2P9LA

Crystal structure of bovine arp2/3 complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
415
structure length
399
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 124
structure length 399
sequence length 415
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9lA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9lA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9lA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9lA04
4BREA 1V4SA 2Q31A 4H0VB 5BREA 4YDUA 1BG3A 1RFQA 4B1XB 2EWSA 4BR2A 3C7NA 3O5BA 2QW9A 3VEWA 3ZEUB 2VCPA 2P9SB 3QFPA 1LCUA 3M3ZA 2E20A 3ZETB 2CGKA 3LDOA 5EVZA 3CQXA 5B8HA 1QZ6A 2GUPA 1WOQA 4MO5A 1SAZA 5F1XA 4DCHA 2IVOA 4MO4A 5E84A 3QICA 5CE3A 4RWTA 4B1YB 4K41A 4BRIA 5KQ8A 3MMVA 1C0GA 2OANA 3D2EA 2A40A 3CI5A 5FPMA 2NLXA 4FWNA 4CBXA 4CZGA 3LL3A 5KPRA 4CZEA 1JCFA 3VF6A 3CJ1A 4CD3A 1TUUA 2ASMA 1TYQA 2A6AA 5AQVA 3R6MA 2I7NA 3VGMA 2QWRA 5EXWA 1DEJA 2BTFA 2V7YA 4CZFA 4DQ8A 3GG4A 5BPNA 3LM9A 2P9UA 1XQSC 1U6ZA 1QQOA 4CJ7A 3OHRA 3FZMA 4FWQA 1NGAA 1BUPA 5EY4A 3WQUA 3C7NB 5JMVA 4FWSA 3UE5A 2IVPA 5AQJA 4BGAA 4PL7A 3O1BA 4IXCA 3H46O 5KPZA 2V7ZA 4NO7A 3M1FA 4BR7A 3FZFA 2I7PA 4IZ9A 3JXUA 4EHTA 3QBWA 3VPZA 2ZF5O 5AQSA 3VERA 3GDQA 5AQNA 3D2EB 3IMXA 3BUZB 1BO5O 1K8KA 4FWOA 1P8ZA 3WUHA 3GOIA 1ZC6A 4CZHA 3G25A 4H5TA 4BRFA 3VENA 4J8FA 4WQ4C 2E2NA 2GTDA 5EOYA 5BN8A 2CH5A 3L6QA 1GLLO 2ITMA 4BG8A 3TU5A 1HLUA 2QWOA 3A5NC 4CZKA 2E2PA 4H0YB 2Q0RA 4FWKA 2A42A 1DKGD 4BC3A 4M7XA 1QQMA 4WYBA 1IJJA 4H5RA 4XH4A 5BRFA 5LJVA 3H1VX 3O8MA 1Z6RA 1YXQA 2FLOA 4JAXA 5FPEA 3D2FA 3KHYA 5AQYA 1XC3A 1MA9B 2WUSA 2GWKA 2YI1A 1ATSA 1NGJA 3VETA 3BEXA 4QS7A 4WQ4A 4IJNA 2QWPA 3ULEB 3WXJA 2UYTA 3SK3A 4Y0WA 3SJHA 3ZX3A 5KPTA 2E2QA 2AA4A 2YCHA 1BA0A 3LM2A 4K42A 3VF2A 4H5WA 1H1VA 4B1ZA 4BRNA 2W41A 2YHXA 1NGGA 2ZGZA 2J4RA 3C0BA 3CIPA 1U2VB 4H0PA 4BQLA 2QWQA 4JHDA 5EX5A 2Q97A 3FZLA 2FF3B 1GLAG 1JCEA 4H0XB 1KXPA 4JN4A 3A5MC 1GLCG 3AARA 3WEEB 4A2BA 4AM7A 1NLVA 3EKSA 1C0FA 5AQUA 4BVOA 4IJAA 4BR5A 4ISFA 3M6GA 3D2FB 4M63C 3QDKA 1HX1A 4BRAA 3MN5A 4B1VA 3O08A 3EL2A 5BPMA 3I8BA 3CJ9A 4JD2B 3FZHA 1KAYA 4RCHA 1QHAA 2VWBA 5AQTA 2F9TA 4EIAA 3VF4A 3HM8A 5AR0A 2ZGYA 3ID8A 1BA1A 2IVNA 4H0OA 4WQ5C 1QZ5A 4FPBA 4Z94A 5BRHA 1R59O 2E88A 4EAHD 3GL1A 3HZ6A 3FGUA 4IWVA 4JHDB 1HKCA 2CH6A 5AFUH 3UKUB 4BC2A 3VEVA 5AFUA 5BPLA 2FXUA 3EKUA 4H0TB 1SQKA 3MN9A 5AQHA 1MWKA 4FWMA 1X3MA 1NGCA 3B8AX 5AQKA 4BRKA 4KBOA 3CJBA 2P9LA 3CJAA 3A5OC 1NGEA 3AAPA 3FZKA 4DHYA 3O1WA 3ULEA 4WQ5A 3WT0A 3R9PA 5AQIA 4DB3A 3QFUA 4A2AA 4BVPA 4ISGA 2Q0UA 1HPMA 1IG8A 3U9ZA 3U9DA 1ATRA 1WUAA 3MN7A 3L4IA 1YUWA 3FE1A 2YHWA 4CZIA 4JNEA 3ENOA 1ATNA 3EZWA 5LJWA 3O6WA 4ISEA 3UKRA 4CBWA 4E1JA 3CERA 3DJCA 4BROA 1U2VA 4FSVA 5FPNA 3DXMA 2A3ZA 2BUPA 2V52B 3DWLA 3GE1A 4XH5A 4C23A 1NGFA 2ZWHA 5AZJA 2QWNA 3H45C 5AZIA 1NBWA 3HTVA 2H3GX 2D1KA 3WEEA 5KQDA 3W3DA 3KVGA 3HSCA 3VGLA 1S22A 1E4FT 5F0XA 2QXLA 3IUCA 4BRMA 4CZJA 2P9LB 4LC9B 3FR0A 3SMPA 3EO3A 3IDHA 3WQTA 1NGBA 3VESA 4L3QA 4B1WB 4BR9A 1NM1A 1OKJA 4JD2A 3LDLA 2P9IA 4B9QA 3QB0A 4BRLA 2IIRA 4K25A 4CZLA 5BR9A 2PAVA 4MLEA 1HKGA 3F9MA 4PL8A 5AQGA 4CI6A 4BRCA 3VGKA 1CZAN 2PBDA 3CQYA 3UKRB 2E2OA 3DXKB 3MK6A 3U4LA 5F2RA 3L0QA 2A41A 2GEMA 2P9KB 1NGHA 4PKGA 3DXMB 5FPDA 3A8YA 3GBTA 4H5VA 5AZJB 3UKUA 4EFHA 2HF3A 3CETA 5AZIB 3W0LA 2W40A 1Z05A 1BWFO 3MDQA 4A61A 1DGKN 4FWRA 3VOVA 4XH1A 1RDWX 1XUPO 1TUYA 4F9OA 3CHWA 1G99A 4FWPA 3S41A 3JS6A 3IFRA 3VEZA 4BC5A 2GELA 1S3XA 1ESVA 2NZTA 4GY2B 3QMLA 5I9EB 2HMPA 2Q2RA 5JLHA 3P4IA 1X3NA 4O5FA 1T6CA 1RGIA 3LDQA 1T44A 2HF4A 4BRDA 3ATUA 3BP8A 4BGBA 1V4TA 2ASOA 2QWMA 2P9IB 3O4WA 3SLCA 3H1QA 2FF6A 4BR4A 4AM6A 4H5NA 5AQPA 1KAXA 4A62A 3O80A 5ADXH 3H3NO 5ADXA 3A0IX 2P9NA 4I6MA 2F9WA 5AQXA 1BOTO 1YVNA 2AP1A 1T6DA 3SMSA 5BN9A 5AQOA 3VEOA 2QWLA 4BRGA 1J6ZA 4PKIA 1YAGA 2VYPA 4XEIA 4B1UB 3BF3A 3EN9A 2CGJA 4RTFD 2GWJA 3ENHA 1D4XA 4M7YA 4BRQA 2ASPA 4K43A 5JICA 2D4WA 2YJFA 4BR0A 2YHYA 4EHUA 4O8KA 5AQRA 3TPQA 2P9PA 4CD1A 4HTLA 1HJOA 5TKYA 1NGDA 4NB4A 1MWMA 3HI0A 2FSKA 3D7EO 3DAWA 2E1ZA 3LDNA 5BRDA 1GLFO 4FL9A 1Q18A 3WXIA 1Y64A 3FLCO 3DXKA 2P9KA 3MCPA 5AQFA 1NWKA 3H6EA 2P9NB 1GLEG 2Q36A 4I6MB 1GLBG 1LOTB 1MDUB 2D0PA 3RSEA 3KZBA 1BDGA 5AQWA 2A5XA 4BG9A 3VEYA 1ZXOA 1QQNA 3WXLA 4BRHA 2D0OA 1ZBSA 1TYQB 4QS8A 5E26A 3FFKB 2CGLA 2KHOA 4HWIA 3VEXA 4GNIA 5AQZA 3LDPA 4BRPA 2P9UB 3ATVA 1GLDG 1GLJO 2FSNA 4H03B 2E8AA 2NRHA 1X9JA 4FPAA 5AQLA 3ZEUA 2P9SA 3QBXA 3HBTA 3R8EA 3ZETA 5JLFA 4FWLA 3AAQA 5AQMA 5LY3A 4CBUA 3CJ7A 2P9PB 1BU6O 3AY9A 3I33A 3MN6A 1HUXA 4FO0A 1NMDA 5ELZA 5AQQA 4YDUC 3ZX0A 1EQYA 3BF1A 1JCGA 4CZMA 4FOIA 3U8XA 3H3OB 4FOEA 3UB5A 1KAZA 3WXKA 2DPNA 3A5LC 2HOEA 2Q1NA 2FSJA 4PKHA 4QS9A 1K8KB 4IO8A 3RSEB 3CJCA 1HKBA 1E4GT 1NGIA 4MLHA 4BQZA 2V51B 4BC4A 3J8AA 3ZX2A 2QM1A 1SZ2A 2YJEA 2E1YA
chains in the Genus database with same CATH superfamily
1YTAA 3KTQA 3P39A 4YDUA 1KVCA 1BG3A 1MU2A 4NLBA 2EWSA 3O5BA 4NXMK 1ZBIA 1VQKN 1QVFM 4WCEL 3OW2M 1LCUA 1VSEA 2E20A 4JI5K 4O44A 5EVZA 1L3SA 3CQXA 1EP4A 3CXCM 2GUPA 1N8RO 1WOQA 4CIGA 4CFBA 3KKSA 4HHTA 1HNZK 2X6NA 1NKCA 2IVOA 5E84A 3QICA 3OYFA 4RWTA 3G6EN 4OKJA 2YHBA 3L2VA 4DU4A 4KH6A 4DR6K 3RTVA 1W0HA 4JI7K 3QINA 5AJ3K 4W5QA 2IAJA 4FWNA 4JI3K 4KB1A 2C1IA 3CJ1A 4YOUA 1YIJN 4BDYA 3MECA 1TYQA 1B9FA 5AQVA 3R6MA 2UXBK 3VGMA 5DM6L 1G15A 4B3MK 4F8RA 1DEJA 4L8RB 4CZFA 2YKNA 1XQSC 1HYVA 4KH4A 3FZMA 5E41A 2QI2A 4FWQA 1NGAA 2HHSA 3TAPA 1UWBA 4BGAA 4K8XA 3O1BA 4IXCA 1VSLA 1K73O 5KPZA 3U3YA 2V7ZA 4BR7A 1EWQA 4EHTA 3NGYA 3QBWA 4Z4HA 4NLCA 2C1GA 2BE2A 3D6RA 3VERA 3GDQA 3D2EB 5K14A 1XMOK 1S6PA 4ELTA 4E3SA 4OGCA 3GOIA 4BE7B 3VQPA 4C1NK 3KLGA 3LP1A 2YNFA 3PIOL 2OZSA 3EEQA 4AF1A 4B9MA 4J8FA 4WQ4C 3TARA 2GTDA 1IH7A 2HHWA 2HHTA 4OO1J 2CH5A 2P1JA 2ITMA 3PO4A 1W97L 3THXA 4BG8A 1OH8A 3TU5A 3A5NC 2QWOA 1U04A 2E2PA 4H0YB 2Q0RA 2G8FA 1BQNA 2A42A 4DV3K 4B08A 4DQIA 4XH4A 5HRRA 4GKJK 1VQ8N 4C8OA 3AO3A 4BDZA 3KWIA 3OYNA 2FLOA 1VQ9N 3KHYA 3VETA 1ATSA 1YJWN 4QS7A 3SZ2A 4IJNA 3M8PA 1LWEA 2OPRA 3SK3A 4Y0WA 2HHHK 3AVHA 1XHZA 2E2QA 3CMAN 1ITGA 1H1VA 4JK7A 2RN2A 3OYDA 4BRNA 2YHXA 2KQ2A 3OJSA 2DTUA 3DI6A 2J4RA 4A59A 3V6DA 3P38A 4LSLA 4PHTX 2QWQA 5EX5A 4AQYK 2Q97A 4CJWA 2DFEA 4H0XB 4JV5K 4OJRA 1KXPA 1NNEA 2RPIA 3A5MC 1GLCG 3AARA 3C6HA 4HUEA 5LMUK 4KHSA 2BGGA 5LL6Z 1M1KO 4FLYA 1IV0A 3S3MA 1YTUA 3L8BA 3CCMN 1U48A 4FXDA 3IRXA 3OBWA 5EU7A 1HX1A 2WTUA 4RW4A 3EL2A 1JLCA 2NRXA 5AQTA 4OPHA 1BISA 4FVMA 4RW6A 2F9TA 3O4QA 4EIAA 4DR5K 3ID8A 2IVNA 4WQ5C 4AHCA 3S5TA 1VQ6N 2E88A 4IWVA 4JHDB 4FJIA 3TAFA 3AVFA 3AO4A 4YY3K 2YNIA 5AQKA 3KWGA 3Q7BA 4KBOA 3OYBA 4KHNA 1NGEA 3OS2A 1XHXA 4FJLA 4DV0K 4IEEA 3VQ5A 4DHYA 2IDOA 4IDKA 4DF4A 4CJUA 3ULEA 2HBJA 2BANA 3K5NA 4EZ6A 1S6QA 3L2UA 3VQEA 3R9PA 4DB3A 4I7FA 1NK7A 3JAMO 1S1WA 3NBPA 3U9ZA 1QTMA 1OH6A 2W6LA 1ATNA 3T3FA 3KK7A 3CERA 3DJCA 1U2VA 4CGDA 1NG9A 3DXMA 3THWB 4XH5A 2ZWHA 5AZJA 2QWNA 5AZIA 2D5RA 4CCHA 2VQEK 1TKTA 5KQDA 3WEEA 1HNXK 1C1BA 2NRWA 5KI6A 2KFNA 2RKIA 1VSKA 2O8BB 2QXLA 5M1NA 4KTQA 4DUYK 4RW8A 3LP2A 2ATQA 1RDBA 1NGBA 3VESA 1NJIO 3U3GA 2JWLA 1WAFA 5GAHP 1HQUA 3TAGA 3NVKA 3TTDA 3VA0A 1HKGA 3F9MA 4J2BA 4Y1CA 4JKBA 1NJXA 2B4JA 3T69A 4FLWA 2E2OA 3HSTB 4FZYA 3L0QA 3AVAA 2HHIA 3A8YA 3GBTA 3ZT1A 3KD5E 3CETA 3W0LA 3I55N 1W9HA 4DWIA 4KHUA 4A61A 3K57A 3AO2A 2F8SA 4CIFA 1RDWX 2F7TA 3JS6A 4CHQA 3IFRA 2ZE2A 3OVNA 2GELA 1S3XA 4FLZA 3QIPA 3OA9A 4DR3K 4KHPK 1HPZA 3QERA 1X3NA 3ZCMA 2I5JA 1RDUA 2XRIA 1T44A 3O9SA 1ZBHA 4BRDA 1RT2A 1VQPN 1Q9XA 5GIPA 2P9IB 3SLCA 4FZXC 3I0RA 2FF6A 3EY1A 3MWTA 4BR4A 4AM6A 4H5NA 1NOYA 4YOWA 4FK0A 2D0AA 5CYQA 4BY9C 4XJXA 1TV6A 3CD6N 2Z1HA 4JKHA 1KSPA 3G0ZA 1WSGA 5DM7L 2KZZA 1VSFA 3J7YP 4IKFA 4LF7K 2CGJA 4DU3A 4FW1A 1D4XA 2D0CA 1IKWA 2VGNA 4DTSA 5LMNK 2YHYA 3MEGA 4EHUA 3CCUN 2HMIA 3IS9A 4KHYA 4IDHA 4HTLA 4RG8A 1HJOA 4JI1K 4E19A 2FSKA 3D7EO 2E1ZA 