB 2O93L 1JCKA 1NJ9A 4LCIH 4OZHE 3RNKA 1F5WA 4XP9L 5JQ6L 3L3HB 1IQDB 3ZSTA 1BBDL 3GMNA 2JJTC 1Q0YL 3VW3H 3RTQA 4FXGA 2EC9U 2WIMA 4HT1L 2I60H 1NGWA 1CD1A 4JG1L 5CS7A 5T3ZD 5DFWH 2IPUG 3ZZ1A 4ZG1A 1IM3B 4DW2L 5HYJD 5FUZL 5F7NC 3T77A 4I3RL 4PYHA 1OGAD 2D7MA 3LH2H 2ZUSA 2VDLL 3IS0X 2R8SH 3DXAE 3MLUL 3ARYA 4S1DC 1NBYB 2DLFH 3SJVE 1IGMH 5EC1B 1KJMB 1CN4A 2WUBH 2DTSA 5DUPH 3QEGH 2YMXH 1IC7L 3SKJH 1T7XA 3A6BL 4Z77A 1J10A 1ZTXL 4JQVA 1MCQA 5FM5M 1NFDA 2FHFA 3DO7A 1FNLA 1JF1B 1E28B 4KI5F 2XWJB 3W9EA 1EV2E 4OKVA 4X6FB 3P4NB 1AC6A 1ORQB 1S9WB 2VXSL 2NY0D 2ZUQB 5IT2H 5BXFA 4K3DH 4P2OB 4WRLA 1G1YA 1NBYA 2Z31B 3RX7A 3B8YA 5E6IB 3PP4L 4U05A 3SBWA 4WFGD 1P4IH 4LAQL 3ULUF 4LLYB 4BKLB 2WNGA 4UDTB 2A74B 1E4XH 2IAND 5EOQL 1IKNA 2DDQL 2J88L 2HVKA 5J7CC 5HDBE 5DDHB 4XBEH 5DD0L 2VZTA 3WFHB 4P2YA 5ITBH 3DV4B 3V6OA 5I1LB 2OK0H 3HE6D 3QO0B 3SO5A 3V0AC 1VSCA 5JZ7C 1I9IH 4M02A 3TT1L 4HIEA 2HLFD 4HKBA 1NC4B 4QHKJ 1PYWA 3LS4L 4L4VA 1JHKL 3FL7A 5DS8A 2WLZA 4PJ7F 4XCCH 1EHXA 4HK3N 1FNFA 3BKCL 4BA8A 1XGTA 4X9BA 1ZLWK 5JUEL 5B22A 4BH7B 4OZGF 2Z8RA 3U30C 4MCYB 4EI6B 4YHIA 5CJXA 5IOPB 3H9SB 1U91B 3HCVB 3IFNH 1U8QB 4XXDB 1I7ZA 5EBWA 2EDEA 3HS0B 4UNUA 3LRSB 3GO1L 2CLZA 1HHHA 2AV7B 3FO9B 5D1ZB 3ZT5A 3ULUC 4JHWH 1ZHNA 4ODUA 1GGCH 1U9KA 2IG2L 2LV4A 4UOW0 4OCLC 1MHPH 4HSQA 2WBJD 4X7DC 5IVXF 3V9FA 4ONOA 4OZGE 4Y4FC 5JHDD 4QTHA 3H2WA 1CF8H 2FB4H 4Y19E 3HC4H 4PJXB 1ZXQA 4DGYL 2F58H 1FLTX 3BP7B 3OKNB 4OUUB 3V5HB 3MRLA 2XQBH 3FT3A 3EOBB 5HHME 4HKJB 2CDEB 3EDJA 3GZKA 1MFEL 2NQCA 1H0DA 4LCWE 5TE4H 4Y2DB 3EFFB 4LSQL 5JW5B 4Y1AA 1KV3A 4HC1A 4DGIL 2BVYA 5KVFL 5F8QC 1CGSL 3BD5A 4MNGA 2X6MA 1Y18B 4BH8B 4WV1B 4PGCA 2NR6D 3TPUA 2ORBL 3TJHC 1DQTA 2I9TA 1PSKH 1SHMA 3QG6A 3CDGA 4LKXB 2XICA 4GKNB 5EIVA 4Y19D 1ZS8A 2IANA 3BZFA 3O0RL 4I0PC 3X12A 5IW6B 3FN9A 1ZVYA 2HMID 4G8GB 2EH8L 4MJ2A 4PJEB 2AXGA 4H8WC 2CK0L 3EGSB 2YKLL 1FV1A 4JFXA 5CBEB 5HHMD 5C71A 3G5XB 5DJYB 1QSFA 1IQWH 1QSVA 2YBRB 4MA1C 3TO4C 2BNQE 1FVEA 3TJHD 2D2OA 1TNNA 2F19L 1CQYA 1A5FL 2FHCA 1CZ8H 4A6YH 1SBBA 5DJCA 1CFQB 3MLSL 3BZEA 