2P9LG

Crystal structure of bovine arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
137
Chain Sequence
b'ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
molecule keywords Actin-like protein 3
source organism Bos taurus
molecule tags Structural protein
total genus 41
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9lG00
2P9NG 3DXKG 1K8KG 3UKUG 1TYQG 1U2VG 2P9SG 3ULEG 4JD2G 3DWLG 3UKRG 3DXMG 2P9KG 2P9UG 3RSEG 4XEIG 2P9LG 2P9PG 2P9IG
chains in the Genus database with same CATH superfamily
2IU1A 3FUIA 3HVEA 5EN5D 2ZGGA 2YHEA 4F1PA 4RSYA 5FQ6A 3L13A 2X6HA 4XZ4A 3ZHEB 3FH5A 4RVBA 3ASHA 2X38A 1HXIA 5ARFA 2HR2A 2YHCA 5AQAA 3BU8A 3KAEA 1UG3A 5H7PA 1IQRA 4KXKB 2C0MA 2IJGX 1ZU2A 5HQ8A 4JHRA 4A1SA 2PM7A 1HO8A 4C9BB 3KD7A 5EDSA 4NQ0A 3CQCB 4GZ5A 3V79K 2V4HC 3KSQA 1YMPA 1E7VA 4RQIA 3DEOA 4FA6A 4HI9A 1B89A 5FJYA 4CDNA 4GTSA 4EZLA 3IHVA 3FU0A 2XGSA 4O1PA 3UI2A 4Q69A 5ENQD 3CK7A 3JQ1A 3OXGA 4ACKA 4G23A 3T5VA 3TAXA 3RSEG 3EHMA 4KZ0A 1L5JA 3ASNE 4TUUA 3HXDA 3ULQA 5KBAA 3DSUA 3D9LA 3DEPA 3DSSA 2FEZA 4V3IA 2GW1A 2C0LA 5M72A 2IOSA 2R17C 4FHJA 5AJLA 4AVXA 2NC9A 3Q4AB 1MX6A 2ZU6B 3CVVA 2EILE 3OAWA 3T8MA 3FUKA 2F8XK 1TJCA 1LTXA 4WNDA 1LD8A 2RG8A 1X81A 3KEAA 1PC2A 1H6OA 2GRLA 3UMVA 4AJWA 4MRUA 1Y8MA 5B1AE 4GYYA 4OVUA 4ACLA 4RG6A 3UTMA 2P58C 4UI9J 3LDZA 4KBQA 3C3RA 3ASGA 5CRUA 3O48A 4C48B 5FQ8A 3KSLA 3CK9A 2VGXB 3UM2A 4EECA 3I3NA 3EIJA 4PS7A 5D0OD 1JPLA 4F53A 3ESLA 2I1JA 2A5EA 3JUEA 3P1UA 4BSZB 3D9MA 3QARA 2VGXA 3FY4A 2EIJE 2J9QA 4U8HA 1HZ4A 4N5CA 4JL0A 1WAO1 4EZKA 5LFAA 5AJDA 5ANLA 5CMYA 4A63B 3C3QA 5CERB 2WQ7A 2R03A 1HU3A 3HXEA 4LSZE 4A1GA 4U63A 4DPRA 2WVIA 4HS2A 5EYPF 2VSNA 2FO1E 3S7JA 4JC8A 5EX3A 1KLXA 5KNGA 1S70B 3CV0A 3FEXA 4B89A 3CVQA 4LRZA 2OEWA 4Q94A 5T3RA 4U7EB 3BG1B 2DYRE 3JXJA 1O1RA 4HLLA 5AN8A 1OT8A 3CIAA 3T5XA 2Q7FA 4ZFHA 2WXPA 4WNGA 3QDNA 4D10C 3FTVA 3FH8A 2P9KG 2E0IA 1HX8A 4GPMA 1A17A 1K3ZD 1UOHA 3B7SA 3D9OA 2V8SE 1K8KG 3WXXA 2VSOE 4IYPA 4I1OB 2WXOA 4QQIA 3UKRG 4XI9A 1V54E 3DXMG 4K5BA 1HE8A 4G24A 2F0YA 2NYJA 3CVWA 3Q47B 4DX1A 2XS8A 4EBAG 3IXEA 4JPSA 3KEZA 4A3TA 1TR4A 4FADA 4IN3B 4BTBA 1HH8A 1N9AA 5LP0A 3EIQC 4KZCA 1MZCA 1Z3XA 2WXQA 5JJTA 3P2BA 3S2AA 3FTXA 2P9UG 2V0PA 3UINC 5EILA 1UN9A 2VQ2A 1DNPA 1JWGA 1TNZA 1OWMA 2P9NG 1DC2A 4AIFA 3Q9NC 4FJYA 5AQ7A 4H7XA 3UQ3A 4J0UA 4U0UA 2ZIRA 3UT4A 4BX8A 5T8IA 1YCSB 4CEMA 4G26A 1XNFA 3NZSA 4F6RD 1H6KA 3QK0A 3ZYMA 3NQPA 2KXPC 4LERA 3PVLA 1Z6TA 3ZW3A 3B7BA 4HOUA 2PZIA 3MGBA 4AP2A 5BW8C 4U8VD 2LSUA 3FTWA 5KJMA 2I9CA 4LEUA 4GCNA 4I9EA 3SFYA 5HKPA 4ATGA 3L82A 4EZJA 3MX3A 3PZ4A 3HRAA 3ZXPA 3PDNA 3CKCA 4N3AA 4JHJA 4JB8P 3NB2A 1SQMA 3FTUA 4U0SA 4L7TA 1KZPA 3JUIA 3QWPA 3UX4A 4F1SA 3BUAA 4I1MA 3VLDA 3BG0B 2X6FA 3CGHA 1E8ZA 3Q15A 2R02A 2L6JA 4GA0A 3FULA 4I6JA 5IY5E 1BLXB 3ASOE 2XCCA 4JW1A 5AAOA 4KT6B 3CVLA 3FUDA 4DLOA 1YA0A 2HE0A 1TYQG 2DIWA 3DSTA 2OOEA 1FT2A 1UJKA 3RRUA 2L9BA 