2P9LG

Crystal structure of bovine arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
137
Chain Sequence
b'ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 41
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9lG00
4XEIG 3DXMG 3DWLG 3ULEG 1U2VG 2P9UG 2P9IG 2P9KG 1K8KG 4JD2G 2P9NG 2P9LG 3UKUG 3RSEG 2P9PG 3DXKG 2P9SG 3UKRG 1TYQG
chains in the Genus database with same CATH superfamily
3D9KA 1N11A 5JJTA 3FY4A 4KVOA 4HRLA 3PRZA 3ASNE 5ARFA 4AY6A 3FTZA 2KCKA 2WXIA 4BSXA 2WXLA 3SFXA 4LNGA 3EIQC 1XNFA 5CEAA 3U3WA 5BT1A 3CVNA 5CRUA 3CHOA 5D0OD 1W3BA 4U07A 2WM9A 2PM6A 4GZDA 4J6IA 2F8XK 3HRAA 3JQ1A 4HI8A 3K9IA 4N2QA 3ZW3A 4ZHBA 2XCBA 4GZ3A 3UM0A 4DLOA 1MQSA 1HG2A 5AQBA 3C98A 3CGHA 4JZYA 3EU9A 1EPUA 4BY6A 3W9GA 1SW6A 3DSWA 3SF4A 4Y6WA 4WNDA 1QZ2A 2YHEA 2WXRA 3CLJA 2CFZA 4XE0A 4BEPA 3G2TA 4ILIA 3ZFWA 4BWRA 2VTBA 3T5VA 4UWGA 4ACKA 4EHMA 5FINA 2YINA 2MYOA 4DX6D 1UG3A 4GA1A 3PREA 3CKCA 3MCXA 1U2VG 1HFAA 1N4QA 2KCLA 3HXEA 2CG3A 3ASFA 3ONKA 3SFZA 3LDZA 3UKUG 1ZBPA 3B7TA 3HVEA 3QARA 4G11A 5EKQD 3FUJA 2LXLA 4TXRA 2AW6A 4RLYA 1U3CA 1KT1A 3G2WA 3QK0A 2AXVA 3DPDA 4IN3B 2Q7FA 4ME2A 3FH8A 5CCMA 4DJAA 5C1DA 4ABNA 1IKND 3ASOE 2F8YA 2WXPA 5LP0A 1AP7A 3D9NA 4YVQC 4WNGA 2WXMA 2MRIA 2QYUA 2E2EA 2HE0A 4J8FA 3FH7A 4NURA 2B0OE 5FIOA 4TUUA 3ZYKA 1IHGA 3L08A 5CECB 1E8ZA 4GTQA 4GTPA 4GYYA 1E8WA 3AS5A 3C72A 3HYMB 2IOSA 3U66A 2XS1A 4HFGA 4HLLA 3LYAA 2VGYA 3KSLA 4XKBA 3SY2A 1KLXA 2ZU6B 1L5JA 4GMLA 4BFRA 3B7RL 4F7AA 1OCZE 1FPPA 3LEWA 4W9RA 3CVWA 3EHMA 1JPLA 3I5PA 4MKTA 1E8YA 4HBDA 4MS6A 1TJCA 5HKPA 1RW2A 1H6OA 5AENA 4UWFA 3CHRA 1DC2A 3ZGQA 5G04C 4XX5A 4NQ0A 5FZRA 3PE4A 4HVBA 1SA5A 3RRUA 5AYWD 1KZOA 2IF4A 1OWOA 4V3IA 3UMVA 4QFVA 4ANWA 4WWPA 2Y1LE 3S7DA 2MOWA 3PE3A 2XEEA 2ZISA 3MV3B 2ILRA 3B7SA 3ZVVA 5AIJA 2V4LA 1BLXB 4H7XA 3PZ3A 3P2BA 3PUJA 5DIZA 3FU0A 2EINE 2ZGGA 2P9KG 2GROB 3ESLA 3ML9A 1Q2ZA 3SBSA 5LFAA 4NACA 2DVWA 4FADA 5AQ7A 3L9TA 4U8VD 4O60A 1LD7A 1K1BA 3SFYA 3PDNA 2PQRA 3IV0A 2XEVA 2ZXWE 4EZLA 3NF1A 3T5XA 3EHQA 4KZ0A 5ENNA 2XENA 3UTMA 5KWDA 3UX4A 3CVXA 4UI9C 3MKRA 1FCHA 5JJ6A 3PNLB 2J4BA 4G25A 3URZA 3L13A 3R9MA 4EZKA 4G1TA 3ML8A 3U4TA 4LCTA 3RIBA 1OT8A 5LCWJ 2H6HA 4K5BA 4GZCA 1UW4B 3EDTB 3FTSA 5AAOA 3S7FA 4FJYA 3RRNB 1WY6A 1NI1A 3CVPA 3BG1B 3DSXA 4APFA 2XCCA 5LOZA 5CRVA 3PUKA 5FQ7A 4ATZD 1N4PA 3HDXA 4KMOA 4Q94A 3MA5A 3EHRA 2BUGA 1YA0A 4TXQA 1K3ZD 2F37A 5J08A 4EPZA 5BXOA 1TNOA 5D2MC 3SD5A 3AG2E 4AV7A 1WM5A 3OXLA 4I6GA 2VQ2A 2M63A 2RD0A 1A17A 4IULA 2L0IA 4AIFA 3IBEA 1NA3A 5J90A 1HS6A 4YDYA 2J49A 1Y8MA 1YCSB 4BTBA 4PDXA 2R02A 3E4BA 2FI7A 3S7JA 1N95A 3I4GA 4IYPA 3X2QE 3QAQA 3OXFA 4I43A 5CERB 3L6AA 3EJNA 2WXOA 4EBAA 2XRYA 3CIAA 4KYOB 5HQ8A 2VYIA 3ULQA 2J08A 2WQ6A 3APFA 2HO1A 4CGWA 4LG6A 1E7UA 3TGOA 3MEKA 4JXTA 3FTXA 3EUVA 1DVPA 1JWGA 3FTWA 2OOEA 4HLEA 5AQ9A 1PAQA 2DIWA 4LEUA 4DRXE 1TEZA 2OEWA 3VLFA 2UWJG 2I1JA 4I1OB 4FP7A 