3ETBF 4U2YA 5DRNB 3P0GB 4X6EA 4GAJL 4RFNB 4BYHA 2YN5A 1RJLB 4K71C 4GMTH 1G6RA 4DTGL 1SJHA 4RGMC 1MHCA 3MA9H 3ULVD 3O41B 1EGJL 4YPJA 6FABH 1UT9A 1FFPA 3SQOH 1EEYB 1CXHA 3OAYK 2HG5A 4I77L 3U2SA 4HAGA 1HYSD 5BV7H 1G7JA 1X5KA 2NY1B 4AG4L 1D5XA 4PGZA 4FXKB 1DSFH 2CR6A 4G7YL 4P3DA 3LB6C 2NY1D 4UILL 5A2JH 4MMZC 3MGTB 1H3TA 2IC2A 3CFBB 4QXWA 3EZJB 1BZQK 5I1EH 1FBIH 1NUNB 4MXVF 1J0ZA 1JGVH 4FFYL 3RA7H 3FFDB 4MNQA 5DK0A 2IFFH 4RISH 5GS1A 1F3RB 2L7JA 1YQ2A 5C9KA 3KGRA 5CEZE 3BQUC 4N9OB 4XP1L 5EO0A 4PJFE 4PRBA 3P3YA 3U9UB 4ZTPL 2UZIL 2AJUL 2DMKA 3ARRA 1ZV5A 1KELL 5I1IL 4L8SB 3VXME 2Z4QB 3TFKD 2G5RA 1CXIA 2E6JA 3MOAH 4PRHB 1BZ7B 3VXUB 1VDGA 2GJZA 1K85A 2ITCA 4HZLB 1UACL 4BZ1H 4HX1A 3IFPB 1RK1B 1B4JH 1FVCB 5I1DA 2PYEE 4CNIA 1RZKL 1LDPL 1ERNA 2BSSB 3M17B 5DWUH 3VCLB 4G3YL 3C6LC 5D7LD 5GHWH 1I8LC 5CEXA 2F54A 3HKFA 3T8XB 5HYIA 1GAFH 3F8UB 4OFIA 1L7TH 5BJTA 2M1KA 1MJUL 2P5WA 3WJJA 1A14L 5EUOB 3SDYH 1UZ6F 5D7SH 4U6XB 4NWUL 2VC2H 4Q9QL 5IFHL 3W2DL 4OZIE 4IS6A 4GW4B 4YDKL 4KKLC 3T8XA 3UPAA 5B8CC 5DVKA 3NCYS 4WEBH 4M3KB 3FQTB 2J8OA 1QVOA 4OLUL 4Z0BH 5DMKB 1JHTA 3QJFA 4YXKL 3CXDL 3P11L 4HKJA 1MRCH 5LG1A 5HGAA 4PV8A 3GK8H 2F9BT 4NZRH 2B2XL 5D2LA 2ITCB 3MRLB 2R1YA 5C0RH 2FX7L 3IU3B 3PL6B 1D5MA 2XV6B 4J4PA 2VLKE 2PYED 4F58H 1MAML 3MXWL 4HWEH 5ALBH 2CLVA 2MPAH 5T1LA 4LGRB 1N6QH 4Y16B 2NNAA 5IVZA 4G6MH 5HDBF 4HUXB 5JOPD 5C0CA 2Z8WC 1F3DJ 5MENE 1YYMH 3WJLC 4JG0L 1F4AA 3MLWH 4JCMA 4X98B 2P46B 4HCRA 4JY5H 3ULUH 3ARBB 4JHAH 4MNQB 3QXWA 2Q3ZA 5CGMA 4YHLL 1J05A 1DBMH 4PIRF 4HC1L 2QTEA 3NIFE 1CDJA 4ZS6C 4Y89A 3DUHA 3LV3A 5KVEL 1N64H 1HN1A 1PX4A 5IW1B 5DGRA 5I8KH 3H9SA 1C5CH 4OF8A 5GSVB 4N9GB 2Y5EA 4L29A 1TXKA 4IRSC 5KOMC 3P4LA 2PCPB 3MODH 4UV4L 3T0VA 1S5HB 4YHPA 5CIPH 2R4SH 5FCUH 4FQHB 1FO0A 4M7KL 5H94A 4OCRH 1BGXL 4HKBB 3EJYD 3MFGB 3ULVC 4K2UH 4TTGA 3QEGL 3D0VA 1HHJB 1NGQL 3INUL 3JWDH 3ZYJA 5DA4A 5E6IC 4WU7B 4JM4H 3KJ4C 1AXIB 2CIIA 4UU9B 1SJHB 3QO1B 4DZBB 1DLFH 5IMOA 2BFVH 4WI3A 4E41B 1V5JA 5DJAA 3LZFH 1FAIH 5CINL 1MQKH 5DRZB 1A6UH 4JRYE 5FXCH 1QQDB 2KZ1B 4R90L 