2P9LG

Crystal structure of bovine arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 41
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9lG00
3DXMG 2P9UG 3RSEG 2P9PG 3DXKG 1TYQG 1U2VG 3UKUG 2P9KG 4XEIG 2P9SG 3DWLG 1K8KG 2P9NG 2P9IG 4JD2G 3UKRG 3ULEG 2P9LG
chains in the Genus database with same CATH superfamily
4KBQA 1JCQA 4Y6CA 4G11A 3UM2A 3ABME 3FP3A 1BI7B 2F8XK 4JXTA 3FEXA 2CFUA 3LCAA 4NIKA 5JJTA 4O6FA 1JCRA 4G1TA 2DCPA 3MX3A 3MZLB 5CECB 2R5SA 4U96D 1EF1C 3X2QE 4OYSA 3UM3A 3UT4A 4IULA 3MKQB 3C72A 4N3CA 4ATGA 4OAUC 3ZPJA 3SY2A 2YHCA 4APOA 4GA0A 1S0PA 1TR4A 3JUIA 3NF1A 4ILGA 1QNFA 5CERB 3ZHEA 5AJDA 3NOCD 4FHKA 4BERA 2X6HA 4G8LA 3ZVVA 4I2ZA 3LJ3A 1NZNA 5KCMA 4I1AA 2IJGX 2B6CA 2QYJA 3LEWA 4N39A 1MYOA 3U9WA 2XEEA 3FUJA 5AN8A 3SD5A 5J08A 2KZTA 3CQCB 4I17A 5FZQA 4KZ0A 5A7DB 4NRHB 4HI9A 4WWOA 3B7SA 2VTBA 2R59A 2DIWA 3GW4A 2DZNA 4MRUA 4EZLA 2JABA 1ELKA 3OXFA 5KJNA 4HVBA 5AENA 2J4BA 4J6IA 1HZ4A 4I1MA 3DSWA 3EHNA 2UY1A 4BWRA 3JQ1A 5D66A 4Z68A 4WWNA 1DC2A 2WXRA 4KVMA 3JXJA 2BKKB 3Q78A 4JC8A 4B8CB 4AY5A 1AP7A 3CK9A 1ELRA 4A3TA 2EINE 1DCEA 4DPRA 4AV7A 3FUEA 3HIZA 4TRQA 2IONA 1X81A 2VGXB 5KNHD 4FJYA 4A55A 3CVVA 2KM4A 1G3NB 1S64A 1VDYA 4NACA 1H2VC 5B1BE 5JA4D 5HRYA 3APFA 4BY6A 3FHEA 4N5CA 5IY5E 5CEDB 4JD2G 2Y4TA 2V4LA 4JHJA 4X8QA 5AARA 3I5PA 5ARFA 4LNUD 3B7UX 4EQFA 3FUHA 1N4RA 3RJVA 1KT0A 3AS8A 4P29A 1UN8A 1PAQA 4F6RD 2PQNA 3Q9UC 3KEAA 3FDHA 3PNLB 2BEDA 5G04C 4YDYA 2HR2A 2KXPC 4ABNA 4UWLA 2HYZA 2GW1A 4FP7A 3TAXA 1JPLA 4MKTA 3MV2B 4LERA 4N2SA 3K9IA 2R02A 1TNUA 3FEYA 4JB8P 2LNIA 4Q94A 5BV0A 4KZCA 1YYHA 2ZU6B 2VSYA 5EYLA 4CEMA 4FULA 2J9QA 3TXNA 2XHEA 4I9CA 1SW6A 3PZ3A 4TUMA 3MYVA 3Q79A 5CHEE 3MCXA 4IN3B 1WDYA 2XCBA 1H19A 2WM9A 3TWTA 3V31A 4O1OA 4BEPA 3UT8A 1X5BA 4CT0A 1HO8A 4DX2A 2UY1B 5A23A 4YDEA 2OEVA 3E4BA 3RRNB 2GRPB 3E37A 2XENA 3D9NA 2X38A 5ITZF 3EU5A 4LUNU 2IOSA 3FU0A 1MX6A 1N0QA 4HBDA 4YNDA 2A5UA 3Q7FA 5JJ6A 3AU4A 5G05J 2GRQB 5KJLA 1O1RA 1YA0A 4RVBA 2WXFA 2I1JA 4H7XA 1HG2A 5J90A 4LG6A 3DEOA 5EIDA 2RKKA 1KLXA 2MHKA 2P58C 1E96B 1OUVA 4G24A 3Q7AA 2XPYA 5BT1A 3S7FA 1RW2A 4UWKA 3ZNGA 3ZEFA 4U04A 2C2LA 4WAFA 3R7RA 1HF8A 4F1PA 2VSXE 1V54E 4EZKA 2OCCE 4EECA 3DBSA 2GGFA 3CHRA 3I3NA 3CVQA 3HG0D 4R7LA 3EU9A 4L2YA 4URKA 2WXLA 4FU3A 2P2CP 4HRMB 3QAQA 5FT9A 4L9PA 3ASOE 5LCWC 3Q5MA 3TL5A 1AWCB 5ENRD 2AXVA 5H7PA 4FA6A 3CVXA 1HX8A 3ML9A 2AXUA 4OVVA 3CR3A 3MGBA 3PZ1A 2XZTG 1WY6A 4F1SA 4B89A 3G2SA 4LNGA 4ZHBA 1MHQA 3FTYA 1FPPA 1TYQG 2X6FA 3FUFA 1OCRE 3TJPA 3TWXA 4QQIA 3AG4E 2ETAA 3O4ZA 4AM9A 4WNGA 2XEHA 3DXMG 4LSZE 1TNBA 3MV3B 3EHMA 4GTRA 1EPUA 3CLJA 2F8YA 3L17A 1HS6A 3ZN3A 3F6QA 5E75A 3S7JA 4J8EA 1OWNA 4I6GA 4UI9K 2FULA 4EZJA 1NI1A 4K5AB 1HFAA 1L5JA 2ZGDA 4AVXA 5LOZA 1A17A 4DLQA 5ENOD 2WXQA 3EHRA 4A63B 1IHBA 2EIKE 3E34A 5BUZA 3CVLA 1N4PA 3EHQA 3R7QA 1UJKA 3PS6A 4UI9J 1WAO1 3TG5A 1QYMA 2FO7A 4FHJA 4J7WA 