2P9PA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
412
structure length
388
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGKWIKQYTGINAKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 124
structure length 388
sequence length 412
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pA03
2QWOA 2V52B 3DXMA 5I9EB 1TYQA 3FE1A 1ATSA 3QDKA 4FSVA 3QFPA 3ULEB 2ZGZA 2A5XA 2EWSA 3FZMA 3LM2A 1NGIA 4FWNA 3C7NA 3A5NC 5JICA 1ZC6A 1BDGA 5AQZA 5EVZA 3BEXA 4IJAA 1KXPA 4DCHA 3AAQA 3P4IA 1E4FT 5F1XA 1S22A 2GWKA 1RDWX 4XH1A 2HF3A 4IJNA 1K8KB 3ZX0A 1C0FA 1U2VB 2GWJA 3L4IA 4MO5A 3U8XA 5AQLA 1KAYA 3TU5A 4I6MB 4L3QA 4BRMA 2DPNA 3UKUB 4RCHA 4H0TB 3ZETB 4CZEA 2A6AA 4CI6A 3UKRB 4H5TA 1ATRA 2W40A 3SJHA 3CJCA 4H5WA 4H0XB 1LOTB 3VGLA 4M7XA 5AFUA 4J8FA 1NMDA 4FL9A 5KPRA 5BN8A 2Q31A 3QBWA 2V51B 2ZGYA 5AZJA 1WOQA 3KHYA 3H1QA 1ZXOA 1NM1A 1NGDA 4IZ9A 5B8HA 4M7YA 5F0XA 4BQZA 3BF1A 1SAZA 5AQGA 1NGGA 5BPMA 5LY3A 4EHTA 3W0LA 4JD2B 1KAZA 3HBTA 4H5RA 4FWMA 3EL2A 1GLCG 4BRAA 2IVPA 1Y64A 5ELZA 4ISFA 4E1JA 2A41A 1U6ZA 1RGIA 2BUPA 3DWLA 5AQQA 1HKGA 3U9DA 3VEXA 5ADXA 3EKSA 4IXCA 2Q36A 3ZX3A 3SLCA 2WUSA 4XH5A 2P9SA 1JCFA 2GEMA 3I33A 4BG9A 4EFHA 3BF3A 2ASMA 2CH6A 4CZKA 2FSKA 1G99A 4M63C 3DXMB 4O8KA 1CZAN 1BWFO 3VF6A 4H0PA 1YVNA 4FWOA 1QQMA 2ASOA 3WXLA 5EOYA 3C7NB 3WXJA 1GLLO 4FWSA 1X9JA 1NGJA 4H0VB 4JAXA 1Q18A 4H0YB 1EQYA 4IO8A 5BPNA 4CD3A 3MCPA 4FPBA 3SMSA 3EN9A 4A62A 4BRGA 5FPNA 2FSNA 3VPZA 2J4RA 1MDUB 2W41A 2YHWA 4QS7A 4Y0WA 3R9PA 4BGBA 2QXLA 4CBUA 1S3XA 3MMVA 3QB0A 5AQKA 5CE3A 2QWMA 3A5MC 3QBXA 4NO7A 2QM1A 3M6GA 5LJVA 3R8EA 2AA4A 1BA1A 1T6CA 3LDPA 1MWKA 5E84A 5AQWA 5FPMA 4JHDB 4FOIA 2QWPA 2QW9A 3AAPA 3CIPA 2NRHA 3KVGA 3CJBA 1BO5O 2HOEA 4Z94A 4FOEA 3O1BA 1NWKA 4H0OA 1NGCA 2P9LB 2P9NB 3HM8A 4QS8A 1RFQA 3H46O 3A8YA 5AZJB 3EZWA 4DQ8A 3HZ6A 3W3DA 1NGHA 3MDQA 1KAXA 1P8ZA 2I7NA 3A0IX 3VGMA 4WQ4C 4FO0A 1XQSC 2UYTA 4GNIA 3CETA 4EIAA 3MN9A 1T6DA 5BR9A 5BN9A 3GOIA 4JNEA 4FWKA 1H1VA 2D4WA 1NGAA 1QQNA 5BRDA 4C23A 2P9KB 3LM9A 1HLUA 1QQOA 3FGUA 3WXIA 2I7PA 3ATVA 2P9UA 4A61A 4A2BA 4K41A 5EX5A 5AZIA 