4Z5RA 4F7MB 1R3IH 4CMMB 3C8KA 5DHXB 1AXSB 4QRRA 1VFBB 3VWJB 4MXQC 5FUCC 1KLUB 4YWGH 4R0LB 4QWWD 3UJJH 4MS8C 3OJDA 1PZ5A 5J9PB 4M3JA 4I3GA 1NUGA 5JIHA 1VHPA 1JNNL 1O7VA 5ITBL 3LSOA 3SDAB 2NX5A 2ZG3A 5L88H 1C1EH 3BDBA 3TYFA 2H6PB 1G7QB 5LCVL 2IH3A 1A6ZB 2JIXD 3D25B 3MRFB 4X7TB 1VADB 1YNLH 3HG1A 1U3YA 2ZUTA 4ZAKB 4F15C 2V7NA 2HJKB 2GSGB 4XCYB 1ZT1B 2AK4D 3OV6A 4ZYKB 4U6YA 4U3HA 1NL0H 4KPHH 1RULL 3RVTC 5GZOD 4AT6A 4OZHB 1JGDA 4JO2L 4U7KA 3STZA 3KNBA 4JJ5A 1WBYB 5TFSL 5KS9A 5CUSL 5E8PB 2FH8A 1U0QA 2EDLA 1V3KA 2V5RA 3OR6A 3VFNA 2ZUXA 1IAMA 5FV1L 3BWAA 1K5NA 4U1NA 3AXLA 5IJKC 3R06A 3H9SD 4TNVK 2OTPA 4FQXA 5J11B 3MNWA 4HBQA 2A73B 4NYLB 5SWSD 1EVTC 5HYFA 1OQXA 2X42A 4FQJH 4X5XB 3WFZA 5C08A 5FB8A 5C0AD 2YS4A 1N5AA 1T5XB 1A6AB 4FXLA 3QDGB 4ZNEA 3AVEA 4IM8A 2DM7A 4G9FD 2MQ0A 1ZHLA 2O5ZH 2JKXA 3V0VA 2FIKA 2VLRD 3TIEB 1SJEA 5EIQA 1IGYA 2WWMD 3Q5OA 1I7RB 3ZYZA 1NCCH 1HQ4A 4N1HB 4LDEB 5JZ7D 1RVFH 3MRRA 5BV7C 3X13B 3KPPA 2QBWA 4C4KO 1WT5C 3ARZA 4X99B 2DMBA 4ETQA 3BN3B 3KLHD 4F8QA 3CJJA 4GAGL 3WFHA 2D7OA 4NN6B 1AO7B 1ZGLM 1ETZB 4NCC2 2VQ1B 3BQUB 3OXSA 3U4EB 1FJ1B 5I0ZA 1TZHA 3DETC 2LVCA 1X6NA 1DDHB 4CAGA 5J06A 3PQYE 3VD9A 5D1ZD 3VXNB 1F8TL 1QFWL 4D94A 2GJ6D 4LLUB 3DSFH 2FLRT 4D0BB 3RWEA 3X13A 3VXQA 1RZIA 2W60A 3H7LA 4KGJA 5KSAC 1X7QA 5CKAA 2EE6A 2OP4H 2F8VA 4EUPG 4YXLL 1H3WM 4Y5VA 4U6VL 4QTIH 3MLYH 5DMIL 1DBAH 4ZTOL 4Y4FA 1R5IB 2BSTA 2P8PB 5J1SC 5J11C 2EYTA 8FABA 2HN7A 3KLDA 3QIBB 4GAYA 3DGCR 3OAUL 4PJHB 4MB4A 4U6TA 4XXCA 5I18L 5D7IA 3DROA 2GK0B 2HKFL 3JXAA 3LQAL 2OTWA 4KI5E 5E8DH 3U4AA 1WBXB 4POZD 2MWCA 3IRPX 4J8RB 5J0BA 3QXDA 5T1MA 1XF3B 4LGPB 4KJWC 2VLLB 1EBPA 2Z8SA 3BPLB 4O2CB 4XVSH 2AXFB 3D2UD 2VAJA 2BVPB 4OV5A 1C7SA 3C60A 4OCWH 3N1MC 2A38A 3QWOB 2J8UB 4OM1L 4Q74A 1A2YA 4JPWH 5D2LF 5E8PA 4JVUA 4YUEL 3EIFA 1HHKB 2GAZB 4JKPL 1SMOA 1JGUL 4YDLB 5DO2D 3P0YL 7FABH 2EE3A 3TBTB 3NPSC 3TBYB 4GUPA 1M71A 1R24A 1RZJC 2XY1A 3VWKB 1ZKAA 1WFOA 1KJVB 2AV1A 3HUJB 4LHQB 4JPKH 4XP6H 5CLWA 1ZWIA 2ZP0T 4LRIA 4UIMA 5DJ6A 3BT2L 4HFWA 5IJVA 1OT1A 5IKCA 3X3GH 4HS3A 3RWFB 