1H0AA 4M3OA 3FH7A 3V2OA 2BUGA 5JHBA 2IO2C 2WXRA 2MOWA 1N94A 2DCPA 3LXUX 1HF8A 4J6IA 2EIME 3ZXSA 2NSZA 2UWJG 4FLBA 1E8XA 4MLPA 3PEUB 2LUHA 1OUVA 3TWXA 1BI7B 2M63A 2FULA 2QYJA 2IONA 4B8CB 4UWGA 3TWSA 2R5SA 2XEEA 3FUFA 3Q75A 5DBKA 4JEHA 3S7FA 1IYGA 3UM3A 5HI7A 3G2SA 3DRAA 3Q5MA 3E37A 4E6HA 3CSFA 4HOQA 4XE0A 1TJFA 4H7YA 2JEKA 3NF1A 4ANVA 3Q49B 1Q2ZA 2HM8A 4BWRA 3QJZA 4UI9K 3I4RB 5FTPA 5AQ9A 3MA5A 2EINE 1EYHA 4XI0A 1H19A 3TXMA 4FU3A 5J08A 5KJLA 5G05J 3E30A 4PDXA 5CHEE 3QKYA 4J7WA 2VTBB 2BEDA 4GTTA 1FVHA 2BF0X 1V55E 3E32A 3L16A 3PE4A 3MYVA 1EPUA 4U07A 3L9TA 4ATZD 2LXMA 3TWTA 2VTBA 3UKUG 3VTYA 3ZHEA 3B7UX 3Q73A 2WPVA 4IRUA 3FUHA 3LVQE 4MS6A 3HIZA 4FC8A 3FTYA 1BU9A 4TV3A 1QYMA 4PUCA 4I9CA 5JJ6A 4OAVB 5KJKA 2LSVA 2E2EA 2I6HA 1N4PA 5FWQA 1K1BA 2GRMA 2I1KA 4GB9A 2ETAA 2EQXA 1SZAA 4O6FA 1S0PA 3U9WA 2J49A 3HG0D 1FVFA 4GTQA 4MKTA 3L22A 4BEPA 3ML8A 2P9PG 3DSXA 3SY2A 5EYLA 5FQ7A 2J4BA 2IF4A 4Z68A 4W9RA 2XENA 3AJIA 3S7BA 1SVXA 2ETBA 4HFGA 3WG7E 4GMJA 1O1SA 4FP7A 2IOLA 3ABLE 4HI8A 4HOTA 2ETCA 3FEYA 3Q7FA 4QFVA 3CVYA 5CEAA 4O60A 4UWFA 2X6JA 4B94A 2WXNA 4BX9A 2VSYA 2ZISA 3FDHA 3NBNB 3ULEG 4BERA 4B8AA 4GTVA 4CT4A 1W3BA 3MZLB 2XS1A 3CQGB 4X8QA 3T9KA 2WXKA 4HBDA 3L17A 4CYMD 3V2XA 1OCRE 3AS5A 4K5CA 1HFAA 3DWLG 4AOFA 4JZYA 4XKBA 3UXGA 5C1DA 3EJNA 4FHKA 2H6FA 2Y3AA 1H2TC 3SHFA 4N39A 4EHMA 2CG3A 4NURA 4DX7D 3OTNA 4EBAA 3ULYA 1E8YA 2Y0BG 2BKGA 5ENTD 1D8DA 2F37A 3SD5A 1LF8A 2KCVA 3FU3A 3VLEA 5KWDA 1MYOA 3AU5A 3D9HA 2F8YA 5EX0A 4BFRA 5ENOD 4YDEA 2OV8A 3FUEA 3RK6A 3PNTB 1RZ4A 4TRQA 3HXFA 5CBOA 3EHNA 5E75A 3ZUVB 4JXTA 2L0IA 3CHSA 4U8YD 4CRWA 1BD8A 4KMOA 2AWIA 5B1BE 2B6CA 2IFUA 5FT9A 4ANXA 4GYWA 1UW4B 3DPDA 4YDOA 5BXUA 5EKQD 3J5PA 4JA7A 2J07A 2VYIA 4JHKA 3KS2A 4GZ3A 3QNKA 3LY7A 3OXFA 5KJNA 4WAFA 3SO8A 2FF4A 3TJPA 1G3NB 4GU5A 3QB2A 1UJJA 3ZIMA 2C2LA 3FUMA 5HRYA 3APDA 2QY7A 4EPZA 3URZA 3R7RA 3NOGD 1IHGA 5A23A 2WM9A 4I6GA 4GTPA 4C0MA 2AJAA 1AWCB 3JYSA 3PEVB 1TNBA 1N0RA 1E7UA 4TXQA 4ABNA 4F7AA 1IKND 1U2VG 3NAWA 1S64A 3ENEA 4J8DA 3SI5A 4AV7A 4F3VA 4APOA 3IKOB 4K03A 2IO3C 3CSTA 5HS0A 3UUXA 1Y6IA 3I5PA 3HXBA 4DI4A 1NA3A 3EDTB 3AU4A 1N0QA 3L6AA 5KCMA 4BSXA 3ZYQA 5BXOA 2RFMA 3GZSA 5CRVA 1TN7A 3DBSA 2WQHA 1NI1A 4R7LA 4AY6A 2MYOA 3ABME 4DLQA 3ZEFA 3TXNA 4AEZC 1N52A 3B7RL 4ZHBA 1OWOA 5AQBA 3C72A 1TNOA 1LD7A 5D2MC 4LNUD 4URKA 4BTAA 1DVPA 2WXLA 4CCAA 2QC9A 4FJZA 3CVXA 3R7QA 3W9FA 4GMLA 3MKQB 3GZ2A 5D0QD 1DCEA 3UIOC 4G11A 4ANWA 2XCBA 4HB5A 3HDXA 1N4QA 4GPKA 3LY9A 3IHYA 2GGFA 2GRRB 3MKQA 2J09A 5EIBE 2CG2A 3U3WA 4JD2G 4O1OA 1HG2A 1Z5SC 2JABA 2MHKA 3DSWA 4NACA 5BT1A 2YNQA 2AW6A 2J08A 5E76A 2CHWA 4HLEA 1GW6A 3MEKA 2DBAA 4TXRA 4Y6WA 2DVWA 3UM1A 3MCXA 3FUNA 2R2LA 2ZGDA 5FINA 1OCZE 3MJWA 2L6BA 4L1BA 1HS6A 3ZPJA 4WNEA 4ILGA 3CHRA 4LNBA 4NIKA 3Q9UC 1H2VC 3ZVVA 3RAUA 1VDYA 3FUJA 3CHQA 1OWLA 3FTZA 3PS6A 4CT0A 3UPVA 4U95D 3RRNB 2X6IA 4N5QA 4E85A 5C2YA 2KC7A 3SFXA 4OAUC 