3E37A 3FH5A 4EZJA 5EDSA 5LX8A 3MGBA 3UT7A 3FUIA 3PS6A 3HVEB 2UY1A 3Q49B 4B8CB 1O1SA 2X6HA 5FQ4A 1TR4A 3KAEA 4K5CA 5EX3A 3CHSA 2P58C 1NP7A 4EBAG 3NZSA 3E30A 3ZYMA 2J4DA 3I3NA 2LSVA 2IY0C 1OY3D 3ASHA 4J7WA 4GTOA 4U95D 5ANLA 4K5AB 2XEHA 1HF8A 3TWRA 3ZYLA 5BNWA 3HXFA 1KPSB 2P9NG 1Z3XA 2AXZA 4I1MA 3TXMA 1E90A 3KS2A 2BF0X 4LERA 1ZU2A 3CHPA 3ZNGA 2VJ8A 2CHZA 2GRQB 4N5CA 2DZNA 2FO7A 2GRPB 3GZ1A 5KJLA 1H0AA 3UINC 1OCCE 1N0RA 3TWUA 2LXMA 3L22A 4I6JA 3U9WA 3ZHEB 1HX8A 4PS7A 3B95A 1UJJA 3ABKE 3FDHA 1IXVA 5JHAA 3C3QA 4DX5D 3SZ7A 4HOSA 1H6KA 4GTSA 1TNYA 3FU6A 2FBNA 2AWIA 2JEKA 1D8DA 2LNIA 5CMYA 1Z3YA 1MJ0A 4GPMA 2P9UG 3OAWA 1D8EA 5A23A 3D9PA 3DSVA 4WWOA 5IY5E 3PEVB 4U96D 3ASDA 1JUQA 2DBAA 4PUCA 1N4RA 4CGVA 4GYOA 4O6FA 2C0LA 4CT0A 5BUZA 1NFIE 3VLDA 1Y6IA 4G8KA 2WXKA 1RZ4A 3NOCD 5ENOD 3CK8A 4CRWA 2P9LG 3OXGA 3FFLA 1E96B 1VDYA 5JJ7A 4GPKA 3SGHA 1X5BA 3ZN3A 2WQ7A 4CDNA 1BPOA 3LVRE 3EU5A 2I1KA 1N9AA 4GTTA 1NZNA 2CG2A 3CK7A 2WPVA 2GW1A 2WXNA 2P9IG 2RFMA 3AG1E 2A5EA 2X6IA 4LNUD 2NC9A 3DXKG 1EF1C 2P9SG 2XZTG 1TJFA 1PY1A 3CKBA 2OCCE 2BEDA 2LUHA 3EHNA 4KBQA 1N54A 2LAHA 4FJZA 3TWTA 3L16A 4AOFA 4KT6B 4G8LA 1SVXA 5B3SE 2X6FA 1V54E 4A1SA 3UM2A 2EQXA 4KVMA 1SZAA 4H7YA 4CT4A 2IO2C 4G2VA 3CEQA 3B13A 3ZYQA 3FUFA 3T8MA 2DYRE 1AWCB 4HB5A 3CQGB 1HU3A 4B8AA 5EN5D 4ANXA 3LKUA 2MHKA 3JYSA 4YVOA 3D9IA 4GZ5A 2OV8A 5EILA 3DXMG 3UT8A 2Y3AA 4GTVA 4AP2A 4J8DA 4BSZB 2L6BA 2LAIA 4CYMD 4BX8A 3QWVA 2PL2A 4N3AA 4FU3A 4D10C 3FEYA 3IEGA 1YYHA 4Q96A 4RVBA 4K03A 2XHEA 3CR3A 1B89A 3Q78A 1TYQG 4CEMA 3APDA 4DX2A 3FULA 4X8QA 2JLBA 2V5FA 3NB2A 2AJAA 3C5RA 5CEDB 3ZHEA 3GZSA 4APOA 3ZUVB 1A5EA 3J5QB 2VSXE 4F1SA 2XPIA 3G2UA 3Q4AB 3ZPJA 2BTDA 2GRNB 4FC8A 5FT9A 4E6HA 2ONDA 3F6QA 4EQFA 4HOUA 3ABLE 3DSTA 4JB8P 3B7UX 2WXJA 4LNBA 1TNUA 4DI3A 1FVHA 4A3TA 3RJVA 4JHJA 1OWMA 3ESKA 2R03A 5ENPD 4I1AA 1UN8A 3DEPA 4EECA 4XKCA 1KZPA 4GYWA 3PNTB 5EYLA 4N3BA 2FO1E 2KM4A 3CV0A 3RO2A 3TG4A 1IYGA 1HO8A 4FHJA 5T4YA 3MJWA 2UY1B 3UQ3A 4JL0A 5BPPA 4P29A 1Z5SC 2XS8A 4GMJA 4GU5A 4ILHB 5G55A 1SZ9A 1JCSA 3FWVA 2J8SD 3FTYA 4L9PA 3IXEA 3T8KA 5ENSD 1O5MA 1UN9A 5CBOA 4I9EA 3D9JA 5DBKA 4L1BA 4A3VA 4UQYA 3UT4A 5AQAA 4RG6A 3O48A 1ELWA 1H6PA 3PH0C 5E75A 4LUNU 3TWVA 4JEHA 3J5PA 3FP3A 2GGFA 2GRLA 5CHEE 4LSZE 1JWFA 4I17A 3DSSA 3HG0D 5G04J 2F0YA 4N3CA 4JHRA 5G05C 3Q73A 3TWXA 4HRNA 1SQMA 1NL4A 5ITZF 4DK5A 3VTXA 2P9PG 3FUEA 2YQ8A 4IRUA 4MLPA 2KATA 3R7RA 3R7QA 3ZRHA 3PEUB 2ETBA 2V8SE 3NAWA 2X38A 3JXJA 1PC2A 3PZ2A 4Z68A 3E34A 4BETA 3SHFA 4O1PA 2XZDG 3UIPC 3AS4A 4C0EA 3D9MA 3P1UA 2I6HA 4I2WA 2R17C 1QQEA 3PVLA 2XGMA 5AJLA 2WMOA 3ENEA 4ZFHA 4OAVB 3TL5A 4AM9A 4UI9J 2C2LA 2BKKB 3CVYA 2VGEA 3AJIA 4TRQA 4BT9A 2ZIRA 5KNGA 2DYSE 3QC1A 2QC9A 4BESA 2RKKA 1N0QA 3ZXSA 3FUHA 3DRAA 4HXIA 2XPZA 1P5QA 3CQCB 1UJKA 2HR2A 5EIBE 2PNNA 4GAAA 4C48B 2IEJA 3LY7A 1DCEA 5BW8C 3Q9UC 1O1RA 4ACLA 3KSQA 4XZ4A 2B6CA 3JUEA 3CVQA 