2P9LG

Crystal structure of bovine arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 41
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9lG00
3UKRG 2P9LG 3DXKG 2P9NG 3DXMG 4XEIG 2P9KG 2P9IG 1U2VG 2P9PG 2P9SG 3UKUG 3ULEG 3RSEG 2P9UG 3DWLG 1TYQG 4JD2G 1K8KG
chains in the Genus database with same CATH superfamily
2V4LA 4QFVA 4XEIG 4DI4A 3N71A 4B89A 4O1OA 4JZYA 1BI7B 4I2ZA 4IYPA 4NRHB 3CEQA 2XGOA 4I2WA 2P9LG 2WXFA 2GRQB 2OVBA 3ASOE 4KXKB 3UT4A 5FT9A 2XPIA 2BKKB 1TEZA 3ZPJA 5AIJA 5EX3A 2IEJA 3UM3A 4OYSA 1S64A 3QK0A 3FTYA 3U66A 3DEOA 2J08A 1K8KG 3SFYA 3MKQA 3IXEA 3C3QA 4B0ZA 3FTSA 3JUIA 4LCTA 3IHVA 4B94A 3ASDA 2WXPA 3U64A 4GU5A 2I1JA 3R7RA 2FO7A 3PVLA 4J8DA 3LS8A 3EDTB 2HM8A 5BNWA 2GGFA 3GZSA 3P2BA 2C0LA 3HXFA 1NA0A 2WXRA 4URKA 2WQ6A 2VSNA 3EHRA 3DSXA 2EILE 4N5QA 3UM1A 3J5PA 2X6IA 5HS0A 3DXMG 2LAHA 2LSUA 5FTPA 3R9AB 3GZ1A 2DWZA 3CVVA 3JCKC 5AQBA 2GROB 3V31A 5KJKA 5BV0A 3EHMA 3R7QA 4WUYA 3UXGA 2KBXA 2VJ8A 4GMJA 3L08A 4XI0A 3PEUB 3PNTB 4JB8P 1HS6A 5FZSA 4DLOA 3URZA 4R7LA 3EHNA 3LCAA 5G55A 3D9LA 3KSQA 3PUJA 3ZVVA 3FTZA 5DIZA 3CVLA 5KNHD 1UOHA 3EIQC 5IY5E 3I4GA 4G8LA 3DSTA 4UI9K 3AS5A 5G2NA 1EPUA 3AU4A 1SZAA 4Q94A 1ELRA 1QZ2A 3AG4E 2YINA 3Q75A 3C3RA 3ZRHA 2P9NG 2EIJE 3D9KA 2VSOE 1NP7A 4I1OB 5JMND 2CHXA 4UUCA 5EN5D 1INZA 1H2VC 4I17A 5J08A 5LP0A 3FUNA 2C0MA 1E90A 2Y1LE 3PRZA 3PDNA 3ZIMA 4CZ2D 3P1UA 3D9NA 4RVBA 2H6GA 4GA2A 5FWQA 3RRUA 3BG1B 2VGYA 4I9CA 4DX6D 4DLQA 4CEMA 3G2VA 3RSEG 3PZ1A 3ZYQA 3HRAA 3Q9NC 3TAXA 3EHQA 2YQ8A 2R03A 2EIKE 2QYUA 4A3VA 5LX8A 4YVQC 1OWLA 1WM5A 4XZ4A 3CK7A 3LYAA 2VTBB 2OCCE 4Q96A 5G04J 4A55A 4N3CA 3D9IA 4A3TA 5KJNA 5E75A 3D9HA 3NBNB 3SHFA 3UINC 2CHWA 3LPZA 4GYOA 3SI5A 5ENOD 2L6JA 4BT9A 2HE0A 4EZKA 1BI8B 2IF4A 2QZAA 3MCXA 1DVPA 2DYRE 4GTMA 1WG0A 5A6CA 3G2WA 3VLFA 2PM6A 4UWFA 3UM0A 4Y6WA 2GW1A 5LOZA 5EIDA 1E96B 4UWLA 3LY9A 2PQNA 1LD7A 3FDHA 4LEUA 2HYZA 2BEDA 4GPKA 4XKBA 4PS8A 4C0MA 2V4HC 2XS8A 3NOCD 4JXTA 1OWNA 3B7RL 3MX3A 5ENPD 4HLLA 2QC9A 3Q49B 3PZ2A 4N2QA 4EPZA 4AV7A 4LNBA 3EUVA 4GTQA 3L17A 3U4TA 1N54A 3IKOB 1BPOA 1MX2A 3SFZA 5HQ8A 3RO2A 4RG9A 2QYJA 4GTVA 5EDSA 2WVIA 1HXIA 1MHQA 5FQ6A 2HO1A 4HVBA 1IHGA 4HI8A 4MBGA 3FP3A 3OXFA 3L16A 1N95A 1RW2A 3WG7E 4BY6A 2DCPA 2DZNA 3E37A 5ENQD 4K03A 4G24A 4LRZA 5CRVA 3ASHA 3MA5A 4ANWA 1UN8A 2H6HA 2VGEA 2ETBA 4F6RD 3I5PA 2PZIA 3L13A 2CHZA 3O4ZA 2Y4TA 3ZW3A 3VLEA 4P29A 2R59A 4W9RA 3MGBA 4FULA 3DSUA 1MZCA 4WWNA 4MLPA 5AN8A 4FLHA 3DXKG 3Q73A 4HRNA 3VTYA 1W3BA 3CK9A 2P9IG 3B7BA 2DBAA 4O60A 3LJNA 1WY6A 3CHRA 1AWCB 1G3NB 4EQFA 4C0EA 5LCWC 3S7FA 3TG5A 1KZOA 4GCNA 5FZQA 5EIBE 1OCRE 3C98A 1U3DA 4B8AA 1QQEA 4TUMA 5CCMA 3CHPA 2JABA 3ZN3A 1JWGA 3CVPA 5CBNA 4E6HA 4V3IA 4WWPA 2E0IA 2A5EA 2WXIA 2NC9A 3E30A 4WWOA 2Y3AA 3D9OA 1QBQA 2VSYA 5LFAA 4L2YA 2IFUA 4JHKA 3CIAA 4L9PA 1Q2ZA 3HXBA 2BTDA 1S0PA 3F6QA 3HVEB 3WXXA 3Q7FA 2P9SG 1DCEA 2LSVA 2XCCA 