1RCHA 1Q18A 4E1NA 2NUBA 2OYQA 2O8CA 2P9KA 4BE1A 1GLEG 3K9KA 3TAEA 4CJKA 3AVJA 1CXUA 1Q82O 1MDUB 3RSEA 3HK2A 2A5XA 1Z26A 4BG9A 5C25A 4JRQA 3NFAA 1ZBSA 1VQLN 1TYQB 1X9MA 5AQZA 2OPSA 1W2BM 2BDPA 4BRPA 3ATVA 4DQSA 4M41A 3CYMA 2E8AA 1CZ9A 2HHUA 4F3OA 1EX4A 2P9SA 1NJZA 4UY8O 4JI0K 3ZETA 4FWLA 2YX6A 1X1PA 3WNGA 5J2NA 5AQQA 4YDUC 1QVGM 4FLXA 3BF1A 1JCGA 5KRSA 4CZMA 3PY8A 1K8AO 4XIUA 3BZKA 4B8AB 4FOEA 4J2EA 4YOVA 4CK1A 2DPNA 3A5LC 1IKVA 2Q1NA 3SUQA 4IO8A 3CJCA 4ELVA 4OKEA 2HHXA 4BC4A 4DTXA 3MXJA 3BY5A 4E72A 1WB9A 5BREA 3DLGA 4BR2A 4B1XB 3C7NA 3TWHA 3VEWA 3AA3A 3ZEUB 1C0MA 4YHHK 3L4QA 1ZBLA 5B8HA 5F1XA 4ILHA 5CE3A 1NMNA 1I39A 1YJNN 1IKYA 4K41A 5KQ8A 3MMVA 2OANA 4FJJA 2XO7A 2A40A 3CG7A 4Z4EA 3MX5A 4KFBA 3LL3A 2DFHA 3O9UA 2KW4A 5C12A 1TUUA 1BCMA 2A6AA 4DQRA 3LPTA 4CEFA 2I7NA 4CGJA 2QWRA 5EXWA 1RTDA 2BTFA 3GG4A 4CFAA 3LM9A 2HVIA 2DFFA 1BUPA 2P51A 4FWSA 4B8CA 3QNOA 1JXBA 3VQ8A 5CHIA 3VTHA 4PL7A 1OH5A 5FDLA 3CCEN 3OYEA 3BZCA 2VWKA 4N5SA 1HQEA 4I9QA 1U4BA 1NU0A 3VPZA 3SPYA 3BUZB 4CJ4A 4R5PA 4CGIA 1IBKK 3WUHA 1ZC6A 4DSKA 5KRTA 3DLBA 1RILA 1VSHA 3SAGA 2P5GA 2UXCK 1RTIA 1KVAA 1GLLO 4DFKA 3SAHA 4PWDA 3ZSZA 4CGHA 3J7ZO 1NOZA 3V9ZA 1YITN 3LPUA 1J5EK 3CM5A 4WE1A 4LH5A 1DKGD 4BC3A 1RNHA 2B6AA 5IT9O 4WYBA 5LJVA 2Z1GA 3O8MA 5I42A 1VRUA 4AHRA 4KAZA 5FPEA 1HNVA 3D2FA 4CJSA 4JKAA 3RR8A 3LP3A 1NGJA 3NVMA 5TKWA 5HOOA 1JKHA 2IOCA 3ULEB 2UYTA 4OPJA 4CEQA 3P83D 4CEOA 5BR8K 1YT3A 3HOSA 1HJRA 4V19S 1A5XA 4B1ZA 3VF2A 4AHSA 2IGIA 3F2KA 1KFSA 2ETJA 4CJ3A 2EHGA 3TSQA 4FJKA 4IEIA 1U2VB 3T1HK 4BQLA 1GOCA 5C0YA 2FF3B 1IBMK 4FJ9A 3QEVA 3WEEB 1VQNN 1NLVA 2FBTA 1QQCA 3HOTA 5AQUA 4BR5A 4M3UA 4ISFA 3AA4A 3NDKA 4M63C 3PLAA 4C1NI 4BRAA 2FBYA 4B1VA 3I0SA 4CJ5A 3SQ4A 3I8BA 3CJ9A 1KAYA 4JKGB 2VWBA 3SV4A 4WFBL 2BH1A 1KFDA 4MDBA 3VF4A 3ID6A 1VSMA 4DR7K 4Z94A 1R59O 3GL1A 2OTLN 4GVEA 4E7IA 3HZ6A 3FGUA 1FK9A 4OGEA 5FROA 5AFUH 3QEWA 5J2MA 1TKDA 3EKUA 3ZSXA 3PX0A 2X78A 3A2FA 3MN9A 5AQHA 4FK4A 3G10A 3KD1E 5HP1A 3CYGA 3R1XA 1VAZA 4BECA 4QAGA 3A5OC 1KCFA 4KREA 2PYJA 2O8FB 2FC0A 3PUFA 4M45A 1WBDA 4JK8A 3WT0A 4DFPA 5M1PA 5AQIA 4A2AA 1ZBFA 5M1QA 4BVPA 4ISGA 1ATRA 3MN7A 4O0IA 3CC4N 4CZIA 3EZWA 5LJWA 3BDPA 1RBUA 4BROA 3DWLA 4NCAA 3H45C 4OLAA 3VQ6A 1U45A 2IS3A 4CHYA 1ASUA 1HYZA 3CQ8A 2ZJRL 5A2QO 1O13A 3HSCA 2P9LB 3LANA 4GV9A 4X65K 3EO3A 1VQMN 2VG7A 4DFJA 1XC9A 4JD2A 4JEPA 1E3MA 3OYAA 4KI6A 1XWLA 3QB0A 4BRLA 1JL1A 4CZLA 5BR9A 4MLEA 3CCLN 3RR7A 3TABA 4PL8A 3ZSWA 2O8DA 4R79A 1J9AA 3UKRB 3MK6A 2UUCK 5F2RA 4E7HA 2GEMA 2P9KB 1NGHA 4PKGA 1RTHA 5FPDA 3JYTA 4KTZA 4Z4IA 3NH0A 3UKUA 3C6UA 2HF3A 3PX4A 2W40A 4LF4K 1C1AA 1DGKN 3VOVA 4XH1A 3RWUA 2LSNA 3S41A 3PX6A 2HHVA 4DU1A 4O8UA 3VEZA 4BACA 4BC5A 2X6SA 4GY2B 1J54A 4O5FA 4FVUA 1T6CA 1WSIA 1L3VA 4JI8K 3K2PA 5JVGL 2O4IA 3AA5X 3CCQN 2NRRA 2WOMA 3VN5A 4FM0A 1V4TA 2QWMA 4M3ZA 3O4WA 3H1QA 2QKKA 5ADXH 1C1CA 1CZBA 1EETA 2FBXA 1BHLA 4YORA 5AQXA 1BOTO 1YVNA 3O4NA 4ID5A 4DTOA 4GV3A 2AP1A 4JI4K 2XY6A 1T6DA 5BN9A 4LFAK 1N5YA 1ILYA 1FKPA 3L2WA 1YAGA 4BWMA 2VYPA 4JKDA 4CJEA 3BF3A 3DLKA 2O8EB 2NRZA 4RTFD 4OKKA 4C8LA 1QSYA 4M7YA 4KRFA 3KLIA 4K43A 2D4WA 3SCXA 3QESA 3VQBA 4O8KA 1JLFA 2P9PA 4GV6A 5M1KA 3T1YK 1NGDA 2XHBA 1MWMA 3HI0A 1KQSM 3LDNA 2NRVA 4DFMA 5BRDA 1X9SA 3OJUA 1TAUA 4HUGA 1YI2N 4OVLA 3KLEA 2HBLA 1LAVA 3DXKA 2GX9A 4IBNA 5AQFA 4DF8A 3CCRN 2P9NB 2Q36A 2E6MA 4I6MB 1GLBG 3CPEA 4LFBK 3QEIA 4CK3A 3O9RA 5AQWA 1BDGA 5SWMA 1QS4A 1ZXOA 3DLRA 1QQNA 3JSMA 3QETA 4BRHA 1SL1A 4QS8A 2KHOA 5SZTA 4HWIA 4IO9L 3VEXA 3V9XA 3AGRA 4B9SA 3SQ2A 3DRPA 5CR4A 3OBYA 1YF5L 4H03B 3PV8A 3LAMA 4OLBA 3ASMA 5C2FA 5KGXA 5AQMA 3AAQA 4KV8A 5LY3A 1K6YA 4NCGA 4CEZA 1HUXA 4FO0A 4IFEA 2YKMA 3NMUA 1KD1O 3LDSA 1EKEA 4Z4CA 1UA0A 1JLEA 4DV5K 4FOIA 1KC8O 1UAXA 2G8HA 4E0DA 5D3GA 2RE2A 3UB5A 4FM1A 1SKWA 3K9JA 2HOEA 4FJHA 3J7AP 3E66A 4ZHRA 3E01A 1NGIA 4CF9A 3AVKA 2ZM6K 3J8AA 1A5VA 1RT4A 2E1YA 1BGXT 1V4SA 4H8KA 3AVLA 3OYMA 4JK9A 4CF2A 5KGWA 3UIQA 1S9EA 2A1RA 2QW9A 1XNQK 4F2RA 5JS2A 4DSEA 3M3ZA 1LAWA 1RT5A 1SUQA 1JLAA 1QZ6A 1U47A 4PUOA 4MO5A 1SAZA 3HJFA 2UUAK 2E4LA 5JENA 2PFUA 5I3UA 4BEBA 4AH9A 4BRIA 2G8VA 1FW6A 5T7BA 4CEDA 5CZ2A 3E9OA 1BQMA 1C0GA 3VQ4A 3D2EA 5GIOA 1WSEA 4DKWA 5C15A 1ZBUA 4CBXA 3TANA 5KPRA 4CZEA 3HRGA 3LZIA 1R0AA 4F2SA 2V7YA 4DQ8A 3V81A 1JLQA 2ITGA 2OZMA 5BPNA 2P9UA 1ZYQA 1U6ZA 4CHZA 3SV3A 3ZSQA 4G9ZA 3DOKA 4CERA 3KK2A 1J5OA 3ZT4A 4LF5K 5JMVA 3UE5A 4FW2A 4ELUA 4DTUA 1VSJA 1Q7YO 1CLQA 4FJMA 3QEXA 2X74A 3AVGA 2VG6A 3H46O 4DSIA 4NO7A 2PYLA 3M1FA 4I2PA 3ULDA 3FZFA 4IZ9A 2NRTA 3V4IA 3H08A 2ZF5O 5AQSA 4CGFA 4I2QA 3IMXA 1NJYA 1NKBA 4MDAA 3C6AA 1P8ZA 1ASWA 3OYGA 1IG9A 4IOCL 5C2DA 3G25A 4BRFA 4YOYA 2E5LK 3NAEA 1SV5A 1S1VA 2E2NA 4G1QA 1RDAA 3D0PA 4EP5A 1N36K 3N4QA 3K5OA 3J81O 4M3YA 1LV5A 2HW3A 4FWKA 4GKKK 2HBKA 1I94K 1QQMA 1W7AA 1IJJA 2KLAA 1I3AA 1TVRA 3H1VX 2KZMA 1WAJA 1RDCA 1XC3A 1MA9B 2G8UA 2WUSA 2GWKA 2YI1A 1C0TA 4HCBA 4ILGB 1TKXA 4KKOA 4JKFA 4B9VA 4IOAL 3HYFA 3ZYYX 2JGUA 3NGIA 3ZX3A 2YCHA 4H5WA 3VQDA 3OS1A 2PY5A 4OX9K 3EYZA 3KK3A 4B3SK 3MEEA 4F3TA 2A1SA 2ZGZA 1KTQA 3AO1A 1L5UA 1XNRK 1LW2A 4FJ5A 3CIPA 4H0PA 4JHDA 4CJTA 4BWJA 3SAFA 1U49A 3FZLA 3LWMA 3THXB 3HM9A 1GLAG 3AGKA 1B9DA 3AVBA 4JN4A 3DLEA 4N76A 3G71N 3V9WA 3NF6A 1YJ9N 2PZSA 2Z1IA 3ITHA 2QA4N 2B5JA 3RVCA 3MN5A 5JS1A 3O08A 3K5LA 3CF5L 4CEBA 5BPMA 4JD2B 3FZHA 1QHAA 4A5BA 2OCEA 2ZGYA 4BE2A 3OYIA 1QZ5A 4FPBA 4FM2A 3THWA 2UU9K 3CMEN 3AV9A 5BRHA 4DTPA 3NHGA 3P31A 3AVMA 3OY9A 1HKCA 2Z1JA 3UKUB 4BC2A 1BI4A 3VEVA 1KLNA 4Y1DA 2FXUA 4K0KK 2DY4A 2KTQA 3P1GA 3S3OA 4CEAA 4LFCK 3KLFA 2G8IA 1X3MA 3E9PA 4BRKA 4ID1A 4DR1K 3CJAA 1T8EA 3KJVA 3ALYA 1VHXA 3AAPA 1S1UA 4I9LA 4IFYA 3FZKA 1QHTA 1RBTA 4CESA 5KTQA 4CF0A 2OA8A 1D9FA 5HROA 2VQFK 3QFUA 3I56N 2Q0UA 1HPMA 4FLUA 1IG8A 3LALA 5FLXO 1WUAA 3L4IA 1YUWA 3EE9A 3FE1A 1WN7A 4DS5A 3O6WA 4ISEA 4CBWA 4E1JA 3NCIA 3L3UA 4FSVA 2A3ZA 3GE1A 4LH4A 5FRMA 1UOCA 1JXEA 4FYDA 1WNSA 5CYMA 1NBWA 3PSFA 2H3GX 2D1KA 1N33K 3HPHA 4IG0A 3KVGA 4CHPA 1E4FT 3SPZA 3IUCA 4BRMA 4CZJA 4DV4K 3CFRA 3E1YA 4LC9B 3FR0A 4X64K 1IBLK 1X9WA 4JS4A 1FKOA 4O4GA 2FBVA 3TAMA 3TI0A 3C6TA 4L3QA 3T1AA 4B1WB 1NM1A 3KLHA 1OKJA 3HPGA 3LDLA 3PO5A 4DSFA 2P9IA 4CW7B 2YHAA 3RMAA 2PAVA 1S72N 2GUIA 5AQGA 2F8TA 4BRCA 5DMRA 3SNNA 2PBDA 4CHOA 4O5BA 3DXKB 2F4VK 3DXMB 1WSHA 4CVNE 5AZJB 4DTJA 4EFHA 2WBNA 5AZIB 3PSIA 2RF2A 1LWFA 2VWJA 1RTJA 1Z05A 3CFOA 1BWFO 4CFCA 4FWRA 3DRSA 3F73A 1XUPO 2YNHA 3SBTA 5J2PA 1F21A 1G99A 3NH2A 4W5TA 3L2QA 1ESVA 3V9UA 2NZTA 2NNWA 3QMLA 1OVQA 5I9EB 2HMPA 4LY7A 2E6LA 3P4IA 4F4KA 4Q5VA 3KK1A 1T3VA 1T03A 1RBVA 3BP8A 4B3RK 4BGBA 1DLOA 1VSIA 4A57A 3LWLA 2ZJPL 3CCJN 4E7KA 5AQPA 3OYLA 3MWPA 3U6FA 1Q86O 3WNFA 1L3UA 2WFBA 3M8SA 3HVRA 3CM6A 3CCVN 4H4MA 1S1XA 5C10A 3OYHA 3BGRA 1J6ZA 1YVUA 4XEIA 3SJJA 4KI4A 3EN9A 1SKRA 3B6OA 3NE6A 3C94A 2OTJN 3C65A 4U7BA 3HT3A 4BRQA 4PA1A 3WNEA 3TPQA 4CD1A 2R7YA 4WFAL 3SUOA 3SYZA 5TKYA 3MCAB 1JLGA 1GOBA 2HNYA 5IWAK 3DAWA 4M3WA 3NF9A 1GLFO 4CF1A 4ICLA 3ENBA 3WXIA 4E1MA 5J1EA 1Y64A 3ZT0A 3FLCO 4AHVA 4RW9A 3P5JA 3V1RA 3TSUA 1TK8A 4M3RA 3RRHA 1NK6A 4B9NA 3IAYA 2QTDA 3H6EA 4IFVA 1LWCA 3O3HA 1LOTB 2D0PA 3KZBA 3VEYA 3WXLA 1P90A 2KKZA 5E26A 3FFKB 2CGLA 4BDPA 4ZTFA 1NK0A 3CC7N 3EE8A 1TK0A 4DQPA 3THYA 2OPQA 2P9UB 1GLDG 1GLJO 2FSNA 5MLCQ 4DLEA 3QIOA 2NRHA 4FPAA 3ZEUA 3OYJA 4PY5A 3QBXA 4LF6K 2HBMA 1HR0K 3R8EA 4DS4A 1DT9A 4Z4GA 3CJ7A 4FJ7A 1BU6O 3AY9A 3V9SA 3TSPA 4HVJA 3MN6A 1WLJA 2Y1JA 5ELZA 1NK5A 1IO2A 4WFNL 3TAQA 4FJNA 1TL3A 4KPYA 2G8KA 2QKBA 1D9DA 3HL8A 1LW0A 5M1OA 3U8XA 2O8CB 2QEXN 3Q7CA 2P5OA 1TGOA 1FJGK 2FSJA 4PKHA 4QS9A 3DLLL 4OPAA 3FFIA 2AJQA 3RSEB 5JVHL 2YV0X 1HKBA 4MLHA 3VQQA 2V51B 4NYFA 1JL2A 1YHQN 1SS6A 1VK0A 3ZX2A 2QM1A 4PQUA 1SZ2A 1HRHA 2Q3SA 4BREA 2Q31A 4FCYA 4CIEA 4H0VB 1OH7A 1RBRA 5HRPA 4DTRA 1RFQA 1TL1A 1WSJA 2GBZA 4CJPA 4DUZK 4EP4A 2VCPA 4CFDA 2P9SB 3QFPA 