2VSYA 3TG5A 2EILE 3JUIA 1INZA 4U04A 1MHQA 3QOUA 1SA4A 4J8EA 4FLBA 1OWNA 1OCRE 3QB2A 2VSOE 4U0SA 3TWSA 3UIOC 2IJGX 4A63B 2R2LA 4GTRA 5ENRD 3UXGA 3DWLG 4DUIA 3ULEG 1UOHA 4WNFA 5T3RA 3QWPA 3IHYA 3MX3A 3VTYA 1ZB1A 4GTMA 2LSUA 1HZ4A 5FJYA 4U8HA 5BV0A 4ATGA 3SNXA 3DPYA 2E0IA 3FUKA 4U7EB 3V31A 3E33A 3BUAA 3DSUA 3AU4A 3HXBA 3KEZA 5HRYA 3S7BA 2WVIA 2ETCA 5G2NA 5E76A 4BT8A 2X3MA 2FF4A 4XEIG 2R5SA 4KZCA 3UM3A 1WAO1 1BI7B 2KZTB 4TXPA 1MZCA 3QNKA 3D9OA 4NIKA 3LCAA 3SQVA 4N39A 3HXDA 3JCKC 3HIZA 4JA9A 2IONA 3IHVA 4BERA 4GCOA 3UKRG 3L82A 4XI9A 4M3OA 5B1BE 3AAAC 3VLEA 1EDUA 5KJKA 2XPYA 1OCOE 1V55E 2Y4TA 4U0UA 2RFAA 3AS8A 1OXJA 5D0QD 2VGXB 3NQPA 4JW1A 2I2OA 4AXHA 3WG7E 3GW4A 4PS8A 4N5QA 2V0PA 5JA4D 4BX9A 1H2TC 1OUVA 2WXGA 4UI9K 1ELKA 4HOQA 3I4RB 4DPRA 2OVBA 4GCNA 2WMNA 4JC8A 1IHBA 1HG5A 4DX1A 2ZGDA 3SO8A 2WXFA 3CVUA 1HXIA 5CCLA 2IO3C 5KCMA 2XQ0A 4WUYA 1S70B 2A4ZA 3BEEA 3CHMA 4YDOA 4DI4A 4TV3A 4HQDA 1E7VA 5FQ8A 1BU9A 2DCPA 4JA7A 4RSYA 4OVVA 4I6EA 3PZ4A 4PH4B 4JEUA 5FZQA 3DEOA 2WB2A 4UWHA 3ASGA 3V79K 1JCRA 4I2ZA 3ZXPA 4G24A 4L2YA 1GW6A 2IFUA 2XGSA 3E32A 4B0ZA 4Y6CA 3ULYA 3SI5A 1OWPA 5AN8A 4WWNA 3R9AB 1TN8A 3U64A 5JMND 5T8IA 1TN7A 4UQZA 2AXUA 3AU5A 3ONLA 1ELRA 1FT2A 2J9QA 2RG8A 3ZIMA 2R59A 3BQOA 3FU5A 4JD2G 1Z6TA 4HNAD 3CK9A 4L7TA 5KJNA 1DNPA 2NXPA 2IU1A 4B93B 1WG0A 2EIKE 4R7LA 4OVUA 2YHCA 3LY9A 3KD7A 4JPSA 3HHMA 2R05A 5ANRA 3MKQB 4G23A 3QKYA 4B89A 2C0MA 2QYJA 5ENTD 3GZ2A 5A6CA 5CBNA 3QDNA 1E8XA 1U3DA 4J8SA 2DZOA 1MX6A 2V5QC 2WXQA 3KEAA 3RKVA 5BXUA 4L23A 1WDYA 3Q7FA 4U8YD 2KZTA 3ZKJA 4U63A 2L6JA 4I9CA 3LPZA 4CDRA 3Q15A 4F6RD 4KXKB 3UI2A 4A1GA 3C3RA 3NZUA 4DLQA 3MV2B 1YMPA 2Y0BG 2OEVA 2QY7A 4UWKA 4F53A 3EIJA 2EIME 1EYHA 2VGXA 3UM1A 5LCWC 3TJPA 4RG9A 5HS0A 3FUMA 3W9FA 1MYOA 4A55A 3FUNA 2X6KA 4HRMB 5AJDA 5D66A 3RO3A 5ARGA 1MX4A 2V4HC 4N2SA 4UWLA 4OAUC 2CFUA 4CZ2D 5KNHD 4MBGA 5FWQA 3FUDA 5EX0A 3PZ1A 2J09A 3APCA 3G2SA 1N52A 3NOGD 1LD8A 1S0PA 4ILGA 4GA0A 4DX7D 2WQHA 3IKOB 4YDEA 4UQXA 4M7CA 2NSZA 4J0UA 4GMRA 3MYVA 1BD8A 3ABME 5B1AE 2EIJE 4FULA 3TWWA 2FEZA 4ANUA 3O4ZA 2KC7A 2X6JA 5EYPF 2QFCA 4HOTA 2IOLA 5AARA 4FHKA 3G2VA 2CHXA 2OVFA 2XRZA 2P2CP 3CVVA 3RK6A 2HYZA 2KXPC 3D3MA 3UPVA 3ZU7B 1XGWA 2L9BA 3LJ3A 2PQNA 1O1TA 3JXIA 4C0MA 4L2LA 3CVLA 4U0ZA 2GRRB 1H2UA 4GZ6A 3HXCA 1D9SA 3L17A 1BI8B 2GRMA 3AG3E 4UUCA 3ISMC 1LF8A 5KBAA 2PM7A 5FTPA 3RRMB 2QZAA 3C3OA 4WAFA 3MKQA 4WNEA 2KBXA 3TXNA 3DBSA 2Y4UA 4FLHA 1K8KG 4O1OA 5BV1A 4E85A 5ENQD 2JABA 3RU0A 1TNBA 4HORA 3D9LA 4CCAA 4ANVA 2I9CA 2Y69E 4TUMA 1S63A 2BKGA 4YNDA 1K1AA 3GYZA 1N94A 2ETAA 3CSFA 2H6GA 2CHWA 1QNFA 4AEZC 3ZEFA 1FVFA 5H7PA 3V30A 3BG0B 2FULA 3QJZA 4YDWA 1FT1A 4F1PA 4G26A 4GB9A 2YNQA 2AVPA 4HS2A 5M72A 3Q7AA 4AVXA 3WXXA 3B7BA 3FU3A 3V2OA 4HI9A 3LVQE 4RQIA 3Q9NC 4OYSA 1NA0A 3RAUA 3OTNA 5G05J 2XGOA 3SBTB 3N71A 1QBQA 2A5UA 4URKA 5CMWA 1H2VC 1HE8A 2VTBB 1TN6A 3TAXA 1KT0A 3BU8A 