4FADA 4XKCA 1N95A 2XPIA 3UUXA 1N94A 1Q2ZA 1GW6A 4FLHA 3ZRHA 4GTQA 3LKUA 4HB5A 3TWQA 1DVPA 5LP0A 1E7UA 5T8IA 3D3MA 2KCKA 4W9RA 1BPOA 3BEEA 4Q96A 1HH8A 2RG8A 2L9BA 3G2WA 3UX4A 1Z3YA 1N4QA 3KSLA 1IQRA 3C3QA 1MX4A 5EILA 4F3VA 3HXFA 3BU8A 5EKQD 1A5EA 4N3AA 4YDWA 1SZ9A 2YNQA 3SFZA 1D9SA 3CHSA 3Q49B 3SBTB 3FULA 4IYPA 5CCLA 4EBAA 3OXLA 3DXKG 3ABLE 4TV3A 3CHPA 3J5PA 2Y0BG 5EDSA 1RZ4A 3IHYA 3CGHA 5FQ8A 3ISMC 3D9KA 1H6PA 2J07A 3CVNA 2V5QC 3DSSA 1SA4A 4HI8A 4G8KA 2I6HA 3RRMB 3LY8A 1TN8A 4F53A 3SQVA 4BETA 4ME2A 3LJNA 2AVPA 3E30A 2VYIA 4DI4A 2I9CA 3TG4A 4M3OA 4EPZA 4ACKA 3CEQA 3JUEA 2VGEA 3PZ2A 3SHFA 1H2TC 1UW4B 3UIOC 3ABKE 4ACLA 4U07A 2NSZA 3ZGQA 1TN7A 3C5RA 3ONLA 3PUKA 4BT8A 3FUDA 3UIPC 4HOQA 4LNBA 2ZISA 3FH8A 4CDRA 4CRWA 1FT1A 2FO1E 2CHWA 2ZIRA 4PS8A 2L6BA 3DSUA 1E7VA 4WNDA 3APDA 3MA5A 3MJWA 3L08A 3KAEA 3P2BA 2GRMA 2HM8A 3UKRG 4RG9A 4PUCA 3B7RL 3JYSA 1OCOE 1N0RA 3IBEA 2WXGA 3T8KA 3HYMB 3HVEB 2UWJG 2X6IA 4BT9A 3CKBA 1QQEA 2DVWA 4TUUA 2L0IA 2IO2C 2WQ6A 3NBNB 1Y8MA 5BNWA 1BU9A 4HRNA 5KNGA 2QYUA 2NXPA 2Y4UA 2IF4A 4APFA 5FZSA 2P9KG 3R9MA 1NA3A 4EHMA 1KZPA 3RAUA 2MRIA 2H6GA 3VLDA 1N52A 1OWOA 1FCHA 4MBGA 5T3RA 3S7DA 4I2WA 3QC1A 1UG3A 4YVOA 3FH7A 4BFRA 1ELWA 3AAAC 3KEZA 3D9HA 4U8HA 3HHMA 3S2AA 3GZ2A 4HLEA 3RO3A 1IHGA 3CSTA 3UINC 3EDTB 3T8MA 3J5QB 3SZ7A 2A4ZA 1SA5A 1KPSB 3TWRA 5FJYA 1LD8A 5EX0A 4ANWA 2OEWA 2WPVA 3QNKA 2RFMA 2M63A 4GCOA 5DIZA 4O60A 3HXCA 1JCSA 4U7EB 5AQAA 5EX3A 3ZHEB 4HOTA 4NURA 2PNNA 3V2XA 3QB2A 3V2OA 1E8XA 5CCMA 2LSUA 3ULEG 1P5QA 1OY3D 2H6HA 5FQ7A 1OWPA 3RKVA 2DWZA 2GRLA 2PM7A 4J8YA 3LPZA 2EQXA 5G05C 3V30A 4BTAA 3ASFA 2BUGA 2KZTB 4E6HA 3FTZA 2V4HC 1OWMA 2FBNA 4HOUA 2VTBB 3PH0C 5KBAA 4GTOA 4BSZB 3FUIA 3QJZA 4UWGA 2GRNB 1E90A 4GU5A 2V8SE 3CVWA 1LD7A 4HOSA 3PE3A 4LCTA 4ATZD 2F0YA 4JPSA 3LDZA 3FFLA 3QWWA 2CG3A 1YMPA 2RD0A 4B94A 3PDNA 5CBNA 2HO1A 1U2VG 4G23A 4TXRA 4XIFA 5G04J 2R03A 3SI5A 3D9JA 2XRZA 3EUVA 3UQ3A 3PEUB 2ZXWE 3UT7A 4I1OB 3MKRA 4B93B 2VQ2A 2OVFA 2KATA 1MX2A 4V3IA 2YHEA 3SBSA 2J08A 3ULYA 2QFCA 2I1KA 2WXIA 2WB2A 3E33A 2ILRA 4F7AA 4DI3A 3FTVA 4DRXE 4HORA 4XI9A 1LTXA 4U8YD 5E76A 3KSQA 4UUCA 4XI0A 4AJWA 1IXVA 3DWLG 3CHMA 1HU3A 5JHAA 3PEVB 4KVOA 5BXUA 3ESLA 5ENTD 4JA7A 4A3VA 3Q9NC 2OV8A 1OCCE 4GMLA 3L82A 4WUYA 3G2VA 4LEUA 3PUJA 3PREA 1N11A 4I43A 2H6IA 4GZ5A 2AXZA 4ILHB 5D2MC 3ONKA 3RRUA 4BSXA 1BD8A 4AIFA 4JHRA 1DCQA 2FI7A 5ANLA 4MLPA 4GYYA 2NYJA 3LS8A 2EIJE 4AY6A 1ZB1A 4UWFA 5G55A 4QFVA 2VSNA 2C0MA 3EJNA 1SZAA 4UI9C 4WNEA 3Q75A 1Z3XA 4C0EA 4GZ6A 4GCNA 5EYPF 4FC8A 5B3SE 5LFAA 3CVPA 5ENPD 3C98A 3PZDA 5AQ7A 1EYHA 3LY9A 2ONDA 4HLLA 3FUMA 3UI2A 2E2EA 4K03A 3MKQA 5G2NA 3CHOA 3CQGB 4BESA 5LX8A 1YCSB 3V79K 4DUIA 4HS2A 3AG1E 2X6KA 4C0MA 5CEAA 4JHKA 3ZUVB 1DNPA 5C1DA 3ASGA 4L1BA 4JA9A 4L2LA 4B8AA 4Y6WA 4DJAA 3ZKJA 1NP7A 4GPKA 4C9BB 2LSVA 3R9AB 5LCWJ 1KZOA 4GMJA 2WMOA 5ENNA 4J8DA 4HQDA 2KCVA 1IQUA 