3ZETB 2CGKA 3O3FA 3LDOA 3QLHA 3V1QA 4DCHA 4MO4A 3O9TA 4B1YB 1C0UA 3F5TA 4IOXA 1D5AA 3CI5A 5FPMA 2NLXA 3CCSN 4CZGA 1JCFA 3VF6A 3T19A 1BL3A 4CD3A 2ASMA 1SL2A 2XY5A 3F9KA 4HUFA 3KIOA 4M3TA 3ZSYA 1Y97A 3RRGA 5DK5A 1QQOA 4Q0BA 4CJ7A 3OHRA 4JKEA 3AVIA 4FLVA 2O4GA 5EY4A 3WQUA 4DR2K 1VQ7N 3C7NB 3HO1A 4FJ8A 1XI1A 2IVPA 1BIUA 3V1OA 3OYCA 3MXIA 3DM2A 4CF8A 5AQJA 2VG5A 1SKSA 4K8ZA 4CK2A 1QE1A 4M3XA 2I7PA 4LSNA 3JXUA 3AA2A 4A5AA 3NH1A 4DSLA 4CHNA 4YNQA 4X62K 5GINA 5AQNA 1WBBA 1BO5O 1K8KA 3ZLJA 2RHKA 4FWOA 1KLMA 1BIZA 3NF7A 4CZHA 4U67L 5C42A 4H5TA 3J80O 3VENA 5C24A 4DQQA 4Z4FA 1B92A 3CC2N 1RT1A 3O3GA 3HP9A 1O1WA 5EOYA 1KVBA 5BN8A 3THVA 3L6QA 1VQ4N 4NXNK 3I8DA 4E7LA 3MX2A 3S3NA 4DTNA 2XY7A 3SUNA 1JLBA 2VGMA 3ZSOA 1BI4B 1HLUA 4CZKA 4X66K 3HVTA 4M7XA 4H5RA 5BRFA 5HRNA 1Z6RA 1YXQA 4JAXA 3PIPL 1GOAA 4O55A 5AQYA 1HYSA 1HMVA 3BEXA 4GMJB 4WQ4A 1VSDA 3C95A 2QWPA 3DMJA 1QSLA 3WXJA 5GADP 4Z0UA 1T7PA 3SJHA 2W6KA 5KPTA 3VQCA 2AA4A 4JKGA 1Q9YA 4KHQA 1BA0A 1DTQA 2XY8A 3LM2A 4K42A 1TK5A 1VQ5N 4W5OA 2HB5A 4H4OA 2W41A 1NGGA 2HSTA 4C8KA 3DYAA 3ZT2A 1EXQA 1EO1A 3C0BA 5GAEP 4WF9L 1SL0A 1JCEA 3MAQA 4LF9K 3S9HA 4FJXA 4CJFA 3EZ5A 3CPWM 4A2BA 4AM7A 5HBMA 3EKSA 1D8YA 1C0FA 4ILJA 4BVOA 4IJAA 3ISNC 3M6GA 3D2FB 3HPOA 3DLHA 3TTCA 4CJVA 1Q81O 2O8FA 2GV9A 5H1SQ 4CE9A 2WC9A 3QDKA 3K0SA 3AO5A 2JWKA 3TTFA 3ZSVA 4E89A 4RCHA 4J2AA 3RMBA 4JLHA 3HM8A 5AR0A 4N47A 4DV7K 4FLTA 1BA1A 4H0OA 4B9UA 4EAHD 3SQ0A 4JKCA 4LF8K 2CH6A 1HNWK 3N4PA 5AFUA 5BPLA 4H0TB 1SQKA 1MWKA 3IG1A 4FWMA 1NGCA 3B8AX 1C6VA 4BE0A 1RBSA 4B9TA 3KKRA 3K5MA 3LP0A 4KHWA 3CJBA 3DOLA 2P9LA 3OS0A 4CEEA 4HCCA 4C8NA 4W5NA 4N56A 3RMCA 3SUPA 4YFUA 4JRPA 1IKXA 3O1WA 3QEPA 4WQ5A 2HHQA 4DV6K 3ZT3A 3QO9A 4RW7A 1RT3A 1XMQK 3U9DA 4YOTA 2OPPA 2YHWA 4JNEA 1TAQA 3ENOA 4E7JA 5GAGP 3UKRA 1WSFA 5FPNA 2JLEA 2BUPA 2V52B 4C23A 4KO0A 1NGFA 5HLFA 1VRTA 4J2DA 1VQON 4DR4K 3HTVA 5M1FA 3W3DA 1Z25A 4KB0A 2WONA 1FXXA 5CY4A 4NCBA 3VGLA 1HNIA 4OPKA 1S22A 4AHUA 5F0XA 4JS5A 4DMNA 2QK9A 4FK2A 4IG3A 3SMPA 3M8QA 4MFBA 3IDHA 3WNHA 3WQTA 1L3TA 3M5RA 1QSSA 3VMFB 3LZJA 4YOXA 2YNGA 4C8MA 4BR9A 3E9LA 4B9QA 2Y1IA 2IIRA 4K25A 1RT6A 5J2QA 1NK8A 4AILC 1K9MO 4DSJA 4CI6A 3OTOK 3T7ZA 4M42A 3VGKA 1CZAN 3CQYA 1KRPA 4JI6K 3U4LA 2HNZA 2A41A 2F96A 3NF8A 4CECA 4N41A 4H5VA 3G4SN 1A5WA 3SQ1A 3K59A 4AHTA 3MDQA 1CXQA 3MXMA 1TUYA 4F9OA 3CHWA 3HP6A 4FWPA 4O0JA 2O8EA 1T05A 2ZD1A 2ZQBA 3THYB 2D0BA 2Q2RA 4ZTJA 5JLHA 3LDQA 1RGIA 5HL7L 2HF4A 3MEDA 3AVNA 1JJ2M 1OVYA 3ATUA 3L2RA 3D45A 4NYNA 2ASOA 2UXDK 2W42A 1N6QA 2HNDA 4KH5A 1J53A 1KAXA 4A62A 3O80A 3NGZA 2O8DB 3H3NO 5ADXA 3A0IX 2P9NA 3R3LA 4I6MA 2F9WA 5HRSA 4CJRA 4FZZA 3SMSA 1REVA 4DTMA 1EWRA 2IC3A 4TSXA 5AQOA 2QWLA 3VEOA 4BRGA 4PKIA 2EX3A 1ASVA 2O8BA 3LAKA 3DRRA 4EZ9A 4B1UB 1NK9A 4GW6A 1BCOA 1RDDA 5CZ1A 2GWJA 3ENHA 4JYAK 3VQAA 2ASPA 5JICA 2YJFA 4HTUA 4BR0A 5AQRA 4NB4A 2W00A 3SBGA 4QOZB 3TR8A 1N34K 4FL9A 4CJLA 3WXMB 3MCPA 1NK4A 4DV1K 1NWKA 3HXMA 3OYKA 2UUBK 4FJGA 4CGGA 3VQ7A 2ZJQL 1S5JA 4DG1A 3VA3A 3O9QA 3QNNA 4B9LA 2D0OA 3ZSRA 1NKEA 4DLGA 4KTWA 4GNIA 4JI2K 3LDPA 1N32K 1M90O 4DV2K 3VQ9A 3B6PA 1X9JA 5AQLA 3HBTA 4GVMA 1Q8IA 5JLFA 1S1TA 2KFZA 4CBUA 4CJQA 2P9PB 3I33A 3SI6A 1NMDA 4B3OA 3CFPA 3ZX0A 3M8RA 1TKZA 1EQYA 5FRNA 4W5RA 4B3TK 3K58A 3VTIA 2G8WA 4LD0A 1RT7A 4UQGA 4QCLA 3AVCA 3H3OB 1KAZA 1NJWA 3WXKA 4MQ3A 1UA1A 1DTTA 1K8KB 1E4GT 3RMDA 4BQZA 2QXFA 3IKMA 1S9GA 3L3VA 2HVHA 2YJEA
chains in the Genus database with same CATH topology
4BREA 1V4SA 2Q31A 3P39A 4H0VB 5BREA 4YDUA 4JK9A 1BG3A 1RFQA 4NLBA 2EWSA 4B1XB 3C7NA 3O5BA 4BR2A 2QW9A 3VEWA 3ZEUB 2VCPA 1VQKN 2P9SB 3QFPA 1QVFM 4WCEL 3L4QA 3OW2M 1LCUA 3M3ZA 2E20A 3ZETB 2CGKA 3LDOA 5EVZA 3CQXA 5B8HA 3CXCM 1QZ6A 2GUPA 1N8RO 1WOQA 4MO5A 1SAZA 5F1XA 4DCHA 2IVOA 2PFUA 4ILHA 4MO4A 3O9TA 3QICA 5E84A 5CE3A 4RWTA 3G6EN 1YJNN 4BEBA 4B1YB 4K41A 4BRIA 5KQ8A 3MMVA 3E9OA 4KH6A 3F5TA 1C0GA 2OANA 4IOXA 3D2EA 2A40A 5GIOA 4DKWA 3CI5A 5FPMA 2NLXA 4FWNA 5C15A 3MX5A 4CBXA 3CCSN 2C1IA 4CZGA 3LL3A 5KPRA 4CZEA 1JCFA 3O9UA 3HRGA 3CJ1A 4YOUA 3VF6A 5C12A 1YIJN 4CD3A 1TUUA 2ASMA 1TYQA 2A6AA 5AQVA 3R6MA 2I7NA 3VGMA 5DM6L 2QWRA 5EXWA 1DEJA 2BTFA 2V7YA 4CZFA 4DQ8A 3GG4A 5BPNA 3LM9A 2P9UA 1XQSC 1U6ZA 1QQOA 4KH4A 4CJ7A 4G9ZA 3OHRA 3FZMA 4JKEA 2QI2A 4FWQA 1NGAA 1BUPA 1VQ7N 5EY4A 3WQUA 3C7NB 5JMVA 4FWSA 3UE5A 2IVPA 1Q7YO 5AQJA 4BGAA 5CHIA 3VTHA 4PL7A 3O1BA 4IXCA 3H46O 3CCEN 1K73O 5KPZA 2V7ZA 4NO7A 3M1FA 4BR7A 3FZFA 2I7PA 4IZ9A 3JXUA 4EHTA 3QBWA 2NRTA 4A5AA 3VPZA 4NLCA 2C1GA 2ZF5O 5AQSA 3D6RA 3VERA 5GINA 3GDQA 5AQNA 3D2EB 3IMXA 3BUZB 1BO5O 4MDAA 1K8KA 2RHKA 4FWOA 3C6AA 1P8ZA 3WUHA 3GOIA 4BE7B 1ZC6A 4C1NK 4CZHA 4U67L 4IOCL 5C2DA 3G25A 4H5TA 4BRFA 4YOYA 3PIOL 4AF1A 3VENA 4J8FA 3SAGA 4WQ4C 3CC2N 2E2NA 2GTDA 3N4QA 5EOYA 4OO1J 5BN8A 2CH5A 1VQ4N 3L6QA 1GLLO 2ITMA 3SAHA 1W97L 4BG8A 3MX2A 3TU5A 3J7ZO 2VGMA 1YITN 1HLUA 2QWOA 3A5NC 4CZKA 2E2PA 4H0YB 2Q0RA 4FWKA 2A42A 1DKGD 4BC3A 2HBKA 4M7XA 1QQMA 4WYBA 1IJJA 4H5RA 2KLAA 4XH4A 5BRFA 5LJVA 1VQ8N 3H1VX 3KWIA 3O8MA 1Z6RA 1YXQA 2FLOA 4JAXA 5FPEA 3D2FA 3PIPL 1VQ9N 3KHYA 4JKAA 5AQYA 1XC3A 1MA9B 2WUSA 2GWKA 2YI1A 1ATSA 1NGJA 3VETA 1YJWN 4ILGB 3BEXA 3NVMA 4QS7A 4WQ4A 5TKWA 5HOOA 4JKFA 4IJNA 2QWPA 3ULEB 3WXJA 4IOAL 5GADP 3ZYYX 2UYTA 3SK3A 4Y0WA 3SJHA 3ZX3A 5KPTA 2E2QA 2AA4A 4JKGA 3HOSA 2YCHA 1BA0A 3CMAN 3LM2A 4K42A 3VF2A 4H5WA 1H1VA 4JK7A 4B1ZA 1VQ5N 4BRNA 3F2KA 2W41A 2YHXA 1NGGA 2HSTA 2ZGZA 2J4RA 3TSQA 4A59A 1EO1A 3C0BA 3CIPA 1U2VB 4H0PA 4IEIA 3P38A 4BQLA 5GAEP 4PHTX 2QWQA 4JHDA 5EX5A 3SAFA 5C0YA 2Q97A 3FZLA 4WF9L 2FF3B 1GLAG 1JCEA 4H0XB 3AGKA 1KXPA 4JN4A 3CPWM 3A5MC 1GLCG 3AARA 3C6HA 3WEEB 4A2BA 4AM7A 1VQNN 1NLVA 3EKSA 1C0FA 1M1KO 3G71N 4ILJA 3HOTA 5AQUA 4BVOA 4IJAA 1YJ9N 4BR5A 4ISFA 3M6GA 3D2FB 3TTCA 3CCMN 2QA4N 1Q81O 4M63C 5H1SQ 2WC9A 3OBWA 1HX1A 3QDKA 3PLAA 4C1NI 4BRAA 3RVCA 3MN5A 4B1VA 3O08A 2JWKA 3CF5L 3TTFA 3EL2A 5BPMA 3I8BA 3CJ9A 4JD2B 3FZHA 1KAYA 4JKGB 1QHAA 2VWBA 2NRXA 4RCHA 5AQTA 4OPHA 4A5BA 2F9TA 4WFBL 4EIAA 2BH1A 4MDBA 3VF4A 3HM8A 3ID6A 5AR0A 2ZGYA 3ID8A 1BA1A 2IVNA 4H0OA 4WQ5C 1QZ5A 4FPBA 3CMEN 4Z94A 5BRHA 1R59O 1VQ6N 2E88A 4EAHD 3GL1A 2OTLN 4GVEA 3P31A 4JKCA 3HZ6A 3FGUA 4IWVA 4JHDB 1HKCA 2CH6A 5AFUH 3UKUB 4BC2A 3VEVA 3N4PA 5AFUA 5BPLA 2FXUA 3EKUA 4H0TB 1SQKA 3MN9A 5AQHA 1MWKA 4FWMA 1X3MA 1NGCA 3B8AX 3KWGA 3Q7BA 5AQKA 3E9PA 4BRKA 4KBOA 3R1XA 3CJBA 1VAZA 4BECA 2P9LA 3CJAA 3A5OC 1NGEA 3AAPA 3FZKA 4IEEA 4DHYA 3O1WA 3ULEA 4WQ5A 2HBJA 4JK8A 3WT0A 5M1PA 3R9PA 5AQIA 4DB3A 3QFUA 4A2AA 5M1QA 4BVPA 3I56N 4ISGA 2Q0UA 1HPMA 1IG8A 3U9ZA 3U9DA 1ATRA 4YOTA 1WUAA 3MN7A 3L4IA 1YUWA 3EE9A 3FE1A 3CC4N 2YHWA 4CZIA 4JNEA 3ENOA 1ATNA 3EZWA 5GAGP 3KK7A 3O6WA 4ISEA 3UKRA 4CBWA 4E1JA 3CERA 3DJCA 4BROA 1U2VA 4FSVA 5FPNA 3DXMA 2A3ZA 2BUPA 2V52B 3DWLA 3GE1A 4XH5A 4C23A 1NGFA 2ZWHA 5AZJA 2QWNA 3H45C 5AZIA 1VQON 1NBWA 3HTVA 5M1FA 2H3GX 2D1KA 3WEEA 5KQDA 3W3DA 2NRWA 3KVGA 2ZJRL 1O13A 3HSCA 3VGLA 1S22A 1E4FT 5F0XA 2QXLA 3IUCA 5M1NA 4BRMA 4CZJA 2P9LB 3E1YA 4LC9B 3FR0A 3SMPA 4GV9A 3EO3A 1VQMN 3IDHA 3WQTA 1NGBA 3M5RA 3VESA 3VMFB 1NJIO 4L3QA 4B1WB 4YOXA 4BR9A 1NM1A 2JWLA 1OKJA 3E9LA 4JD2A 4JEPA 3LDLA 5GAHP 2P9IA 4B9QA 3QB0A 4BRLA 3NVKA 2IIRA 4K25A 3TTDA 4CZLA 2PAVA 4MLEA 1HKGA 5BR9A 1S72N 3CCLN 3F9MA 1K9MO 4PL8A 5AQGA 4CI6A 3T7ZA 4JKBA 3VGKA 4BRCA 4R79A 1CZAN 2PBDA 3CQYA 3T69A 3UKRB 2E2OA 3DXKB 3MK6A 3U4LA 5F2RA 3L0QA 2A41A 2GEMA 2P9KB 1NGHA 4PKGA 3DXMB 5FPDA 3A8YA 3GBTA 4H5VA 5AZJB 3UKUA 4EFHA 2WBNA 2HF3A 3CETA 5AZIB 3W0LA 3I55N 3G4SN 2W40A 1Z05A 1BWFO 3MDQA 4A61A 1DGKN 4FWRA 3VOVA 4XH1A 1RDWX 1XUPO 1TUYA 4F9OA 3CHWA 3SBTA 1G99A 4FWPA 2F7TA 3S41A 3JS6A 3IFRA 4O8UA 3VEZA 4BC5A 2GELA 1S3XA 1ESVA 3OA9A 2NZTA 2NNWA 4GY2B 3QMLA 5I9EB 2HMPA 2Q2RA 5JLHA 3P4IA 1X3NA 4O5FA 4FVUA 1T3VA 1RGIA 1T6CA 3LDQA 5HL7L 1RDUA 1T44A 5JVGL 3O9SA 2HF4A 4BRDA 1JJ2M 