2IONA 4DK5A 3ZEFA 4FP7A 5ENSD 2P9PG 4K5AB 4HOUA 3FU0A 4PS3A 4AJWA 1JWFA 2ZISA 1X5BA 3FFLA 3QARA 1S70B 4G26A 3KD7A 5CCLA 2OEVA 2XRYA 3FUKA 3CVXA 5BV1A 3ABKE 4N2SA 4GA1A 3RRNB 1EDUA 4NURA 3QKYA 4J8EA 4KT6B 2KZTB 3TG4A 4GTTA 2OOEA 1N4SA 4KMOA 2I9CA 5G05C 2F0YA 1YCSB 2QY7A 5CRUA 3ULEG 4BSXA 3Q15A 2BF0X 2WXHA 2DYSE 4HOQA 5B1BE 1SQMA 2AJAA 2IY0C 4XX5A 5FZRA 4CT0A 4GYYA 3KEAA 4N39A 1Z3XA 5AARA 3PUKA 4GTRA 1FCHA 3APDA 3FUDA 3TXNA 4APOA 3TWVA 4I6JA 1HO8A 4U07A 4KZCA 3SD5A 3CHMA 4H7YA 2R5SA 5AQ9A 4J0UA 3ZGQA 2VSXE 3T5XA 1U2VG 2LXMA 4GMLA 3AAAC 3UIOC 4OAUC 4TXPA 4WAFA 5KJLA 2F8XK 4EZLA 2MRIA 3HXCA 4JHRA 2FEZA 1FPPA 3B95A 3TXMA 3FU6A 4N5CA 3BQOA 1PC2A 3TWXA 2HR2A 3CQCB 2ZGDA 4XE0A 1ZB1A 4CYMD 4AM9A 4CCAA 2GRPB 3PREA 1O5MA 1H6OA 2ILRA 4EZJA 3DSVA 4WNFA 5EYLA 4PH4B 1N52A 4JEHA 4TRQA 4UQYA 3SBTB 5CHEE 5AENA 3CVUA 1TNYA 1H2TC 5JJTA 1HFAA 3VLDA 1BD8A 3ASFA 2R02A 3ENEA 2YNQA 2AXUA 3APFA 1TNBA 3JQ0A 4F3VA 5LCWJ 1UJJA 3CVWA 2L9BA 2C2LA 4FJZA 4HFGA 2KM4A 1PY1A 2YHCA 3MV2B 3NB2A 2XRZA 1YMPA 5HKPA 3IV0A 1PAQA 1TN8A 3FUFA 3L9TA 4YDYA 3PS6A 1H19A 2WMOA 4L7TA 4AXHA 3EJNA 3MJWA 4YVOA 4AOFA 4GMRA 3DPYA 5CERB 2AXVA 3UKUG 2DVWA 2AVPA 2AW6A 5BXOA 2WQHA 2M63A 3UMVA 3BEEA 3SGHA 1E8XA 1D9SA 2WM9A 3GW4A 1EYHA 3QAQA 4APFA 2XHEA 3ZKJA 5FQ4A 2R17C 1HZ4A 3SZ7A 3TWWA 1N4QA 5B3SE 1O1SA 1NI1A 2WQ7A 1K1BA 4TV3A 4K0RA 2WXOA 2VTBA 2ETAA 5D0QD 5EX0A 3LDZA 5ENRD 3FEXA 4ANXA 5KBAA 4J7WA 2CFUA 5H7PA 3UIPC 1OUVA 1DCQA 3DEPA 2P9UG 4H7XA 5CEAA 5ARFA 1IQUA 3Q5MA 2XEHA 1IQRA 4KVOA 4GYWA 5JJ7A 4YDWA 4LSZE 2V0PA 3KAEA 3T8MA 1O1TA 1V54E 3FTXA 3TWRA 4HOSA 5C1DA 1JPLA 2IOSA 2BKGA 4ZHBA 3D3MA 5CEDB 4BETA 1SA4A 3R9MA 3KSLA 5ANLA 3UX4A 2EQXA 2AXZA 1JCSA 4AY5A 4U8HA 1TNOA 5AJLA 1LTXA 1YYHA 1E8YA 1HG2A 3D9PA 3AG3E 4L2LA 1SW6A 4HB5A 3V2OA 5KWDA 4G11A 4UWKA 1H2UA 2V8SE 2L0IA 2PM7A 3CQGB 2FO1E 2IO2C 4U7EB 4Q69A 2OV8A 2WXGA 5ENNA 3MKQB 1IXVA 4I1MA 3ZHEA 2LO6A 3E32A 3OAWA 4MKTA 3ESKA 3DWLG 1ELKA 1KZPA 1JUQA 1MYOA 1VDYA 1UG3A 2J4DA 2FI7A 2BUGA 2H6FA 1BLXB 2GRNB 4BTAA 3L82A 1HU3A 3NOGD 4UQZA 4ZFHA 5KJMA 2XPYA 4DI3A 2X6HA 1FT1A 1TNUA 4AEZC 4AP2A 3FWVA 4BTBA 4GZDA 4U8VD 3ASGA 4DRXE 3PZ3A 4MRUA 3X2QE 1N0QA 3CSFA 2J09A 4GA0A 1H6KA 3CHQA 2EIME 3FU5A 3HG0D 1N94A 3DPDA 2QFCA 1ELWA 1OCCE 3V79K 2R2LA 3CVYA 2V5QC 1OWMA 3PE3A 4BT8A 3GZ2A 4TUUA 4F1PA 1KT1A 3UT7A 1N4RA 3ZNGA 3ZYLA 4GZCA 2P2CP 4WNDA 3QNKA 3ZHEB 3FUJA 2LXLA 4K5CA 1IKND 4LUNU 1TYQG 4CGWA 4TXQA 3DSSA 5JA4D 4G23A 3KEZA 4GTSA 4DPRA 5BPPA 4KBQA 1OT8A 4A63B 4CDRA 4F1SA 2RG8A 3ML9A 5AYWD 3TJPA 2ZXWE 3JUEA 4HBDA 3JQ1A 3LY7A 2ONDA 3FTWA 3RU0A 3CLJA 3LVRE 2PQRA 5FQ8A 3OTNA 3TWUA 5EYPF 4HI9A 2WXMA 3JXJA 4Z68A 2X6JA 3AS8A 4GZ5A 4CDMA 4GPMA 2JEKA 3QWPA 1XNFA 4I43A 4M3OA 3ZUVB 1K3ZD 4E85A 4FLBA 2RFAA 2LAIA 2ZIRA 4YDEA 1DC2A 5EKQD 3FUIA 4JHJA 2XZTG 4FHJA 3E33A 3C72A 3L54A 3IHYA 4I6GA 4CT4A 2OEWA 2X3MA 3LXUX 4ILHB 1TNZA 