2D0PA 3CJ1A 4K43A 2AP1A 3IUCA 3D2FB 1T44A 3O80A 4CZGA 1ZBSA 3WEEA 5AQRA 2P9PB 3RSEA 4B1VA 3ZEUA 5JMVA 1GLBG 4NB4A 3VGKA 1GLEG 1D4XA 4BG8A 3HSCA 2VYPA 3CQYA 3ENHA 4BC5A 1DKGD 3A5LC 4YDUA 5AQOA 4BR7A 1JCEA 1BG3A 3J8AA 3OHRA 1ESVA 4WQ5C 1QZ5A 2NZTA 5ADXH 3H3NO 3IDHA 4B1UB 2ZWHA 3O8MA 4WYBA 1BUPA 2YCHA 4PKGA 4BC3A 4HTLA 3MN6A 3LDQA 2IIRA 2F9TA 5JLHA 3GBTA 4O5FA 2CGLA 3BP8A 5EXWA 5BPLA 5BRHA 5BRFA 5AQYA 3CHWA 4BR2A 4BC4A 2CGKA 3QFUA 4BVOA 2YJEA 3ZX2A 2E2PA 3LL3A 4BRKA 4MLHA 3H3OB 5KPZA 3DAWA 3JXUA 3ULEA 4CZLA 4FPAA 3CJ9A 3VESA 3FLCO 3VOVA 4CZMA 2FLOA 2YHXA 1X3MA 4B9QA 3CJAA 1TYQB 4DHYA 3IMXA 1NBWA 5FPDA 2KHOA 2V7ZA 3D7EO 3WQUA 5AQXA 5AQPA 4PKHA 4AM6A 3G25A 3B8AX 1K8KA 3LDOA 1U2VA 5AQSA 4H5NA 3VF2A 2QWRA 1C0GA 1SQKA 3H45C 4B1ZA 2V7YA 3CQXA 3ZETA 5KQ8A 2P9IA 3MK6A 3IFRA 1V4TA 3UKRA 4BQLA 1HKBA 1XC3A 2YJFA 4CZJA 1BOTO 5F2RA 2Q1NA 4CBXA 4FWQA 4DB3A 1HJOA 1GLFO 2PBDA 4CZFA 4BR0A 2FF3B 3ZEUB 3M1FA 3FZKA 3H1VX 4FWRA 4QS9A 4XH4A 3O6WA 5KQDA 1Z05A 4KBOA 3FZFA 4BR4A 3TPQA 4CD1A 1J6ZA 1SZ2A 1ATNA 2A40A 3MN5A 3L0QA 3FFKB 5JLFA 3QICA 3VEYA 3GG4A 1TUYA 3JS6A 1IJJA 3FZHA 2D1KA 5LJWA 5AQMA 1MA9B 3WQTA 4BRHA 3HI0A 3EO3A 4BRNA 3VEOA 3DJCA 5AFUH 5AQIA 1QHAA 4GY2B 2IVOA 1NGBA 2CH5A 4BRQA 1YAGA 4H03B 2ZF5O 4B1XB 2E1YA 5AQJA 2Q2RA 3A5OC 2P9SB 2VCPA 4EHUA 4F9OA 1NGFA 4JN4A 3QMLA 3VF4A 2IVNA 4AM7A 4BRLA 3UE5A 1E4GT 4CZIA 2FF6A 1X3NA 4IWVA 4ISGA 2Q0UA 2GELA 5AQHA 4BRDA 1DEJA 3SK3A 4ISEA 4PL8A 1TUUA 4RWTA 4BRFA 3CERA 4CJ7A 4CZHA 5FPEA 2PAVA 4LC9B 1V4SA 4MLEA 5AQUA 4EAHD 3AARA 1QZ6A 2E8AA 2P9IB 3O08A 4CBWA 3CJ7A 2A42A 5KPTA 3MN7A 2BTFA 1XUPO 2GUPA 3DXKA 3I8BA 4RTFD 4JHDA 2E2OA 2YHYA 3F9MA 5AR0A 3D2EA 1GLJO 4HWIA 1BU6O 3GE1A 3O1WA 4K25A 3VEVA 3O5BA 4FWPA 1NGEA 2FXUA 5AQTA 4FWLA 2P9LA 2P9NA 5EY4A 3AY9A 3WT0A 3LDNA 2Q0RA 2QWLA 3L6QA 5AQFA 2H3GX 3WUHA 1DGKN 4K42A 2F9WA 3VEZA 1GLDG 4B1WB 5AQVA 2OANA 3U9ZA 3LDLA 5BREA 2P9KA 3UB5A 3VETA 1R59O 4BGAA 2D0OA 4H5VA 1LCUA 2Q97A 4I6MA 3WXKA 2E2NA 3EKUA 3VERA 3SMPA 3D2FA 3VEWA 4WQ4A 3UKUA 3ID8A 1YXQA 2P9UB 3KZBA 4YDUC 2E2QA 5AZIB 1HUXA 1HPMA 2P9PA 