3DOSA 3BRDA 4TRPL 1A6TA 3U36B 3LN4B 4QT5B 5IB5B 4PS4L 1HXYB 1C5DB 4NWUH 2XZAH 4KTEL 3QJHB 5HGBA 4Q9QH 4U49A 1WZLA 3S36L 5HHPB 3SE3A 4B7IA 4RQQB 3WD5H 5HYSB 3MRGB 3QDAA 4H20L 3AS0A 1OP5K 2E6PA 4HZAA 1K8IA 2HJLB 5E8NA 3WO4C 2X4TB 5J13B 3HLAB 5IMLA 3OJ2C 2VDLH 5TE7H 1IGCL 1RJYA 1PY9A 4HS8L 4J3UA 5IGXH 1RUMH 4HWEL 4XPBL 1MAMH 3DUUA 3VFVA 1UWEL 4Z8FL 2DLTA 3V52H 4X8JA 4UB0H 5EBGA 4OM0L 5D7IE 3QEQA 5IW3A 1B0RA 3F12B 4LLWB 4N90D 2VUYA 3QUZA 4JN2B 4LLQB 1Q9KB 5GGQH 3WXWL 4QRQB 4KHXL 1RJCA 4OT1H 3HNVH 3IJHB 2E6QA 1KN2H 2PCPA 3FOMB 3HUJF 5C09B 3T2OA 3QUZC 1TVBB 3OKYA 1IAIH 1A3LH 3SY0A 1QNZL 4NUGH 3EO0B 1INEH 5DJ2A 3F5WB 3V4UL 3NCJL 1CICB 3KAAA 3MRPA 1HINH 1IC4L 4O02L 5L2JA 4Z7QF 3EYUL 3QNXA 4PG9A 3HNTH 3OSKA 1UCTA 5KSUA 1UVQB 1CGWA 2MKWA 5GRJH 5C6TL 4LPVA 2B1AL 5D96C 3IDGA 5F8RC 4DCQA 4X98A 3RVXD 3MRRB 2J88H 5EOTB 2LU4A 4ELMF 2IEPA 1WICA 3L9RB 3I6GB 3O4OC 3FQWA 1MUJA 4X6FA 1MNUH 5GISL 1JNHB 4QT5A 3SHSA 4R7DA 4RMTA 1TNMA 1MQ8A 3LS4H 1N59B 1JZ4A 4NZTL 4HFWB 3PL6A 3KYOA 5IJVB 3TGXA 2FJHB 4IOFC 4NCDA 2DKSA 2R1XA 4S1RH 4CMHB 1L7IH 4PJ8D 4P2RA 2Q7YA 3S3PA 2AQ2A 1EHLL 5FDWA 3EAKA 3DUSA 4KKBD 4PJIE 4V2CB 2VMFA 1OVZA 3FB5A 3VGGA 4LLDA 4YK4C 2DD8H 4XP4H 4EN3C 3PDDA 2MOVA 5AD0A 4G8FB 4BFBD 4QOKB 1ACZA 3BPCA 4PLKC 1KEMH 4U2ZA 5I76B 5KG9A 3C60B 1KPVA 4YX2L 3KPNB 3RX8A 4NDMB 3CFKB 4GXUN 1WF5A 3RNKB 3AAZB 4JQXC 5ACMA 3ZDXE 4QEGA 2Y6SC 1INDL 3R1GL 3VXUD 5FYKD 4RMWA 3MMEA 4YGVB 1RK1A 5BOPA 3MUY1 4S1SL 3D85D 1JVKA 5D72H 5E9DD 3K46A 3MO1A 3WDHA 5F70A 2G5BB 3QI9B 5CUSH 3U48A 1P84K 4KQ4L 1U8HA 5IB4B 2IAMD 4YEEA 3W0WD 2VNCA 4R4ND 2AJ3B 1KIPA 3D48R 3PV6B 5JW3H 4XXCC 1F42A 1KYOK 2D9QB 5DEFB 5EO0B 2EDTA 1G7QA 1N26A 2OCFD 3DV6B 4PBXA 1IGFH 2JELH 2VE6A 4J1UA 4FZEL 1U3HC 4TSCL 1XGQA 1H5BA 1FCCA 3NA4A 1SM3L 5L2KA 3V0WL 4L3EB 3CCHA 3O4LB 1O0VA 1OW0A 1CL7I 1OGAB 2DYPD 2CK0H 1KTLA 4S10A 5JIPA 3SDCB 1J0YA 2B20A 4P5TC 5TE6H 1YEFH 2FJGA 2FH6A 4GBXB 4R8WH 2Y4SA 3G5YB 4WI9A 5D2NA 3SGEI 4PJDE 3JTSB 2DBLH 4Z76A 2DM2A 4ZO8A 5D8JH 3EW3B 4LEXL 3QO1A 4DZBA 5E8OA 3ZE1F 5HGGS 1G84A 