3CCQN 1OVYA 3ATUA 1VQPN 2NRRA 3BP8A 5GIPA 4BGBA 1V4TA 2ASOA 2QWMA 2P9IB 3O4WA 3SLCA 3H1QA 2FF6A 3MWTA 4A57A 2ZJPL 4KH5A 4BR4A 3CCJN 4AM6A 4H5NA 5AQPA 3MWPA 1KAXA 4A62A 3O80A 5ADXH 1Q86O 4YOWA 3H3NO 5ADXA 3A0IX 2WFBA 2P9NA 3R3LA 4I6MA 3CCVN 2F9WA 4YORA 5AQXA 1BOTO 1YVNA 4GV3A 2AP1A 4BY9C 1T6DA 4XJXA 3SMSA 3CD6N 5BN9A 5C10A 5AQOA 3VEOA 2QWLA 4BRGA 1J6ZA 4PKIA 4JKHA 1ILYA 1YAGA 2VYPA 4JKDA 5DM7L 4XEIA 4B1UB 3BF3A 3EN9A 2OTJN 2NRZA 2CGJA 4RTFD 3C65A 2GWJA 3ENHA 4U7BA 1D4XA 2VGNA 4M7YA 4BRQA 2ASPA 4K43A 5JICA 2D4WA 2YJFA 4BR0A 2YHYA 4EHUA 4O8KA 5AQRA 3TPQA 3CCUN 2P9PA 4GV6A 4IDHA 4HTLA 4CD1A 4WFAL 5M1KA 1HJOA 5TKYA 1NGDA 4NB4A 1MWMA 3MCAB 3HI0A 2W00A 3SBGA 2FSKA 3D7EO 1KQSM 3DAWA 2E1ZA 3LDNA 2NRVA 5BRDA 1GLFO 1YI2N 4FL9A 1Q18A 3ENBA 3WXIA 1Y64A 2HBLA 3FLCO 3DXKA 3TSUA 3WXMB 2GX9A 2P9KA 3MCPA 5AQFA 1NWKA 2QTDA 3H6EA 3CCRN 2P9NB 1GLEG 3K9KA 2Q36A 4I6MB 1GLBG 3CPEA 1Q82O 1LOTB 1MDUB 2D0PA 3RSEA 2ZJQL 3O9RA 3KZBA 1BDGA 5AQWA 2A5XA 4BG9A 3VEYA 1ZXOA 1QQNA 3WXLA 3O9QA 4BRHA 2D0OA 1P90A 1ZBSA 1VQLN 2KKZA 1TYQB 4QS8A 5E26A 3FFKB 2CGLA 2KHOA 3CC7N 4HWIA 4IO9L 3EE8A 3VEXA 4GNIA 5AQZA 1W2BM 3AGRA 3LDPA 4BRPA 2P9UB 3ATVA 5CR4A 1GLDG 1GLJO 2FSNA 1M90O 3OBYA 1YF5L 4H03B 2E8AA 5MLCQ 2NRHA 1X9JA 4FPAA 5AQLA 3ZEUA 5C2FA 2P9SA 3QBXA 3HBTA 4UY8O 2HBMA 3R8EA 3ZETA 5JLFA 4FWLA 3AAQA 1DT9A 5AQMA 5LY3A 4CBUA 2YX6A 3CJ7A 2P9PB 1BU6O 3AY9A 3TSPA 3I33A 3MN6A 1HUXA 4FO0A 1NMDA 4IFEA 5ELZA 3NMUA 5AQQA 4YDUC 1QVGM 1KD1O 4WFNL 3ZX0A 1EQYA 3BF1A 3VTIA 1JCGA 4CZMA 1K8AO 5LJWA 4FOIA 5M1OA 3U8XA 1KC8O 2QEXN 3H3OB 2RE2A 4FOEA 3UB5A 1KAZA 3Q7CA 4YOVA 3WXKA 3K9JA 2DPNA 3A5LC 2HOEA 2Q1NA 2FSJA 4PKHA 4QS9A 3DLLL 3E66A 4OPAA 1K8KB 4IO8A 3RSEB 5JVHL 3CJCA 1HKBA 1E4GT 1NGIA 4MLHA 4BQZA 2V51B 3IKMA 4BC4A 1YHQN 1SS6A 3J8AA 3ZX2A 2QM1A 1SZ2A 2YJEA 2E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRE A;  1V4S A;  2Q31 A;  4H0V B;  5BRE A;  4YDU A;  1BG3 A;  1RFQ A;  4B1X B;  2EWS A;  4BR2 A;  3C7N A;  3O5B A;  2QW9 A;  3VEW A;  3ZEU B;  2VCP A;  2P9S B;  3QFP A;  1LCU A;  3M3Z A;  2E20 A;  3ZET B;  2CGK A;  3LDO A;  5EVZ A;  3CQX A;  5B8H A;  1QZ6 A;  2GUP A;  1WOQ A;  4MO5 A;  1SAZ A;  5F1X A;  4DCH A;  2IVO A;  4MO4 A;  5E84 A;  3QIC A;  5CE3 A;  4RWT A;  4B1Y B;  4K41 A;  4BRI A;  5KQ8 A;  3MMV A;  1C0G A;  2OAN A;  3D2E A;  2A40 A;  3CI5 A;  5FPM A;  2NLX A;  4FWN A;  4CBX A;  4CZG A;  3LL3 A;  5KPR A;  4CZE A;  1JCF A;  3VF6 A;  3CJ1 A;  4CD3 A;  1TUU A;  2ASM A;  1TYQ A;  2A6A A;  5AQV A;  3R6M A;  2I7N A;  3VGM A;  2QWR A;  5EXW A;  1DEJ A;  2BTF A;  2V7Y A;  4CZF A;  4DQ8 A;  3GG4 A;  5BPN A;  3LM9 A;  2P9U A;  1XQS C;  1U6Z A;  1QQO A;  4CJ7 A;  3OHR A;  3FZM A;  4FWQ A;  1NGA A;  1BUP A;  5EY4 A;  3WQU A;  3C7N B;  5JMV A;  4FWS A;  3UE5 A;  2IVP A;  5AQJ A;  4BGA A;  4PL7 A;  3O1B A;  4IXC A;  3H46 O;  5KPZ A;  2V7Z A;  4NO7 A;  3M1F A;  4BR7 A;  3FZF A;  2I7P A;  4IZ9 A;  3JXU A;  4EHT A;  3QBW A;  3VPZ A;  2ZF5 O;  5AQS A;  3VER A;  3GDQ A;  5AQN A;  3D2E B;  3IMX A;  3BUZ B;  1BO5 O;  1K8K A;  4FWO A;  1P8Z A;  3WUH A;  3GOI A;  1ZC6 A;  4CZH A;  3G25 A;  4H5T A;  4BRF A;  3VEN A;  4J8F A;  4WQ4 C;  2E2N A;  2GTD A;  5EOY A;  5BN8 A;  2CH5 A;  3L6Q A;  1GLL O;  2ITM A;  4BG8 A;  3TU5 A;  1HLU A;  2QWO A;  3A5N C;  4CZK A;  2E2P A;  4H0Y B;  2Q0R A;  4FWK A;  2A42 A;  1DKG D;  4BC3 A;  4M7X A;  1QQM A;  4WYB A;  1IJJ A;  4H5R A;  4XH4 A;  5BRF A;  5LJV A;  3H1V X;  3O8M A;  1Z6R A;  1YXQ A;  2FLO A;  4JAX A;  5FPE A;  3D2F A;  3KHY A;  5AQY A;  1XC3 A;  1MA9 B;  2WUS A;  2GWK A;  2YI1 A;  1ATS A;  1NGJ A;  3VET A;  3BEX A;  4QS7 A;  4WQ4 A;  4IJN A;  2QWP A;  3ULE B;  3WXJ A;  2UYT A;  3SK3 A;  4Y0W A;  3SJH A;  3ZX3 A;  5KPT A;  2E2Q A;  2AA4 A;  2YCH A;  1BA0 A;  3LM2 A;  4K42 A;  3VF2 A;  4H5W A;  1H1V A;  4B1Z A;  4BRN A;  2W41 A;  2YHX A;  1NGG A;  2ZGZ A;  2J4R A;  3C0B A;  3CIP A;  1U2V B;  4H0P A;  4BQL A;  2QWQ A;  4JHD A;  5EX5 A;  2Q97 A;  3FZL A;  2FF3 B;  1GLA G;  1JCE A;  4H0X B;  1KXP A;  4JN4 A;  3A5M C;  1GLC G;  3AAR A;  3WEE B;  4A2B A;  4AM7 A;  1NLV A;  3EKS A;  1C0F A;  5AQU A;  4BVO A;  4IJA A;  4BR5 A;  4ISF A;  3M6G A;  3D2F B;  4M63 C;  3QDK A;  1HX1 A;  4BRA A;  3MN5 A;  4B1V A;  3O08 A;  3EL2 A;  5BPM A;  3I8B A;  3CJ9 A;  4JD2 B;  3FZH A;  1KAY A;  4RCH A;  1QHA A;  2VWB A;  5AQT A;  2F9T A;  4EIA A;  3VF4 A;  3HM8 A;  5AR0 A;  2ZGY A;  3ID8 A;  1BA1 A;  2IVN A;  4H0O A;  4WQ5 C;  1QZ5 A;  4FPB A;  4Z94 A;  5BRH A;  1R59 O;  2E88 A;  4EAH D;  3GL1 A;  3HZ6 A;  3FGU A;  4IWV A;  4JHD B;  1HKC A;  2CH6 A;  5AFU H;  3UKU B;  4BC2 A;  3VEV A;  5AFU A;  5BPL A;  2FXU A;  3EKU A;  4H0T B;  1SQK A;  3MN9 A;  5AQH A;  1MWK A;  4FWM A;  1X3M A;  1NGC A;  3B8A X;  5AQK A;  4BRK A;  4KBO A;  3CJB A;  2P9L A;  3CJA A;  3A5O C;  1NGE A;  3AAP A;  3FZK A;  4DHY A;  3O1W A;  3ULE A;  4WQ5 A;  3WT0 A;  3R9P A;  5AQI A;  4DB3 A;  3QFU A;  4A2A A;  4BVP A;  4ISG A;  2Q0U A;  1HPM A;  1IG8 A;  3U9Z A;  3U9D A;  1ATR A;  1WUA A;  3MN7 A;  3L4I A;  1YUW A;  3FE1 A;  2YHW A;  4CZI A;  4JNE A;  3ENO A;  1ATN A;  3EZW A;  5LJW A;  3O6W A;  4ISE A;  3UKR A;  4CBW A;  4E1J A;  3CER A;  3DJC A;  4BRO A;  1U2V A;  4FSV A;  5FPN A;  3DXM A;  2A3Z A;  2BUP A;  2V52 B;  3DWL A;  3GE1 A;  4XH5 A;  4C23 A;  1NGF A;  2ZWH A;  5AZJ A;  2QWN A;  3H45 C;  5AZI A;  1NBW A;  3HTV A;  2H3G X;  2D1K A;  3WEE A;  5KQD A;  3W3D A;  3KVG A;  3HSC A;  3VGL A;  1S22 A;  1E4F T;  5F0X A;  2QXL A;  3IUC A;  4BRM A;  4CZJ A;  2P9L B;  4LC9 B;  3FR0 A;  3SMP A;  3EO3 A;  3IDH A;  3WQT A;  1NGB A;  3VES A;  4L3Q A;  4B1W B;  4BR9 A;  1NM1 A;  1OKJ A;  4JD2 A;  3LDL A;  2P9I A;  4B9Q A;  3QB0 A;  4BRL A;  2IIR A;  4K25 A;  4CZL A;  5BR9 A;  2PAV A;  4MLE A;  1HKG A;  3F9M A;  4PL8 A;  5AQG A;  4CI6 A;  4BRC A;  3VGK A;  1CZA N;  2PBD A;  3CQY A;  3UKR B;  2E2O A;  3DXK B;  3MK6 A;  3U4L A;  5F2R A;  3L0Q A;  2A41 A;  2GEM A;  2P9K B;  1NGH A;  4PKG A;  3DXM B;  5FPD A;  3A8Y A;  3GBT A;  4H5V A;  5AZJ B;  3UKU A;  4EFH A;  2HF3 A;  3CET A;  5AZI B;  3W0L A;  2W40 A;  1Z05 A;  1BWF O;  3MDQ A;  4A61 A;  1DGK N;  4FWR A;  3VOV A;  4XH1 A;  1RDW X;  1XUP O;  1TUY A;  4F9O A;  3CHW A;  1G99 A;  4FWP A;  3S41 A;  3JS6 A;  3IFR A;  3VEZ A;  4BC5 A;  2GEL A;  1S3X A;  1ESV A;  2NZT A;  4GY2 B;  3QML A;  5I9E B;  2HMP A;  2Q2R A;  5JLH A;  3P4I A;  1X3N A;  4O5F A;  1T6C A;  1RGI A;  3LDQ A;  1T44 A;  2HF4 A;  4BRD A;  3ATU A;  3BP8 A;  4BGB A;  1V4T A;  2ASO A;  2QWM A;  2P9I B;  3O4W A;  3SLC A;  3H1Q A;  2FF6 A;  4BR4 A;  4AM6 A;  4H5N A;  5AQP A;  1KAX A;  4A62 A;  3O80 A;  5ADX H;  3H3N O;  5ADX A;  3A0I X;  2P9N A;  4I6M A;  2F9W A;  5AQX A;  1BOT O;  1YVN A;  2AP1 A;  1T6D A;  3SMS A;  5BN9 A;  5AQO A;  3VEO A;  2QWL A;  4BRG A;  1J6Z A;  4PKI A;  1YAG A;  2VYP A;  4XEI A;  4B1U B;  3BF3 A;  3EN9 A;  2CGJ A;  4RTF D;  2GWJ A;  3ENH A;  1D4X A;  4M7Y A;  4BRQ A;  2ASP A;  4K43 A;  5JIC A;  2D4W A;  2YJF A;  4BR0 A;  2YHY A;  4EHU A;  4O8K A;  5AQR A;  3TPQ A;  2P9P A;  4CD1 A;  4HTL A;  1HJO A;  5TKY A;  1NGD A;  4NB4 A;  1MWM A;  3HI0 A;  2FSK A;  3D7E O;  3DAW A;  2E1Z A;  3LDN A;  5BRD A;  1GLF O;  4FL9 A;  1Q18 A;  3WXI A;  1Y64 A;  3FLC O;  3DXK A;  2P9K A;  3MCP A;  5AQF A;  1NWK A;  3H6E A;  2P9N B;  1GLE G;  2Q36 A;  4I6M B;  1GLB G;  1LOT B;  1MDU B;  2D0P A;  3RSE A;  3KZB A;  1BDG A;  5AQW A;  2A5X A;  4BG9 A;  3VEY A;  1ZXO A;  1QQN A;  3WXL A;  4BRH A;  2D0O A;  1ZBS A;  1TYQ B;  4QS8 A;  5E26 A;  3FFK B;  2CGL A;  2KHO A;  4HWI A;  3VEX A;  4GNI A;  5AQZ A;  3LDP A;  4BRP A;  2P9U B;  3ATV A;  1GLD G;  1GLJ O;  2FSN A;  4H03 B;  2E8A A;  2NRH A;  1X9J A;  4FPA A;  5AQL A;  3ZEU A;  2P9S A;  3QBX A;  3HBT A;  3R8E A;  3ZET A;  5JLF A;  4FWL A;  3AAQ A;  5AQM A;  5LY3 A;  4CBU A;  3CJ7 A;  2P9P B;  1BU6 O;  3AY9 A;  3I33 A;  3MN6 A;  1HUX A;  4FO0 A;  1NMD A;  5ELZ A;  5AQQ A;  4YDU C;  3ZX0 A;  1EQY A;  3BF1 A;  1JCG A;  4CZM A;  4FOI A;  3U8X A;  3H3O B;  4FOE A;  3UB5 A;  1KAZ A;  3WXK A;  2DPN A;  3A5L C;  2HOE A;  2Q1N A;  2FSJ A;  4PKH A;  4QS9 A;  1K8K B;  4IO8 A;  3RSE B;  3CJC A;  1HKB A;  1E4G T;  1NGI A;  4MLH A;  4BQZ A;  2V51 B;  4BC4 A;  3J8A A;  3ZX2 A;  2QM1 A;  1SZ2 A;  2YJE A;  2E1Y A; 