2AXVA 3X2QE 2R59A 5A6CA 3C3OA 2DZOA 2DYSE 5J90A 4K0RA 1IQUA 3TL5A 4XEIG 4MBGA 4IULA 3PUJA 2WXHA 5CMWA 2KZTB 2LAHA 1E8WA 2DWZA 4I43A 3C98A 5ARGA 2IY0C 1D8EA 5AYWD 4CZ2D 3UM0A 1E90A 2GROB 4UUCA 3APCA 5BUZA 4I6EA 4GYOA 2CHZA 5AARA 3IBEA 3G2UA 4FLHA 1YYHA 1TN6A 3FU6A 1ELKA 4KVMA 4CDMA 4ANUA 3PRZA 2EIKE 3TGOA 3GYZA 2RKKA 3QWWA 4A55A 4OYSA 5BV0A 2WQ6A 2WMOA 1O5MA 3V30A 1X5BA 1MX2A 2CFUA 1A5EA 2P9IG 3LEWA 1ELWA 1NP7A 4AY5A 4UI9C 4L2LA 4DI3A 2RFAA 3FU5A 3PZ3A 5ENPD 2H6GA 4PS3A 4LUNU 3TWVA 3RJVA 3I4GA 5CBNA 4CGWA 4C0EA 4M7CA 1OCOE 3TWWA 3O4ZA 4G1TA 4G8LA 1N4RA 2KATA 4BESA 4DX2A 5ENSD 3RO3A 2X6KA 4J8FA 5FZSA 1BPOA 4YVOA 3ZU7B 1RW2A 4I1AA 3CHOA 5CCLA 4BY6A 1H2UA 4GMRA 4AXHA 3ZN3A 1ELRA 1N54A 3FFLA 3ZYLA 2XRYA 4JA9A 2XGMA 2KCLA 4XKCA 1OCCE 5BPPA 3G2WA 4I2ZA 1DCQA 4G8KA 3MV2B 3R9AB 4YDWA 2ONDA 4HNAD 1MHQA 3PZ1A 4CGVA 3CVUA 4BT8A 2XEVA 4PH4B 2XZDG 2VGEA 3FTSA 2AVPA 1N11A 1WDYA 3LKUA 3CR3A 3U64A 1FCHA 2V5FA 3B13A 2XGOA 1NA0A 4HRNA 3CLJA 5FQ4A 4UQZA 1MX4A 3LJ3A 1HG5A 3IEGA 3F6QA 3MV3B 3DPYA 2WB2A 2CHXA 3G2TA 2OCCE 4TUMA 3ZKJA 2ILRA 2V5QC 4L9PA 2X3MA 5FZRA 2DZNA 5G04C 3QWVA 1ZBPA 5JA4D 4LCTA 2HYZA 2Y4UA 3U66A 3R9MA 3EUVA 3PZ2A 2OEVA 4L23A 3B7TA 3LCAA 2CFZA 5AIJA 3AS8A 2XHEA 3GZ1A 1S63A 2OVBA 2B0OE 3E4BA 4HOSA 3ISMC 4WWOA 5ENNA 3CK8A 4XIFA 3SBSA 3LJNA 4HORA 3V31A 4ILHB 1QZ2A 4J8SA 3AG3E 2OVFA 4RLYA 3VLFA 3ZNGA 1TN8A 5DIZA 5T4YA 1OY3D 3JQ0A 2AXUA 4J8EA 3D9JA 4GA1A 4APFA 3LVRE 2A4ZA 4WUYA 2R05A 3ABKE 3DSVA 2JLBA 5BNWA 2QZAA 2XQ0A 3B95A 4XX5A 3JCKC 5JMND 3SQVA 2GRQB 4TXPA 3SBTB 1Z3YA 3GW4A 2PL2A 3Q78A 3BEEA 2BKKB 3SFZA 3T8KA 1BI8B 3CVPA 1JUQA 2P9LG 4UQYA 3SGHA 2VGYA 3SF4A 2PQNA 3D3MA 2FI7A 5LCWC 5ENRD 3HXCA 4L2YA 5KNHD 1KT0A 1INZA 1IXVA 1JCRA 3AS4A 1QBQA 3S7DA 4I17A 3J5QB 3ONKA 4GTMA 4B0ZA 4N3BA 4Q96A 2LAIA 2NXPA 1JCSA 4CDRA 2XZTG 3EHQA 4I2WA 3SZ7A 1OWNA 1IHBA 5G2NA 4B93B 4N2QA 3E34A 4WWNA 2KBXA 3CHMA 2I2OA 5AENA 2XPZA 1SA5A 2YINA 3LYAA 3N71A 4PS8A 2WMNA 3DXKG 1SZ9A 1EF1C 2WXIA 2XPIA 3MKRA 2YQ8A 4YDYA 3PZDA 4P29A 3AG4E 1NZNA 3RIBA 2HO1A 2J8SD 3RU0A 2Y69E 2LO6A 4UWHA 4ME2A 3UT7A 4RG9A 5G04J 2KM4A 5JJ7A 1PAQA 5FZQA 1WY6A 3D9NA 4YVQC 2WXGA 4EQFA 2H6HA 3RRMB 4G2VA 4GZCA 1KT1A 5CEDB 1FT1A 2UY1B 2A5UA 4U04A 1E96B 5B3SE 4BETA 4UWLA 3FP3A 3JXIA 4DX5D 3EU5A 1OWPA 1K1AA 1PY1A 2QFCA 3NOCD 4HRLA 3FHEA 2UY1A 5ITZF 3Q79A 1H6PA 4WWPA 4HXIA 3U4TA 3LPZA 1MJ0A 5LOZA 3D9IA 3L54A 1FPPA 3W9GA 2WXMA 2V4LA 5G05C 1N95A 2AXZA 3ZGQA 4DK5A 3LY8A 4J8YA 2ZXWE 2WXFA 4HQDA 4AM9A 4U96D 3CEQA 1TEZA 1AP7A 3QC1A 3UIPC 2QYUA 4OVVA 4LNGA 3CHPA 2PNNA 3SNXA 3ONLA 1OXJA 1P5QA 4GZ6A 4KYOB 2VJ8A 2XEHA 5CECB 2GRPB 4U0ZA 3ASDA 5JHAA 3EHRA 3APFA 1QNFA 4N2SA 3L08A 3AG2E 4BT9A 2J4DA 1N4SA 3K9IA 5ANRA 3HHMA 2IQCA 2VSXE 1U3CA 2Y1LE 2PM6A 3PH0C 4DJAA 2IEJA 2RD0A 4Y6CA 3TG4A 4HVBA 5LCWJ 1SA4A 2GRNB 4GA2A 2H6IA 4FULA 4GTOA 1ZB1A 3PNLB 3TWRA 1TNYA 3Q7AA 3G2VA 1XGWA 3TWQA 3AAAC 5A7DB 