2OQJA 4A6YL 4BJLA 4I2XA 1HEZB 5EBLB 3PGFH 4WW2F 4LVHC 5J57B 3N1FC 5CGYD 1FVDA 5ALCH 4CUCA 2XACC 5E6ID 2L0DA 3VXRD 4DTGH 2AK4E 3IRZA 3QIUD 3OQ3B 4PJAA 2V6HA 2DI9A 3BZEB 3OB0H 4KRNA 5JDSB 5BS0B 2D7QA 3QIUB 4N9GA 2P8LB 3C9NA 4OLWL 5KAQF 2IF7A 4U1GC 5EC2A 4OD3H 5FYJD 5BV7L 2JLLA 4RAUA 1QACA 2UWEB 1CFNB 1CFNA 4DKFH 2GK2A 1T7YA 4PJEA 3U7WH 4GRLC 1OSZA 1YQVL 5JPMA 3L95B 5EU3B 5B3JF 2R23A 1GIGL 5SWZD 5C8JB 1V7NH 5LQBH 3GJEB 1MWAH 4HUXA 1YECL 3KYNB 4ZDHB 1NDGA 1N5YL 3O6FB 4H8WH 1E4XI 1CE6B 2I25N 1SBSL 1N0XL 1OF2B 1FVDB 2Z0BA 5A40E 2CLVB 2CRMA 1YYLH 2YN3A 3X3FH 4M7LT 4XNZC 2FEEI 4PGCB 3O3BA 3BOVA 3QCTL 4R7NA 3ZDYE 1MLBA 2IADB 4LAJH 2LTQC 1M6OB 3QPQD 4TSAL 5IR1B 2KH2B 2M26A 3SDDC 5EZLB 1OP3K 5B38B 3IJSA 5DMGD 1WBYA 2OI9C 2ZCHL 1T21B 3WO3B 4TUJA 1DP0A 1HYRC 2FX9H 5E2UL 2JJUA 3B9AA 4XHJC 4HUUB 3MSPA 1A1MA 2DTMH 4RZCB 1YEGH 4LPYA 5KSBA 4ZOCA 2Z91A 2J8UF 1GOGA 2W9LA 1L7TL 1K4CA 2XRAH 2W38A 1XH3B 4NOFA 2Y5TB 4OLZH 4MZ2A 3FB7B 3S37H 1J8KA 3M17A 1FO0L 3U9PH 4I9WD 5GGSY 2FEEL 3IB4A 4YBLB 3TO4A 3RY4A 2XNAA 1Z6JT 4NQCD 2CLZB 5F97E 5J9PA 4MXVE 1OB1A 5J3HC 3CH1A 4PRHA 5AG9A 5J89A 4FQQB 4DKEL 3BN9D 3QIUA 2R69H 5H37G 4EQ3A 2D4FA 3PABB 4NZRL 3U46A 1OD9A 3H9HA 4KKBC 3CSBA 3BZ4A 1EPFA 2CUMA 4KY1H 3HG1D 3VDCA 5DF0A 3L5JA 3O2WL 4HJ0D 3G5ZA 5E00A 4AEEA 1AIFA 2ZKHH 1ITCA 4LDOB 3H3PH 4LL9A 1N2RB 4NKDB 5DQDL 1MELA 4UTBL 2ARJQ 1LQSR 5F21B 5I1LA 2Q76B 3N85H 1YYML 1F3DH 4ONFL 2IQAB 3MLWL 4HLZG 3U30B 3VXOA 1W72B 3BN9C 1JN6B 5C0DA 1U8OA 3KPRE 4K8RD 2H2PC 4R4BA 1KOAA 3MREB 4GQPH 4ZXBA 3DMMB 1QLRB 4XVUD 2CGRL 3E6FA 4FABH 2Y7QB 3UJIH 4DVBB 3H0TA 1N64L 5FK9A 1NGXA 5BRZE 5I8EA 2P43B 2VLRB 5CEZH 4Q2ZA 4JFZL 2A6JA 1XF4A 4HS8H 1CG9B 2FJHA 4JANB 5AUMA 3ARGC 3WIIH 4OKVB 5E1HB 2QR0A 2G60L 5D7KE 3TWCL 3E2HB 2VR4A 5TQ0L 4GG8B 1WT5A 3DRQB 1YZZA 5IMMA 1OAQH 4UUJA 5FOBA 5F96L 4MD4B 4NQSB 1P7QD 4WTZG 4L8BB 3BH9A 3WHXA 3K80A 2UYLA 3W9DB 2WBKA 1MY5A 4KKNA 4P23C 3VFPB 3S9DB 5T3ZL 4MQ7A 5C08E 3EGSA 3SGEH 2VL4A 2GJJA 4KI1A 2X1XR 2YPLA 3JV4B 4P46C 2N1KA 2AI0L 5DMKA 4A2MA 1DQMH 2AKRB 4OQTL 1AGDA 