1H19A 5HI7A 2L0TB 3Q75A 3FTUA 2WXHA 3PZDA 2HM8A 4NRHB 4LRZA 3Q79A 3QWWA 5KJMA 5EIDA 4CDMA 3CSTA 4F3VA 2KCVA 1DCQA 4PS3A 1MX2A 1X81A 2H6FA 3Q47B 2NYJA 3FEXA 2PZIA 1N4SA 3MZLB 3NBNB 4Q69A 1HH8A 3AG4E 1G3NB 3L54A 4QQIA 1IQRA 1LTXA 4XI0A 4JHKA 3Q5MA 4JVSA 1S64A 3LS8A 5FQ6A 4J8YA 3LXUX 5JHBA 3V2XA 2LO6A 5FZSA 4B94A 1JCQA 5C2YA 3JQ0A 3FTVA 3LJNA 4AY5A 1QYMA 1TNZA 4GA2A 4FA6A 2H6IA 4BTAA 1OWLA 3CHQA 4XIFA 3T9KA 2DWZA 3UUXA 2J07A 5A7DB 4C9BB 4MRUA 3S2AA 3RSEG 3D9HA 3FHEA 3TWQA 4AJWA 4K0RA 2IQCA 1IQUA 2VSNA 3LY8A
chains in the Genus database with same CATH topology
4XEIG 3DXMG 3DWLG 3ULEG 1U2VG 2P9UG 2P9IG 2P9KG 1K8KG 4JD2G 2P9NG 2P9LG 3UKUG 3RSEG 2P9PG 3DXKG 2P9SG 3UKRG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEI G;  3DXM G;  3DWL G;  3ULE G;  1U2V G;  2P9U G;  2P9I G;  2P9K G;  1K8K G;  4JD2 G;  2P9N G;  2P9L G;  3UKU G;  3RSE G;  2P9P G;  3DXK G;  2P9S G;  3UKR G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 3D9K A;  1N11 A;  5JJT A;  3FY4 A;  4KVO A;  4HRL A;  3PRZ A;  3ASN E;  5ARF A;  4AY6 A;  3FTZ A;  2KCK A;  2WXI A;  4BSX A;  2WXL A;  3SFX A;  4LNG A;  3EIQ C;  1XNF A;  5CEA A;  3U3W A;  5BT1 A;  3CVN A;  5CRU A;  3CHO A;  5D0O D;  1W3B A;  4U07 A;  2WM9 A;  2PM6 A;  4GZD A;  4J6I A;  2F8X K;  3HRA A;  3JQ1 A;  4HI8 A;  3K9I A;  4N2Q A;  3ZW3 A;  4ZHB A;  2XCB A;  4GZ3 A;  3UM0 A;  4DLO A;  1MQS A;  1HG2 A;  5AQB A;  3C98 A;  3CGH A;  4JZY A;  3EU9 A;  1EPU A;  4BY6 A;  3W9G A;  1SW6 A;  3DSW A;  3SF4 A;  4Y6W A;  4WND A;  1QZ2 A;  2YHE A;  2WXR A;  3CLJ A;  2CFZ A;  4XE0 A;  4BEP A;  3G2T A;  4ILI A;  3ZFW A;  4BWR A;  2VTB A;  3T5V A;  4UWG A;  4ACK A;  4EHM A;  5FIN A;  2YIN A;  2MYO A;  4DX6 D;  1UG3 A;  4GA1 A;  3PRE A;  3CKC A;  3MCX A;  1U2V G;  1HFA A;  1N4Q A;  2KCL A;  3HXE A;  2CG3 A;  3ASF A;  3ONK A;  3SFZ A;  3LDZ A;  3UKU G;  1ZBP A;  3B7T A;  3HVE A;  3QAR A;  4G11 A;  5EKQ D;  3FUJ A;  2LXL A;  4TXR A;  2AW6 A;  4RLY A;  1U3C A;  1KT1 A;  3G2W A;  3QK0 A;  2AXV A;  3DPD A;  4IN3 B;  2Q7F A;  4ME2 A;  3FH8 A;  5CCM A;  4DJA A;  5C1D A;  4ABN A;  1IKN D;  3ASO E;  2F8Y A;  2WXP A;  5LP0 A;  1AP7 A;  3D9N A;  4YVQ C;  4WNG A;  2WXM A;  2MRI A;  2QYU A;  2E2E A;  2HE0 A;  4J8F A;  3FH7 A;  4NUR A;  2B0O E;  5FIO A;  4TUU A;  3ZYK A;  1IHG A;  3L08 A;  5CEC B;  1E8Z A;  4GTQ A;  4GTP A;  4GYY A;  1E8W A;  3AS5 A;  3C72 A;  3HYM B;  2IOS A;  3U66 A;  2XS1 A;  4HFG A;  4HLL A;  3LYA A;  2VGY A;  3KSL A;  4XKB A;  3SY2 A;  1KLX A;  2ZU6 B;  1L5J A;  4GML A;  4BFR A;  3B7R L;  4F7A A;  1OCZ E;  1FPP A;  3LEW A;  4W9R A;  3CVW A;  3EHM A;  1JPL A;  3I5P A;  4MKT A;  1E8Y A;  4HBD A;  4MS6 A;  1TJC A;  5HKP A;  1RW2 A;  1H6O A;  5AEN A;  4UWF A;  3CHR A;  1DC2 A;  3ZGQ A;  5G04 C;  4XX5 A;  4NQ0 A;  5FZR A;  3PE4 A;  4HVB A;  1SA5 A;  3RRU A;  5AYW D;  1KZO A;  2IF4 A;  