3PE4A 1TN6A 2PL2A 4QQIA 4NIKA 4ATGA 2KCKA 3CHSA 2IJGX 4B93B 4LNUD 3CVNA 3VTXA 3UUXA 3L22A 5D0OD 1N4PA 3FUMA 4M7CA 2KXPC 3HXEA 3FTUA 2I6HA 4JEUA 2VQ2A 3PNLB 5G05J 1FVHA 4BEPA 3CVQA 3ONKA 2KCLA 2JLBA 3UKRG 3Q78A 4HRMB 3QOUA 3MKRA 2FULA 3ABLE 1YA0A 5ANRA 3UPVA 1JCRA 4JVSA 3ISMC 2RD0A 3HIZA 3SO8A 1XGWA 2X6FA 4KYOB 1K1AA 4G1TA 2B0OE 1BU9A 4EECA 4U0SA 2Y69E 5A23A 2MYOA 4LNGA 4JPSA 1E8ZA 3UT8A 3E34A 5FQ7A 4DJAA 3ML8A 3ZYMA 2WXQA 2YHEA 2A4ZA 4C9BB 1OY3D 3ULQA 4U0UA 1E7UA 3I3NA 2XQ0A 3FEYA 4ANVA 1SVXA 1UJKA 4J6IA 4FU3A 4RQIA 3FY4A 4L1BA 3D9MA 5E76A 5B1AE 5KNGA 3TWSA 3I4RB 2NYJA 3U9WA 4AY6A 4GAAA 1Y6IA 2J8SD 3BG0B 4KVMA 3CSTA 2XPZA 1LF8A 2IOLA 4NQ0A 5AQAA 1KLXA 5ITZF 3HHMA 5HRYA 4BX9A 3RRMB 2KZTA 3SBSA 4N3BA 1Z6TA 4EHMA 2CFZA 3LY8A 3B7TA 3G2TA 4KZ0A 3EU9A 3FH5A 5BUZA 4C48B 3MV3B 4B8CB 4BSZB 4I6EA 2RKKA 3UTMA 2WB2A 3LVQE 1E7VA 1IHBA 3ZYKA 3S7DA 2B6CA 2XS1A 3V2XA 5CMYA 4OAVB 3Q79A 3RKVA 4RSYA 5CECB 5T4YA 5BT1A 3S7JA 3RO3A 1UN9A 4JA9A 1SA5A 3RIBA 1SZ9A 4OVUA 3FUHA 3APCA 4HOTA 3CGHA 5BXUA 1V55E 4YNDA 2NSZA 3LJ3A 3AG1E 4OVVA 4K5BA 3K9IA 2WXKA 3JYSA 4ME2A 3NZSA 4J8FA 1HF8A 1NA3A 2J07A 5AJDA 3TGOA 2LUHA 1X81A 3PZDA 3ULYA 4JC8A 4U8YD 3IEGA 4FADA 1OXJA 4IULA 3QWVA 3HYMB 4HS2A 2OVFA 3W9FA 2FF4A 1FVFA 3G2UA 1NZNA 4DX5D 3U3WA 4NACA 4UI9J 4IRUA 4F53A 1OWOA 4JA7A 3RAUA 1OCZE 2WXNA 3NF1A 3W9GA 5JHAA 3Q4AB 2F8YA 4RLYA 3Q7AA 2KCVA 5M72A 3FH8A 2R05A 1OWPA 1TJFA 3LEWA 2L6BA 3CR3A 4ILIA 3NZUA 2CG3A 4O6FA 3KS2A 2XZDG 4UQXA 3B7UX 3Q47B 1Z5SC 3S2AA 4Y6CA 3HDXA 4ILGA 1LD8A 2CG2A 1QYMA 3JXIA 4ACKA 5G04C 5JHBA 1TN7A 1QNFA 2AWIA 3SNXA 4XI9A 3LKUA 1HE8A 3HVEA 2XGMA 5AAOA 5KCMA 4HXIA 2J9QA 4ATZD 4HNAD 2E2EA 1MX6A 2DZOA 5CMWA 4N3AA 3IBEA 4U0ZA 4RG6A 2MHKA 1AP7A 2GRMA 3CKBA 4A1GA 3AJIA 3V30A 2LNIA 4BWRA 2WMNA 4G25A 1KPSB 3QWWA 3AG2E 5D2MC 4DX2A 5ARGA 2XGSA 4BESA 3AS4A 3S7BA 3AU5A 3FHEA 4O1PA 4JD2G 3NQPA 3RJVA 2WXJA 1IYGA 3MEKA 4GB9A 2I1KA 4YDOA 2MOWA 2X6KA 1GW6A 4AIFA 3ABME 4LERA 1ZBPA 5HI7A 1N9AA 5BW8C 3ONLA 4J8SA 3CHOA 4U04A 1FT2A 5FIOA 2FBNA 2H6IA 1WAO1 2PNNA 4D10C 4MS6A 1NL4A 5FJYA 5JJ6A 3QB2A 4DX7D 1D8DA 4AVXA 3ASNE 5AQ7A 3BU8A 4IN3B 3T5VA 2EINE 4HLEA 4DX1A 1ZU2A 3ZXSA 1MJ0A 1KT0A 1S63A 1TJCA 3QC1A 3T8KA 3SF4A 4LG6A 4PS7A 4F7AA 3E4BA 3BUAA 1JCQA 3FU3A 4UWGA 4FC8A 3T9KA 3PZ4A 3ESLA 5A7DB 1MX4A 2X38A 4GZ6A 3RK6A 3UM2A 1H6PA 2DIWA 4EBAG 2KATA 2VGXA 1E8WA 2XEVA 3DSWA 4U96D 1OCOE 2IU1A 4FA6A 3TL5A 2P58C 3PEVB 4XKCA 1Y8MA 4WNEA 2GRLA 5DBKA 3DBSA 1U3CA 5J90A 4HQDA 5T8IA 5T3RA 4CRWA 1HH8A 2WXLA 2V5FA 1L5JA 1N0RA 4I1AA 4TXRA 2RFMA 3EIJA 1NFIE 2I2OA 4J8YA 1O1RA 3OXLA 3EU5A 3MYVA 3C3OA 3Q9UC 2F37A 3ZU7B 3FULA 4G8KA 2UY1A 3ZFWA 4X8QA 4WNGA 3D9JA 2ZGGA 3CV0A 5ENTD 5C2YA 3SQVA 3SFXA 4BERA 1B89A 2WPVA 4GZ3A 2UWJG 1HG5A 3HXDA 3O48A 3PH0C 4PUCA 5EILA 1DNPA 4U95D 4FJYA 3B7SA 2ZU6B 4G2VA 2XENA 2IQCA 3NAWA 3CKCA 1D8EA 4I9EA 4PDXA 2KC7A 1Z3YA 