1MQSA 3D9PA 1JWFA 1EDUA 4K5AB 3NZUA 2LNIA 4ILIA 2P9SG 2XRZA 1QQEA 3TWUA 2LXLA 1TNUA 2KZTA 1WG0A 4GTRA 5BV1A 4DRXE 3QAQA 4NRHB 3ZYKA 2P2CP 3LS8A 3RO2A 2L0TB 3BQOA 3CKBA 2XPYA 3ML9A 2MRIA 5EIDA 4DX6D 3QOUA 2PQRA 5LX8A 4JEUA 2WXJA 3FWVA 1JCQA 2FBNA 3ZRHA 4UQXA 3AG1E 1SW6A 4GCOA 3ZFWA 4DUIA 1KZOA 4KVOA 3PREA 4WNFA 2BTDA 1KPSB 3TG5A 1NL4A 4A3VA 4JVSA 3VTXA 3PUKA 3EU9A 3ASFA 3E33A 5G55A 4UWKA 4HRMB 4G25A 5FIOA 1U3DA 1NFIE 4GZDA 1D9SA 1WM5A 3RKVA 3C5RA 3PE3A 1UN8A 2FO7A 2KCKA 3CVNA 3D9KA 4YNDA 3UT8A 3HVEB 5D66A 4GAAA 3HYMB 3ESKA 3OXLA 2Y4TA 3IV0A 4LG6A 5CCMA 4N3CA 1O1TA
chains in the Genus database with same CATH topology
2P9NG 3DXKG 1K8KG 3UKUG 1TYQG 1U2VG 2P9SG 3ULEG 4JD2G 3DWLG 3UKRG 3DXMG 2P9KG 2P9UG 3RSEG 4XEIG 2P9LG 2P9PG 2P9IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N G;  3DXK G;  1K8K G;  3UKU G;  1TYQ G;  1U2V G;  2P9S G;  3ULE G;  4JD2 G;  3DWL G;  3UKR G;  3DXM G;  2P9K G;  2P9U G;  3RSE G;  4XEI G;  2P9L G;  2P9P G;  2P9I G; 
#chains in the Genus database with same CATH topology
 2IU1 A;  3FUI A;  3HVE A;  5EN5 D;  2ZGG A;  2YHE A;  4F1P A;  4RSY A;  5FQ6 A;  3L13 A;  2X6H A;  4XZ4 A;  3ZHE B;  3FH5 A;  4RVB A;  3ASH A;  2X38 A;  1HXI A;  5ARF A;  2HR2 A;  2YHC A;  5AQA A;  3BU8 A;  3KAE A;  1UG3 A;  5H7P A;  1IQR A;  4KXK B;  2C0M A;  2IJG X;  1ZU2 A;  5HQ8 A;  4JHR A;  4A1S A;  2PM7 A;  1HO8 A;  4C9B B;  3KD7 A;  5EDS A;  4NQ0 A;  3CQC B;  4GZ5 A;  3V79 K;  2V4H C;  3KSQ A;  1YMP A;  1E7V A;  4RQI A;  3DEO A;  4FA6 A;  4HI9 A;  1B89 A;  5FJY A;  4CDN A;  4GTS A;  4EZL A;  3IHV A;  3FU0 A;  2XGS A;  4O1P A;  3UI2 A;  4Q69 A;  5ENQ D;  3CK7 A;  3JQ1 A;  3OXG A;  4ACK A;  4G23 A;  3T5V A;  3TAX A;  3RSE G;  3EHM A;  4KZ0 A;  1L5J A;  3ASN E;  4TUU A;  3HXD A;  3ULQ A;  5KBA A;  3DSU A;  3D9L A;  3DEP A;  3DSS A;  2FEZ A;  4V3I A;  2GW1 A;  2C0L A;  5M72 A;  2IOS A;  2R17 C;  4FHJ A;  5AJL A;  4AVX A;  2NC9 A;  3Q4A B;  1MX6 A;  2ZU6 B;  3CVV A;  2EIL E;  3OAW A;  3T8M A;  3FUK A;  2F8X K;  1TJC A;  1LTX A;  4WND A;  1LD8 A;  2RG8 A;  1X81 A;  3KEA A;  1PC2 A;  1H6O A;  2GRL A;  3UMV A;  4AJW A;  4MRU A;  1Y8M A;  5B1A E;  4GYY A;  4OVU A;  4ACL A;  4RG6 A;  3UTM A;  2P58 C;  4UI9 J;  3LDZ A;  4KBQ A;  3C3R A;  3ASG A;  5CRU A;  3O48 A;  4C48 B;  5FQ8 A;  3KSL A;  3CK9 A;  2VGX B;  3UM2 A;  4EEC A;  3I3N A;  3EIJ A;  4PS7 A;  5D0O D;  1JPL A;  4F53 A;  3ESL A;  2I1J A;  2A5E A;  3JUE A;  3P1U A;  4BSZ B;  3D9M A;  3QAR A;  2VGX A;  3FY4 A;  2EIJ E;  2J9Q A;  4U8H A;  1HZ4 A;  4N5C A;  4JL0 A;  1WAO 1;  4EZK A;  5LFA A;  5AJD A;  5ANL A;  5CMY A;  4A63 B;  3C3Q A;  5CER B;  2WQ7 A;  2R03 A;  1HU3 A;  3HXE A;  4LSZ E;  4A1G A;  4U63 A;  4DPR A;  2WVI A;  4HS2 A;  5EYP F;  2VSN A;  2FO1 E;  3S7J A;  4JC8 A;  5EX3 A;  1KLX A;  5KNG A;  1S70 B;  3CV0 A;  3FEX A;  4B89 A;  3CVQ A;  4LRZ A;  2OEW A;  