3ZU7B 2F37A 4CCAA 4NQ0A 3U4TA 2Y1LE 4JL0A 3ZYLA 3P1UA 4ILIA 3C3RA 4YDOA 2MOWA 4FLBA 4ANUA 4RSYA 5FQ4A 2AWIA 2BF0X 3L13A 4LRZA 3L22A 1O1SA 3ENEA 4GA2A 4L7TA 4TXQA 1Y6IA 2E0IA 3HDXA 3KD7A 5FZRA 2XGOA 4N5QA 4FJZA 2LUHA 4PH4B 3D9MA 3PZ4A 5BXOA 3NQPA 4UQXA 3FY4A 5ARGA 1XNFA 4GZDA 3DRAA 3PVLA 5B1AE 1IYGA 4L23A 4PS3A 4H7YA 2IY0C 5EIBE 5AIJA 1V55E 3BG0B 2WXKA 3TWSA 3ZFWA 4KMOA 1ZBPA 4RG6A 2IO3C 2ZGGA 1N9AA 2WMNA 1FT2A 3OXGA 1UN9A 3TGOA 2QC9A 2XPZA 4E85A 3QK0A 5JJ7A 4GPMA 3TWVA 4AXHA 1JWFA 2VGXA 4CGVA 2PL2A 2AJAA 2XS1A 3GYZA 2IFUA 3CK8A 4GYOA 1EDUA 3FU6A 3G2TA 1B89A 3B13A 4AEZC 2XS8A 2P9UG 3NZSA 1OXJA 4GTSA 2DZOA 2EIME 4DX5D 3VTYA 3S7BA 2BTDA 4A1SA 2PQRA 4OAVB 2PZIA 2V0PA 5HS0A 3DPDA 4G25A 3FUKA 3FTXA 5KJKA 3AG2E 4XX5A 3APCA 1H2UA 4ANVA 4BTBA 3HXEA 2H6FA 4J8FA 2LXLA 4I9EA 2LAIA 2ETCA 2RFAA 5FTPA 3OAWA 3SGHA 4TXPA 3G2UA 1NFIE 4J0UA 1WG0A 3MEKA 3I4RB 3HXBA 3NOGD 3CK7A 4J8SA 3NB2A 4PDXA 2C0LA 3UXGA 3U66A 3FTSA 2XZDG 2X6JA 5FIOA 2JLBA 4GMRA 3FU3A 4D10C 5HQ8A 3RU0A 4U0SA 4BX9A 3D9OA 2LXMA 2KC7A 1BI8B 1KT1A 3RK6A 3RIBA 3ASDA 5AQBA 1MJ0A 4U63A 4CYMD 2XEVA 5HI7A 3UKUG 3HRAA 3DEPA 2VSOE 2R05A 5CRUA 1E8YA 2OOEA 3DPYA 5JHBA 1UJJA 2LAHA 3FH5A 3B7BA 4HFGA 1S63A 3CKCA 3FU5A 3FUNA 1PC2A 2DYRE 4CDNA 2P9PG 3U64A 3T5VA 2WQHA 3VLFA 2LO6A 2OVBA 2P9IG 3T9KA 4A1GA 4N2QA 2V5FA 2KBXA 1FVFA 1JUQA 2CG2A 2IEJA 1OCZE 4ZFHA 1HG5A 1TEZA 3SNXA 3PRZA 3TWWA 2QZAA 2WQ7A 2L0TB 3AJIA 4OVUA 4DX7D 3TWUA 3URZA 3RSEG 3HXDA 3W9FA 2XCCA 3ZW3A 1TNYA 3FTUA 1SQMA 4IRUA 3ZXSA 3GZ1A 3L16A 2IQCA 3IHVA 3C3OA 2GROB 2A5EA 1OT8A 4UQYA 5D0QD 3EIQC 4M7CA 5FWQA 3UMVA 2WXHA 1H6KA 3GZSA 2XRYA 3O48A 3N71A 3LVQE 3Q73A 4Q69A 5CMYA 2B0OE 5BW8C 5C2YA 1TN6A 4GTVA 3DSXA 3ZYMA 3ML8A 2FEZA 1INZA 4GTTA 5BV1A 2YINA 2WXOA 2Y69E 4K0RA 4PS7A 3L6AA 1HXIA 4JW1A 2P9LG 2FF4A 3LY7A 2X3MA 2CHZA 1LF8A 1H6OA 1ZU2A 3BUAA 4EBAG 1E8ZA 1K1BA 4MS6A 4I6EA 1Z5SC 4O1PA 5KWDA 1OWLA 3B95A 1BLXB 4AP2A 3ESKA 3ASHA 3W9GA 3AS4A 1FVHA 3B7TA 1MZCA 3U3WA 2HE0A 3L54A 2J09A 3BQOA 3FWVA 3ZYQA 5DBKA 2GRRB 3ZYKA 4U95D 3ZIMA 4GZ3A 1H0AA 5AJLA 2P9NG 2EILE 5A6CA 4U0ZA 4C48B 4DX6D 5CBOA 4CDMA 5AQ9A 4U8VD 4G2VA 2Y3AA 4RLYA 3FTWA 1TNOA 4K5CA 2J8SD 3D9IA 1IKND 1QBQA 1W3BA 1XGWA 5CMWA 4XEIG 1Z6TA 4KXKB 3CVUA 2AW6A 1WM5A 4U0UA 4DX1A 3WXXA 2ETBA 3SF4A 3UTMA 5ANRA 4GTMA 4JEHA 4KT6B 2R17C 4B0ZA 4WWPA 3IXEA 1JWGA 1SVXA 3KS2A 2IOLA 1MQSA 3D9LA 1UOHA 2VJ8A 3RO2A 5D0OD 4WNFA 1NA0A 3QKYA 3JCKC 4CGWA 3UM0A 4GZCA 4KYOB 4N3BA 3TXMA 5FQ6A 2WXPA 1PY1A 1D8DA 3SFXA 2PM6A 2YQ8A 1TJFA 1N4SA 3Q47B 3NAWA 5ENQD 3LYAA 1HE8A 2R2LA 3CHQA 4UWHA 2XGMA 1O5MA 2WXMA 2L6JA 4XZ4A 2QY7A 3QDNA 2XGSA 3ASNE 4CZ2D 3QWPA 4HXIA 5T4YA 5AYWD 3AU5A 5KJMA 4GA1A 3Q15A 2CFZA 4ANXA 4CT4A 1N54A 5HKPA 2JEKA 3LXUX 1TNZA 3QOUA 5FINA 2P9SG 1E8WA 4JZYA 4GYWA 3E32A 3BG1B 3IV0A 3UM1A 2I2OA 3WG7E 2IU1A 4DLOA 3SFYA 3JXIA 3JQ0A 3IKOB 3AG3E 2KCLA 1K8KG 2WXJA 