3RA7L 3WN5A 2X7LA 5HHMB 1X5LA 2L7UA 4HUWA 5H37H 1U58A 4GG6A 2GW5A 2QEJA 2XWTB 1JYNA 2E3VA 4H0HB 4J23A 4LCWB 3TBVA 1UYWL 4GS7B 4JO4H 3C2AH 5C07D 4LSDA 1DLHB 2X89D 3KR3L 2IH1A 4ODTH 5DJ0B 3MCLL 1MH5B 3ARDB 3QNZB 4HJGA 3RL1B 4BQCA 4UIKH 2BVTA 2OYPA 2IPUK 3CPLB 1OTUC 3HZKA 3O6KH 1NCDL 2R2CA 3V79C 3MV01 1D9KC 3PP3K 2X1QA 4O58L 3B2UC 4KK8C 3FRUB 4QHUB 4BZ1L 4Q9RH 4YK4B 1MJ7L 3EFDL 1G7MA 5ID1B 5DWUL 3ARWA 5ISZB 1N3NB 4JDZB 4XNYH 4XPAH 4M93C 4KROC 3RWIA 1GAFL 2XXMB 5L2KE 2AABL 5HHQB 5D7LA 3B2VH 1WFUA 4JE4B 1ND0B 4XGZB 1MFDH 1BBDH 5HYJB 4FQLL 1EERB 2J8HA 3U36A 3QDJB 4QRSB 5C0EA 4HXBH 5IIEB 1IGJA 1QLFA 1BX2B 4WFGE 1S9XA 3D18B 5GS1B 1W0YT 4LSUH 4ODHL 4R4FL 3PL6D 3IXTA 3GJFA 3EOYG 4NZDA 4Y1AD 3TIDA 3CC5A 2H45A 4XX1G 2R0LH 3TBYA 1B2WH 1DTUA 4U1IA 1I7ZB 3TCLA 2ZNWA 4YIQA 5DHYB 4IBLT 4TULL 4HKXA 1TVBA 3HC0A 3ARPA 2YK1L 4NNYA 5FUOH 4ESKA 3L3IA 3SDDA 2YMXL 4N1CA 4JFDB 2ZOLA 2XTJB 3ECBB 4GXVH 4J4PD 5GRYA 1KPRB 1U3HD 1VCAA 4JFDD 1KLFA 3ES6A 2XWTA 2XN9B 4YBHA 1FYTB 1OAUL 3VFVB 4HPOH 1Z0MA 1XF3A 2AEPL 3RIAK 2KUTA 3I6LE 1IEAB 1QSEE 3HB3D 4LCCC 4UDTA 1NMBH 5IMLB 3OKOB 3LVEA 2L4OA 2BERA 4KKCC 4KV5F 1RZFH 3KPTA 4PJ9B 2XZCH 5T5NG 4N8PA 3RKDD 3DYPA 4JDVA 4QHLA 3MJ6A 2X1WL 3TC9A 5CBEA 2F53B 2P1YA 1S7SA 3JVGA 4FS0A 3JWDL 3DRQA 5IMMB 2F74A 4JVWA 4M61A 4TOYL 2BXZA 1NLBL 4NKQB 3EYVA 1II4E 2RFXA 1VEOA 4XC1L 1G7HA 4G9DB 1UXSA 3OKEA 1I8MB 5DHVB 4TTDD 1BOGB 4XCEB 1KJVA 2AV1B 4Q97A 2VDQL 2X4RA 4PJIB 5CINH 3ZE2E 3HZVB 4ZUVB 4LPTA 3GM0A 4WFFD 5D1QD 2PKDA 5DYOA 3LPFA 3GO1H 4NNYB 4D2NA 3FKUS 3V8CA 3BRGC 3R8BB 2RGSA 1WV7T 3D0LB 3U4EA 4J2XA 5FYKH 4MNQD 1T2XA 5TDPB 5I18H 1URLA 4I8DA 2BCKA 1DVFB 2ZUUA 3C6SB 3B5HA 2P48B 3CC5B 3V8OA 2J1KA 1JPFA 3KPQB 1RFDH 2YOCA 3L3HA 3W11D 1ZLUK 3WBDA 5D1XC 2FB4L 1NCWH 4KVCL 4XZUA 1FAKT 3GSWB 4KK8D 1RURH 4NNXB 5DEGA 1N0XH 2IPTL 3PABA 4PJCE 1Q94A 2XA8H 4HWZA 3DVGA 3QG7H 1CGXA 4K9EL 1NL0L 4KPHL 3QZWA 1I8LA 4YE4H 4JO2H 4Z7VB 4JPWL 5KVDL 1CDBA 3BIKB 5MENB 2NY4D 3O8XC 4MJ6A 2HAZA 1OWRM 1JV5A 1R3LB 4MWFA 5JXED 1MVUB 3I3BA 4XCFH 4P2QE 4Q6YA 4MNQE 