4BREA 4MO4A 1WUAA 3GDQA 2VWBA 1GLAG 4BC2A 4BVPA 3U4LA 3WEEB 2E1ZA 3RSEB 1NLVA 3S41A 2QWQA 2GTDA 2QWNA 3FZLA 3GL1A 5E26A 2FSJA 1OKJA 3FR0A 2HMPA 3VENA 1HKCA 4A2AA 4XEIA 1Z6RA 2CGJA 1BA0A 2E88A 3M3ZA 5AQNA 4B1YB 3H6EA 1HX1A 4PL7A 3HTVA 1YUWA 4JD2A 3C0BA 2ASPA 3R6MA 4BRCA 4BR5A 4WQ5A 5TKYA 1IG8A 3DXKB 3ATUA 1MWMA 4PKIA 4BRIA 3D2EB 3CI5A 4BROA 1JCGA 4BR9A 3ENOA 2ITMA 2HF4A 2E20A 3O4WA 2A3ZA 2NLXA 2YI1A 3BUZB 4BRPA
chains in the Genus database with same CATH superfamily
2QWOA 5I9EB 1S1UA 4O55A 3F5TA 3M5RA 4Y1DA 1NJIO 4JS4A 3FZMA 1B9FA 4JKGA 2B5JA 3KKSA 2XY7A 4IJAA 1KXPA 4DCHA 3HOSA 3NH1A 1S22A 5GAHP 2GWKA 1RDWX 1YJ9N 4IJNA 5TKWA 3PIPL 3V9WA 2Z1IA 3U8XA 4FLWA 1L3TA 2R7YA 3TR8A 2A1RA 2DPNA 3NGYA 4RCHA 4UY8O 5J2QA 2A6AA 3NF6A 5SWMA 4JKDA 1BIZA 4Z4HA 3LP0A 3CJCA 4H5WA 4H0XB 1NK0A 4LSLA 4NLBA 5C25A 2LSNA 4DV4K 4J8FA 1NK4A 2NRVA 4FL9A 5KPRA 2YV0X 1ITGA 1S1WA 3QBWA 4KO0A 3ZT3A 4R5PA 2V51B 2ZGYA 4KHNA 4IZ9A 1NGDA 1C0TA 3VQ5A 4M7YA 4BQZA 1NK8A 3RVCA 1NGGA 1D9FA 5GIOA 1IKYA 4FWMA 1TKTA 3EL2A 3L4QA 3CC4N 3MEDA 3C6TA 2IVPA 4F4KA 3LP3A 1HQEA 3DM2A 4ISFA 3SI6A 1RGIA 5ADXA 3VEXA 4DV0K 3EKSA 4DFKA 4XH5A 4O4GA 1U4BA 3WNGA 2P9SA 4CEBA 1JCFA 4EFHA 3MXMA 2Z1HA 3BF3A 2XRIA 4OGEA 2CH6A 4DSIA 4KI6A 3DXMB 3AV9A 1BWFO 4JRPA 3VF6A 2DFFA 4FWOA 2ASOA 3WXLA 3C7NB 1XNRK 3PO4A 4FWSA 4KREA 3O3FA 4Q0BA 4LFBK 1VK0A 5BPNA 4CD3A 3MCPA 4FPBA 2YX6A 5M1KA 4A62A 1C1AA 3ZCMA 1QVGM 2J4RA 1MDUB 2YHWA 4QS7A 4PQUA 4GVMA 3VN5A 3AVMA 4CBUA 1ILYA 3QB0A 3T1AA 2VG6A 3A5MC 4AHVA 5LJVA 1UAXA 3C6HA 4OVLA 3LDPA 1VSMA 3E9PA 5KRSA 3V9ZA 1EO1A 3K0SA 1Z26A 2Y1JA 3J80O 1W0HA 2HOEA 4I9LA 1WSIA 3TTCA 4RG8A 4ZTFA 5C2DA 4B9UA 2P9LB 4QS8A 1YITN 1U04A 3H46O 3A8YA 4F2SA 4KAZA 2FC0A 1XMQK 3EZWA 3HZ6A 1QSLA 3W3DA 1NGHA 4CFAA 3SQ0A 1T6DA 3RMDA 1NGAA 5BRDA 1HNIA 1ASUA 4FZXC 1L3UA 3L3VA 4DU3A 4IEEA 2HHQA 1WAFA 2I7PA 1XNQK 4FVUA 4DV1K 3G6EN 4A61A 4CJUA 4KTZA 3NVMA 4K43A 5CZ2A 4DKWA 2AP1A 2HBKA 1ZBSA 1CXQA 5AQRA 4CHZA 4B1VA 1NKBA 1VQMN 5JMVA 1GLBG 3OVNA 3OJSA 1VRTA 1BIUA 3TI0A 2VYPA 1DKGD 1BI4A 4BR7A 1RT1A 1CZ9A 3OHRA 1ESVA 4B8AB 2NZTA 