2J49A 3PNTB 3QARA 4GTPA 3CV0A 3LVRE 2VGYA 3OTNA 3T5XA 3D9PA 3ULQA 4I6JA 3VLEA 2DBAA 1QZ2A 2MYOA 4GB9A 2NC9A 3L9TA 3SO8A 3CIAA 3I4GA 3Q4AB 3NZUA 4HRLA 4RQIA 3VTXA 3DSTA 2WVIA 4AOFA 4K5BA 4HNAD 1O1TA 5AAOA 1K3ZD 4UQZA 1NL4A 3UPVA 2CHXA 4XE0A 3CSFA 1D8EA 3HVEA 4JVSA 3DSVA 1S70B 3ZXPA 2Q7FA 1U3DA 1U3CA 3IEGA 4BX8A 2WXNA 2BKGA 1TJCA 4G26A 5CRVA 2J4DA 5ENSD 2DYSE 5M72A 1K1AA 5JMND 5BPPA 3AS5A 3EIJA 4GAAA 4JEUA 5EN5D 4YVQC 3CVYA 4XKBA 3QWVA 4DK5A 2XQ0A 3PE4A
chains in the Genus database with same CATH topology
3DXMG 2P9UG 3RSEG 2P9PG 3DXKG 1TYQG 1U2VG 3UKUG 2P9KG 4XEIG 2P9SG 3DWLG 1K8KG 2P9NG 2P9IG 4JD2G 3UKRG 3ULEG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM G;  2P9U G;  3RSE G;  2P9P G;  3DXK G;  1TYQ G;  1U2V G;  3UKU G;  2P9K G;  4XEI G;  2P9S G;  3DWL G;  1K8K G;  2P9N G;  2P9I G;  4JD2 G;  3UKR G;  3ULE G;  2P9L G; 
#chains in the Genus database with same CATH topology
 4KBQ A;  1JCQ A;  4Y6C A;  4G11 A;  3UM2 A;  3ABM E;  3FP3 A;  1BI7 B;  2F8X K;  4JXT A;  3FEX A;  2CFU A;  3LCA A;  4NIK A;  5JJT A;  4O6F A;  1JCR A;  4G1T A;  2DCP A;  3MX3 A;  3MZL B;  5CEC B;  2R5S A;  4U96 D;  1EF1 C;  3X2Q E;  4OYS A;  3UM3 A;  3UT4 A;  4IUL A;  3MKQ B;  3C72 A;  4N3C A;  4ATG A;  4OAU C;  3ZPJ A;  3SY2 A;  2YHC A;  4APO A;  4GA0 A;  1S0P A;  1TR4 A;  3JUI A;  3NF1 A;  4ILG A;  1QNF A;  5CER B;  3ZHE A;  5AJD A;  3NOC D;  4FHK A;  4BER A;  2X6H A;  4G8L A;  3ZVV A;  4I2Z A;  3LJ3 A;  1NZN A;  5KCM A;  4I1A A;  2IJG X;  2B6C A;  2QYJ A;  3LEW A;  4N39 A;  1MYO A;  3U9W A;  2XEE A;  3FUJ A;  5AN8 A;  3SD5 A;  5J08 A;  2KZT A;  3CQC B;  4I17 A;  5FZQ A;  4KZ0 A;  5A7D B;  4NRH B;  4HI9 A;  4WWO A;  3B7S A;  2VTB A;  2R59 A;  2DIW A;  3GW4 A;  2DZN A;  4MRU A;  4EZL A;  2JAB A;  1ELK A;  3OXF A;  5KJN A;  4HVB A;  5AEN A;  2J4B A;  4J6I A;  1HZ4 A;  4I1M A;  3DSW A;  3EHN A;  2UY1 A;  4BWR A;  3JQ1 A;  5D66 A;  4Z68 A;  4WWN A;  1DC2 A;  2WXR A;  4KVM A;  3JXJ A;  2BKK B;  3Q78 A;  4JC8 A;  4B8C B;  4AY5 A;  1AP7 A;  3CK9 A;  1ELR A;  4A3T A;  2EIN E;  1DCE A;  4DPR A;  4AV7 A;  3FUE A;  3HIZ A;  4TRQ A;  2ION A;  1X81 A;  2VGX B;  5KNH D;  4FJY A;  4A55 A;  3CVV A;  2KM4 A;  1G3N B;  1S64 A;  1VDY A;  4NAC A;  1H2V C;  5B1B E;  5JA4 D;  5HRY A;  3APF A;  4BY6 A;  3FHE A;  4N5C A;  5IY5 E;  5CED B;  4JD2 G;  2Y4T A;  2V4L A;  4JHJ A;  4X8Q A;  5AAR A;  3I5P A;  5ARF A;  4LNU D;  3B7U X;  4EQF A;  3FUH A;  1N4R A;  3RJV A;  1KT0 A;  3AS8 A;  4P29 A;  1UN8 A;  1PAQ A;  4F6R D;  2PQN A;  3Q9U C;  3KEA A;  3FDH A;  3PNL B;  2BED A;  5G04 C;  4YDY A;  2HR2 A;  2KXP C;  4ABN A;  4UWL A;  2HYZ A;  2GW1 A;  4FP7 A;  3TAX A;  1JPL A;  4MKT A;  3MV2 B;  4LER A;  4N2S A;  3K9I A;  2R02 A;  1TNU A;  3FEY A;  4JB8 P;  2LNI A;  4Q94 A;  5BV0 A;  4KZC A;  1YYH A;  2ZU6 B;  2VSY A;  5EYL A;  4CEM A;  4FUL