1OWO A;  4V3I A;  3UMV A;  4QFV A;  4ANW A;  4WWP A;  2Y1L E;  3S7D A;  2MOW A;  3PE3 A;  2XEE A;  2ZIS A;  3MV3 B;  2ILR A;  3B7S A;  3ZVV A;  5AIJ A;  2V4L A;  1BLX B;  4H7X A;  3PZ3 A;  3P2B A;  3PUJ A;  5DIZ A;  3FU0 A;  2EIN E;  2ZGG A;  2P9K G;  2GRO B;  3ESL A;  3ML9 A;  1Q2Z A;  3SBS A;  5LFA A;  4NAC A;  2DVW A;  4FAD A;  5AQ7 A;  3L9T A;  4U8V D;  4O60 A;  1LD7 A;  1K1B A;  3SFY A;  3PDN A;  2PQR A;  3IV0 A;  2XEV A;  2ZXW E;  4EZL A;  3NF1 A;  3T5X A;  3EHQ A;  4KZ0 A;  5ENN A;  2XEN A;  3UTM A;  5KWD A;  3UX4 A;  3CVX A;  4UI9 C;  3MKR A;  1FCH A;  5JJ6 A;  3PNL B;  2J4B A;  4G25 A;  3URZ A;  3L13 A;  3R9M A;  4EZK A;  4G1T A;  3ML8 A;  3U4T A;  4LCT A;  3RIB A;  1OT8 A;  5LCW J;  2H6H A;  4K5B A;  4GZC A;  1UW4 B;  3EDT B;  3FTS A;  5AAO A;  3S7F A;  4FJY A;  3RRN B;  1WY6 A;  1NI1 A;  3CVP A;  3BG1 B;  3DSX A;  4APF A;  2XCC A;  5LOZ A;  5CRV A;  3PUK A;  5FQ7 A;  4ATZ D;  1N4P A;  3HDX A;  4KMO A;  4Q94 A;  3MA5 A;  3EHR A;  2BUG A;  1YA0 A;  4TXQ A;  1K3Z D;  2F37 A;  5J08 A;  4EPZ A;  5BXO A;  1TNO A;  5D2M C;  3SD5 A;  3AG2 E;  4AV7 A;  1WM5 A;  3OXL A;  4I6G A;  2VQ2 A;  2M63 A;  2RD0 A;  1A17 A;  4IUL A;  2L0I A;  4AIF A;  3IBE A;  1NA3 A;  5J90 A;  1HS6 A;  4YDY A;  2J49 A;  1Y8M A;  1YCS B;  4BTB A;  4PDX A;  2R02 A;  3E4B A;  2FI7 A;  3S7J A;  1N95 A;  3I4G A;  4IYP A;  3X2Q E;  3QAQ A;  3OXF A;  4I43 A;  5CER B;  3L6A A;  3EJN A;  2WXO A;  4EBA A;  2XRY A;  3CIA A;  4KYO B;  5HQ8 A;  2VYI A;  3ULQ A;  2J08 A;  2WQ6 A;  3APF A;  2HO1 A;  4CGW A;  4LG6 A;  1E7U A;  3TGO A;  3MEK A;  4JXT A;  3FTX A;  3EUV A;  1DVP A;  1JWG A;  3FTW A;  2OOE A;  4HLE A;  5AQ9 A;  1PAQ A;  2DIW A;  4LEU A;  4DRX E;  1TEZ A;  2OEW A;  3VLF A;  2UWJ G;  2I1J A;  4I1O B;  4FP7 A;  3E37 A;  3FH5 A;  4EZJ A;  5EDS A;  5LX8 A;  3MGB A;  3UT7 A;  3FUI A;  3PS6 A;  3HVE B;  2UY1 A;  3Q49 B;  4B8C B;  1O1S A;  2X6H A;  5FQ4 A;  1TR4 A;  3KAE A;  4K5C A;  5EX3 A;  3CHS A;  2P58 C;  1NP7 A;  4EBA G;  3NZS A;  3E30 A;  3ZYM A;  2J4D A;  3I3N A;  2LSV A;  2IY0 C;  1OY3 D;  3ASH A;  4J7W A;  4GTO A;  4U95 D;  5ANL A;  4K5A B;  2XEH A;  1HF8 A;  3TWR A;  3ZYL A;  5BNW A;  3HXF A;  1KPS B;  2P9N G;  1Z3X A;  2AXZ A;  4I1M A;  3TXM A;  1E90 A;  3KS2 A;  2BF0 X;  4LER A;  1ZU2 A;  3CHP A;  3ZNG A;  2VJ8 A;  2CHZ A;  2GRQ B;  4N5C A;  2DZN A;  2FO7 A;  2GRP B;  3GZ1 A;  5KJL A;  1H0A A;  3UIN C;  1OCC E;  1N0R A;  3TWU A;  2LXM A;  3L22 A;  4I6J A;  3U9W A;  3ZHE B;  1HX8 A;  4PS7 A;  3B95 A;  1UJJ A;  3ABK E;  3FDH A;  1IXV A;  5JHA A;  3C3Q A;  4DX5 D;  3SZ7 A;  4HOS A;  1H6K A;  4GTS A;  1TNY A;  3FU6 A;  2FBN A;  2AWI A;  2JEK A;  1D8D A;  2LNI A;  5CMY A;  1Z3Y A;  1MJ0 A;  4GPM A;  2P9U G;  3OAW A;  1D8E A;  5A23 A;  3D9P A;  3DSV A;  4WWO A;  5IY5 E;  3PEV B;  4U96 D;  3ASD A;  1JUQ A;  2DBA A;  4PUC A;  1N4R A;  4CGV A;  4GYO A;  4O6F A;  2C0L A;  4CT0 A;  5BUZ A;  1NFI E;  3VLD A;  1Y6I A;  4G8K A;  2WXK A;  1RZ4 A;  3NOC D;  5ENO D;  3CK8 A;  4CRW A;  2P9L G;  3OXG A;  3FFL A;  1E96 B;  1VDY A;  5JJ7 A;  4GPK A;  3SGH A;  1X5B A;  3ZN3 A;  2WQ7 A;  4CDN A;  1BPO A;  3LVR E;  3EU5 A;  2I1K A;  1N9A A;  4GTT A;  1NZN A;  2CG2 A;  3CK7 A;  2WPV A;  2GW1 A;  2WXN A;  2P9I G;  2RFM A;  3AG1 E;  2A5E A;  2X6I A;  4LNU D;  2NC9 A;  3DXK G;  1EF1 C;  2P9S G;  2XZT G;  1TJF A;  1PY1 A;  3CKB A;  2OCC E;  2BED A;  2LUH A;  3EHN A;  4KBQ A;  1N54 A;  2LAH A;  4FJZ A;  3TWT A;  3L16 A;  4AOF A;  4KT6 B;  4G8L A;  1SVX A;  5B3S E;  2X6F A;  1V54 E;  4A1S A;  3UM2 A;  2EQX A;  4KVM A;  1SZA A;  4H7Y A;  4CT4 A;  2IO2 C;  4G2V A;  3CEQ A;  3B13 A;  3ZYQ A;  3FUF A;  3T8M A;  2DYR E;  1AWC B;  4HB5 A;  3CQG B;  1HU3 A;  4B8A A;  5EN5 D;  4ANX A;  3LKU A;  2MHK A;  3JYS A;  4YVO A;  3D9I A;  4GZ5 A;  2OV8 A;  5EIL A;  3DXM G;  3UT8 A;  2Y3A A;  4GTV A;  4AP2 A;  4J8D A;  4BSZ B;  2L6B A;  2LAI A;  4CYM D;  4BX8 A;  3QWV A;  2PL2 A;  4N3A A;  4FU3 A;  4D10 C;  3FEY A;  3IEG A;  1YYH A;  4Q96 A;  4RVB A;  4K03 A;  2XHE A;  3CR3 A;  1B89 A;  3Q78 A;  1TYQ G;  4CEM A;  3APD A;  4DX2 A;  3FUL A;  4X8Q A;  2JLB A;  2V5F A;  3NB2 A;  2AJA A;  3C5R A;  5CED B;  3ZHE A;  3GZS A;  4APO A;  3ZUV B;  1A5E A;  3J5Q B;  2VSX E;  4F1S A;  2XPI A;  3G2U A;  3Q4A B;  3ZPJ A;  2BTD A;  2GRN B;  4FC8 A;  5FT9 A;  4E6H A;  2OND A;  3F6Q A;  4EQF A;  4HOU A;  3ABL E;  3DST A;  4JB8 P;  3B7U X;  2WXJ A;  4LNB A;  1TNU A;  4DI3 A;  1FVH A;  4A3T A;  3RJV A;  4JHJ A;  1OWM A;  3ESK A;  2R03 A;  5ENP D;  4I1A A;  1UN8 A;  3DEP A;  4EEC A;  4XKC A;  1KZP A;  4GYW A;  3PNT B;  5EYL A;  4N3B A;  2FO1 E;  2KM4 A;  3CV0 A;  3RO2 A;  3TG4 A;  1IYG A;  1HO8 A;  4FHJ A;  5T4Y A;  3MJW A;  2UY1 B;  3UQ3 A;  4JL0 A;  5BPP A;  4P29 A;  1Z5S C;  2XS8 A;  4GMJ A;  4GU5 A;  4ILH B;  5G55 A;  1SZ9 A;  1JCS A;  3FWV A;  2J8S D;  3FTY A;  4L9P A;  3IXE A;  3T8K A;  5ENS D;  1O5M A;  1UN9 A;  5CBO A;  4I9E A;  3D9J A;  5DBK A;  4L1B A;  4A3V A;  4UQY A;  3UT4 A;  5AQA A;  4RG6 A;  3O48 A;  1ELW A;  1H6P A;  3PH0 C;  5E75 A;  4LUN U;  3TWV A;  4JEH A;  3J5P A;  3FP3 A;  2GGF A;  2GRL A;  5CHE E;  4LSZ E;  1JWF A;  4I17 A;  3DSS A;  3HG0 D;  5G04 J;  2F0Y A;  4N3C A;  4JHR A;  5G05 C;  3Q73 A;  3TWX A;  4HRN A;  1SQM A;  1NL4 A;  5ITZ F;  4DK5 A;  3VTX A;  2P9P G;  3FUE A;  2YQ8 A;  4IRU A;  4MLP A;  2KAT A;  3R7R A;  3R7Q A;  3ZRH A;  3PEU B;  2ETB A;  2V8S E;  3NAW A;  2X38 A;  3JXJ A;  1PC2 A;  3PZ2 A;  4Z68 A;  3E34 A;  4BET A;  3SHF A;  4O1P A;  2XZD G;  3UIP C;  3AS4 A;  4C0E A;  3D9M A;  3P1U A;  2I6H A;  4I2W A;  2R17 C;  1QQE A;  3PVL A;  2XGM A;  5AJL A;  2WMO A;  3ENE A;  4ZFH A;  4OAV B;  3TL5 A;  4AM9 A;  4UI9 J;  2C2L A;  2BKK B;  3CVY