5ADXH 3H3NO 3IDHA 1VQ6N 2YCHA 1YT3A 4BC3A 4CK2A 3MN6A 3QESA 2EHGA 2F9TA 1BISA 4B9MA 1IO2A 4O5FA 2KW4A 4IBNA 3NH0A 1OVYA 4X65K 3AA3A 2D5RA 1N33K 4LF8K 2YJEA 1HNVA 3ZX2A 4CF8A 3H3OB 5M1PA 3DAWA 4JK9A 4NLCA 3KTQA 3JXUA 4CZLA 3P31A 3OJUA 3FLCO 1J5OA 4CJPA 4CFDA 3HJFA 2FLOA 4CF2A 1RTJA 3CJAA 2HW3A 4B3TK 3HP9A 4KHSA 3TAQA 4M41A 3WQUA 1SL2A 4ID1A 4PKHA 4AM6A 4DTMA 3PX6A 1HNWK 4KRFA 3THXA 5J1EA 1U2VA 4CGDA 4B1ZA 2V7YA 4A5BA 3CQXA 4CCHA 2ZJPL 1V4TA 3KWIA 2YJFA 4DTOA 4CZJA 1YTUA 1JLEA 4CEOA 4AQYK 4DB3A 4DR2K 1HJOA 2O8BA 4KKOA 1GLFO 4G1QA 2KFNA 3CCLN 1RNHA 2FF3B 4CHNA 3B6OA 1IG9A 1QTMA 1EP4A 1OH5A 3H1VX 1KVAA 2RE2A 1WBBA 1U45A 5J2PA 5KQDA 1DTQA 1Z05A 4CD1A 5JENA 4DS4A 1ZBLA 1LWFA 3MECA 1M1KO 1XMOK 1ATNA 1T05A 5M1QA 3S9HA 4AILC 3MN5A 3GG4A 3SJJA 2D1KA 5CY4A 5AQMA 1S1VA 4CGFA 4E3SA 2P5GA 3IKMA 1RTIA 1GOBA 3AO1A 2O8CA 4DG1A 2IVOA 1NGBA 3DLKA 3CXCM 3DOKA 3LANA 5AQJA 2XO7A 2P9SB 1RT7A 2VCPA 1SKRA 2O8FA 3E01A 3V1OA 3D0PA 3CCRN 2VQFK 5HRRA 3QMLA 3VF4A 4BRLA 2QKKA 2F8TA 1RT6A 1E4GT 4ELTA 3M8PA 1HYZA 4CZIA 2FF6A 2UXCK 3LAMA 3SPYA 4PL8A 4BRFA 4CJ7A 3VA3A 3OYFA 4EAHD 2X6NA 1QHTA 5K14A 3NE6A 3CJ7A 1UWBA 1QS4A 2BTFA 3H08A 4I9QA 3DXKA 4RTFD 4JHDA 5AR0A 4HWIA 1BU6O 3GE1A 3P1GA 5DK5A 2HNYA 4FK4A 5AQTA 4LH4A 1U48A 3SQ2A 1G15A 1NJXA 4E1MA 5FRMA 3LDNA 3J81O 2Q0RA 4NCBA 3L6QA 4K42A 3N4QA 3VQ6A 4B1WB 5AQVA 4B8CA 4L8RB 2P9KA 3DLHA 2HSTA 3LZJA 4DV3K 4CFCA 3Q7CA 1R0AA 3LAKA 3JYTA 4H5VA 2Q97A 3WXKA 2E2NA 1RBRA 1IBKK 3D2FA 1NKEA 3P5JA 5HRSA 3AO4A 3KZBA 4B08A 5HOOA 1VQON 2E5LK 4TSXA 2VWBA 1W7AA 3RWUA 3DLBA 4YNQA 4PUOA 3U4LA 1SL0A 1WLJA 1TKXA 4CJ5A 2FSJA 4DR3K 1JLQA 1HKCA 4I2PA 1WSJA 4DTJA 3CM6A 5I42A 1EETA 4LF4K 5GAGP 1BI4B 3OYDA 3QO9A 4M45A 3EYZA 1K8AO 3ZSRA 1YUWA 2G8WA 2ASPA 4W5NA 4O0JA 3CMAN 1LV5A 1IG8A 3CFRA 1MWMA 3KLIA 1TKDA 1N36K 4PKIA 4JRQA 4CEAA 4FZZA 3ENOA 2ITMA 3TSQA 5A2QO 3ISNC 2E20A 4CGHA 4FJ8A 5CYMA 3VMFB 3S3NA 4E89A 4IFYA 2V52B 3DXMA 4CHPA 3QDKA 3K5MA 3OBWA 4EP5A 4JLHA 2ZGZA 2A5XA 2EWSA 2WBNA 3C7NA 2JWLA 3CD6N 4KV8A 3SNNA 2HMIA 1WSHA 3TANA 4F8RA 2QKBA 1LW2A 2Y1IA 4CJLA 3THXB 1U2VB 