A;  2J9Q A;  3TXN A;  2XHE A;  4I9C A;  1SW6 A;  3PZ3 A;  4TUM A;  3MYV A;  3Q79 A;  5CHE E;  3MCX A;  4IN3 B;  1WDY A;  2XCB A;  1H19 A;  2WM9 A;  3TWT A;  3V31 A;  4O1O A;  4BEP A;  3UT8 A;  1X5B A;  4CT0 A;  1HO8 A;  4DX2 A;  2UY1 B;  5A23 A;  4YDE A;  2OEV A;  3E4B A;  3RRN B;  2GRP B;  3E37 A;  2XEN A;  3D9N A;  2X38 A;  5ITZ F;  3EU5 A;  4LUN U;  2IOS A;  3FU0 A;  1MX6 A;  1N0Q A;  4HBD A;  4YND A;  2A5U A;  3Q7F A;  5JJ6 A;  3AU4 A;  5G05 J;  2GRQ B;  5KJL A;  1O1R A;  1YA0 A;  4RVB A;  2WXF A;  2I1J A;  4H7X A;  1HG2 A;  5J90 A;  4LG6 A;  3DEO A;  5EID A;  2RKK A;  1KLX A;  2MHK A;  2P58 C;  1E96 B;  1OUV A;  4G24 A;  3Q7A A;  2XPY A;  5BT1 A;  3S7F A;  1RW2 A;  4UWK A;  3ZNG A;  3ZEF A;  4U04 A;  2C2L A;  4WAF A;  3R7R A;  1HF8 A;  4F1P A;  2VSX E;  1V54 E;  4EZK A;  2OCC E;  4EEC A;  3DBS A;  2GGF A;  3CHR A;  3I3N A;  3CVQ A;  3HG0 D;  4R7L A;  3EU9 A;  4L2Y A;  4URK A;  2WXL A;  4FU3 A;  2P2C P;  4HRM B;  3QAQ A;  5FT9 A;  4L9P A;  3ASO E;  5LCW C;  3Q5M A;  3TL5 A;  1AWC B;  5ENR D;  2AXV A;  5H7P A;  4FA6 A;  3CVX A;  1HX8 A;  3ML9 A;  2AXU A;  4OVV A;  3CR3 A;  3MGB A;  3PZ1 A;  2XZT G;  1WY6 A;  4F1S A;  4B89 A;  3G2S A;  4LNG A;  4ZHB A;  1MHQ A;  3FTY A;  1FPP A;  1TYQ G;  2X6F A;  3FUF A;  1OCR E;  3TJP A;  3TWX A;  4QQI A;  3AG4 E;  2ETA A;  3O4Z A;  4AM9 A;  4WNG A;  2XEH A;  3DXM G;  4LSZ E;  1TNB A;  3MV3 B;  3EHM A;  4GTR A;  1EPU A;  3CLJ A;  2F8Y A;  3L17 A;  1HS6 A;  3ZN3 A;  3F6Q A;  5E75 A;  3S7J A;  4J8E A;  1OWN A;  4I6G A;  4UI9 K;  2FUL A;  4EZJ A;  1NI1 A;  4K5A B;  1HFA A;  1L5J A;  2ZGD A;  4AVX A;  5LOZ A;  1A17 A;  4DLQ A;  5ENO D;  2WXQ A;  3EHR A;  4A63 B;  1IHB A;  2EIK E;  3E34 A;  5BUZ A;  3CVL A;  1N4P A;  3EHQ A;  3R7Q A;  1UJK A;  3PS6 A;  4UI9 J;  1WAO 1;  3TG5 A;  1QYM A;  2FO7 A;  4FHJ A;  4J7W A;  4FAD A;  4XKC A;  1N95 A;  2XPI A;  3UUX A;  1N94 A;  1Q2Z A;  1GW6 A;  4FLH A;  3ZRH A;  4GTQ A;  3LKU A;  4HB5 A;  3TWQ A;  1DVP A;  5LP0 A;  1E7U A;  5T8I A;  3D3M A;  2KCK A;  4W9R A;  1BPO A;  3BEE A;  4Q96 A;  1HH8 A;  2RG8 A;  2L9B A;  3G2W A;  3UX4 A;  1Z3Y A;  1N4Q A;  3KSL A;  1IQR A;  3C3Q A;  1MX4 A;  5EIL A;  4F3V A;  3HXF A;  3BU8 A;  5EKQ D;  1A5E A;  4N3A A;  4YDW A;  1SZ9 A;  2YNQ A;  3SFZ A;  1D9S A;  3CHS A;  3Q49 B;  3SBT B;  3FUL A;  4IYP A;  5CCL A;  4EBA A;  3OXL A;  3DXK G;  3ABL E;  4TV3 A;  3CHP A;  3J5P A;  2Y0B G;  5EDS A;  1RZ4 A;  3IHY A;  3CGH A;  5FQ8 A;  3ISM C;  3D9K A;  1H6P A;  2J07 A;  3CVN A;  2V5Q C;  3DSS A;  1SA4 A;  4HI8 A;  4G8K A;  2I6H A;  3RRM B;  3LY8 A;  1TN8 A;  4F53 A;  3SQV A;  4BET A;  4ME2 A;  3LJN A;  2AVP A;  3E30 A;  2VYI A;  4DI4 A;  2I9C A;  3TG4 A;  4M3O A;  4EPZ A;  4ACK A;  3CEQ A;  3JUE A;  2VGE A;  3PZ2 A;  3SHF A;  1H2T C;  1UW4 B;  3UIO C;  3ABK E;  4ACL A;  4U07 A;  2NSZ A;  3ZGQ A;  1TN7 A;  3C5R A;  3ONL A;  3PUK A;  4BT8 A;  3FUD A;  3UIP C;  4HOQ A;  4LNB A;  2ZIS A;  3FH8 A;  4CDR A;  4CRW A;  1FT1 A;  2FO1 E;  2CHW A;  2ZIR A;  4PS8 A;  2L6B A;  3DSU A;  1E7V A;  4WND A;  3APD A;  3MA5 A;  3MJW A;  3L08 A;  3KAE A;  3P2B A;  2GRM A;  2HM8 A;  3UKR G;  4RG9 A;  4PUC A;  3B7R L;  3JYS A;  1OCO E;  1N0R A;  3IBE A;  2WXG A;  3T8K A;  3HYM B;  3HVE B;  2UWJ G;  2X6I A;  4BT9 A;  3CKB A;  1QQE A;  2DVW A;  4TUU A;  2L0I A;  2IO2 C;  2WQ6 A;  3NBN B;  1Y8M A;  5BNW A;  1BU9 A;  4HRN A;  5KNG A;  2QYU A;  2NXP A;  2Y4U A;  2IF4 A;  4APF A;  5FZS A;  2P9K G;  3R9M A;  1NA3 A;  4EHM A;  1KZP A;  3RAU A;  2MRI A;  2H6G A;  3VLD A;  1N52 A;  1OWO A;  1FCH A;  4MBG A;  5T3R A;  3S7D A;  4I2W A;  3QC1 A;  1UG3 A;  4YVO A;  3FH7 A;  4BFR A;  1ELW A;  3AAA C;  3KEZ A;  3D9H A;  4U8H A;  3HHM A;  3S2A A;  3GZ2 A;  4HLE A;  3RO3 A;  1IHG A;  3CST A;  3UIN C;  3EDT B;  3T8M A;  3J5Q B;  3SZ7 A;  2A4Z A;  1SA5 A;  1KPS B;  3TWR A;  5FJY A;  1LD8 A;  5EX0 A;  4ANW A;  2OEW A;  2WPV A;  3QNK A;  2RFM A;  2M63 A;  4GCO A;  5DIZ A;  4O60 A;  3HXC A;  1JCS A;  4U7E B;  5AQA A;  5EX3 A;  3ZHE B;  4HOT A;  4NUR A;  2PNN A;  3V2X A;  3QB2 A;  3V2O A;  1E8X A;  5CCM A;  2LSU A;  3ULE G;  1P5Q A;  1OY3 D;  2H6H A;  5FQ7 A;  1OWP A;  3RKV A;  2DWZ A;  2GRL A;  2PM7 A;  4J8Y A;  3LPZ A;  2EQX A;  5G05 C;  3V30 A;  4BTA A;  3ASF A;  2BUG A;  2KZT B;  4E6H A;  3FTZ A;  2V4H C;  1OWM A;  2FBN A;  4HOU A;  2VTB B;  3PH0 C;  5KBA A;  4GTO A;  4BSZ B;  3FUI A;  3QJZ A;  4UWG A;  2GRN B;  1E90 A;  4GU5 A;  2V8S E;  3CVW A;  1LD7 A;  4HOS A;  3PE3 A;  4LCT A;  4ATZ D;  2F0Y A;  4JPS A;  3LDZ A;  3FFL A;  3QWW A;  2CG3 A;  1YMP A;  2RD0 A;  4B94 A;  3PDN A;  5CBN A;  2HO1 A;  1U2V G;  4G23 A;  4TXR A;  4XIF A;  5G04 J;  2R03 A;  3SI5 A;  3D9J A;  2XRZ A;  3EUV A;  3UQ3 A;  3PEU B;  2ZXW E;  3UT7 A;  4I1O B;  3MKR A;  4B93 B;  2VQ2 A;  2OVF A;  2KAT A;  1MX2 A;  4V3I A;  2YHE A;  3SBS A;  2J08 A;  3ULY A;  2QFC A;  2I1K A;  2WXI A;  2WB2 A;  3E33 A;  2ILR A;  4F7A A;  4DI3 A;  3FTV A;  4DRX E;  4HOR A;  4XI9 A;  1LTX A;  4U8Y D;  5E76 A;  3KSQ A;  4UUC A;  4XI0 A;  4AJW A;  1IXV A;  3DWL G;  3CHM A;  1HU3 A;  5JHA A;  3PEV B;  4KVO A;  5BXU A;  3ESL A;  5ENT D;  4JA7 A;  4A3V A;  3Q9N C;  2OV8 A;  1OCC E;  4GML A;  3L82 A;  4WUY A;  3G2V A;  4LEU A;  3PUJ A;  3PRE A;  1N11 A;  4I43 A;  2H6I A;  4GZ5 A;  2AXZ A;  4ILH B;  5D2M C;  3ONK A;  3RRU A;  4BSX A;  1BD8 A;  4AIF A;  4JHR A;  1DCQ A;  2FI7 A;  5ANL A;  4MLP A;  4GYY A;  2NYJ A;  3LS8 A;  2EIJ E;  4AY6 A;  1ZB1 A;  4UWF A;  5G55 A;  4QFV A;  2VSN A;  2C0M A;  3EJN A;  1SZA A;  4UI9 C;  4WNE A;  3Q75 A;  1Z3X A;  4C0E A;  4GZ6 A;  4GCN A;  5EYP F;  4FC8 A;  5B3S E;  5LFA A;  3CVP A;  5ENP D;  3C98 A;  3PZD A;  5AQ7 A;  1EYH A;  3LY9 A;  