A;  2VGE A;  3AJI A;  4TRQ A;  4BT9 A;  2ZIR A;  5KNG A;  2DYS E;  3QC1 A;  2QC9 A;  4BES A;  2RKK A;  1N0Q A;  3ZXS A;  3FUH A;  3DRA A;  4HXI A;  2XPZ A;  1P5Q A;  3CQC B;  1UJK A;  2HR2 A;  5EIB E;  2PNN A;  4GAA A;  4C48 B;  2IEJ A;  3LY7 A;  1DCE A;  5BW8 C;  3Q9U C;  1O1R A;  4ACL A;  3KSQ A;  4XZ4 A;  2B6C A;  3JUE A;  3CVQ A;  2VSY A;  3TG5 A;  2EIL E;  3JUI A;  1INZ A;  4U04 A;  1MHQ A;  3QOU A;  1SA4 A;  4J8E A;  4FLB A;  1OWN A;  1OCR E;  3QB2 A;  2VSO E;  4U0S A;  3TWS A;  3UIO C;  2IJG X;  4A63 B;  2R2L A;  4GTR A;  5ENR D;  3UXG A;  3DWL G;  4DUI A;  3ULE G;  1UOH A;  4WNF A;  5T3R A;  3QWP A;  3IHY A;  3MX3 A;  3VTY A;  1ZB1 A;  4GTM A;  2LSU A;  1HZ4 A;  5FJY A;  4U8H A;  5BV0 A;  4ATG A;  3SNX A;  3DPY A;  2E0I A;  3FUK A;  4U7E B;  3V31 A;  3E33 A;  3BUA A;  3DSU A;  3AU4 A;  3HXB A;  3KEZ A;  5HRY A;  3S7B A;  2WVI A;  2ETC A;  5G2N A;  5E76 A;  4BT8 A;  2X3M A;  2FF4 A;  4XEI G;  2R5S A;  4KZC A;  3UM3 A;  1WAO 1;  1BI7 B;  2KZT B;  4TXP A;  1MZC A;  3QNK A;  3D9O A;  4NIK A;  3LCA A;  3SQV A;  4N39 A;  3HXD A;  3JCK C;  3HIZ A;  4JA9 A;  2ION A;  3IHV A;  4BER A;  4GCO A;  3UKR G;  3L82 A;  4XI9 A;  4M3O A;  5B1B E;  3AAA C;  3VLE A;  1EDU A;  5KJK A;  2XPY A;  1OCO E;  1V55 E;  2Y4T A;  4U0U A;  2RFA A;  3AS8 A;  1OXJ A;  5D0Q D;  2VGX B;  3NQP A;  4JW1 A;  2I2O A;  4AXH A;  3WG7 E;  3GW4 A;  4PS8 A;  4N5Q A;  2V0P A;  5JA4 D;  4BX9 A;  1H2T C;  1OUV A;  2WXG A;  4UI9 K;  1ELK A;  4HOQ A;  3I4R B;  4DPR A;  2OVB A;  4GCN A;  2WMN A;  4JC8 A;  1IHB A;  1HG5 A;  4DX1 A;  2ZGD A;  3SO8 A;  2WXF A;  3CVU A;  1HXI A;  5CCL A;  2IO3 C;  5KCM A;  2XQ0 A;  4WUY A;  1S70 B;  2A4Z A;  3BEE A;  3CHM A;  4YDO A;  4DI4 A;  4TV3 A;  4HQD A;  1E7V A;  5FQ8 A;  1BU9 A;  2DCP A;  4JA7 A;  4RSY A;  4OVV A;  4I6E A;  3PZ4 A;  4PH4 B;  4JEU A;  5FZQ A;  3DEO A;  2WB2 A;  4UWH A;  3ASG A;  3V79 K;  1JCR A;  4I2Z A;  3ZXP A;  4G24 A;  4L2Y A;  1GW6 A;  2IFU A;  2XGS A;  3E32 A;  4B0Z A;  4Y6C A;  3ULY A;  3SI5 A;  1OWP A;  5AN8 A;  4WWN A;  3R9A B;  1TN8 A;  3U64 A;  5JMN D;  5T8I A;  1TN7 A;  4UQZ A;  2AXU A;  3AU5 A;  3ONL A;  1ELR A;  1FT2 A;  2J9Q A;  2RG8 A;  3ZIM A;  2R59 A;  3BQO A;  3FU5 A;  4JD2 G;  1Z6T A;  4HNA D;  3CK9 A;  4L7T A;  5KJN A;  1DNP A;  2NXP A;  2IU1 A;  4B93 B;  1WG0 A;  2EIK E;  4R7L A;  4OVU A;  2YHC A;  3LY9 A;  3KD7 A;  4JPS A;  3HHM A;  2R05 A;  5ANR A;  3MKQ B;  4G23 A;  3QKY A;  4B89 A;  2C0M A;  2QYJ A;  5ENT D;  3GZ2 A;  5A6C A;  5CBN A;  3QDN A;  1E8X A;  1U3D A;  4J8S A;  2DZO A;  1MX6 A;  2V5Q C;  2WXQ A;  3KEA A;  3RKV A;  5BXU A;  4L23 A;  1WDY A;  3Q7F A;  4U8Y D;  2KZT A;  3ZKJ A;  4U63 A;  2L6J A;  4I9C A;  3LPZ A;  4CDR A;  3Q15 A;  4F6R D;  4KXK B;  3UI2 A;  4A1G A;  3C3R A;  3NZU A;  4DLQ A;  3MV2 B;  1YMP A;  2Y0B G;  2OEV A;  2QY7 A;  4UWK A;  