2GWJA 4WCEL 2ZJRL 4LSNA 2HNDA 3G10A 4C8OA 4FW1A 1NOZA 4DTUA 4H5TA 1ATRA 3F73A 1OH7A 2W40A 4DR6K 2GX9A 4KTQA 3AVGA 1LOTB 3VGLA 4HUGA 5KI6A 2O8BB 3MAQA 5AFUA 3HK2A 3AVKA 1NMDA 2FBVA 3KIOA 4CIFA 1OVQA 4C8KA 4AF1A 3G0ZA 1W2BM 4OPAA 5T7BA 1RBVA 4BDZA 3KHYA 3KLEA 1K6YA 5M1OA 5B8HA 4DTPA 2OPPA 3BF1A 5FLXO 3BDPA 5LY3A 4JI8K 1S1TA 4R79A 1SS6A 4HHTA 4KB0A 3MXJA 3HBTA 1BQNA 2B6AA 1GLCG 3TTDA 1A5VA 1TL3A 4QOZB 4CE9A 1Y64A 4CHOA 4E1JA 4QCLA 2VG7A 4QAGA 4IXCA 4DQRA 3SLCA 2WUSA 4NCGA 4BG9A 1DTTA 5KTQA 4CZKA 3RRHA 4F2RA 4M63C 3ASMA 4GKKK 1YVNA 4ZTJA 4OGCA 2O8FB 4O5BA 1NK6A 5HRPA 3ENBA 1NGJA 1WN7A 5FROA 4H0VB 4JAXA 3NGZA 1NKCA 4FLUA 3C94A 3O9QA 3SMSA 1JL2A 1S1XA 3AVIA 4B3MK 3SBGA 4LY7A 4FJLA 3QEVA 3FFIA 2OPRA 4HCCA 1NK5A 1RDAA 3KK2A 2XY8A 4J2BA 3R8EA 2AA4A 3E1YA 4NYFA 3QEWA 1BA1A 4KH5A 4HCBA 1TL1A 1MWKA 4CJ3A 5AQWA 4FYDA 4JHDB 4IOAL 2QWPA 3VQ7A 3O3GA 3VQEA 3CIPA 3CJBA 4Z94A 3LP1A 4FOEA 1HQUA 4KI4A 4I2QA 3O1BA 3OS2A 2HB5A 4FW2A 1NGCA 3ID6A 4FLVA 3F9KA 4OPJA 1SKWA 1VSKA 1RFQA 4NXMK 4DQ8A 2ZE2A 1I94K 3PY8A 4DSLA 4GNIA 1XQSC 1ZBFA 2FBTA 4EIAA 1KC8O 4PWDA 5BR9A 4EP4A 2YHBA 5BN9A 4FWKA 1H1VA 2D4WA 2P9KB 1HLUA 1QQOA 4A59A 4C1NI 4CK1A 4DUZK 4DTNA 1WB9A 4A2BA 1HNXK 2AJQA 4K41A 5EX5A 5HBMA 1IBMK 4E72A 3O3HA 3AVBA 3CJ1A 3IUCA 3D2FB 1T44A 3HT3A 3O80A 3IG1A 4H4MA 2XY6A 3OYCA 3NF8A 4DV5K 2O4GA 4FJKA 4AHTA 3WNEA 5SZTA 3HP6A 5IT9O 5KGWA 3HSCA 1JLAA 1IBLK 4BC5A 4JKFA 3SUQA 4WQ5C 3OYIA 1QZ5A 4U7BA 3TARA 4DTSA 3RTVA 4B1UB 1ASWA 2ZWHA 3O8MA 2ITGA 4LF5K 1B9DA 4DR5K 4HTLA 2PY5A 2G8KA 3LDQA 3SAHA 1S6QA 3V4IA 2O8DB 5BRFA 5EXWA 4GV3A 5BRHA 3SPZA 5AQYA 2ATQA 4E0DA 4BR2A 2CGKA 3CFOA 3QFUA 4LH5A 4AHSA 3B6PA 1VSFA 5FRNA 3NDKA 1REVA 4BRKA 3QERA 4W5OA 1VQKN 2RF2A 3ULEA 2GUIA 2VGMA 3KK7A 3VESA 4CJEA 4DU4A 3NF7A 3MXIA 5CYQA 4Z4CA 3EE9A 4B9QA 5GAEP 1NBWA 4JI1K 4Z0UA 2V7ZA 1Y97A 3SUNA 4GW6A 3DLLL 3QETA 3B8AX 1S5JA 2XHBA 4CERA 3VF2A 2PYJA 2QWRA 3KLHA 1ZBIA 3V6DA 3N4PA 3D6RA 3ZETA 4KTWA 4DTXA 4M3ZA 3MK6A 3IFRA 2P5OA 3UKRA 1QQCA 1WSFA 4KHQA 1NG9A 5F2RA 3NH2A 3KD5E 2Q1NA 1JJ2M 4CBXA 1KLNA 4BE1A 2UXDK 1ZBHA 