3TWQA 3SY2A 4GTPA 4EBAA 3FH7A 2J49A 3ZXPA 4BX8A 4ABNA 4CDNA 5CBOA 2L0TB 4UI9C 4JW1A 3C5RA 3OXGA 4UWHA 3GYZA 4HRLA 1RZ4A 5D66A 2P9KG 2UY1B 2VYIA 4XIFA 2Y0BG 3UI2A 2IO3C 3UQ3A 4GTOA 1WDYA 2XEEA 4FHKA 1TR4A 4HORA 3L6AA 3J5QB 4DUIA 2XCBA 3TWTA 2Q7FA 3FTVA 2ETCA 1P5QA 4ANUA 4BFRA 3QDNA 2J4BA 1HX8A 4U63A 1MQSA 3DRAA 4CGVA 2GRRB 4L23A 1A17A 3B13A 2A5UA 1UW4B 1EF1C 3QJZA 4A1SA 4ACLA 1N11A 4GCOA 3G2SA 2VGXB 2Y4UA 3MZLB 3FUEA 1A5EA 4JL0A 2NXPA 5FINA 3CK8A 1H0AA
chains in the Genus database with same CATH topology
3UKRG 2P9LG 3DXKG 2P9NG 3DXMG 4XEIG 2P9KG 2P9IG 1U2VG 2P9PG 2P9SG 3UKUG 3ULEG 3RSEG 2P9UG 3DWLG 1TYQG 4JD2G 1K8KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKR G;  2P9L G;  3DXK G;  2P9N G;  3DXM G;  4XEI G;  2P9K G;  2P9I G;  1U2V G;  2P9P G;  2P9S G;  3UKU G;  3ULE G;  3RSE G;  2P9U G;  3DWL G;  1TYQ G;  4JD2 G;  1K8K G; 
#chains in the Genus database with same CATH topology
 2V4L A;  4QFV A;  4XEI G;  4DI4 A;  3N71 A;  4B89 A;  4O1O A;  4JZY A;  1BI7 B;  4I2Z A;  4IYP A;  4NRH B;  3CEQ A;  2XGO A;  4I2W A;  2P9L G;  2WXF A;  2GRQ B;  2OVB A;  3ASO E;  4KXK B;  3UT4 A;  5FT9 A;  2XPI A;  2BKK B;  1TEZ A;  3ZPJ A;  5AIJ A;  5EX3 A;  2IEJ A;  3UM3 A;  4OYS A;  1S64 A;  3QK0 A;  3FTY A;  3U66 A;  3DEO A;  2J08 A;  1K8K G;  3SFY A;  3MKQ A;  3IXE A;  3C3Q A;  4B0Z A;  3FTS A;  3JUI A;  4LCT A;  3IHV A;  4B94 A;  3ASD A;  2WXP A;  3U64 A;  4GU5 A;  2I1J A;  3R7R A;  2FO7 A;  3PVL A;  4J8D A;  3LS8 A;  3EDT B;  2HM8 A;  5BNW A;  2GGF A;  3GZS A;  3P2B A;  2C0L A;  3HXF A;  1NA0 A;  2WXR A;  4URK A;  2WQ6 A;  2VSN A;  3EHR A;  3DSX A;  2EIL E;  4N5Q A;  3UM1 A;  3J5P A;  2X6I A;  5HS0 A;  3DXM G;  2LAH A;  2LSU A;  5FTP A;  3R9A B;  3GZ1 A;  2DWZ A;  3CVV A;  3JCK C;  5AQB A;  2GRO B;  3V31 A;  5KJK A;  5BV0 A;  3EHM A;  3R7Q A;  4WUY A;  3UXG A;  2KBX A;  2VJ8 A;  4GMJ A;  3L08 A;  4XI0 A;  3PEU B;  3PNT B;  4JB8 P;  1HS6 A;  5FZS A;  4DLO A;  3URZ A;  4R7L A;  3EHN A;  3LCA A;  5G55 A;  3D9L A;  3KSQ A;  3PUJ A;  3ZVV A;  3FTZ A;  5DIZ A;  3CVL A;  5KNH D;  1UOH A;  3EIQ C;  5IY5 E;  3I4G A;  4G8L A;  3DST A;  4UI9 K;  3AS5 A;  5G2N A;  1EPU A;  3AU4 A;  1SZA A;  4Q94 A;  1ELR A;  1QZ2 A;  3AG4 E;  2YIN A;  3Q75 A;  3C3R A;  3ZRH A;  2P9N G;  2EIJ E;  3D9K A;  2VSO E;  1NP7 A;  4I1O B;  5JMN D;  2CHX A;  4UUC A;  5EN5 D;  1INZ A;  1H2V C;  4I17 A;  5J08 A;  5LP0 A;  3FUN A;  2C0M A;  1E90 A;  2Y1L E;  3PRZ A;  3PDN A;  3ZIM A;  4CZ2 D;  3P1U A;  3D9N A;  4RVB A;  2H6G A;  4GA2 A;  5FWQ A;  3RRU A;  3BG1 B;  2VGY A;  4I9C A;  4DX6 D;  4DLQ A;  4CEM A;  3G2V A;  3RSE G;  3PZ1 A;  3ZYQ A;  3HRA A;  3Q9N C;  3TAX A;  3EHQ A;  2YQ8 A;  2R03 A;  2EIK E;  2QYU A;  4A3V A;  5LX8 A;  4YVQ C;  1OWL A;  1WM5 A;  4XZ4 A;  3CK7 A;  3LYA A;  2VTB B;  2OCC E;  4Q96 A;  5G04 J;  4A55 A;  4N3C A;  3D9I