4Q94 A;  5T3R A;  4U7E B;  3BG1 B;  2DYR E;  3JXJ A;  1O1R A;  4HLL A;  5AN8 A;  1OT8 A;  3CIA A;  3T5X A;  2Q7F A;  4ZFH A;  2WXP A;  4WNG A;  3QDN A;  4D10 C;  3FTV A;  3FH8 A;  2P9K G;  2E0I A;  1HX8 A;  4GPM A;  1A17 A;  1K3Z D;  1UOH A;  3B7S A;  3D9O A;  2V8S E;  1K8K G;  3WXX A;  2VSO E;  4IYP A;  4I1O B;  2WXO A;  4QQI A;  3UKR G;  4XI9 A;  1V54 E;  3DXM G;  4K5B A;  1HE8 A;  4G24 A;  2F0Y A;  2NYJ A;  3CVW A;  3Q47 B;  4DX1 A;  2XS8 A;  4EBA G;  3IXE A;  4JPS A;  3KEZ A;  4A3T A;  1TR4 A;  4FAD A;  4IN3 B;  4BTB A;  1HH8 A;  1N9A A;  5LP0 A;  3EIQ C;  4KZC A;  1MZC A;  1Z3X A;  2WXQ A;  5JJT A;  3P2B A;  3S2A A;  3FTX A;  2P9U G;  2V0P A;  3UIN C;  5EIL A;  1UN9 A;  2VQ2 A;  1DNP A;  1JWG A;  1TNZ A;  1OWM A;  2P9N G;  1DC2 A;  4AIF A;  3Q9N C;  4FJY A;  5AQ7 A;  4H7X A;  3UQ3 A;  4J0U A;  4U0U A;  2ZIR A;  3UT4 A;  4BX8 A;  5T8I A;  1YCS B;  4CEM A;  4G26 A;  1XNF A;  3NZS A;  4F6R D;  1H6K A;  3QK0 A;  3ZYM A;  3NQP A;  2KXP C;  4LER A;  3PVL A;  1Z6T A;  3ZW3 A;  3B7B A;  4HOU A;  2PZI A;  3MGB A;  4AP2 A;  5BW8 C;  4U8V D;  2LSU A;  3FTW A;  5KJM A;  2I9C A;  4LEU A;  4GCN A;  4I9E A;  3SFY A;  5HKP A;  4ATG A;  3L82 A;  4EZJ A;  3MX3 A;  3PZ4 A;  3HRA A;  3ZXP A;  3PDN A;  3CKC A;  4N3A A;  4JHJ A;  4JB8 P;  3NB2 A;  1SQM A;  3FTU A;  4U0S A;  4L7T A;  1KZP A;  3JUI A;  3QWP A;  3UX4 A;  4F1S A;  3BUA A;  4I1M A;  3VLD A;  3BG0 B;  2X6F A;  3CGH A;  1E8Z A;  3Q15 A;  2R02 A;  2L6J A;  4GA0 A;  3FUL A;  4I6J A;  5IY5 E;  1BLX B;  3ASO E;  2XCC A;  4JW1 A;  5AAO A;  4KT6 B;  3CVL A;  3FUD A;  4DLO A;  1YA0 A;  2HE0 A;  1TYQ G;  2DIW A;  3DST A;  2OOE A;  1FT2 A;  1UJK A;  3RRU A;  2L9B A;  1H0A A;  4M3O A;  3FH7 A;  3V2O A;  2BUG A;  5JHB A;  2IO2 C;  2WXR A;  2MOW A;  1N94 A;  2DCP A;  3LXU X;  1HF8 A;  4J6I A;  2EIM E;  3ZXS A;  2NSZ A;  2UWJ G;  4FLB A;  1E8X A;  4MLP A;  3PEU B;  2LUH A;  1OUV A;  3TWX A;  1BI7 B;  2M63 A;  2FUL A;  2QYJ A;  2ION A;  4B8C B;  4UWG A;  3TWS A;  2R5S A;  2XEE A;  3FUF A;  3Q75 A;  5DBK A;  4JEH A;  3S7F A;  1IYG A;  3UM3 A;  5HI7 A;  3G2S A;  3DRA A;  3Q5M A;  3E37 A;  4E6H A;  3CSF A;  4HOQ A;  4XE0 A;  1TJF A;  4H7Y A;  2JEK A;  3NF1 A;  4ANV A;  3Q49 B;  1Q2Z A;  2HM8 A;  4BWR A;  3QJZ A;  4UI9 K;  3I4R B;  5FTP A;  5AQ9 A;  3MA5 A;  2EIN E;  1EYH A;  4XI0 A;  1H19 A;  3TXM A;  4FU3 A;  5J08 A;  5KJL A;  5G05 J;  3E30 A;  4PDX A;  5CHE E;  3QKY A;  4J7W A;  2VTB B;  2BED A;  4GTT A;  1FVH A;  2BF0 X;  1V55 E;  3E32 A;  3L16 A;  3PE4 A;  3MYV A;  1EPU A;  4U07 A;  3L9T A;  4ATZ D;  2LXM A;  3TWT A;  2VTB A;  3UKU G;  3VTY A;  3ZHE A;  3B7U X;  3Q73 A;  2WPV A;  4IRU A;  3FUH A;  3LVQ E;  4MS6 A;  3HIZ A;  4FC8 A;  3FTY A;  1BU9 A;  4TV3 A;  1QYM A;  4PUC A;  4I9C A;  5JJ6 A;  4OAV B;  5KJK A;  2LSV A;  2E2E A;  2I6H A;  1N4P A;  5FWQ A;  1K1B A;  2GRM A;  2I1K A;  