#chains in the Genus database with same CATH topology
 1YTA A;  3KTQ A;  3P39 A;  4YDU A;  1KVC A;  1BG3 A;  1MU2 A;  4NLB A;  2EWS A;  3O5B A;  4NXM K;  1ZBI A;  1VQK N;  1QVF M;  4WCE L;  3OW2 M;  1LCU A;  1VSE A;  2E20 A;  4JI5 K;  4O44 A;  5EVZ A;  1L3S A;  3CQX A;  1EP4 A;  3CXC M;  2GUP A;  1N8R O;  1WOQ A;  4CIG A;  4CFB A;  3KKS A;  4HHT A;  1HNZ K;  2X6N A;  1NKC A;  2IVO A;  5E84 A;  3QIC A;  3OYF A;  4RWT A;  3G6E N;  4OKJ A;  2YHB A;  3L2V A;  4DU4 A;  4KH6 A;  4DR6 K;  3RTV A;  1W0H A;  4JI7 K;  3QIN A;  5AJ3 K;  4W5Q A;  2IAJ A;  4FWN A;  4JI3 K;  4KB1 A;  2C1I A;  3CJ1 A;  4YOU A;  1YIJ N;  4BDY A;  3MEC A;  1TYQ A;  1B9F A;  5AQV A;  3R6M A;  2UXB K;  3VGM A;  5DM6 L;  1G15 A;  4B3M K;  4F8R A;  1DEJ A;  4L8R B;  4CZF A;  2YKN A;  1XQS C;  1HYV A;  4KH4 A;  3FZM A;  5E41 A;  2QI2 A;  4FWQ A;  1NGA A;  2HHS A;  3TAP A;  1UWB A;  4BGA A;  4K8X A;  3O1B A;  4IXC A;  1VSL A;  1K73 O;  5KPZ A;  3U3Y A;  2V7Z A;  4BR7 A;  1EWQ A;  4EHT A;  3NGY A;  3QBW A;  4Z4H A;  4NLC A;  2C1G A;  2BE2 A;  3D6R A;  3VER A;  3GDQ A;  3D2E B;  5K14 A;  1XMO K;  1S6P A;  4ELT A;  4E3S A;  4OGC A;  3GOI A;  4BE7 B;  3VQP A;  4C1N K;  3KLG A;  3LP1 A;  2YNF A;  3PIO L;  2OZS A;  3EEQ A;  4AF1 A;  4B9M A;  4J8F A;  4WQ4 C;  3TAR A;  2GTD A;  1IH7 A;  2HHW A;  2HHT A;  4OO1 J;  2CH5 A;  2P1J A;  2ITM A;  3PO4 A;  1W97 L;  3THX A;  4BG8 A;  1OH8 A;  3TU5 A;  3A5N C;  2QWO A;  1U04 A;  2E2P A;  4H0Y B;  2Q0R A;  2G8F A;  1BQN A;  2A42 A;  4DV3 K;  4B08 A;  4DQI A;  4XH4 A;  5HRR A;  4GKJ K;  1VQ8 N;  4C8O A;  3AO3 A;  4BDZ A;  3KWI A;  3OYN A;  2FLO A;  1VQ9 N;  3KHY A;  3VET A;  1ATS A;  1YJW N;  4QS7 A;  3SZ2 A;  4IJN A;  3M8P A;  1LWE A;  2OPR A;  3SK3 A;  4Y0W A;  2HHH K;  3AVH A;  1XHZ A;  2E2Q A;  3CMA N;  1ITG A;  1H1V A;  4JK7 A;  2RN2 A;  3OYD A;  4BRN A;  2YHX A;  2KQ2 A;  3OJS A;  2DTU A;  3DI6 A;  2J4R A;  4A59 A;  3V6D A;  3P38 A;  4LSL A;  4PHT X;  2QWQ A;  5EX5 A;  4AQY K;  2Q97 A;  4CJW A;  2DFE A;  4H0X B;  4JV5 K;  4OJR A;  1KXP A;  1NNE A;  2RPI A;  3A5M C;  1GLC G;  3AAR A;  3C6H A;  4HUE A;  5LMU K;  4KHS A;  2BGG A;  5LL6 Z;  1M1K O;  4FLY A;  1IV0 A;  3S3M A;  1YTU A;  3L8B A;  3CCM N;  1U48 A;  4FXD A;  3IRX A;  3OBW A;  5EU7 A;  1HX1 A;  2WTU A;  4RW4 A;  3EL2 A;  1JLC A;  2NRX A;  5AQT A;  4OPH A;  1BIS A;  4FVM A;  4RW6 A;  2F9T A;  3O4Q A;  4EIA A;  4DR5 K;  3ID8 A;  2IVN A;  4WQ5 C;  4AHC A;  3S5T A;  1VQ6 N;  2E88 A;  4IWV A;  4JHD B;  4FJI A;  3TAF A;  3AVF A;  3AO4 A;  4YY3 K;  2YNI A;  5AQK A;  3KWG A;  3Q7B A;  4KBO A;  3OYB A;  4KHN A;  1NGE A;  3OS2 A;  1XHX A;  4FJL A;  4DV0 K;  4IEE A;  3VQ5 A;  4DHY A;  2IDO A;  4IDK A;  4DF4 A;  4CJU A;  3ULE A;  2HBJ A;  2BAN A;  3K5N A;  4EZ6 A;  1S6Q A;  3L2U A;  3VQE A;  3R9P A;  4DB3 A;  4I7F A;  1NK7 A;  3JAM O;  1S1W A;  3NBP A;  3U9Z A;  1QTM A;  1OH6 A;  2W6L A;  1ATN A;  3T3F A;  3KK7 A;  3CER A;  3DJC A;  1U2V A;  4CGD A;  1NG9 A;  3DXM A;  3THW B;  4XH5 A;  2ZWH A;  5AZJ A;  2QWN A;  5AZI A;  2D5R A;  4CCH A;  2VQE K;  1TKT A;  5KQD A;  3WEE A;  1HNX K;  1C1B A;  2NRW A;  5KI6 A;  2KFN A;  2RKI A;  1VSK A;  2O8B B;  2QXL A;  5M1N A;  4KTQ A;  4DUY K;  4RW8 A;  3LP2 A;  2ATQ A;  1RDB A;  1NGB A;  3VES A;  1NJI O;  3U3G A;  2JWL A;  1WAF A;  5GAH P;  1HQU A;  3TAG A;  3NVK A;  3TTD A;  3VA0 A;  1HKG A;  3F9M A;  4J2B A;  4Y1C A;  4JKB A;  1NJX A;  2B4J A;  3T69 A;  4FLW A;  2E2O A;  3HST B;  4FZY A;  3L0Q A;  3AVA A;  2HHI A;  3A8Y A;  3GBT A;  3ZT1 A;  3KD5 E;  3CET A;  3W0L A;  3I55 N;  1W9H A;  4DWI A;  4KHU A;  4A61 A;  3K57 A;  3AO2 A;  2F8S A;  4CIF A;  1RDW X;  2F7T A;  3JS6 A;  4CHQ A;  3IFR A;  2ZE2 A;  3OVN A;  2GEL A;  1S3X A;  4FLZ A;  3QIP A;  3OA9 A;  4DR3 K;  4KHP K;  1HPZ A;  3QER A;  1X3N A;  3ZCM A;  2I5J A;  1RDU A;  2XRI A;  1T44 A;  3O9S A;  1ZBH A;  4BRD A;  1RT2 A;  1VQP N;  1Q9X A;  5GIP A;  2P9I B;  3SLC A;  4FZX C;  3I0R A;  2FF6 A;  3EY1 A;  3MWT A;  4BR4 A;  4AM6 A;  4H5N A;  1NOY A;  4YOW A;  4FK0 A;  2D0A A;  5CYQ A;  4BY9 C;  4XJX A;  1TV6 A;  3CD6 N;  2Z1H A;  4JKH A;  1KSP A;  3G0Z A;  1WSG A;  5DM7 L;  2KZZ A;  1VSF A;  3J7Y P;  4IKF A;  4LF7 K;  2CGJ A;  4DU3 A;  4FW1 A;  1D4X A;  2D0C A;  1IKW A;  2VGN A;  4DTS A;  5LMN K;  2YHY A;  3MEG A;  4EHU A;  3CCU N;  2HMI A;  3IS9 A;  4KHY A;  4IDH A;  4HTL A;  4RG8 A;  1HJO A;  4JI1 K;  4E19 A;  2FSK A;  3D7E O;  2E1Z A;  1RCH A;  1Q18 A;  4E1N A;  2NUB A;  2OYQ A;  2O8C A;  2P9K A;  4BE1 A;  1GLE G;  3K9K A;  3TAE A;  4CJK A;  3AVJ A;  1CXU A;  1Q82 O;  1MDU B;  3RSE A;  3HK2 A;  2A5X A;  1Z26 A;  4BG9 A;  5C25 A;  4JRQ A;  3NFA A;  1ZBS A;  1VQL N;  1TYQ B;  1X9M A;  5AQZ A;  2OPS A;  1W2B M;  2BDP A;  4BRP A;  3ATV A;  4DQS A;  4M41 A;  3CYM A;  2E8A A;  1CZ9 A;  2HHU A;  4F3O A;  1EX4 A;  2P9S A;  1NJZ A;  4UY8 O;  4JI0 K;  3ZET A;  4FWL A;  2YX6 A;  1X1P A;  3WNG A;  5J2N A;  5AQQ A;  4YDU C;  1QVG M;  4FLX A;  3BF1 A;  1JCG A;  5KRS A;  4CZM A;  3PY8 A;  1K8A O;  4XIU A;  3BZK A;  4B8A B;  4FOE A;  4J2E A;  4YOV A;  4CK1 A;  2DPN A;  3A5L C;  1IKV A;  2Q1N A;  3SUQ A;  4IO8 A;  3CJC A;  4ELV A;  4OKE A;  2HHX A;  4BC4 A;  4DTX A;  3MXJ A;  3BY5 A;  4E72 A;  1WB9 A;  5BRE A;  3DLG A;  4BR2 A;  4B1X B;  3C7N A;  3TWH A;  3VEW A;  3AA3 A;  3ZEU B;  1C0M A;  4YHH K;  3L4Q A;  1ZBL A;  5B8H A;  5F1X A;  4ILH A;  5CE3 A;  1NMN A;  1I39 A;  1YJN N;  1IKY A;  4K41 A;  5KQ8 A;  3MMV A;  2OAN A;  4FJJ A;  2XO7 A;  2A40 A;  3CG7 A;  4Z4E A;  3MX5 A;  4KFB A;  3LL3 A;  2DFH A;  3O9U A;  2KW4 A;  5C12 A;  1TUU A;  1BCM A;  2A6A A;  4DQR A;  3LPT A;  4CEF A;  2I7N A;  4CGJ A;  2QWR A;  5EXW A;  1RTD A;  2BTF A;  3GG4 A;  4CFA A;  3LM9 A;  2HVI A;  2DFF A;  1BUP A;  2P51 A;  4FWS A;  4B8C A;  3QNO A;  1JXB A;  3VQ8 A;  5CHI A;  3VTH A;  4PL7 A;  1OH5 A;  5FDL A;  3CCE N;  3OYE A;  3BZC A;  2VWK A;  4N5S A;  1HQE A;  4I9Q A;  1U4B A;  1NU0 A;  3VPZ A;  3SPY A;  3BUZ B;  4CJ4 A;  4R5P A;  4CGI A;  1IBK K;  3WUH A;  1ZC6 A;  4DSK A;  5KRT A;  3DLB A;  1RIL A;  1VSH A;  3SAG A;  2P5G A;  2UXC K;  1RTI A;  1KVA A;  1GLL O;  4DFK A;  3SAH A;  4PWD A;  3ZSZ A;  4CGH A;  3J7Z O;  1NOZ A;  3V9Z A;  1YIT N;  3LPU A;  1J5E K;  3CM5 A;  4WE1 A;  4LH5 A;  1DKG D;  4BC3 A;  1RNH A;  2B6A A;  5IT9 O;  4WYB A;  5LJV A;  2Z1G A;  3O8M A;  5I42 A;  1VRU A;  4AHR A;  4KAZ A;  5FPE A;  1HNV A;  3D2F A;  4CJS A;  4JKA A;  3RR8 A;  3LP3 A;  1NGJ A;  3NVM A;  5TKW A;  5HOO A;  1JKH A;  2IOC A;  3ULE B;  2UYT A;  4OPJ A;  4CEQ A;  3P83 D;  4CEO A;  5BR8 K;  1YT3 A;  3HOS A;  1HJR A;  4V19 S;  1A5X A;  4B1Z A;  3VF2 A;  4AHS A;  2IGI A;  3F2K A;  1KFS A;  2ETJ A;  4CJ3 A;  2EHG A;  3TSQ A;  4FJK A;  4IEI A;  1U2V B;  3T1H K;  4BQL A;  1GOC A;  5C0Y A;  2FF3 B;  1IBM K;  4FJ9 A;  3QEV A;  3WEE B;  1VQN N;  1NLV A;  2FBT A;  1QQC A;  3HOT A;  5AQU A;  4BR5 A;  4M3U A;  4ISF A;  3AA4 A;  3NDK A;  4M63 C;  3PLA A;  4C1N I;  4BRA A;  2FBY A;  4B1V A;  3I0S A;  4CJ5 A;  3SQ4 A;  3I8B A;  3CJ9 A;  1KAY A;  4JKG B;  2VWB A;  3SV4 A;  4WFB L;  2BH1 A;  1KFD A;  4MDB A;  3VF4 A;  3ID6 A;  1VSM A;  4DR7 K;  4Z94 A;  1R59 O;  3GL1 A;  2OTL