2P9MA

Crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
128
Chain Sequence
LKNIKVKDVMTKNVITAKRHEGVVEAFEKMLKYKISSLPVIDDENKVIGIVTTTDIGYNLIRDKYTLETTIGDVMTKDVITIHEDASILEAIKKMDISIINQLPVVDKNNKLVGIISDGDIIRTISKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein MJ0922 from Methanocaldococcus jannaschii DSM 2661
rcsb
molecule keywords Hypothetical protein MJ0922
molecule tags Structural genomics, unknown function
source organism Methanocaldococcus jannaschii dsm 2661
total genus 28
structure length 128
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2p9mA00
2UV7A 5LXQA 3FV6A 1PVMA 4L27A 2QH1A 3K6EA 3SL7A 5K25C 2QLVC 2P9MA 3PC2A 5IIPA 2EMQA 2NYCA 2RIFA 2UV6A 2YVYA 2YVZA 4DQWA 1O50A 1PBJA 3OCMA 5MMZA 4FRYA 1Y5HA 2ZY9A 3GBYA 4IY2A 4IY3A 2NYEA 2YZIA 4IYSA 4ESYB 4PCUA 4L0DA 4ESYA 3OI8A 3LV9A 2RC3A 3LQNA 1XKFA 2UV4A 3FWRA 3KPBA 2O16A 2QRCE 3FWSA 5K22B 3KPCA 2UV5A 4COOA 2QRDE 1YAVA 2QREE 4HG0A 2PFIA 2OOXE 3T4NC 3KXRA 4L28A 2OOYE 3ORGA 3K2VA 3TDHC 3FHMA 2RIHA 4GQVA 4IY0A 3L2BA 2OUXA 4GQWA 3TE5C 3I8NA 3PC4A 3L31A 4P1OA 2YVXA 3DDJA 4P1GA 3LFZA 4FXSA 4O9KA 4GQYA 5K23C 5K24C 4UUUA 3LHHA 4IY4A 3KPDA 5KS7A 2QR1E 4NOCA 4L3VA 2YZQA 3KH5A 3PC3A 2D4ZA 3OCOA 2EF7A 3HF7A 3FNAA
chains in the Genus database with same CATH superfamily
2UV7A 5LXQA 3FV6A 1PVMA 4L27A 2QH1A 3K6EA 3SL7A 5K25C 2QLVC 2P9MA 3PC2A 5IIPA 2EMQA 2NYCA 2RIFA 2UV6A 2YVYA 2YVZA 4DQWA 1O50A 1PBJA 3OCMA 5MMZA 4FRYA 1Y5HA 2ZY9A 3GBYA 4IY2A 4IY3A 2NYEA 2YZIA 4IYSA 4ESYB 4PCUA 2J9LA 4L0DA 4ESYA 3OI8A 3LV9A 2RC3A 3LQNA 1XKFA 2UV4A 3FWRA 3KPBA 2O16A 2QRCE 3FWSA 5K22B 3KPCA 2UV5A 4COOA 2QRDE 1YAVA 2JA3A 2QREE 4HG0A 2PFIA 2OOXE 3T4NC 3KXRA 4L28A 2OOYE 3ORGA 3K2VA 3TDHC 3FHMA 2RIHA 4GQVA 4IY0A 3L2BA 2OUXA 4GQWA 3TE5C 3I8NA 3PC4A 3L31A 4P1OA 2YVXA 3DDJA 4P1GA 3LFZA 4FXSA 4O9KA 4GQYA 5K23C 5K24C 4UUUA 3LHHA 4IY4A 3KPDA 5KS7A 2QR1E 4NOCA 4L3VA 2YZQA 3KH5A 3PC3A 2D4ZA 3OCOA 2EF7A 3HF7A 3FNAA
chains in the Genus database with same CATH topology
2UV7A 5LXQA 3FV6A 1PVMA 4L27A 2QH1A 3K6EA 3SL7A 5K25C 2QLVC 2P9MA 3PC2A 5IIPA 2EMQA 2NYCA 2RIFA 2UV6A 2YVYA 2YVZA 4DQWA 1O50A 1PBJA 3OCMA 5MMZA 4FRYA 1Y5HA 2ZY9A 3GBYA 4IY2A 4IY3A 2NYEA 2YZIA 4IYSA 4ESYB 4PCUA 2J9LA 4L0DA 4ESYA 3OI8A 3LV9A 2RC3A 3LQNA 1XKFA 2UV4A 3FWRA 3KPBA 2O16A 2QRCE 3FWSA 5K22B 3KPCA 2UV5A 4COOA 2QRDE 1YAVA 2JA3A 2QREE 4HG0A 2PFIA 2OOXE 3T4NC 3KXRA 4L28A 2OOYE 3ORGA 3K2VA 3TDHC 3FHMA 2RIHA 4GQVA 4IY0A 3L2BA 2OUXA 4GQWA 3TE5C 3I8NA 3PC4A 3L31A 4P1OA 2YVXA 3DDJA 4P1GA 3LFZA 4FXSA 4O9KA 4GQYA 5K23C 5K24C 4UUUA 3LHHA 4IY4A 3KPDA 5KS7A 2QR1E 4NOCA 4L3VA 2YZQA 3KH5A 3PC3A 2D4ZA 3OCOA 2EF7A 3HF7A 3FNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UV7 A;  5LXQ A;  3FV6 A;  1PVM A;  4L27 A;  2QH1 A;  3K6E A;  3SL7 A;  5K25 C;  2QLV C;  2P9M A;  3PC2 A;  5IIP A;  2EMQ A;  2NYC A;  2RIF A;  2UV6 A;  2YVY A;  2YVZ A;  4DQW A;  