2OND A;  4HLL A;  3FUM A;  3UI2 A;  2E2E A;  4K03 A;  3MKQ A;  5G2N A;  3CHO A;  3CQG B;  4BES A;  5LX8 A;  1YCS B;  3V79 K;  4DUI A;  4HS2 A;  3AG1 E;  2X6K A;  4C0M A;  5CEA A;  4JHK A;  3ZUV B;  1DNP A;  5C1D A;  3ASG A;  4L1B A;  4JA9 A;  4L2L A;  4B8A A;  4Y6W A;  4DJA A;  3ZKJ A;  1NP7 A;  4GPK A;  4C9B B;  2LSV A;  3R9A B;  5LCW J;  1KZO A;  4GMJ A;  2WMO A;  5ENN A;  4J8D A;  4HQD A;  2KCV A;  1IQU A;  3ZU7 B;  2F37 A;  4CCA A;  4NQ0 A;  3U4T A;  2Y1L E;  4JL0 A;  3ZYL A;  3P1U A;  4ILI A;  3C3R A;  4YDO A;  2MOW A;  4FLB A;  4ANU A;  4RSY A;  5FQ4 A;  2AWI A;  2BF0 X;  3L13 A;  4LRZ A;  3L22 A;  1O1S A;  3ENE A;  4GA2 A;  4L7T A;  4TXQ A;  1Y6I A;  2E0I A;  3HDX A;  3KD7 A;  5FZR A;  2XGO A;  4N5Q A;  4FJZ A;  2LUH A;  4PH4 B;  3D9M A;  3PZ4 A;  5BXO A;  3NQP A;  4UQX A;  3FY4 A;  5ARG A;  1XNF A;  4GZD A;  3DRA A;  3PVL A;  5B1A E;  1IYG A;  4L23 A;  4PS3 A;  4H7Y A;  2IY0 C;  5EIB E;  5AIJ A;  1V55 E;  3BG0 B;  2WXK A;  3TWS A;  3ZFW A;  4KMO A;  1ZBP A;  4RG6 A;  2IO3 C;  2ZGG A;  1N9A A;  2WMN A;  1FT2 A;  3OXG A;  1UN9 A;  3TGO A;  2QC9 A;  2XPZ A;  4E85 A;  3QK0 A;  5JJ7 A;  4GPM A;  3TWV A;  4AXH A;  1JWF A;  2VGX A;  4CGV A;  2PL2 A;  2AJA A;  2XS1 A;  3GYZ A;  2IFU A;  3CK8 A;  4GYO A;  1EDU A;  3FU6 A;  3G2T A;  1B89 A;  3B13 A;  4AEZ C;  2XS8 A;  2P9U G;  3NZS A;  1OXJ A;  4GTS A;  2DZO A;  2EIM E;  4DX5 D;  3VTY A;  3S7B A;  2BTD A;  4A1S A;  2PQR A;  4OAV B;  2PZI A;  2V0P A;  5HS0 A;  3DPD A;  4G25 A;  3FUK A;  3FTX A;  5KJK A;  3AG2 E;  4XX5 A;  3APC A;  1H2U A;  4ANV A;  4BTB A;  3HXE A;  2H6F A;  4J8F A;  2LXL A;  4I9E A;  2LAI A;  2ETC A;  2RFA A;  5FTP A;  3OAW A;  3SGH A;  4TXP A;  3G2U A;  1NFI E;  4J0U A;  1WG0 A;  3MEK A;  3I4R B;  3HXB A;  3NOG D;  3CK7 A;  4J8S A;  3NB2 A;  4PDX A;  2C0L A;  3UXG A;  3U66 A;  3FTS A;  2XZD G;  2X6J A;  5FIO A;  2JLB A;  4GMR A;  3FU3 A;  4D10 C;  5HQ8 A;  3RU0 A;  4U0S A;  4BX9 A;  3D9O A;  2LXM A;  2KC7 A;  1BI8 B;  1KT1 A;  3RK6 A;  3RIB A;  3ASD A;  5AQB A;  1MJ0 A;  4U63 A;  4CYM D;  2XEV A;  5HI7 A;  3UKU G;  3HRA A;  3DEP A;  2VSO E;  2R05 A;  5CRU A;  1E8Y A;  2OOE A;  3DPY A;  5JHB A;  1UJJ A;  2LAH A;  3FH5 A;  3B7B A;  4HFG A;  1S63 A;  3CKC A;  3FU5 A;  3FUN A;  1PC2 A;  2DYR E;  4CDN A;  2P9P G;  3U64 A;  3T5V A;  2WQH A;  3VLF A;  2LO6 A;  2OVB A;  2P9I G;  3T9K A;  4A1G A;  4N2Q A;  2V5F A;  2KBX A;  1FVF A;  1JUQ A;  2CG2 A;  2IEJ A;  1OCZ E;  4ZFH A;  1HG5 A;  1TEZ A;  3SNX A;  3PRZ A;  3TWW A;  2QZA A;  2WQ7 A;  2L0T B;  3AJI A;  4OVU A;  4DX7 D;  3TWU A;  3URZ A;  3RSE G;  3HXD A;  3W9F A;  2XCC A;  3ZW3 A;  1TNY A;  3FTU A;  1SQM A;  4IRU A;  3ZXS A;  3GZ1 A;  3L16 A;  2IQC A;  3IHV A;  3C3O A;  2GRO B;  2A5E A;  1OT8 A;  4UQY A;  5D0Q D;  3EIQ C;  4M7C A;  5FWQ A;  3UMV A;  2WXH A;  1H6K A;  3GZS A;  