N;  4GVE A;  4E7I A;  3HZ6 A;  3FGU A;  1FK9 A;  4OGE A;  5FRO A;  5AFU H;  3QEW A;  5J2M A;  1TKD A;  3EKU A;  3ZSX A;  3PX0 A;  2X78 A;  3A2F A;  3MN9 A;  5AQH A;  4FK4 A;  3G10 A;  3KD1 E;  5HP1 A;  3CYG A;  3R1X A;  1VAZ A;  4BEC A;  4QAG A;  3A5O C;  1KCF A;  4KRE A;  2PYJ A;  2O8F B;  2FC0 A;  3PUF A;  4M45 A;  1WBD A;  4JK8 A;  3WT0 A;  4DFP A;  5M1P A;  5AQI A;  4A2A A;  1ZBF A;  5M1Q A;  4BVP A;  4ISG A;  1ATR A;  3MN7 A;  4O0I A;  3CC4 N;  4CZI A;  3EZW A;  5LJW A;  3BDP A;  1RBU A;  4BRO A;  3DWL A;  4NCA A;  3H45 C;  4OLA A;  3VQ6 A;  1U45 A;  2IS3 A;  4CHY A;  1ASU A;  1HYZ A;  3CQ8 A;  2ZJR L;  5A2Q O;  1O13 A;  3HSC A;  2P9L B;  3LAN A;  4GV9 A;  4X65 K;  3EO3 A;  1VQM N;  2VG7 A;  4DFJ A;  1XC9 A;  4JD2 A;  4JEP A;  1E3M A;  3OYA A;  4KI6 A;  1XWL A;  3QB0 A;  4BRL A;  1JL1 A;  4CZL A;  5BR9 A;  4MLE A;  3CCL N;  3RR7 A;  3TAB A;  4PL8 A;  3ZSW A;  2O8D A;  4R79 A;  1J9A A;  3UKR B;  3MK6 A;  2UUC K;  5F2R A;  4E7H A;  2GEM A;  2P9K B;  1NGH A;  4PKG A;  1RTH A;  5FPD A;  3JYT A;  4KTZ A;  4Z4I A;  3NH0 A;  3UKU A;  3C6U A;  2HF3 A;  3PX4 A;  2W40 A;  4LF4 K;  1C1A A;  1DGK N;  3VOV A;  4XH1 A;  3RWU A;  2LSN A;  3S41 A;  3PX6 A;  2HHV A;  4DU1 A;  4O8U A;  3VEZ A;  4BAC A;  4BC5 A;  2X6S A;  4GY2 B;  1J54 A;  4O5F A;  4FVU A;  1T6C A;  1WSI A;  1L3V A;  4JI8 K;  3K2P A;  5JVG L;  2O4I A;  3AA5 X;  3CCQ N;  2NRR A;  2WOM A;  3VN5 A;  4FM0 A;  1V4T A;  2QWM A;  4M3Z A;  3O4W A;  3H1Q A;  2QKK A;  5ADX H;  1C1C A;  1CZB A;  1EET A;  2FBX A;  1BHL A;  4YOR A;  5AQX A;  1BOT O;  1YVN A;  3O4N A;  4ID5 A;  4DTO A;  4GV3 A;  2AP1 A;  4JI4 K;  2XY6 A;  1T6D A;  5BN9 A;  4LFA K;  1N5Y A;  1ILY A;  1FKP A;  3L2W A;  1YAG A;  4BWM A;  2VYP A;  4JKD A;  4CJE A;  3BF3 A;  3DLK A;  2O8E B;  2NRZ A;  4RTF D;  4OKK A;  4C8L A;  1QSY A;  4M7Y A;  4KRF A;  3KLI A;  4K43 A;  2D4W A;  3SCX A;  3QES A;  3VQB A;  4O8K A;  1JLF A;  2P9P A;  4GV6 A;  5M1K A;  3T1Y K;  1NGD A;  2XHB A;  1MWM A;  3HI0 A;  1KQS M;  3LDN A;  2NRV A;  4DFM A;  5BRD A;  1X9S A;  3OJU A;  1TAU A;  4HUG A;  1YI2 N;  4OVL A;  3KLE A;  2HBL A;  1LAV A;  3DXK A;  2GX9 A;  4IBN A;  5AQF A;  4DF8 A;  3CCR N;  2P9N B;  2Q36 A;  2E6M A;  4I6M B;  1GLB G;  3CPE A;  4LFB K;  3QEI A;  4CK3 A;  3O9R A;  5AQW A;  1BDG A;  5SWM A;  1QS4 A;  1ZXO A;  3DLR A;  1QQN A;  3JSM A;  3QET A;  4BRH A;  1SL1 A;  4QS8 A;  2KHO A;  5SZT A;  4HWI A;  4IO9 L;  3VEX A;  3V9X A;  3AGR A;  4B9S A;  3SQ2 A;  3DRP A;  5CR4 A;  3OBY A;  1YF5 L;  4H03 B;  3PV8 A;  3LAM A;  4OLB A;  3ASM A;  5C2F A;  5KGX A;  5AQM A;  3AAQ A;  4KV8 A;  5LY3 A;  1K6Y A;  4NCG A;  4CEZ A;  1HUX A;  4FO0 A;  4IFE A;  2YKM A;  3NMU A;  1KD1 O;  3LDS A;  1EKE A;  4Z4C A;  1UA0 A;  1JLE A;  4DV5 K;  4FOI A;  1KC8 O;  1UAX A;  2G8H A;  4E0D A;  5D3G A;  2RE2 A;  3UB5 A;  4FM1 A;  1SKW A;  3K9J A;  2HOE A;  4FJH A;  3J7A P;  3E66 A;  4ZHR A;  3E01 A;  1NGI A;  4CF9 A;  3AVK A;  2ZM6 K;  3J8A A;  1A5V A;  1RT4 A;  2E1Y A;  1BGX T;  1V4S A;  4H8K A;  3AVL A;  3OYM A;  4JK9 A;  4CF2 A;  5KGW A;  3UIQ A;  1S9E A;  2A1R A;  2QW9 A;  1XNQ K;  4F2R A;  5JS2 A;  4DSE A;  3M3Z A;  1LAW A;  1RT5 A;  1SUQ A;  1JLA A;  1QZ6 A;  1U47 A;  4PUO A;  4MO5 A;  1SAZ A;  3HJF A;  2UUA K;  2E4L A;  5JEN A;  2PFU A;  5I3U A;  4BEB A;  4AH9 A;  4BRI A;  2G8V A;  1FW6 A;  5T7B A;  4CED A;  5CZ2 A;  3E9O A;  1BQM A;  1C0G A;  3VQ4 A;  3D2E A;  5GIO A;  1WSE A;  4DKW A;  5C15 A;  1ZBU A;  4CBX A;  3TAN A;  5KPR A;  4CZE A;  3HRG A;  3LZI A;  1R0A A;  4F2S A;  2V7Y A;  4DQ8 A;  3V81 A;  1JLQ A;  2ITG A;  2OZM A;  5BPN A;  2P9U A;  1ZYQ A;  1U6Z A;  4CHZ A;  3SV3 A;  3ZSQ A;  4G9Z A;  3DOK A;  4CER A;  3KK2 A;  1J5O A;  3ZT4 A;  4LF5 K;  5JMV A;  3UE5 A;  4FW2 A;  4ELU A;  4DTU A;  1VSJ A;  1Q7Y O;  1CLQ A;  4FJM A;  3QEX A;  2X74 A;  3AVG A;  2VG6 A;  3H46 O;  4DSI A;  4NO7 A;  2PYL A;  3M1F A;  4I2P A;  3ULD A;  3FZF A;  4IZ9 A;  2NRT A;  3V4I A;  3H08 A;  2ZF5 O;  5AQS A;  4CGF A;  4I2Q A;  3IMX A;  1NJY A;  1NKB A;  4MDA A;  3C6A A;  1P8Z A;  1ASW A;  3OYG A;  1IG9 A;  4IOC L;  5C2D A;  3G25 A;  4BRF A;  4YOY A;  2E5L K;  3NAE A;  1SV5 A;  1S1V A;  2E2N A;  4G1Q A;  1RDA A;  3D0P A;  4EP5 A;  1N36 K;  3N4Q A;  3K5O A;  3J81 O;  4M3Y A;  1LV5 A;  2HW3 A;  4FWK A;  4GKK K;  2HBK A;  1I94 K;  1QQM A;  1W7A A;  1IJJ A;  2KLA A;  1I3A A;  1TVR A;  3H1V X;  2KZM A;  1WAJ A;  1RDC A;  1XC3 A;  1MA9 B;  2G8U A;  2WUS A;  2GWK A;  2YI1 A;  1C0T A;  4HCB A;  4ILG B;  1TKX A;  4KKO A;  4JKF A;  4B9V A;  4IOA L;  3HYF A;  3ZYY X;  2JGU A;  3NGI A;  3ZX3 A;  2YCH A;  4H5W A;  3VQD A;  3OS1 A;  2PY5 A;  4OX9 K;  3EYZ A;  3KK3 A;  4B3S K;  3MEE A;  4F3T A;  2A1S A;  2ZGZ A;  1KTQ A;  3AO1 A;  1L5U A;  1XNR K;  1LW2 A;  4FJ5 A;  3CIP A;  4H0P A;  4JHD A;  4CJT A;  4BWJ A;  3SAF A;  1U49 A;  3FZL A;  3LWM A;  3THX B;  3HM9 A;  1GLA G;  3AGK A;  1B9D A;  3AVB A;  4JN4 A;  3DLE A;  4N76 A;  3G71 N;  3V9W A;  3NF6 A;  1YJ9 N;  2PZS A;  2Z1I A;  3ITH A;  2QA4 N;  2B5J A;  3RVC A;  3MN5 A;  5JS1 A;  3O08 A;  3K5L A;  3CF5 L;  4CEB A;  5BPM A;  4JD2 B;  3FZH A;  1QHA A;  4A5B A;  2OCE A;  2ZGY A;  4BE2 A;  3OYI A;  1QZ5 A;  4FPB A;  4FM2 A;  3THW A;  2UU9 K;  3CME N;  3AV9 A;  5BRH A;  4DTP A;  3NHG A;  3P31 A;  3AVM A;  3OY9 A;  1HKC A;  2Z1J A;  3UKU B;  4BC2 A;  1BI4 A;  3VEV A;  1KLN A;  4Y1D A;  2FXU A;  4K0K K;  2DY4 A;  2KTQ A;  3P1G A;  3S3O A;  4CEA A;  4LFC K;  3KLF A;  2G8I A;  1X3M A;  3E9P A;  4BRK A;  4ID1 A;  4DR1 K;  3CJA A;  1T8E A;  3KJV A;  3ALY A;  1VHX A;  3AAP A;  1S1U A;  4I9L A;  4IFY A;  3FZK A;  1QHT A;  1RBT A;  4CES A;  5KTQ A;  4CF0 A;  2OA8 A;  1D9F A;  5HRO A;  2VQF K;  3QFU A;  3I56 N;  2Q0U A;  1HPM A;  4FLU A;  1IG8 A;  3LAL A;  5FLX O;  1WUA A;  3L4I A;  1YUW A;  3EE9 A;  3FE1 A;  1WN7 A;  4DS5 A;  3O6W A;  4ISE A;  4CBW A;  4E1J A;  3NCI A;  3L3U A;  4FSV A;  2A3Z A;  3GE1 A;  4LH4 A;  5FRM A;  1UOC A;  1JXE A;  4FYD A;  1WNS A;  5CYM A;  1NBW A;  3PSF A;  2H3G X;  2D1K A;  1N33 K;  3HPH A;  4IG0 A;  3KVG A;  4CHP A;  1E4F T;  3SPZ A;  3IUC A;  4BRM A;  4CZJ A;  4DV4 K;  3CFR A;  3E1Y A;  4LC9 B;  3FR0 A;  4X64 K;  1IBL K;  1X9W A;  4JS4 A;  1FKO A;  4O4G A;  2FBV A;  3TAM A;  3TI0 A;  3C6T A;  4L3Q A;  3T1A A;  4B1W B;  1NM1 A;  3KLH A;  1OKJ A;  3HPG A;  3LDL A;  3PO5 A;  4DSF A;  2P9I A;  4CW7 B;  2YHA A;  3RMA A;  2PAV A;  1S72 N;  2GUI A;  5AQG A;  2F8T A;  4BRC A;  5DMR A;  3SNN A;  2PBD A;  4CHO A;  4O5B A;  3DXK B;  2F4V K;  3DXM B;  1WSH A;  4CVN E;  5AZJ B;  4DTJ A;  4EFH A;  2WBN A;  5AZI B;  3PSI A;  2RF2 A;  1LWF A;  2VWJ A;  1RTJ A;  1Z05 A;  3CFO A;  1BWF O;  4CFC A;  4FWR A;  3DRS A;  3F73 A;  1XUP O;  2YNH A;  3SBT A;  5J2P A;  1F21 A;  1G99 A;  3NH2 A;  4W5T A;  3L2Q A;  1ESV A;  3V9U A;  2NZT A;  2NNW A;  3QML A;  1OVQ A;  5I9E B;  2HMP A;  4LY7 A;  2E6L A;  3P4I A;  4F4K A;  4Q5V A;  3KK1 A;  1T3V A;  1T03 A;  1RBV A;  3BP8 A;  4B3R K;  4BGB A;  1DLO A;  1VSI A;  4A57 A;  3LWL A;  2ZJP L;  3CCJ N;  4E7K A;  5AQP A;  3OYL A;  3MWP A;  3U6F A;  1Q86 O;  3WNF A;  1L3U A;  2WFB A;  3M8S A;  3HVR A;  3CM6 A;  3CCV N;  4H4M A;  1S1X A;  5C10 A;  3OYH A;  3BGR A;  1J6Z A;  1YVU A;  4XEI A;  3SJJ A;  4KI4 A;  3EN9 A;  1SKR A;  3B6O A;  3NE6 A;  3C94 A;  2OTJ N;  3C65 A;  4U7B A;  3HT3 A;  4BRQ A;  4PA1 A;  3WNE A;  3TPQ A;  4CD1 A;  2R7Y A;  4WFA L;  3SUO A;  3SYZ A;  5TKY A;  3MCA B;  1JLG A;  1GOB A;  2HNY A;  5IWA K;  3DAW A;  4M3W A;  3NF9 A;  1GLF O;  4CF1 A;  4ICL A;  3ENB A;  3WXI A;  4E1M A;  5J1E A;  1Y64 A;  3ZT0 A;  3FLC O;  4AHV A;  4RW9 A;  3P5J A;  3V1R A;  3TSU A;  1TK8 A;  4M3R A;  3RRH A;  1NK6 A;  4B9N A;  3IAY A;  2QTD A;  