1O50 A;  1PBJ A;  3OCM A;  5MMZ A;  4FRY A;  1Y5H A;  2ZY9 A;  3GBY A;  4IY2 A;  4IY3 A;  2NYE A;  2YZI A;  4IYS A;  4ESY B;  4PCU A;  4L0D A;  4ESY A;  3OI8 A;  3LV9 A;  2RC3 A;  3LQN A;  1XKF A;  2UV4 A;  3FWR A;  3KPB A;  2O16 A;  2QRC E;  3FWS A;  5K22 B;  3KPC A;  2UV5 A;  4COO A;  2QRD E;  1YAV A;  2QRE E;  4HG0 A;  2PFI A;  2OOX E;  3T4N C;  3KXR A;  4L28 A;  2OOY E;  3ORG A;  3K2V A;  3TDH C;  3FHM A;  2RIH A;  4GQV A;  4IY0 A;  3L2B A;  2OUX A;  4GQW A;  3TE5 C;  3I8N A;  3PC4 A;  3L31 A;  4P1O A;  2YVX A;  3DDJ A;  4P1G A;  3LFZ A;  4FXS A;  4O9K A;  4GQY A;  5K23 C;  5K24 C;  4UUU A;  3LHH A;  4IY4 A;  3KPD A;  5KS7 A;  2QR1 E;  4NOC A;  4L3V A;  2YZQ A;  3KH5 A;  3PC3 A;  2D4Z A;  3OCO A;  2EF7 A;  3HF7 A;  3FNA A; 
#chains in the Genus database with same CATH topology
 2UV7 A;  5LXQ A;  3FV6 A;  1PVM A;  4L27 A;  2QH1 A;  3K6E A;  3SL7 A;  5K25 C;  2QLV C;  2P9M A;  3PC2 A;  5IIP A;  2EMQ A;  2NYC A;  2RIF A;  2UV6 A;  2YVY A;  2YVZ A;  4DQW A;  1O50 A;  1PBJ A;  3OCM A;  5MMZ A;  4FRY A;  1Y5H A;  2ZY9 A;  3GBY A;  4IY2 A;  4IY3 A;  2NYE A;  2YZI A;  4IYS A;  4ESY B;  4PCU A;  2J9L A;  4L0D A;  4ESY A;  3OI8 A;  3LV9 A;  2RC3 A;  3LQN A;  1XKF A;  2UV4 A;  3FWR A;  3KPB A;  2O16 A;  2QRC E;  3FWS A;  5K22 B;  3KPC A;  2UV5 A;  4COO A;  2QRD E;  1YAV A;  2JA3 A;  2QRE E;  4HG0 A;  2PFI A;  2OOX E;  3T4N C;  3KXR A;  4L28 A;  2OOY E;  3ORG A;  3K2V A;  3TDH C;  3FHM A;  2RIH A;  4GQV A;  4IY0 A;  3L2B A;  2OUX A;  4GQW A;  3TE5 C;  3I8N A;  3PC4 A;  3L31 A;  4P1O A;  2YVX A;  3DDJ A;  4P1G A;  3LFZ A;  4FXS A;  4O9K A;  4GQY A;  5K23 C;  5K24 C;  4UUU A;  3LHH A;  4IY4 A;  3KPD A;  5KS7 A;  2QR1 E;  4NOC A;  4L3V A;  2YZQ A;  3KH5 A;  3PC3 A;  2D4Z A;  3OCO A;  2EF7 A;  3HF7 A;  3FNA A; 
#chains in the Genus database with same CATH homology
 2UV7 A;  5LXQ A;  3FV6 A;  1PVM A;  4L27 A;  2QH1 A;  3K6E A;  3SL7 A;  5K25 C;  2QLV C;  2P9M A;  3PC2 A;  5IIP A;  2EMQ A;  2NYC A;  2RIF A;  2UV6 A;  2YVY A;  2YVZ A;  4DQW A;  1O50 A;  1PBJ A;  3OCM A;  5MMZ A;  4FRY A;  1Y5H A;  2ZY9 A;  3GBY A;  4IY2 A;  4IY3 A;  2NYE A;  2YZI A;  4IYS A;  4ESY B;  4PCU A;  2J9L A;  4L0D A;  4ESY A;  3OI8 A;  3LV9 A;  2RC3 A;  3LQN A;  1XKF A;  2UV4 A;  3FWR A;  3KPB A;  2O16 A;  2QRC E;  3FWS A;  5K22 B;  3KPC A;  2UV5 A;  4COO A;  2QRD E;  1YAV A;  2JA3 A;  2QRE E;  4HG0 A;  2PFI A;  2OOX E;  3T4N C;  3KXR A;  4L28 A;  2OOY E;  3ORG A;  3K2V A;  3TDH C;  3FHM A;  2RIH A;  4GQV A;  4IY0 A;  3L2B A;  2OUX A;  4GQW A;  3TE5 C;  3I8N A;  3PC4 A;  3L31 A;  4P1O A;  2YVX A;  3DDJ A;  4P1G A;  3LFZ A;  4FXS A;  4O9K A;  4GQY A;  5K23 C;  5K24 C;  4UUU A;  3LHH A;  4IY4 A;  3KPD A;  5KS7 A;  2QR1 E;  4NOC A;  4L3V A;  2YZQ A;  3KH5 A;  3PC3 A;  2D4Z A;  3OCO A;  2EF7 A;  3HF7 A;  3FNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...