2XRY A;  3O48 A;  3N71 A;  3LVQ E;  3Q73 A;  4Q69 A;  5CMY A;  2B0O E;  5BW8 C;  5C2Y A;  1TN6 A;  4GTV A;  3DSX A;  3ZYM A;  3ML8 A;  2FEZ A;  1INZ A;  4GTT A;  5BV1 A;  2YIN A;  2WXO A;  2Y69 E;  4K0R A;  4PS7 A;  3L6A A;  1HXI A;  4JW1 A;  2P9L G;  2FF4 A;  3LY7 A;  2X3M A;  2CHZ A;  1LF8 A;  1H6O A;  1ZU2 A;  3BUA A;  4EBA G;  1E8Z A;  1K1B A;  4MS6 A;  4I6E A;  1Z5S C;  4O1P A;  5KWD A;  1OWL A;  3B95 A;  1BLX B;  4AP2 A;  3ESK A;  3ASH A;  3W9G A;  3AS4 A;  1FVH A;  3B7T A;  1MZC A;  3U3W A;  2HE0 A;  3L54 A;  2J09 A;  3BQO A;  3FWV A;  3ZYQ A;  5DBK A;  2GRR B;  3ZYK A;  4U95 D;  3ZIM A;  4GZ3 A;  1H0A A;  5AJL A;  2P9N G;  2EIL E;  5A6C A;  4U0Z A;  4C48 B;  4DX6 D;  5CBO A;  4CDM A;  5AQ9 A;  4U8V D;  4G2V A;  2Y3A A;  4RLY A;  3FTW A;  1TNO A;  4K5C A;  2J8S D;  3D9I A;  1IKN D;  1QBQ A;  1W3B A;  1XGW A;  5CMW A;  4XEI G;  1Z6T A;  4KXK B;  3CVU A;  2AW6 A;  1WM5 A;  4U0U A;  4DX1 A;  3WXX A;  2ETB A;  3SF4 A;  3UTM A;  5ANR A;  4GTM A;  4JEH A;  4KT6 B;  2R17 C;  4B0Z A;  4WWP A;  3IXE A;  1JWG A;  1SVX A;  3KS2 A;  2IOL A;  1MQS A;  3D9L A;  1UOH A;  2VJ8 A;  3RO2 A;  5D0O D;  4WNF A;  1NA0 A;  3QKY A;  3JCK C;  4CGW A;  3UM0 A;  4GZC A;  4KYO B;  4N3B A;  3TXM A;  5FQ6 A;  2WXP A;  1PY1 A;  1D8D A;  3SFX A;  2PM6 A;  2YQ8 A;  1TJF A;  1N4S A;  3Q47 B;  3NAW A;  5ENQ D;  3LYA A;  1HE8 A;  2R2L A;  3CHQ A;  4UWH A;  2XGM A;  1O5M A;  2WXM A;  2L6J A;  4XZ4 A;  2QY7 A;  3QDN A;  2XGS A;  3ASN E;  4CZ2 D;  3QWP A;  4HXI A;  5T4Y A;  5AYW D;  3AU5 A;  5KJM A;  4GA1 A;  3Q15 A;  2CFZ A;  4ANX A;  4CT4 A;  1N54 A;  5HKP A;  2JEK A;  3LXU X;  1TNZ A;  3QOU A;  5FIN A;  2P9S G;  1E8W A;  4JZY A;  4GYW A;  3E32 A;  3BG1 B;  3IV0 A;  3UM1 A;  2I2O A;  3WG7 E;  2IU1 A;  4DLO A;  3SFY A;  3JXI A;  3JQ0 A;  3IKO B;  3AG3 E;  2KCL A;  1K8K G;  2WXJ A;  2J49 A;  3PNT B;  3QAR A;  4GTP A;  3CV0 A;  3LVR E;  2VGY A;  3OTN A;  3T5X A;  3D9P A;  3ULQ A;  4I6J A;  3VLE A;  2DBA A;  1QZ2 A;  2MYO A;  4GB9 A;  2NC9 A;  3L9T A;  3SO8 A;  3CIA A;  3I4G A;  3Q4A B;  3NZU A;  4HRL A;  4RQI A;  3VTX A;  3DST A;  2WVI A;  4AOF A;  4K5B A;  4HNA D;  1O1T A;  5AAO A;  1K3Z D;  4UQZ A;  1NL4 A;  3UPV A;  2CHX A;  4XE0 A;  3CSF A;  1D8E A;  3HVE A;  4JVS A;  3DSV A;  1S70 B;  3ZXP A;  2Q7F A;  1U3D A;  1U3C A;  3IEG A;  4BX8 A;  2WXN A;  2BKG A;  1TJC A;  4G26 A;  5CRV A;  2J4D A;  5ENS D;  2DYS E;  5M72 A;  1K1A A;  5JMN D;  5BPP A;  3AS5 A;  3EIJ A;  4GAA A;  4JEU A;  5EN5 D;  4YVQ C;  3CVY A;  4XKB A;  3QWV A;  4DK5 A;  2XQ0 A;  3PE4 A; 
#chains in the Genus database with same CATH homology
 3DXM G;  2P9U G;  3RSE G;  2P9P G;  3DXK G;  1TYQ G;  1U2V G;  3UKU G;  2P9K G;  4XEI G;  2P9S G;  3DWL G;  1K8K G;  2P9N G;  2P9I G;  4JD2 G;  3UKR G;  3ULE G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...