3H6E A;  4IFV A;  1LWC A;  3O3H A;  1LOT B;  2D0P A;  3KZB A;  3VEY A;  3WXL A;  1P90 A;  2KKZ A;  5E26 A;  3FFK B;  2CGL A;  4BDP A;  4ZTF A;  1NK0 A;  3CC7 N;  3EE8 A;  1TK0 A;  4DQP A;  3THY A;  2OPQ A;  2P9U B;  1GLD G;  1GLJ O;  2FSN A;  5MLC Q;  4DLE A;  3QIO A;  2NRH A;  4FPA A;  3ZEU A;  3OYJ A;  4PY5 A;  3QBX A;  4LF6 K;  2HBM A;  1HR0 K;  3R8E A;  4DS4 A;  1DT9 A;  4Z4G A;  3CJ7 A;  4FJ7 A;  1BU6 O;  3AY9 A;  3V9S A;  3TSP A;  4HVJ A;  3MN6 A;  1WLJ A;  2Y1J A;  5ELZ A;  1NK5 A;  1IO2 A;  4WFN L;  3TAQ A;  4FJN A;  1TL3 A;  4KPY A;  2G8K A;  2QKB A;  1D9D A;  3HL8 A;  1LW0 A;  5M1O A;  3U8X A;  2O8C B;  2QEX N;  3Q7C A;  2P5O A;  1TGO A;  1FJG K;  2FSJ A;  4PKH A;  4QS9 A;  3DLL L;  4OPA A;  3FFI A;  2AJQ A;  3RSE B;  5JVH L;  2YV0 X;  1HKB A;  4MLH A;  3VQQ A;  2V51 B;  4NYF A;  1JL2 A;  1YHQ N;  1SS6 A;  1VK0 A;  3ZX2 A;  2QM1 A;  4PQU A;  1SZ2 A;  1HRH A;  2Q3S A;  4BRE A;  2Q31 A;  4FCY A;  4CIE A;  4H0V B;  1OH7 A;  1RBR A;  5HRP A;  4DTR A;  1RFQ A;  1TL1 A;  1WSJ A;  2GBZ A;  4CJP A;  4DUZ K;  4EP4 A;  2VCP A;  4CFD A;  2P9S B;  3QFP A;  3ZET B;  2CGK A;  3O3F A;  3LDO A;  3QLH A;  3V1Q A;  4DCH A;  4MO4 A;  3O9T A;  4B1Y B;  1C0U A;  3F5T A;  4IOX A;  1D5A A;  3CI5 A;  5FPM A;  2NLX A;  3CCS N;  4CZG A;  1JCF A;  3VF6 A;  3T19 A;  1BL3 A;  4CD3 A;  2ASM A;  1SL2 A;  2XY5 A;  3F9K A;  4HUF A;  3KIO A;  4M3T A;  3ZSY A;  1Y97 A;  3RRG A;  5DK5 A;  1QQO A;  4Q0B A;  4CJ7 A;  3OHR A;  4JKE A;  3AVI A;  4FLV A;  2O4G A;  5EY4 A;  3WQU A;  4DR2 K;  1VQ7 N;  3C7N B;  3HO1 A;  4FJ8 A;  1XI1 A;  2IVP A;  1BIU A;  3V1O A;  3OYC A;  3MXI A;  3DM2 A;  4CF8 A;  5AQJ A;  2VG5 A;  1SKS A;  4K8Z A;  4CK2 A;  1QE1 A;  4M3X A;  2I7P A;  4LSN A;  3JXU A;  3AA2 A;  4A5A A;  3NH1 A;  4DSL A;  4CHN A;  4YNQ A;  4X62 K;  5GIN A;  5AQN A;  1WBB A;  1BO5 O;  1K8K A;  3ZLJ A;  2RHK A;  4FWO A;  1KLM A;  1BIZ A;  3NF7 A;  4CZH A;  4U67 L;  5C42 A;  4H5T A;  3J80 O;  3VEN A;  5C24 A;  4DQQ A;  4Z4F A;  1B92 A;  3CC2 N;  1RT1 A;  3O3G A;  3HP9 A;  1O1W A;  5EOY A;  1KVB A;  5BN8 A;  3THV A;  3L6Q A;  1VQ4 N;  4NXN K;  3I8D A;  4E7L A;  3MX2 A;  3S3N A;  4DTN A;  2XY7 A;  3SUN A;  1JLB A;  2VGM A;  3ZSO A;  1BI4 B;  1HLU A;  4CZK A;  4X66 K;  3HVT A;  4M7X A;  4H5R A;  5BRF A;  5HRN A;  1Z6R A;  1YXQ A;  4JAX A;  3PIP L;  1GOA A;  4O55 A;  5AQY A;  1HYS A;  1HMV A;  3BEX A;  4GMJ B;  4WQ4 A;  1VSD A;  3C95 A;  2QWP A;  3DMJ A;  1QSL A;  3WXJ A;  5GAD P;  4Z0U A;  1T7P A;  3SJH A;  2W6K A;  5KPT A;  3VQC A;  2AA4 A;  4JKG A;  1Q9Y A;  4KHQ A;  1BA0 A;  1DTQ A;  2XY8 A;  3LM2 A;  4K42 A;  1TK5 A;  1VQ5 N;  4W5O A;  2HB5 A;  4H4O A;  2W41 A;  1NGG A;  2HST A;  4C8K A;  3DYA A;  3ZT2 A;  1EXQ A;  1EO1 A;  3C0B A;  5GAE P;  4WF9 L;  1SL0 A;  1JCE A;  3MAQ A;  4LF9 K;  3S9H A;  4FJX A;  4CJF A;  3EZ5 A;  3CPW M;  4A2B A;  4AM7 A;  5HBM A;  3EKS A;  1D8Y A;  1C0F A;  4ILJ A;  4BVO A;  4IJA A;  3ISN C;  3M6G A;  3D2F B;  3HPO A;  3DLH A;  3TTC A;  4CJV A;  1Q81 O;  2O8F A;  2GV9 A;  5H1S Q;  4CE9 A;  2WC9 A;  3QDK A;  3K0S A;  3AO5 A;  2JWK A;  3TTF A;  3ZSV A;  4E89 A;  4RCH A;  4J2A A;  3RMB A;  4JLH A;  3HM8 A;  5AR0 A;  4N47 A;  4DV7 K;  4FLT A;  1BA1 A;  4H0O A;  4B9U A;  4EAH D;  3SQ0 A;  4JKC A;  4LF8 K;  2CH6 A;  1HNW K;  3N4P A;  5AFU A;  5BPL A;  4H0T B;  1SQK A;  1MWK A;  3IG1 A;  4FWM A;  1NGC A;  3B8A X;  1C6V A;  4BE0 A;  1RBS A;  4B9T A;  3KKR A;  3K5M A;  3LP0 A;  4KHW A;  3CJB A;  3DOL A;  2P9L A;  3OS0 A;  4CEE A;  4HCC A;  4C8N A;  4W5N A;  4N56 A;  3RMC A;  3SUP A;  4YFU A;  4JRP A;  1IKX A;  3O1W A;  3QEP A;  4WQ5 A;  2HHQ A;  4DV6 K;  3ZT3 A;  3QO9 A;  4RW7 A;  1RT3 A;  1XMQ K;  3U9D A;  4YOT A;  2OPP A;  2YHW A;  4JNE A;  1TAQ A;  3ENO A;  4E7J A;  5GAG P;  3UKR A;  1WSF A;  5FPN A;  2JLE A;  2BUP A;  2V52 B;  4C23 A;  4KO0 A;  1NGF A;  5HLF A;  1VRT A;  4J2D A;  1VQO N;  4DR4 K;  3HTV A;  5M1F A;  3W3D A;  1Z25 A;  4KB0 A;  2WON A;  1FXX A;  5CY4 A;  4NCB A;  3VGL A;  1HNI A;  4OPK A;  1S22 A;  4AHU A;  5F0X A;  4JS5 A;  4DMN A;  2QK9 A;  4FK2 A;  4IG3 A;  3SMP A;  3M8Q A;  4MFB A;  3IDH A;  3WNH A;  3WQT A;  1L3T A;  3M5R A;  1QSS A;  3VMF B;  3LZJ A;  4YOX A;  2YNG A;  4C8M A;  4BR9 A;  3E9L A;  4B9Q A;  2Y1I A;  2IIR A;  4K25 A;  1RT6 A;  5J2Q A;  1NK8 A;  4AIL C;  1K9M O;  4DSJ A;  4CI6 A;  3OTO K;  3T7Z A;  4M42 A;  3VGK A;  1CZA N;  3CQY A;  1KRP A;  4JI6 K;  3U4L A;  2HNZ A;  2A41 A;  2F96 A;  3NF8 A;  4CEC A;  4N41 A;  4H5V A;  3G4S N;  1A5W A;  3SQ1 A;  3K59 A;  4AHT A;  3MDQ A;  1CXQ A;  3MXM A;  1TUY A;  4F9O A;  3CHW A;  3HP6 A;  4FWP A;  4O0J A;  2O8E A;  1T05 A;  2ZD1 A;  2ZQB A;  3THY B;  2D0B A;  2Q2R A;  4ZTJ A;  5JLH A;  3LDQ A;  1RGI A;  5HL7 L;  2HF4 A;  3MED A;  3AVN A;  1JJ2 M;  1OVY A;  3ATU A;  3L2R A;  3D45 A;  4NYN A;  2ASO A;  2UXD K;  2W42 A;  1N6Q A;  2HND A;  4KH5 A;  1J53 A;  1KAX A;  4A62 A;  3O80 A;  3NGZ A;  2O8D B;  3H3N O;  5ADX A;  3A0I X;  2P9N A;  3R3L A;  4I6M A;  2F9W A;  5HRS A;  4CJR A;  4FZZ A;  3SMS A;  1REV A;  4DTM A;  1EWR A;  2IC3 A;  4TSX A;  5AQO A;  2QWL A;  3VEO A;  4BRG A;  4PKI A;  2EX3 A;  1ASV A;  2O8B A;  3LAK A;  3DRR A;  4EZ9 A;  4B1U B;  1NK9 A;  4GW6 A;  1BCO A;  1RDD A;  5CZ1 A;  2GWJ A;  3ENH A;  4JYA K;  3VQA A;  2ASP A;  5JIC A;  2YJF A;  4HTU A;  4BR0 A;  5AQR A;  4NB4 A;  2W00 A;  3SBG A;  4QOZ B;  3TR8 A;  1N34 K;  4FL9 A;  4CJL A;  3WXM B;  3MCP A;  1NK4 A;  4DV1 K;  1NWK A;  3HXM A;  3OYK A;  2UUB K;  4FJG A;  4CGG A;  3VQ7 A;  2ZJQ L;  1S5J A;  4DG1 A;  3VA3 A;  3O9Q A;  3QNN A;  4B9L A;  2D0O A;  3ZSR A;  1NKE A;  4DLG A;  4KTW A;  4GNI A;  4JI2 K;  3LDP A;  1N32 K;  1M90 O;  4DV2 K;  3VQ9 A;  3B6P A;  1X9J A;  5AQL A;  3HBT A;  4GVM A;  1Q8I A;  5JLF A;  1S1T A;  2KFZ A;  4CBU A;  4CJQ A;  2P9P B;  3I33 A;  3SI6 A;  1NMD A;  4B3O A;  3CFP A;  3ZX0 A;  3M8R A;  1TKZ A;  1EQY A;  5FRN A;  4W5R A;  4B3T K;  3K58 A;  3VTI A;  2G8W A;  4LD0 A;  1RT7 A;  4UQG A;  4QCL A;  3AVC A;  3H3O B;  1KAZ A;  1NJW A;  3WXK A;  4MQ3 A;  1UA1 A;  1DTT A;  1K8K B;  1E4G T;  3RMD A;  4BQZ A;  2QXF A;  3IKM A;  1S9G A;  3L3V A;  2HVH A;  2YJE A; 
#chains in the Genus database with same CATH homology
 4BRE A;  1V4S A;  2Q31 A;  3P39 A;  4H0V B;  5BRE A;  4YDU A;  4JK9 A;  1BG3 A;  1RFQ A;  4NLB A;  2EWS A;  4B1X B;  3C7N A;  3O5B A;  4BR2 A;  2QW9 A;  3VEW A;  3ZEU B;  2VCP A;  1VQK N;  2P9S B;  3QFP A;  1QVF M;  4WCE L;  3L4Q A;  3OW2 M;  1LCU A;  3M3Z A;  2E20 A;  3ZET B;  2CGK A;  3LDO A;  5EVZ A;  3CQX A;  5B8H A;  3CXC M;  1QZ6 A;  2GUP A;  1N8R O;  1WOQ A;  4MO5 A;  1SAZ A;  5F1X A;  4DCH A;  2IVO A;  2PFU A;  4ILH A;  4MO4 A;  3O9T A;  3QIC A;  5E84 A;  5CE3 A;  4RWT A;  3G6E N;  1YJN N;  4BEB A;  4B1Y B;  4K41 A;  4BRI A;  5KQ8 A;  3MMV A;  3E9O A;  4KH6 A;  3F5T A;  1C0G A;  2OAN A;  4IOX A;  3D2E A;  2A40 A;  5GIO A;  4DKW A;  3CI5 A;  5FPM A;  2NLX A;  4FWN A;  5C15 A;  3MX5 A;  4CBX A;  3CCS N;  2C1I A;  4CZG A;  3LL3 A;  5KPR A;  4CZE A;  1JCF A;  3O9U A;  3HRG A;  3CJ1 A;  4YOU A;  3VF6 A;  5C12 A;  1YIJ N;  4CD3 A;  1TUU A;  2ASM A;  1TYQ A;  2A6A A;  5AQV A;  3R6M A;  2I7N A;  3VGM A;  5DM6 L;  2QWR A;  5EXW A;  1DEJ A;  2BTF A;  2V7Y A;  4CZF A;  4DQ8 A;  3GG4 A;  5BPN A;  3LM9 A;  2P9U A;  1XQS C;  1U6Z A;  1QQO A;  4KH4 A;  4CJ7 A;  4G9Z A;  3OHR A;  3FZM A;  4JKE A;  2QI2 A;  4FWQ A;  1NGA A;  1BUP A;  1VQ7 N;  5EY4 A;  3WQU A;  3C7N B;  5JMV A;  4FWS A;  3UE5 A;  2IVP A;  1Q7Y O;  5AQJ A;  4BGA A;  5CHI A;  3VTH A;  4PL7 A;  3O1B A;  4IXC A;  3H46 O;  3CCE N;  1K73 O;  5KPZ A;  2V7Z A;  4NO7 A;  3M1F A;  4BR7 A;  3FZF A;  2I7P A;  4IZ9 A;  3JXU A;  4EHT A;  3QBW A;  2NRT A;  