2PBDA 3S3OA 4CZFA 3ZEUB 3LWLA 4EZ6A 3MEGA 3M1FA 4B9LA 4PHTX 3T19A 4KB1A 4XH4A 5EU7A 3QIPA 3VTHA 4FXDA 2RN2A 3TPQA 1BL3A 4KPYA 5LL6Z 4YY3K 1KLMA 5HL7L 3L0QA 4E1NA 1WSGA 4CEFA 2KTQA 4RW8A 1IJJA 1MA9B 2F96A 4BWMA 3HI0A 2IDOA 4BRNA 3VEOA 1JL1A 3DJCA 3TABA 4M3XA 4BRQA 1YAGA 4H03B 3A5OC 3MX2A 2OZMA 5H1SQ 1ASVA 1N32K 2IVNA 2F4VK 4BWJA 1QSSA 1DEJA 1RILA 2NRXA 2DTUA 3HYFA 3CQ8A 5CR4A 5DM6L 5FPEA 4LC9B 3AARA 1QZ6A 1RBSA 2E8AA 3NBPA 2KLAA 4DUYK 3K59A 1OH8A 4CBWA 4GV6A 2A42A 1NNEA 3OTOK 3HPGA 2GUPA 3I8BA 1QVFM 3CYMA 3F9MA 3CCSN 1GLJO 3O1WA 4K25A 4B9SA 3O5BA 1NGEA 1U47A 5D3GA 1Q8IA 4C8MA 4JYAK 2GBZA 4AH9A 1WBDA 1EKEA 1BCMA 3VQDA 5JS2A 5AQFA 2F9WA 3VEZA 1GLDG 1O1WA 1O13A 3LPTA 1KQSM 1NU0A 1SV5A 3M8QA 3V9UA 3BGRA 2DY4A 4RW9A 4CIGA 2P51A 3VETA 3R1XA 3AVLA 2W42A 4IFVA 4BGAA 4Z4EA 2D0OA 2W6KA 1LCUA 4I7FA 1XC9A 1EXQA 1SUQA 1YXQA 1RDBA 2F8SA 1JXBA 4JK7A 1HUXA 2C1IA 1HPMA 2P9PA 4MO4A 3GDQA 3NFAA 4HUEA 5C2FA 1GLAG 1XHZA 1VSJA 2D0CA 3S41A 2QWQA 2GTDA 5E26A 4YOWA 4B3RK 5DM7L 1NJZA 4YORA 3NCIA 4A2AA 1CZBA 4XIUA 2A1SA 2E6LA 4XEIA 4E7JA 3G71N 1BA0A 4E19A 4LD0A 4CJVA 3CCJN 1Q86O 1JKHA 1LAWA 3AVHA 3C0BA 4CIEA 4BRCA 4BR5A 4WQ5A 1A5XA 2NUBA 4B3OA 3CI5A 4BROA 3KD1E 2JLEA 2HF4A 4MDBA 4CHYA 5JVHL 3O4WA 2A3ZA 4AHUA 3QIOA 3ULEB 1ATSA 3QFPA 3LM2A 4FWNA 3A5NC 1ZC6A 1KRPA 4CVNE 2HVHA 4X64K 2HHUA 1L3VA 1L5UA 2P1JA 3AAQA 1E4FT 3LDSA 5F1XA 3CCMN 4K8XA 2F7TA 4E7KA 4XH1A 1YI2N 3L3UA 1KSPA 3ZX0A 2HHXA 5AQLA 1KAYA 4GMJB 3TU5A 4I6MB 3RMBA 1VQ4N 4BEBA 4IG0A 3UKUB 3ZETB 4CI6A 5GINA 3UKRB 1Q9YA 3SJHA 3E9OA 3MX5A 3KKRA 4BDPA 4M7XA 3EY1A 3ZYYX 3TAEA 1L3SA 3VA0A 3TWHA 4FLYA 4HTUA 4JV5K 1WOQA 4ID5A 3S3MA 3I0RA 2YKNA 1SAZA 3ULDA 4EHTA 4ZHRA 4IEIA 5C15A 3C65A 3W0LA 4H5RA 3TAFA 2NRTA 3HL8A 3L8BA 4X62K 4WFBL 5ELZA 2A41A 4DLEA 4KH6A 1U6ZA 2BUPA 5AQQA 3UIQA 3QEPA 3U3YA 2Q3SA 2GEMA 3I33A 1S9GA 3CCVN 4CGIA 2FSKA 3LALA 1G99A 3VQAA 1HR0K 3EEQA 4O8KA 3OYJA 3OYMA 1N8RO 4H0PA 1T7PA 4M3WA 1J9AA 1QQMA 5EOYA 4DSFA 2B4JA 3BZKA 1KVCA 1GLLO 3MEEA 4FJ9A 1Q18A 2JGUA 1EQYA 3I8DA 4M3UA 1D9DA 4DMNA 2HHSA 1HNZK 5FPNA 4JK8A 2W41A 2YKMA 