4GB9 A;  2ETA A;  2EQX A;  1SZA A;  4O6F A;  1S0P A;  3U9W A;  2J49 A;  3HG0 D;  1FVF A;  4GTQ A;  4MKT A;  3L22 A;  4BEP A;  3ML8 A;  2P9P G;  3DSX A;  3SY2 A;  5EYL A;  5FQ7 A;  2J4B A;  2IF4 A;  4Z68 A;  4W9R A;  2XEN A;  3AJI A;  3S7B A;  1SVX A;  2ETB A;  4HFG A;  3WG7 E;  4GMJ A;  1O1S A;  4FP7 A;  2IOL A;  3ABL E;  4HI8 A;  4HOT A;  2ETC A;  3FEY A;  3Q7F A;  4QFV A;  3CVY A;  5CEA A;  4O60 A;  4UWF A;  2X6J A;  4B94 A;  2WXN A;  4BX9 A;  2VSY A;  2ZIS A;  3FDH A;  3NBN B;  3ULE G;  4BER A;  4B8A A;  4GTV A;  4CT4 A;  1W3B A;  3MZL B;  2XS1 A;  3CQG B;  4X8Q A;  3T9K A;  2WXK A;  4HBD A;  3L17 A;  4CYM D;  3V2X A;  1OCR E;  3AS5 A;  4K5C A;  1HFA A;  3DWL G;  4AOF A;  4JZY A;  4XKB A;  3UXG A;  5C1D A;  3EJN A;  4FHK A;  2H6F A;  2Y3A A;  1H2T C;  3SHF A;  4N39 A;  4EHM A;  2CG3 A;  4NUR A;  4DX7 D;  3OTN A;  4EBA A;  3ULY A;  1E8Y A;  2Y0B G;  2BKG A;  5ENT D;  1D8D A;  2F37 A;  3SD5 A;  1LF8 A;  2KCV A;  3FU3 A;  3VLE A;  5KWD A;  1MYO A;  3AU5 A;  3D9H A;  2F8Y A;  5EX0 A;  4BFR A;  5ENO D;  4YDE A;  2OV8 A;  3FUE A;  3RK6 A;  3PNT B;  1RZ4 A;  4TRQ A;  3HXF A;  5CBO A;  3EHN A;  5E75 A;  3ZUV B;  4JXT A;  2L0I A;  3CHS A;  4U8Y D;  4CRW A;  1BD8 A;  4KMO A;  2AWI A;  5B1B E;  2B6C A;  2IFU A;  5FT9 A;  4ANX A;  4GYW A;  1UW4 B;  3DPD A;  4YDO A;  5BXU A;  5EKQ D;  3J5P A;  4JA7 A;  2J07 A;  2VYI A;  4JHK A;  3KS2 A;  4GZ3 A;  3QNK A;  3LY7 A;  3OXF A;  5KJN A;  4WAF A;  3SO8 A;  2FF4 A;  3TJP A;  1G3N B;  4GU5 A;  3QB2 A;  1UJJ A;  3ZIM A;  2C2L A;  3FUM A;  5HRY A;  3APD A;  2QY7 A;  4EPZ A;  3URZ A;  3R7R A;  3NOG D;  1IHG A;  5A23 A;  2WM9 A;  4I6G A;  4GTP A;  4C0M A;  2AJA A;  1AWC B;  3JYS A;  3PEV B;  1TNB A;  1N0R A;  1E7U A;  4TXQ A;  4ABN A;  4F7A A;  1IKN D;  1U2V G;  3NAW A;  1S64 A;  3ENE A;  4J8D A;  3SI5 A;  4AV7 A;  4F3V A;  4APO A;  3IKO B;  4K03 A;  2IO3 C;  3CST A;  5HS0 A;  3UUX A;  1Y6I A;  3I5P A;  3HXB A;  4DI4 A;  1NA3 A;  3EDT B;  3AU4 A;  1N0Q A;  3L6A A;  5KCM A;  4BSX A;  3ZYQ A;  5BXO A;  2RFM A;  3GZS A;  5CRV A;  1TN7 A;  3DBS A;  2WQH A;  1NI1 A;  4R7L A;  4AY6 A;  2MYO A;  3ABM E;  4DLQ A;  3ZEF A;  3TXN A;  4AEZ C;  1N52 A;  3B7R L;  4ZHB A;  1OWO A;  5AQB A;  3C72 A;  1TNO A;  1LD7 A;  5D2M C;  4LNU D;  4URK A;  4BTA A;  1DVP A;  2WXL A;  4CCA A;  2QC9 A;  4FJZ A;  3CVX A;  3R7Q A;  3W9F A;  4GML A;  3MKQ B;  3GZ2 A;  5D0Q D;  1DCE A;  3UIO C;  4G11 A;  4ANW A;  2XCB A;  4HB5 A;  3HDX A;  1N4Q A;  4GPK A;  3LY9 A;  3IHY A;  2GGF A;  2GRR B;  3MKQ A;  2J09 A;  5EIB E;  2CG2 A;  3U3W A;  4JD2 G;  4O1O A;  1HG2 A;  1Z5S C;  2JAB A;  2MHK A;  3DSW A;  4NAC A;  5BT1 A;  2YNQ A;  2AW6 A;  2J08 A;  5E76 A;  2CHW A;  4HLE A;  1GW6 A;  3MEK A;  2DBA A;  4TXR A;  4Y6W A;  2DVW A;  3UM1 A;  3MCX A;  3FUN A;  2R2L A;  2ZGD A;  5FIN A;  1OCZ E;  3MJW A;  2L6B A;  4L1B A;  1HS6 