A;  4A3T A;  5KJN A;  5E75 A;  3D9H A;  3NBN B;  3SHF A;  3UIN C;  2CHW A;  3LPZ A;  4GYO A;  3SI5 A;  5ENO D;  2L6J A;  4BT9 A;  2HE0 A;  4EZK A;  1BI8 B;  2IF4 A;  2QZA A;  3MCX A;  1DVP A;  2DYR E;  4GTM A;  1WG0 A;  5A6C A;  3G2W A;  3VLF A;  2PM6 A;  4UWF A;  3UM0 A;  4Y6W A;  2GW1 A;  5LOZ A;  5EID A;  1E96 B;  4UWL A;  3LY9 A;  2PQN A;  1LD7 A;  3FDH A;  4LEU A;  2HYZ A;  2BED A;  4GPK A;  4XKB A;  4PS8 A;  4C0M A;  2V4H C;  2XS8 A;  3NOC D;  4JXT A;  1OWN A;  3B7R L;  3MX3 A;  5ENP D;  4HLL A;  2QC9 A;  3Q49 B;  3PZ2 A;  4N2Q A;  4EPZ A;  4AV7 A;  4LNB A;  3EUV A;  4GTQ A;  3L17 A;  3U4T A;  1N54 A;  3IKO B;  1BPO A;  1MX2 A;  3SFZ A;  5HQ8 A;  3RO2 A;  4RG9 A;  2QYJ A;  4GTV A;  5EDS A;  2WVI A;  1HXI A;  1MHQ A;  5FQ6 A;  2HO1 A;  4HVB A;  1IHG A;  4HI8 A;  4MBG A;  3FP3 A;  3OXF A;  3L16 A;  1N95 A;  1RW2 A;  3WG7 E;  4BY6 A;  2DCP A;  2DZN A;  3E37 A;  5ENQ D;  4K03 A;  4G24 A;  4LRZ A;  5CRV A;  3ASH A;  3MA5 A;  4ANW A;  1UN8 A;  2H6H A;  2VGE A;  2ETB A;  4F6R D;  3I5P A;  2PZI A;  3L13 A;  2CHZ A;  3O4Z A;  2Y4T A;  3ZW3 A;  3VLE A;  4P29 A;  2R59 A;  4W9R A;  3MGB A;  4FUL A;  3DSU A;  1MZC A;  4WWN A;  4MLP A;  5AN8 A;  4FLH A;  3DXK G;  3Q73 A;  4HRN A;  3VTY A;  1W3B A;  3CK9 A;  2P9I G;  3B7B A;  2DBA A;  4O60 A;  3LJN A;  1WY6 A;  3CHR A;  1AWC B;  1G3N B;  4EQF A;  4C0E A;  5LCW C;  3S7F A;  3TG5 A;  1KZO A;  4GCN A;  5FZQ A;  5EIB E;  1OCR E;  3C98 A;  1U3D A;  4B8A A;  1QQE A;  4TUM A;  5CCM A;  3CHP A;  2JAB A;  3ZN3 A;  1JWG A;  3CVP A;  5CBN A;  4E6H A;  4V3I A;  4WWP A;  2E0I A;  2A5E A;  2WXI A;  2NC9 A;  3E30 A;  4WWO A;  2Y3A A;  3D9O A;  1QBQ A;  2VSY A;  5LFA A;  4L2Y A;  2IFU A;  4JHK A;  3CIA A;  4L9P A;  1Q2Z A;  3HXB A;  2BTD A;  1S0P A;  3F6Q A;  3HVE B;  3WXX A;  3Q7F A;  2P9S G;  1DCE A;  2LSV A;  2XCC A;  2ION A;  4DK5 A;  3ZEF A;  4FP7 A;  5ENS D;  2P9P G;  4K5A B;  4HOU A;  3FU0 A;  4PS3 A;  4AJW A;  1JWF A;  2ZIS A;  1X5B A;  3FFL A;  3QAR A;  1S70 B;  4G26 A;  3KD7 A;  5CCL A;  2OEV A;  2XRY A;  3FUK A;  3CVX A;  5BV1 A;  3ABK E;  4N2S A;  4GA1 A;  3RRN B;  1EDU A;  4NUR A;  3QKY A;  4J8E A;  4KT6 B;  2KZT B;  3TG4 A;  4GTT A;  2OOE A;  1N4S A;  4KMO A;  2I9C A;  5G05 C;  2F0Y A;  1YCS B;  2QY7 A;  5CRU A;  3ULE G;  4BSX A;  3Q15 A;  2BF0 X;  2WXH A;  2DYS E;  4HOQ A;  5B1B E;  1SQM A;  2AJA A;  2IY0 C;  4XX5 A;  5FZR A;  4CT0 A;  4GYY A;  3KEA A;  4N39 A;  1Z3X A;  5AAR A;  3PUK A;  4GTR A;  1FCH A;  3APD A;  3FUD A;  3TXN A;  4APO A;  3TWV A;  4I6J A;  1HO8 A;  4U07 A;  4KZC A;  3SD5 A;  3CHM A;  4H7Y A;  2R5S A;  5AQ9 A;  4J0U A;  3ZGQ A;  2VSX E;  3T5X A;  1U2V G;  2LXM A;  4GML A;  3AAA C;  3UIO C;  4OAU C;  4TXP A;  4WAF A;  5KJL A;  2F8X K;  4EZL A;  2MRI A;  3HXC A;  4JHR A;  2FEZ A;  1FPP A;  3B95 A;  3TXM A;  3FU6 A;  4N5C A;  3BQO