4WFNL 4Y0WA 1KFSA 3VTIA 3R9PA 1JLBA 2QXLA 1S3XA 1MU2A 3MMVA 3PSIA 2O8DA 3QBXA 4NO7A 3M6GA 3AVNA 1T6CA 4CW7B 2RHKA 4FOIA 2QW9A 1C0MA 3OYBA 1BHLA 2NRHA 3K9KA 3HO1A 1BO5O 4GVEA 1VQPN 3AVFA 5FDLA 3HM8A 1RTHA 3HRGA 3J7ZO 5AZJB 3MCAB 1C1CA 1KTQA 1T8EA 3A0IX 3AA5X 3VGMA 4FO0A 3ZT2A 3CETA 4O8UA 2YNHA 1BCOA 4CF9A 2HBMA 3SUPA 4C23A 3AGRA 3LM9A 3FGUA 4DQPA 2EX3A 4CJRA 4DLGA 2X6SA 1RBTA 3LWMA 3AO5A 1Q9XA 2BH1A 2P9UA 1N5YA 1CLQA 4UQGA 2D0PA 2QEXN 1NK7A 1K73O 4JKCA 3K57A 4DQIA 4LF6K 2P9PB 3RSEA 3ZEUA 4W5RA 1D5AA 1IV0A 2FBXA 1GLEG 1VQ5N 3IRXA 3CG7A 4OLBA 2YHAA 1BG3A 3J8AA 4OLAA 1XWLA 2YNIA 1IKVA 3C95A 3KK1A 4LFCK 2BANA 2IIRA 4JKEA 5JLHA 3GBTA 2CGLA 2Z1JA 3TSPA 1J54A 4BC4A 3K5OA 4H4OA 3HPOA 1FK9A 1LAVA 3PV8A 3F2KA 3LL3A 3M8RA 5KPZA 1TV6A 4N47A 5HRNA 4N5SA 4FPAA 2C1GA 1RDCA 3CC2N 1VSHA 3HSTB 3VOVA 1RTDA 2YHXA 4B9TA 3TTFA 5FPDA 3DRPA 2KHOA 3D7EO 3VQ9A 4O0IA 4DR1K 2IOCA 4U67L 2X78A 3T3FA 3LZIA 1VSDA 1K8KA 1HRHA 3LDOA 4DF8A 3NF9A 4M42A 1C0GA 3EZ5A 3KJVA 1TK0A 1C0UA 2HBJA 4DR7K 3HXMA 3VQQA 1HKBA 1XC3A 2JWKA 5JS1A 3SBTA 2HHTA 3G4SN 1T03A 3KK3A 1HJRA 2HBLA 2IC3A 5J2MA 3FZKA 1VQNN 3NMUA 2OPQA 3TAGA 3QNNA 4FWRA 4QS9A 4IG3A 4FJMA 5E41A 3L2VA 1VSLA 4KBOA 3FZFA 1J6ZA 4YOUA 4FLTA 1SZ2A 3SQ4A 3V1RA 2VQEK 1RBUA 3DLEA 2FBYA 2A40A 4WE1A 4C8NA 5JLFA 4CGGA 3VEYA 3JAMO 3JS6A 3FZHA 4LF7K 4DR4K 3WQTA 4W5QA 1EX4A 3AVAA 5AFUH 2BGGA 3ZT4A 4A57A 2ETJA 2CH5A 3AGKA 2ZF5O 2RPIA 2E1YA 3OBYA 2Q2RA 4CHQA 4JKBA 1JLGA 3AA4A 4Y1CA 4ILGB 4F9OA 2G8HA 4JN4A 1FKOA 1VAZA 1XHXA 3PX0A 4IWVA 1EWRA 1X3NA 5AQHA 2Q0UA 1Z25A 3I55N 3RR8A 2OYQA 3S5TA 4YOTA 1YVUA 5JVGL 3CC7N 4KFBA 4ISEA 4DSEA 1CXUA 1TUUA 3AVCA 4RWTA 4BY9C 3CERA 4ILHA 4CZHA 3PUFA 2PAVA 2OCEA 1KCFA 3WNHA 4F3TA 1S6PA 3PLAA 1F21A 2P9IB 4FZYA 3O08A 3OYGA 1XUPO 1KFDA 4MDAA 2E2OA 5KGXA 2DFEA 4BACA 2E6MA 4CFBA 3THVA 4FWPA 3DRRA 4CF1A 2FXUA 3OYLA 3THWA 4EZ9A 4AHCA 2DFHA 4FWLA 2P9NA 5C10A 4IO9L 4CEQA 2IS3A 1HYVA 2Z1GA 3J7YP 2H3GX 3WUHA 2OTLN 5LMUK 4JKHA 3U9ZA 2IAJA 3LDLA 1RDUA 3IS9A 5BREA 1WAJA 1X9SA 3LPUA 1RT4A 3U6FA 1IKXA 4V19S 1VQ7N 3SV3A 3VQPA 1NMNA 4I6MA 4NCAA 