A;  3ZPJ A;  4WNE A;  4ILG A;  3CHR A;  4LNB A;  4NIK A;  3Q9U C;  1H2V C;  3ZVV A;  3RAU A;  1VDY A;  3FUJ A;  3CHQ A;  1OWL A;  3FTZ A;  3PS6 A;  4CT0 A;  3UPV A;  4U95 D;  3RRN B;  2X6I A;  4N5Q A;  4E85 A;  5C2Y A;  2KC7 A;  3SFX A;  4OAU C;  2AXV A;  3X2Q E;  2R59 A;  5A6C A;  3C3O A;  2DZO A;  2DYS E;  5J90 A;  4K0R A;  1IQU A;  3TL5 A;  4XEI G;  4MBG A;  4IUL A;  3PUJ A;  2WXH A;  5CMW A;  2KZT B;  2LAH A;  1E8W A;  2DWZ A;  4I43 A;  3C98 A;  5ARG A;  2IY0 C;  1D8E A;  5AYW D;  4CZ2 D;  3UM0 A;  1E90 A;  2GRO B;  4UUC A;  3APC A;  5BUZ A;  4I6E A;  4GYO A;  2CHZ A;  5AAR A;  3IBE A;  3G2U A;  4FLH A;  1YYH A;  1TN6 A;  3FU6 A;  1ELK A;  4KVM A;  4CDM A;  4ANU A;  3PRZ A;  2EIK E;  3TGO A;  3GYZ A;  2RKK A;  3QWW A;  4A55 A;  4OYS A;  5BV0 A;  2WQ6 A;  2WMO A;  1O5M A;  3V30 A;  1X5B A;  1MX2 A;  2CFU A;  1A5E A;  2P9I G;  3LEW A;  1ELW A;  1NP7 A;  4AY5 A;  4UI9 C;  4L2L A;  4DI3 A;  2RFA A;  3FU5 A;  3PZ3 A;  5ENP D;  2H6G A;  4PS3 A;  4LUN U;  3TWV A;  3RJV A;  3I4G A;  5CBN A;  4CGW A;  4C0E A;  4M7C A;  1OCO E;  3TWW A;  3O4Z A;  4G1T A;  4G8L A;  1N4R A;  2KAT A;  4BES A;  4DX2 A;  5ENS D;  3RO3 A;  2X6K A;  4J8F A;  5FZS A;  1BPO A;  4YVO A;  3ZU7 B;  1RW2 A;  4I1A A;  3CHO A;  5CCL A;  4BY6 A;  1H2U A;  4GMR A;  4AXH A;  3ZN3 A;  1ELR A;  1N54 A;  3FFL A;  3ZYL A;  2XRY A;  4JA9 A;  2XGM A;  2KCL A;  4XKC A;  1OCC E;  5BPP A;  3G2W A;  4I2Z A;  1DCQ A;  4G8K A;  3MV2 B;  3R9A B;  4YDW A;  2OND A;  4HNA D;  1MHQ A;  3PZ1 A;  4CGV A;  3CVU A;  4BT8 A;  2XEV A;  4PH4 B;  2XZD G;  2VGE A;  3FTS A;  2AVP A;  1N11 A;  1WDY A;  3LKU A;  3CR3 A;  3U64 A;  1FCH A;  2V5F A;  3B13 A;  2XGO A;  1NA0 A;  4HRN A;  3CLJ A;  5FQ4 A;  4UQZ A;  1MX4 A;  3LJ3 A;  1HG5 A;  3IEG A;  3F6Q A;  3MV3 B;  3DPY A;  2WB2 A;  2CHX A;  3G2T A;  2OCC E;  4TUM A;  3ZKJ A;  2ILR A;  2V5Q C;  4L9P A;  2X3M A;  5FZR A;  2DZN A;  5G04 C;  3QWV A;  1ZBP A;  5JA4 D;  4LCT A;  2HYZ A;  2Y4U A;  3U66 A;  3R9M A;  3EUV A;  3PZ2 A;  2OEV A;  4L23 A;  3B7T A;  3LCA A;  2CFZ A;  5AIJ A;  3AS8 A;  2XHE A;  3GZ1 A;  1S63 A;  2OVB A;  2B0O E;  3E4B A;  4HOS A;  3ISM C;  4WWO A;  5ENN A;  3CK8 A;  4XIF A;  3SBS A;  3LJN A;  4HOR A;  3V31 A;  4ILH B;  1QZ2 A;  4J8S A;  3AG3 E;  2OVF A;  4RLY A;  3VLF A;  3ZNG A;  1TN8 A;  5DIZ A;  5T4Y A;  1OY3 D;  3JQ0 A;  2AXU A;  4J8E A;  3D9J A;  4GA1 A;  4APF A;  3LVR E;  2A4Z A;  4WUY A;  2R05 A;  3ABK E;  3DSV A;  2JLB A;  5BNW A;  2QZA A;  2XQ0 A;  3B95 A;  4XX5 A;  3JCK C;  5JMN D;  3SQV A;  2GRQ B;  4TXP A;  3SBT B;  1Z3Y A;  3GW4 A;  2PL2 A;  3Q78 A;  3BEE A;  2BKK B;  3SFZ A;  3T8K A;  1BI8 B;  3CVP A;  1JUQ A;  2P9L G;  4UQY A;  3SGH A;  2VGY A;  3SF4 A;  2PQN A;  3D3M A;  2FI7 A;  5LCW C;  5ENR D;  3HXC A;  4L2Y A;  5KNH D;  1KT0 A;  1INZ A;  1IXV A;  1JCR A;  3AS4 A;  1QBQ A;  3S7D A;  4I17 A;  3J5Q B;  3ONK A;  4GTM A;  4B0Z A;  4N3B A;  4Q96 A;  2LAI A;  2NXP A;  1JCS A;  4CDR A;  2XZT G;  3EHQ A;  4I2W A;  3SZ7 A;  1OWN A;  1IHB A;  5G2N A;  4B93 B;  4N2Q A;  3E34 A;  4WWN A;  2KBX A;  3CHM A;  2I2O A;  5AEN A;  2XPZ A;  1SA5 A;  2YIN A;  3LYA A;  3N71 A;  4PS8 A;  2WMN A;  3DXK G;  1SZ9 A;  1EF1 C;  2WXI A;  2XPI A;  3MKR A;  2YQ8 A;  4YDY A;  3PZD A;  4P29 A;  3AG4 E;  1NZN A;  3RIB A;  2HO1 A;  2J8S D;  3RU0 A;  2Y69 E;  2LO6 A;  4UWH A;  4ME2 A;  3UT7 A;  4RG9 A;  5G04 J;  2KM4 A;  5JJ7 A;  1PAQ A;  5FZQ A;  1WY6 A;  3D9N A;  4YVQ C;  2WXG A;  4EQF A;  2H6H A;  3RRM B;  4G2V A;  4GZC A;  1KT1 A;  5CED B;  1FT1 A;  2UY1 B;  2A5U A;  4U04 A;  1E96 B;  5B3S E;  4BET A;  4UWL A;  3FP3 A;  3JXI A;  4DX5 D;  3EU5 A;  1OWP A;  1K1A A;  1PY1 A;  2QFC A;  3NOC D;  4HRL A;  3FHE A;  2UY1 A;  5ITZ F;  3Q79 A;  1H6P A;  4WWP A;  4HXI A;  3U4T A;  3LPZ A;  1MJ0 A;  5LOZ A;  3D9I A;  3L54 A;  1FPP A;  3W9G A;  2WXM A;  2V4L A;  5G05 C;  1N95 A;  2AXZ A;  3ZGQ A;  4DK5 A;  3LY8 A;  4J8Y A;  2ZXW E;  2WXF A;  4HQD A;  4AM9 A;  4U96 D;  3CEQ A;  1TEZ A;  1AP7 A;  3QC1 A;  3UIP C;  2QYU A;  4OVV A;  4LNG A;  3CHP A;  2PNN A;  3SNX A;  3ONL A;  1OXJ A;  1P5Q A;  4GZ6 A;  4KYO B;  2VJ8 A;  2XEH A;  5CEC B;  2GRP B;  4U0Z A;  3ASD A;  5JHA A;  3EHR A;  3APF A;  1QNF A;  4N2S A;  3L08 A;  3AG2 E;  4BT9 A;  2J4D A;  1N4S A;  3K9I A;  5ANR A;  3HHM A;  2IQC A;  2VSX E;  1U3C A;  2Y1L E;  2PM6 A;  3PH0 C;  4DJA A;  2IEJ A;  2RD0 A;  4Y6C A;  3TG4 A;  4HVB A;  5LCW J;  1SA4 A;  2GRN B;  4GA2 A;  2H6I A;  4FUL A;  4GTO A;  1ZB1 A;  3PNL B;  3TWR A;  1TNY A;  3Q7A A;  3G2V A;  1XGW A;  3TWQ A;  3AAA C;  5A7D B;  1MQS A;  3D9P A;  1JWF A;  1EDU A;  4K5A B;  3NZU A;  2LNI A;  4ILI A;  2P9S G;  2XRZ A;  1QQE A;  3TWU A;  2LXL A;  1TNU A;  2KZT A;  1WG0 A;  4GTR A;  5BV1 A;  4DRX E;  3QAQ A;  4NRH B;  3ZYK A;  2P2C P;  3LS8 A;  3RO2 A;  2L0T B;  3BQO A;  3CKB A;  2XPY A;  3ML9 A;  2MRI A;  5EID A;  4DX6 D;  3QOU A;  2PQR A;  5LX8 A;  4JEU A;  2WXJ A;  3FWV A;  1JCQ A;  2FBN A;  3ZRH A;  4UQX A;  3AG1 E;  1SW6 A;  4GCO A;  3ZFW A;  4DUI A;  1KZO A;  4KVO A;  3PRE A;  4WNF A;  2BTD A;  1KPS B;  3TG5 A;  1NL4 A;  4A3V A;  4JVS A;  3VTX A;  3PUK A;  3EU9 A;  3ASF A;  3E33 A;  5G55 A;  4UWK A;  4HRM B;  4G25 A;  5FIO A;  1U3D A;  1NFI E;  4GZD A;  1D9S A;  1WM5 A;  3RKV A;  3C5R A;  3PE3 A;  1UN8 A;  2FO7 A;  2KCK A;  3CVN A;  3D9K A;  4YND A;  3UT8 A;  3HVE B;  5D66 A;  4GAA A;  3HYM B;  3ESK A;  3OXL A;  2Y4T A;  3IV0 A;  4LG6 A;  5CCM A;  4N3C A;  1O1T A; 
#chains in the Genus database with same CATH homology
 2P9N G;  3DXK G;  1K8K G;  3UKU G;  1TYQ G;  1U2V G;  2P9S G;  3ULE G;  4JD2 G;  3DWL G;  3UKR G;  3DXM G;  2P9K G;  2P9U G;  3RSE G;  4XEI G;  2P9L G;  2P9P G;  2P9I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...