4F53 A;  3EIJ A;  2EIM E;  1EYH A;  2VGX A;  3UM1 A;  5LCW C;  3TJP A;  4RG9 A;  5HS0 A;  3FUM A;  3W9F A;  1MYO A;  4A55 A;  3FUN A;  2X6K A;  4HRM B;  5AJD A;  5D66 A;  3RO3 A;  5ARG A;  1MX4 A;  2V4H C;  4N2S A;  4UWL A;  4OAU C;  2CFU A;  4CZ2 D;  5KNH D;  4MBG A;  5FWQ A;  3FUD A;  5EX0 A;  3PZ1 A;  2J09 A;  3APC A;  3G2S A;  1N52 A;  3NOG D;  1LD8 A;  1S0P A;  4ILG A;  4GA0 A;  4DX7 D;  2WQH A;  3IKO B;  4YDE A;  4UQX A;  4M7C A;  2NSZ A;  4J0U A;  4GMR A;  3MYV A;  1BD8 A;  3ABM E;  5B1A E;  2EIJ E;  4FUL A;  3TWW A;  2FEZ A;  4ANU A;  3O4Z A;  2KC7 A;  2X6J A;  5EYP F;  2QFC A;  4HOT A;  2IOL A;  5AAR A;  4FHK A;  3G2V A;  2CHX A;  2OVF A;  2XRZ A;  2P2C P;  3CVV A;  3RK6 A;  2HYZ A;  2KXP C;  3D3M A;  3UPV A;  3ZU7 B;  1XGW A;  2L9B A;  3LJ3 A;  2PQN A;  1O1T A;  3JXI A;  4C0M A;  4L2L A;  3CVL A;  4U0Z A;  2GRR B;  1H2U A;  4GZ6 A;  3HXC A;  1D9S A;  3L17 A;  1BI8 B;  2GRM A;  3AG3 E;  4UUC A;  3ISM C;  1LF8 A;  5KBA A;  2PM7 A;  5FTP A;  3RRM B;  2QZA A;  3C3O A;  4WAF A;  3MKQ A;  4WNE A;  2KBX A;  3TXN A;  3DBS A;  2Y4U A;  4FLH A;  1K8K G;  4O1O A;  5BV1 A;  4E85 A;  5ENQ D;  2JAB A;  3RU0 A;  1TNB A;  4HOR A;  3D9L A;  4CCA A;  4ANV A;  2I9C A;  2Y69 E;  4TUM A;  1S63 A;  2BKG A;  4YND A;  1K1A A;  3GYZ A;  1N94 A;  2ETA A;  3CSF A;  2H6G A;  2CHW A;  1QNF A;  4AEZ C;  3ZEF A;  1FVF A;  5H7P A;  3V30 A;  3BG0 B;  2FUL A;  3QJZ A;  4YDW A;  1FT1 A;  4F1P A;  4G26 A;  4GB9 A;  2YNQ A;  2AVP A;  4HS2 A;  5M72 A;  3Q7A A;  4AVX A;  3WXX A;  3B7B A;  3FU3 A;  3V2O A;  4HI9 A;  3LVQ E;  4RQI A;  3Q9N C;  4OYS A;  1NA0 A;  3RAU A;  3OTN A;  5G05 J;  2XGO A;  3SBT B;  3N71 A;  1QBQ A;  2A5U A;  4URK A;  5CMW A;  1H2V C;  1HE8 A;  2VTB B;  1TN6 A;  3TAX A;  1KT0 A;  3BU8 A;  1H19 A;  5HI7 A;  2L0T B;  3Q75 A;  3FTU A;  2WXH A;  3PZD A;  2HM8 A;  4NRH B;  4LRZ A;  3Q79 A;  3QWW A;  5KJM A;  5EID A;  4CDM A;  3CST A;  4F3V A;  2KCV A;  1DCQ A;  4PS3 A;  1MX2 A;  1X81 A;  2H6F A;  3Q47 B;  2NYJ A;  3FEX A;  2PZI A;  1N4S A;  3MZL B;  3NBN B;  4Q69 A;  1HH8 A;  3AG4 E;  1G3N B;  3L54 A;  4QQI A;  1IQR A;  1LTX A;  4XI0 A;  4JHK A;  3Q5M A;  4JVS A;  1S64 A;  3LS8 A;  5FQ6 A;  4J8Y A;  3LXU X;  5JHB A;  3V2X A;  2LO6 A;  5FZS A;  4B94 A;  1JCQ A;  5C2Y A;  3JQ0 A;  3FTV A;  3LJN A;  4AY5 A;  1QYM A;  1TNZ A;  4GA2 A;  4FA6 A;  2H6I A;  4BTA A;  1OWL A;  3CHQ A;  4XIF A;  3T9K A;  2DWZ A;  3UUX A;  2J07 A;  5A7D B;  4C9B B;  4MRU A;  3S2A A;  3RSE G;  3D9H A;  3FHE A;  3TWQ A;  4AJW A;  4K0R A;  2IQC A;  1IQU A;  2VSN A;  3LY8 A; 
#chains in the Genus database with same CATH homology
 4XEI G;  3DXM G;  3DWL G;  3ULE G;  1U2V G;  2P9U G;  2P9I G;  2P9K G;  1K8K G;  4JD2 G;  2P9N G;  2P9L G;  3UKU G;  3RSE G;  2P9P G;  3DXK G;  2P9S G;  3UKR G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...