A;  1PC2 A;  3TWX A;  2HR2 A;  3CQC B;  2ZGD A;  4XE0 A;  1ZB1 A;  4CYM D;  4AM9 A;  4CCA A;  2GRP B;  3PRE A;  1O5M A;  1H6O A;  2ILR A;  4EZJ A;  3DSV A;  4WNF A;  5EYL A;  4PH4 B;  1N52 A;  4JEH A;  4TRQ A;  4UQY A;  3SBT B;  5CHE E;  5AEN A;  3CVU A;  1TNY A;  1H2T C;  5JJT A;  1HFA A;  3VLD A;  1BD8 A;  3ASF A;  2R02 A;  3ENE A;  2YNQ A;  2AXU A;  3APF A;  1TNB A;  3JQ0 A;  4F3V A;  5LCW J;  1UJJ A;  3CVW A;  2L9B A;  2C2L A;  4FJZ A;  4HFG A;  2KM4 A;  1PY1 A;  2YHC A;  3MV2 B;  3NB2 A;  2XRZ A;  1YMP A;  5HKP A;  3IV0 A;  1PAQ A;  1TN8 A;  3FUF A;  3L9T A;  4YDY A;  3PS6 A;  1H19 A;  2WMO A;  4L7T A;  4AXH A;  3EJN A;  3MJW A;  4YVO A;  4AOF A;  4GMR A;  3DPY A;  5CER B;  2AXV A;  3UKU G;  2DVW A;  2AVP A;  2AW6 A;  5BXO A;  2WQH A;  2M63 A;  3UMV A;  3BEE A;  3SGH A;  1E8X A;  1D9S A;  2WM9 A;  3GW4 A;  1EYH A;  3QAQ A;  4APF A;  2XHE A;  3ZKJ A;  5FQ4 A;  2R17 C;  1HZ4 A;  3SZ7 A;  3TWW A;  1N4Q A;  5B3S E;  1O1S A;  1NI1 A;  2WQ7 A;  1K1B A;  4TV3 A;  4K0R A;  2WXO A;  2VTB A;  2ETA A;  5D0Q D;  5EX0 A;  3LDZ A;  5ENR D;  3FEX A;  4ANX A;  5KBA A;  4J7W A;  2CFU A;  5H7P A;  3UIP C;  1OUV A;  1DCQ A;  3DEP A;  2P9U G;  4H7X A;  5CEA A;  5ARF A;  1IQU A;  3Q5M A;  2XEH A;  1IQR A;  4KVO A;  4GYW A;  5JJ7 A;  4YDW A;  4LSZ E;  2V0P A;  3KAE A;  3T8M A;  1O1T A;  1V54 E;  3FTX A;  3TWR A;  4HOS A;  5C1D A;  1JPL A;  2IOS A;  2BKG A;  4ZHB A;  3D3M A;  5CED B;  4BET A;  1SA4 A;  3R9M A;  3KSL A;  5ANL A;  3UX4 A;  2EQX A;  2AXZ A;  1JCS A;  4AY5 A;  4U8H A;  1TNO A;  5AJL A;  1LTX A;  1YYH A;  1E8Y A;  1HG2 A;  3D9P A;  3AG3 E;  4L2L A;  1SW6 A;  4HB5 A;  3V2O A;  5KWD A;  4G11 A;  4UWK A;  1H2U A;  2V8S E;  2L0I A;  2PM7 A;  3CQG B;  2FO1 E;  2IO2 C;  4U7E B;  4Q69 A;  2OV8 A;  2WXG A;  5ENN A;  3MKQ B;  1IXV A;  4I1M A;  3ZHE A;  2LO6 A;  3E32 A;  3OAW A;  4MKT A;  3ESK A;  3DWL G;  1ELK A;  1KZP A;  1JUQ A;  1MYO A;  1VDY A;  1UG3 A;  2J4D A;  2FI7 A;  2BUG A;  2H6F A;  1BLX B;  2GRN B;  4BTA A;  3L82 A;  1HU3 A;  3NOG D;  4UQZ A;  4ZFH A;  5KJM A;  2XPY A;  4DI3 A;  2X6H A;  1FT1 A;  1TNU A;  4AEZ C;  4AP2 A;  3FWV A;  4BTB A;  4GZD A;  4U8V D;  3ASG A;  4DRX E;  3PZ3 A;  4MRU A;  3X2Q E;  1N0Q A;  3CSF A;  2J09 A;  4GA0 A;  1H6K A;  3CHQ A;  2EIM E;  3FU5 A;  3HG0 D;  1N94 A;  3DPD A;  2QFC A;  1ELW A;  1OCC E;  3V79 K;  2R2L A;  3CVY A;  2V5Q C;  1OWM A;  3PE3 A;  4BT8 A;  3GZ2 A;  4TUU A;  4F1P A;  1KT1 A;  3UT7 A;  1N4R A;  3ZNG A;  3ZYL A;  4GZC A;  2P2C P;  4WND A;  3QNK A;  3ZHE B;  3FUJ A;  2LXL A;  4K5C A;  1IKN D;  4LUN U;  1TYQ G;  4CGW A;  4TXQ A;  3DSS A;  5JA4 D;  4G23 A;  3KEZ A;  4GTS A;  4DPR A;  5BPP A;  4KBQ A;  1OT8 A;  4A63 B;  4CDR A;  4F1S A;  2RG8 A;  3ML9 A;  5AYW D;  3TJP A;  2ZXW E;  3JUE A;  4HBD A;  3JQ1 A;  3LY7 A;  2OND A;  3FTW A;  3RU0 A;  3CLJ A;  3LVR E;  2PQR A;  5FQ8 A;  3OTN A;  3TWU A;  5EYP F;  4HI9 A;  2WXM A;  3JXJ A;  4Z68 A;  2X6J A;  3AS8 A;  4GZ5 A;  4CDM A;  4GPM A;  2JEK A;  3QWP A;  1XNF A;  4I43 A;  4M3O A;  3ZUV B;  1K3Z D;  4E85 A;  4FLB A;  2RFA A;  2LAI A;  2ZIR A;  4YDE A;  1DC2 A;  5EKQ D;  3FUI A;  4JHJ A;  2XZT G;  4FHJ A;  3E33 A;  3C72 A;  3L54 A;  3IHY A;  4I6G A;  4CT4 A;  2OEW A;  2X3M A;  3LXU X;  4ILH B;  1TNZ A;  3PE4 A;  1TN6 A;  2PL2 A;  4QQI A;  4NIK A;  4ATG A;  2KCK A;  3CHS A;  2IJG X;  4B93 B;  4LNU D;  3CVN A;  3VTX A;  3UUX A;  3L22 A;  5D0O D;  1N4P A;  3FUM A;  4M7C A;  2KXP C;  3HXE A;  3FTU A;  2I6H A;  4JEU A;  2VQ2 A;  3PNL B;  5G05 J;  1FVH A;  4BEP A;  3CVQ A;  3ONK A;  2KCL A;  2JLB A;  3UKR G;  3Q78 A;  4HRM B;  3QOU A;  3MKR A;  2FUL A;  3ABL E;  1YA0 A;  5ANR A;  3UPV A;  1JCR A;  4JVS A;  3ISM C;  2RD0 A;  3HIZ A;  3SO8 A;  1XGW A;  2X6F A;  4KYO B;  1K1A A;  4G1T A;  2B0O E;  1BU9 A;  4EEC A;  4U0S A;  2Y69 E;  5A23 A;  2MYO A;  4LNG A;  4JPS A;  1E8Z A;  3UT8 A;  3E34 A;  5FQ7 A;  4DJA A;  3ML8 A;  3ZYM A;  2WXQ A;  2YHE A;  2A4Z A;  4C9B B;  1OY3 D;  3ULQ A;  4U0U A;  1E7U A;  3I3N A;  2XQ0 A;  3FEY A;  4ANV A;  1SVX A;  1UJK A;  4J6I A;  4FU3 A;  4RQI A;  3FY4 A;  4L1B A;  3D9M A;  5E76 A;  5B1A E;  5KNG A;  3TWS A;  3I4R B;  2NYJ A;  3U9W A;  4AY6 A;  4GAA A;  1Y6I A;  2J8S D;  3BG0 B;  4KVM A;  3CST A;  2XPZ A;  1LF8 A;  2IOL A;  4NQ0 A;  5AQA A;  1KLX A;  5ITZ F;  3HHM A;  5HRY A;  4BX9 A;  3RRM B;  2KZT A;  3SBS A;  4N3B A;  1Z6T A;  4EHM A;  2CFZ A;  3LY8 A;  3B7T A;  3G2T A;  4KZ0 A;  3EU9 A;  3FH5 A;  5BUZ A;  4C48 B;  3MV3 B;  4B8C B;  4BSZ B;  4I6E A;  2RKK A;  3UTM A;  2WB2 A;  3LVQ E;  1E7V A;  1IHB A;  3ZYK A;  3S7D A;  2B6C A;  2XS1 A;  3V2X A;  5CMY A;  4OAV B;  3Q79 A;  3RKV A;  4RSY A;  5CEC B;  5T4Y A;  5BT1 A;  3S7J A;  3RO3 A;  1UN9 A;  4JA9 A;  1SA5 A;  3RIB A;  1SZ9 A;  4OVU A;  3FUH A;  3APC A;  4HOT A;  3CGH A;  5BXU A;  1V55 E;  4YND A;  2NSZ A;  3LJ3 A;  3AG1 E;  4OVV A;  4K5B A;  3K9I A;  2WXK A;  3JYS A;  4ME2 A;  3NZS A;  4J8F A;  1HF8 A;  1NA3 A;  2J07 A;  5AJD A;  3TGO A;  2LUH A;  1X81 A;  3PZD A;  3ULY A;  4JC8 A;  4U8Y D;  3IEG A;  4FAD A;  1OXJ A;  4IUL A;  3QWV A;  3HYM B;  4HS2 A;  2OVF A;  3W9F A;  2FF4 A;  1FVF A;  3G2U A;  1NZN A;  4DX5 D;  3U3W A;  4NAC A;  4UI9 J;  4IRU A;  4F53 A;  1OWO A;  4JA7 A;  3RAU A;  1OCZ E;  2WXN A;  3NF1 A;  3W9G A;  5JHA A;  3Q4A B;  2F8Y A;  4RLY A;  3Q7A A;  2KCV A;  5M72 A;  3FH8 A;  2R05 A;  1OWP A;  1TJF A;  3LEW A;  2L6B A;  3CR3 A;  4ILI A;  3NZU A;  2CG3 A;  4O6F A;  3KS2 A;  2XZD G;  4UQX A;  3B7U X;  3Q47 B;  1Z5S C;  3S2A A;  4Y6C A;  3HDX A;  4ILG A;  1LD8 A;  2CG2 A;  1QYM A;  3JXI A;  4ACK A;  5G04 C;  5JHB A;  1TN7 A;  1QNF A;  2AWI A;  3SNX A;  4XI9 A;  3LKU A;  1HE8 A;  3HVE A;  2XGM