4A5A A;  3VPZ A;  4NLC A;  2C1G A;  2ZF5 O;  5AQS A;  3D6R A;  3VER A;  5GIN A;  3GDQ A;  5AQN A;  3D2E B;  3IMX A;  3BUZ B;  1BO5 O;  4MDA A;  1K8K A;  2RHK A;  4FWO A;  3C6A A;  1P8Z A;  3WUH A;  3GOI A;  4BE7 B;  1ZC6 A;  4C1N K;  4CZH A;  4U67 L;  4IOC L;  5C2D A;  3G25 A;  4H5T A;  4BRF A;  4YOY A;  3PIO L;  4AF1 A;  3VEN A;  4J8F A;  3SAG A;  4WQ4 C;  3CC2 N;  2E2N A;  2GTD A;  3N4Q A;  5EOY A;  4OO1 J;  5BN8 A;  2CH5 A;  1VQ4 N;  3L6Q A;  1GLL O;  2ITM A;  3SAH A;  1W97 L;  4BG8 A;  3MX2 A;  3TU5 A;  3J7Z O;  2VGM A;  1YIT N;  1HLU A;  2QWO A;  3A5N C;  4CZK A;  2E2P A;  4H0Y B;  2Q0R A;  4FWK A;  2A42 A;  1DKG D;  4BC3 A;  2HBK A;  4M7X A;  1QQM A;  4WYB A;  1IJJ A;  4H5R A;  2KLA A;  4XH4 A;  5BRF A;  5LJV A;  1VQ8 N;  3H1V X;  3KWI A;  3O8M A;  1Z6R A;  1YXQ A;  2FLO A;  4JAX A;  5FPE A;  3D2F A;  3PIP L;  1VQ9 N;  3KHY A;  4JKA A;  5AQY A;  1XC3 A;  1MA9 B;  2WUS A;  2GWK A;  2YI1 A;  1ATS A;  1NGJ A;  3VET A;  1YJW N;  4ILG B;  3BEX A;  3NVM A;  4QS7 A;  4WQ4 A;  5TKW A;  5HOO A;  4JKF A;  4IJN A;  2QWP A;  3ULE B;  3WXJ A;  4IOA L;  5GAD P;  3ZYY X;  2UYT A;  3SK3 A;  4Y0W A;  3SJH A;  3ZX3 A;  5KPT A;  2E2Q A;  2AA4 A;  4JKG A;  3HOS A;  2YCH A;  1BA0 A;  3CMA N;  3LM2 A;  4K42 A;  3VF2 A;  4H5W A;  1H1V A;  4JK7 A;  4B1Z A;  1VQ5 N;  4BRN A;  3F2K A;  2W41 A;  2YHX A;  1NGG A;  2HST A;  2ZGZ A;  2J4R A;  3TSQ A;  4A59 A;  1EO1 A;  3C0B A;  3CIP A;  1U2V B;  4H0P A;  4IEI A;  3P38 A;  4BQL A;  5GAE P;  4PHT X;  2QWQ A;  4JHD A;  5EX5 A;  3SAF A;  5C0Y A;  2Q97 A;  3FZL A;  4WF9 L;  2FF3 B;  1GLA G;  1JCE A;  4H0X B;  3AGK A;  1KXP A;  4JN4 A;  3CPW M;  3A5M C;  1GLC G;  3AAR A;  3C6H A;  3WEE B;  4A2B A;  4AM7 A;  1VQN N;  1NLV A;  3EKS A;  1C0F A;  1M1K O;  3G71 N;  4ILJ A;  3HOT A;  5AQU A;  4BVO A;  4IJA A;  1YJ9 N;  4BR5 A;  4ISF A;  3M6G A;  3D2F B;  3TTC A;  3CCM N;  2QA4 N;  1Q81 O;  4M63 C;  5H1S Q;  2WC9 A;  3OBW A;  1HX1 A;  3QDK A;  3PLA A;  4C1N I;  4BRA A;  3RVC A;  3MN5 A;  4B1V A;  3O08 A;  2JWK A;  3CF5 L;  3TTF A;  3EL2 A;  5BPM A;  3I8B A;  3CJ9 A;  4JD2 B;  3FZH A;  1KAY A;  4JKG B;  1QHA A;  2VWB A;  2NRX A;  4RCH A;  5AQT A;  4OPH A;  4A5B A;  2F9T A;  4WFB L;  4EIA A;  2BH1 A;  4MDB A;  3VF4 A;  3HM8 A;  3ID6 A;  5AR0 A;  2ZGY A;  3ID8 A;  1BA1 A;  2IVN A;  4H0O A;  4WQ5 C;  1QZ5 A;  4FPB A;  3CME N;  4Z94 A;  5BRH A;  1R59 O;  1VQ6 N;  2E88 A;  4EAH D;  3GL1 A;  2OTL N;  4GVE A;  3P31 A;  4JKC A;  3HZ6 A;  3FGU A;  4IWV A;  4JHD B;  1HKC A;  2CH6 A;  5AFU H;  3UKU B;  4BC2 A;  3VEV A;  3N4P A;  5AFU A;  5BPL A;  2FXU A;  3EKU A;  4H0T B;  1SQK A;  3MN9 A;  5AQH A;  1MWK A;  4FWM A;  1X3M A;  1NGC A;  3B8A X;  3KWG A;  3Q7B A;  5AQK A;  3E9P A;  4BRK A;  4KBO A;  3R1X A;  3CJB A;  1VAZ A;  4BEC A;  2P9L A;  3CJA A;  3A5O C;  1NGE A;  3AAP A;  3FZK A;  4IEE A;  4DHY A;  3O1W A;  3ULE A;  4WQ5 A;  2HBJ A;  4JK8 A;  3WT0 A;  5M1P A;  3R9P A;  5AQI A;  4DB3 A;  3QFU A;  4A2A A;  5M1Q A;  4BVP A;  3I56 N;  4ISG A;  2Q0U A;  1HPM A;  1IG8 A;  3U9Z A;  3U9D A;  1ATR A;  4YOT A;  1WUA A;  3MN7 A;  3L4I A;  1YUW A;  3EE9 A;  3FE1 A;  3CC4 N;  2YHW A;  4CZI A;  4JNE A;  3ENO A;  1ATN A;  3EZW A;  5GAG P;  3KK7 A;  3O6W A;  4ISE A;  3UKR A;  4CBW A;  4E1J A;  3CER A;  3DJC A;  4BRO A;  1U2V A;  4FSV A;  5FPN A;  3DXM A;  2A3Z A;  2BUP A;  2V52 B;  3DWL A;  3GE1 A;  4XH5 A;  4C23 A;  1NGF A;  2ZWH A;  5AZJ A;  2QWN A;  3H45 C;  5AZI A;  1VQO N;  1NBW A;  3HTV A;  5M1F A;  2H3G X;  2D1K A;  3WEE A;  5KQD A;  3W3D A;  2NRW A;  3KVG A;  2ZJR L;  1O13 A;  3HSC A;  3VGL A;  1S22 A;  1E4F T;  5F0X A;  2QXL A;  3IUC A;  5M1N A;  4BRM A;  4CZJ A;  2P9L B;  3E1Y A;  4LC9 B;  3FR0 A;  3SMP A;  4GV9 A;  3EO3 A;  1VQM N;  3IDH A;  3WQT A;  1NGB A;  3M5R A;  3VES A;  3VMF B;  1NJI O;  4L3Q A;  4B1W B;  4YOX A;  4BR9 A;  1NM1 A;  2JWL A;  1OKJ A;  3E9L A;  4JD2 A;  4JEP A;  3LDL A;  5GAH P;  2P9I A;  4B9Q A;  3QB0 A;  4BRL A;  3NVK A;  2IIR A;  4K25 A;  3TTD A;  4CZL A;  2PAV A;  4MLE A;  1HKG A;  5BR9 A;  1S72 N;  3CCL N;  3F9M A;  1K9M O;  4PL8 A;  5AQG A;  4CI6 A;  3T7Z A;  4JKB A;  3VGK A;  4BRC A;  4R79 A;  1CZA N;  2PBD A;  3CQY A;  3T69 A;  3UKR B;  2E2O A;  3DXK B;  3MK6 A;  3U4L A;  5F2R A;  3L0Q A;  2A41 A;  2GEM A;  2P9K B;  1NGH A;  4PKG A;  3DXM B;  5FPD A;  3A8Y A;  3GBT A;  4H5V A;  5AZJ B;  3UKU A;  4EFH A;  2WBN A;  2HF3 A;  3CET A;  5AZI B;  3W0L A;  3I55 N;  3G4S N;  2W40 A;  1Z05 A;  1BWF O;  3MDQ A;  4A61 A;  1DGK N;  4FWR A;  3VOV A;  4XH1 A;  1RDW X;  1XUP O;  1TUY A;  4F9O A;  3CHW A;  3SBT A;  1G99 A;  4FWP A;  2F7T A;  3S41 A;  3JS6 A;  3IFR A;  4O8U A;  3VEZ A;  4BC5 A;  2GEL A;  1S3X A;  1ESV A;  3OA9 A;  2NZT A;  2NNW A;  4GY2 B;  3QML A;  5I9E B;  2HMP A;  2Q2R A;  5JLH A;  3P4I A;  1X3N A;  4O5F A;  4FVU A;  1T3V A;  1RGI A;  1T6C A;  3LDQ A;  5HL7 L;  1RDU A;  1T44 A;  5JVG L;  3O9S A;  2HF4 A;  4BRD A;  1JJ2 M;  3CCQ N;  1OVY A;  3ATU A;  1VQP N;  2NRR A;  3BP8 A;  5GIP A;  4BGB A;  1V4T A;  2ASO A;  2QWM A;  2P9I B;  3O4W A;  3SLC A;  3H1Q A;  2FF6 A;  3MWT A;  4A57 A;  2ZJP L;  4KH5 A;  4BR4 A;  3CCJ N;  4AM6 A;  4H5N A;  5AQP A;  3MWP A;  1KAX A;  4A62 A;  3O80 A;  5ADX H;  1Q86 O;  4YOW A;  3H3N O;  5ADX A;  3A0I X;  2WFB A;  2P9N A;  3R3L A;  4I6M A;  3CCV N;  2F9W A;  4YOR A;  5AQX A;  1BOT O;  1YVN A;  4GV3 A;  2AP1 A;  4BY9 C;  1T6D A;  4XJX A;  3SMS A;  3CD6 N;  5BN9 A;  5C10 A;  5AQO A;  3VEO A;  2QWL A;  4BRG A;  1J6Z A;  4PKI A;  4JKH A;  1ILY A;  1YAG A;  2VYP A;  4JKD A;  5DM7 L;  4XEI A;  4B1U B;  3BF3 A;  3EN9 A;  2OTJ N;  2NRZ A;  2CGJ A;  4RTF D;  3C65 A;  2GWJ A;  3ENH A;  4U7B A;  1D4X A;  2VGN A;  4M7Y A;  4BRQ A;  2ASP A;  4K43 A;  5JIC A;  2D4W A;  2YJF A;  4BR0 A;  2YHY A;  4EHU A;  4O8K A;  5AQR A;  3TPQ A;  3CCU N;  2P9P A;  4GV6 A;  4IDH A;  4HTL A;  4CD1 A;  4WFA L;  5M1K A;  1HJO A;  5TKY A;  1NGD A;  4NB4 A;  1MWM A;  3MCA B;  3HI0 A;  2W00 A;  3SBG A;  2FSK A;  3D7E O;  1KQS M;  3DAW A;  2E1Z A;  3LDN A;  2NRV A;  5BRD A;  1GLF O;  1YI2 N;  4FL9 A;  1Q18 A;  3ENB A;  3WXI A;  1Y64 A;  2HBL A;  3FLC O;  3DXK A;  3TSU A;  3WXM B;  2GX9 A;  2P9K A;  3MCP A;  5AQF A;  1NWK A;  2QTD A;  3H6E A;  3CCR N;  2P9N B;  1GLE G;  3K9K A;  2Q36 A;  4I6M B;  1GLB G;  3CPE A;  1Q82 O;  1LOT B;  1MDU B;  2D0P A;  3RSE A;  2ZJQ L;  3O9R A;  3KZB A;  1BDG A;  5AQW A;  2A5X A;  4BG9 A;  3VEY A;  1ZXO A;  1QQN A;  3WXL A;  3O9Q A;  4BRH A;  2D0O A;  1P90 A;  1ZBS A;  1VQL N;  2KKZ A;  1TYQ B;  4QS8 A;  5E26 A;  3FFK B;  2CGL A;  2KHO A;  3CC7 N;  4HWI A;  4IO9 L;  3EE8 A;  3VEX A;  4GNI A;  5AQZ A;  1W2B M;  3AGR A;  3LDP A;  4BRP A;  2P9U B;  3ATV A;  5CR4 A;  1GLD G;  1GLJ O;  2FSN A;  1M90 O;  3OBY A;  1YF5 L;  4H03 B;  2E8A A;  5MLC Q;  2NRH A;  1X9J A;  4FPA A;  5AQL A;  3ZEU A;  5C2F A;  2P9S A;  3QBX A;  3HBT A;  4UY8 O;  2HBM A;  3R8E A;  3ZET A;  5JLF A;  4FWL A;  3AAQ A;  1DT9 A;  5AQM A;  5LY3 A;  4CBU A;  2YX6 A;  3CJ7 A;  2P9P B;  1BU6 O;  3AY9 A;  3TSP A;  3I33 A;  3MN6 A;  1HUX A;  4FO0 A;  1NMD A;  4IFE A;  5ELZ A;  3NMU A;  5AQQ A;  4YDU C;  1QVG M;  1KD1 O;  4WFN L;  3ZX0 A;  1EQY A;  3BF1 A;  3VTI A;  1JCG A;  4CZM A;  1K8A O;  5LJW A;  4FOI A;  5M1O A;  3U8X A;  1KC8 O;  2QEX N;  3H3O B;  2RE2 A;  4FOE A;  3UB5 A;  1KAZ A;  3Q7C A;  4YOV A;  3WXK A;  3K9J A;  2DPN A;  3A5L C;  2HOE A;  2Q1N A;  2FSJ A;  4PKH A;  4QS9 A;  3DLL L;  3E66 A;  4OPA A;  1K8K B;  4IO8 A;  3RSE B;  5JVH L;  3CJC A;  1HKB A;  1E4G T;  1NGI A;  4MLH A;  4BQZ A;  2V51 B;  3IKM A;  4BC4 A;  1YHQ N;  1SS6 A;  3J8A A;  3ZX2 A;  2QM1 A;  1SZ2 A;  2YJE A;  2E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...