4PD4K 4YHKL 1MJJB 4R9HA 3SDAC 1GCFA 5I66A 1ES0A 3U0PB 5HHVL 3CU1A 4D9QD 2DLEA 3KPSD 4PJFA 1MFCL 1WCQA 1M1SA 1VEPA 3PGCB 3RRQA 2OZ4L 1QFWI 2NY2D 4JQXA 2A83A 3THML 1JGEA 4JPVH 4U1NB 5DUBB 4G9FB 1ZLVK 1Q0XL 3KYAA 1FGVL 1TENA 3DMMD 3G6AB 4K3GA 3OR6B 2ICES 5IROA 4F7CA 1MCNA 1TCRB 1FDLL 4UBDC 1EHNA 4KC3B 1CDIA 1FN4A 3MRBB 4KMTH 1L6ZA 1U8NA 5F7DA 5C08D 1QA9B 4G6FB 4YEFA 3D39E 1Z5LA 5A3IC 1IM9D 3ZKMC 1J8HD 1KG0B 5KSBE 3OKKB 1PKQB 3Q5YA 3NH7L 4RAHA 4MGXA 5ESAA 3SDCC 4ORGB 5GXBB 3BH9B 3WHXB 5MP6L 2CQVA 3PF2A 4KY1L 5BS0E 3DTXB 3V52L 1P7HL 1RVFL 1T22A 2GY7B 3WS6C 2HH0H 2MCPL 3N0PB 1REIA 4I5BA 5FO9B 1EH9A 2P42B 4K8RC 3BP6B 3A0OA 5I8CB 1LHZA 5DJ8A 3DRTA 4PJ7E 4BK4A 2HKHL 1BM3H 1MLCA 4KHXH 5EBMA 3GI8H 1GZPB 2VAAA 5ICYA 2F8XC 4PJGF 1FPTL 3LKQB 3L6FA 1PZ5B 1CLZH 4AM0B 4HFUH 1I8KA 4E42A 1T5XA 1A3LL 3DVNA 3S8WA 3C5ZB 4OAWA 4LNVA 1CTOA 4FABL 1LK2A 1QFWH 1T0PB 1GZPA 2P49B 3C5ZD 2B4CL 5IBLC 4D9LH 1QLRA 1JGVL 4Y16C 2B1AH 3P40A 2AEIT 4FQIH 4NHCH 3AM8A 5DJAB 3GB7B 3UTSA 4UT6L 3WIIL 5IMOB 2VDMH 4L4TE 5INDB 1J86A 4U3CA 1GJIA 2Q76A 2UZIH 3G6DH 3TZVC 1MHHA 2WUCL 4U6VH 4E0RB 1G9EA 2GHWB 3ILQD 1HHJA 5JW4N 2CMRL 1PFCA 2HT4D 4BUHA 4X5LA 4EUPB 1HILB 2OSLA 4LPWA 1A7RH 5BRZA 5GS0H 1B4JL 1V3JA 3UTPD 3MGOB 1ZMYA 4WHYG 4XMLH 4XPHL 4WHYH 3EDKA 5TH2A 3O6FC 1RK0A 2XKNB 3KPRA 5GHWL 3B3IB 4F9PA 1VADA 1E4KA 2YD7A 3MJ9H 1F4XL 3QFDA 1MJUH 1U92A 2DQCL 3D87B 1F13A 1RPQA 3VGAB 4XNUL 4PJFB 2YPKB 2VC2L 4LP5A 2WLYA 3WNKA 4FNLL 2OR9L 2AJ3A 4YX2H 3PV7A 4J4PC 4X9IA 2QHRL 2CD0A 4WU5B 4JKPH 4NHUB 5JR1H 1T0NB 3P11H 5T5FL 4PGEA 1KEGL 1AXSA 3GI9H 4Z7UE 2FRGP 2WZPD 1G0XA 1R3JA 4YZFF 4BFGA 1JHTB 3UTPE 1MJ7H 3NPZB 4NKOB 4GRWB 5CP3A 4XP6L 1UCBH 4WI5A 3VE0B 2BVOA 3NFNA 3RUGF 3ULVF 1LEGA 3HNSH 3MV7B 2CIIB 4TRPH 1AXTL 5C3TA 4QRUA 3QUXA 5EUKA 1UH3A 2ITDA 2XY2A 5I76A 3GJFK 1CBVL 4EOWL 2ZCLH 4XAWL 3EDFA 1TJGL 1FFNB 3TA3C 5E8EA 4GG6E 1A7QL 4HMDA 1WZMA 1YJDH 6CGTA 2A1WL 3UTSD 1DUYA 2MQCA 2X4SB 2EYSB 4TN9A 4U1SA 1K9TA 2JB5H 3GRWA 3P73B 3G04A 3CFDA 4UV4H 4MAYA 5IMKB 3LEXB 1UWEH 5SX4H 4Z8FH 2QADC 2SEBB 