A;  5AAO A;  5KCM A;  4HXI A;  2J9Q A;  4ATZ D;  4HNA D;  2E2E A;  1MX6 A;  2DZO A;  5CMW A;  4N3A A;  3IBE A;  4U0Z A;  4RG6 A;  2MHK A;  1AP7 A;  2GRM A;  3CKB A;  4A1G A;  3AJI A;  3V30 A;  2LNI A;  4BWR A;  2WMN A;  4G25 A;  1KPS B;  3QWW A;  3AG2 E;  5D2M C;  4DX2 A;  5ARG A;  2XGS A;  4BES A;  3AS4 A;  3S7B A;  3AU5 A;  3FHE A;  4O1P A;  4JD2 G;  3NQP A;  3RJV A;  2WXJ A;  1IYG A;  3MEK A;  4GB9 A;  2I1K A;  4YDO A;  2MOW A;  2X6K A;  1GW6 A;  4AIF A;  3ABM E;  4LER A;  1ZBP A;  5HI7 A;  1N9A A;  5BW8 C;  3ONL A;  4J8S A;  3CHO A;  4U04 A;  1FT2 A;  5FIO A;  2FBN A;  2H6I A;  1WAO 1;  2PNN A;  4D10 C;  4MS6 A;  1NL4 A;  5FJY A;  5JJ6 A;  3QB2 A;  4DX7 D;  1D8D A;  4AVX A;  3ASN E;  5AQ7 A;  3BU8 A;  4IN3 B;  3T5V A;  2EIN E;  4HLE A;  4DX1 A;  1ZU2 A;  3ZXS A;  1MJ0 A;  1KT0 A;  1S63 A;  1TJC A;  3QC1 A;  3T8K A;  3SF4 A;  4LG6 A;  4PS7 A;  4F7A A;  3E4B A;  3BUA A;  1JCQ A;  3FU3 A;  4UWG A;  4FC8 A;  3T9K A;  3PZ4 A;  3ESL A;  5A7D B;  1MX4 A;  2X38 A;  4GZ6 A;  3RK6 A;  3UM2 A;  1H6P A;  2DIW A;  4EBA G;  2KAT A;  2VGX A;  1E8W A;  2XEV A;  3DSW A;  4U96 D;  1OCO E;  2IU1 A;  4FA6 A;  3TL5 A;  2P58 C;  3PEV B;  4XKC A;  1Y8M A;  4WNE A;  2GRL A;  5DBK A;  3DBS A;  1U3C A;  5J90 A;  4HQD A;  5T8I A;  5T3R A;  4CRW A;  1HH8 A;  2WXL A;  2V5F A;  1L5J A;  1N0R A;  4I1A A;  4TXR A;  2RFM A;  3EIJ A;  1NFI E;  2I2O A;  4J8Y A;  1O1R A;  3OXL A;  3EU5 A;  3MYV A;  3C3O A;  3Q9U C;  2F37 A;  3ZU7 B;  3FUL A;  4G8K A;  2UY1 A;  3ZFW A;  4X8Q A;  4WNG A;  3D9J A;  2ZGG A;  3CV0 A;  5ENT D;  5C2Y A;  3SQV A;  3SFX A;  4BER A;  1B89 A;  2WPV A;  4GZ3 A;  2UWJ G;  1HG5 A;  3HXD A;  3O48 A;  3PH0 C;  4PUC A;  5EIL A;  1DNP A;  4U95 D;  4FJY A;  3B7S A;  2ZU6 B;  4G2V A;  2XEN A;  2IQC A;  3NAW A;  3CKC A;  1D8E A;  4I9E A;  4PDX A;  2KC7 A;  1Z3Y A;  3TWQ A;  3SY2 A;  4GTP A;  4EBA A;  3FH7 A;  2J49 A;  3ZXP A;  4BX8 A;  4ABN A;  4CDN A;  5CBO A;  2L0T B;  4UI9 C;  4JW1 A;  3C5R A;  3OXG A;  4UWH A;  3GYZ A;  4HRL A;  1RZ4 A;  5D66 A;  2P9K G;  2UY1 B;  2VYI A;  4XIF A;  2Y0B G;  3UI2 A;  2IO3 C;  3UQ3 A;  4GTO A;  1WDY A;  2XEE A;  4FHK A;  1TR4 A;  4HOR A;  3L6A A;  3J5Q B;  4DUI A;  2XCB A;  3TWT A;  2Q7F A;  3FTV A;  2ETC A;  1P5Q A;  4ANU A;  4BFR A;  3QDN A;  2J4B A;  1HX8 A;  4U63 A;  1MQS A;  3DRA A;  4CGV A;  2GRR B;  4L23 A;  1A17 A;  3B13 A;  2A5U A;  1UW4 B;  1EF1 C;  3QJZ A;  4A1S A;  4ACL A;  1N11 A;  4GCO A;  3G2S A;  2VGX B;  2Y4U A;  3MZL B;  3FUE A;  1A5E A;  4JL0 A;  2NXP A;  5FIN A;  3CK8 A;  1H0A A; 
#chains in the Genus database with same CATH homology
 3UKR G;  2P9L G;  3DXK G;  2P9N G;  3DXM G;  4XEI G;  2P9K G;  2P9I G;  1U2V G;  2P9P G;  2P9S G;  3UKU G;  3ULE G;  3RSE G;  2P9U G;  3DWL G;  1TYQ G;  4JD2 G;  1K8K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...