3ARBA 3ROLA 1GC1L 5C2BL 3KYOB 4IRJC 1U42A 2R56L 2ICEB 5TQ2H 2YUXA 3GMQB 3GUTB 1E4WL 1X5HA 4JKWA 1QBBA 2ID5A 3GBMH 3DTXA 4JFQB 4K7PX 3Q0HA 2X4NA 4XTRD 3UTTD 2XI9A 1N4XL 2Q8AH 3VH8A 1X4YA 1PKQA 3BYYA 4I48B 3OKDA 2EH7L 1W72L 4JFFD 2BNUB 1CTNA 3NVQA 1OGAE 4LMQI 4K3JL 2P45B 1Z5LB 3JTSA 3RBSA 4KJYA 2V2WA 1KCKA 4X0KB 4RRPA 2XZCL 3TV3L 12E8L 1KCVH 4HWNA 4JFEE 4OB5L 1HYSC 4MX7A 1I1RA 2FZ3B 4G9FA 3FOMA 3TN0C 2E27L 1C8PA 4LEOA 4WTXA 3SE3C 4LLWA 4ZAKD 2BSRA 1P2CA 4Z95L 2VLJA 2BOCA 3T3PE 1NLBH 1EJOL 4RGNB 4MMXC 2IBBA 4H8WL 3ARGD 3RPIB 5IBUB 3RUGB 2DWDB 1I1AC 3HPJB 3VGDA 3B9DA 4GRWF 4YHNA 3S4SA 2FJFA 5GS2D 1R5WB 5MEPA 3CLEL 3KLAA 5TFSH 1I1AA 1MI5B 3GIVB 4OTXH 5HHPA 1NC2D 5HYJE 5IP4A 2IBGA 3G5XA 3BIKA 1E6JH 1I3VA 1QRKA 4M1CD 3FCTA 3QIBC 1D5ZB 3MMEB 5HGBB 3VXRE 1Q94B 5FHAH 4PJAF 5LKNA 2DTML 1S7QA 4PBVC 4LLAA 4U33A 1JZ8A 4YPGA 5JQHC 2EIEA 1A6TB 4D0DA 4RNRA 4F57L 3OG4B 3DXAB 4WW2A 1LP9E 1ZWIB 4AEIL 5IB3B 2ICCA 3SJVB 1YEEL 5AEAA 4H5SB 1MAKA 5C0JA 5DA0B 3MRIA 4K9EH 5MERA 5C0BB 5KVDH 3OGCA 5D9SB 4M00A 5FDWB 1G7JB 1S9YA 2ENYA 2QQNH 3ZKXB 4XMKH 5C07A 5BZDB 1YEHL 5T5NF 3SPVB 3DURA 1T03L 2R4RL 4OV5B 3V5HA 4UMGA 5HHVH 3TVMD 4AY0A 5GRVL 1NFKA 2R0KL 3AS2A 5F3BB 4MCZB 25C8H 3CK0L 1LVEA 4PJXA 3OAYH 2BVPA 4H1LA 3QUML 4G80A 1NGPH 5T1MB 3JWNC 2ADGB 3LIZL 1JZ5A 1BFOA 4NO3A 2Q87A 3X11B 2AJVL 5D71L 5EU6D 1X5GA 1CDGA 5J1AA 1ZHBA 5FF6B 1IEBB 5EU6B 1I1AB 1MI5A 1HHHB 2ERJB 4JLRB 5KSUB 5FYLH 4TSBH 2NY3C 4AIZB 2W0PA 1HH6B 4LEXH 4WCYL 3Q6FA 1IFHL 1XGPB 4KMLB 3S4SB 4ZFZB 4YHNB 4LU5H 4YHIB 3SY0B 3FO0H 9CGTA 3PGFL 3QUZD 1CXFA 1NGYB 5IW6A 4DKDC 1CD9B 4GG8A 5KZCD 1Q9OA 2HMIC 1LDSA 2JK5B 3H9SE 5F6HI 5K9QI 4HD9A 2X4UB 4X7CC 3VXQB 4J3SA 2FCBA 4G7VL 4POYA 2HH0L 4L9LA 3JVGC 4X6BB 3CVIL 3KYMA 5FM4A 4I2XE 3PWPA 3EYOA 3ZL4H 1NMAH 5C0GB 3VXRA 3QEQB 2VN7A 3MRKA 2XQYG 4WIQA 5CJ8A 2HKHH 3K8KA 4L8CB 5JORA 1RZGB 5I1CH 3QXVA 1KXQE 3OAUH 1H0DB 4WUUD 2X4TA 2PXYA 3MFFB 3QEHA 3VFWA 5DUMH 3CMOH 4FQCH 4Z7UF 2YSSA 5HYSA 1U93A 3QPXH 1YECH 3BQUD 4JKKA 5JMRA 2HRPH 1MWAB 4OFDA 2E7HA 1FL3A 3J8F7 3QJHA 1BX2A