3EKUA 3SMPA 3C6AA 4LF9K 3UKUA 3ID8A 4CEDA 4YOXA 2P9UB 4C1NK 4JI6K 4YDUC 1RT2A 2E2QA 3L2UA 4DU1A 1KD1O 4PY5A 4BREA 2ZQBA 4FVMA 3K9JA 2D0BA 3L2RA 4K0KK 4BC2A 1YJNN 3E9LA 5C12A 2E1ZA 3RSEB 2VWJA 3R3LA 2QWNA 1OKJA 3CFPA 1X1PA 3VENA 3HPHA 3SYZA 2WOMA 2UUBK 3ZSXA 1YIJN 4JI3K 3OYEA 2CGJA 4JI2K 3M3ZA 5AQNA 2O8EB 2NRRA 4CEZA 4B9NA 3H6EA 1HX1A 3PO5A 4DQSA 2HNZA 2GV9A 3P39A 1QSYA 1FKPA 4DS5A 3R6MA 3HVRA 4G9ZA 4JI0K 5TKYA 3ATUA 2UUCK 3OYAA 2G8FA 4BRIA 3CCEN 3D2EB 3K2PA 3O9UA 3ZSOA 4N56A 1A5WA 3ZSYA 4MFBA 2NLXA 3V1QA 4BRPA 4H8KA 3VQBA 1TYQA 3FE1A 4FSVA 2VG5A 4IDHA 5AJ3K 3EE8A 1NGIA 5JICA 1TK8A 1BDGA 5AQZA 5EVZA 2G8IA 4DWIA 3BEXA 4NXNK 5MLCQ 4FJJA 3P4IA 4C8LA 1IH7A 4IDKA 3BY5A 1JXEA 2HF3A 5DMRA 1K8KB 5M1FA 1C0FA 4GKJK 3L4IA 4MO5A 3CM5A 1OH6A 4ILJA 3CMEN 2G8UA 4BRMA 4L3QA 3SQ1A 5HLFA 2QXFA 4WF9L 4H0TB 4CZEA 2I5JA 4YOVA 3ALYA 2RKIA 3DLRA 4M3TA 4F3OA 1J53A 4J2EA 2PZSA 3WXMB 4FJXA 2WONA 3T69A 1X9WA 1B92A 4A5AA 3SV4A 4DFMA 3PIOL 4N76A 4E7IA 5BN8A 2Q31A 1TAUA 5IWAK 3C6UA 4CGJA 1Q81O 4ICLA 5AZJA 3I0SA 3H1QA 1ZXOA 1NM1A 5F0XA 1QE1A 5AQGA 4FCYA 5BPMA 3P38A 3T7ZA 4JS5A 3CCQN 4CJ4A 4B9VA 4JD2B 1KAZA 5CHIA 4E7HA 3AO2A 4BRAA 3CYGA 3OYKA 5HROA 3K58A 1WSEA 2D0AA 3DWLA 3K5LA 3U9DA 1HKGA 1GOAA 4RW6A 2Q36A 3ZX3A 4MQ3A 3QEIA 4FK2A 1XI1A 2ASMA 3BZCA 4YOYA 3ZSVA 1DLOA 3TAPA 1BQMA 3KLGA 1CZAN 2YNGA 4DQQA 1LWCA 2NRZA 3E66A 4JKGB 2KQ2A 3WXJA 1X9JA 2W6LA 4H0YB 1RCHA 4JEPA 4IO8A 3M8SA 1D8YA 4DFPA 3QEXA 3EN9A 1SL1A 4BRGA 2FSNA 3VPZA 3VQ8A 4BECA 4BGBA 3SAGA 5AQKA 5CE3A 2QWMA 1UA1A 2E4LA 2KKZA 2QM1A 2VWKA 3RRGA 4PA1A 5E84A 5FPMA 4KHUA 3DYAA 3AAPA 2O4IA 3KVGA 4K8ZA 2PFUA 1X9MA 3THWB 1NWKA 2X74A 4H0OA 1P90A 2P9NB 3HVTA 3CF5L 3MDQA 4DV6K 4JKAA 2G8VA 5I3UA 1KAXA 1P8ZA 2I7NA 2NRWA 4IOCL 4WQ4C 2UYTA 3MN9A 3HM9A 1FW6A 3ITHA 3GOIA 4JNEA 3U3GA 1QQNA 4CEEA 4FJ5A 4ELVA 3WXIA 1FXXA 3TAMA 5M1NA 4CESA 3ATVA 4BE7B 4OPHA 5AZIA 4BDYA 3T1HK 3SAFA 3AA2A 1UA0A 4KHWA 2YNFA 4CZGA 4CJWA 3WEEA 4J2DA 5J2NA 4CECA 1W9HA 4CJKA 2IGIA 4NB4A 3VGKA 4BG8A 1D4XA 3CQYA 3ENHA 3A5LC 4YDUA 3P83D 3V9SA 5AQOA 1E3MA 4CJQA 1JCEA 2NNWA 1I39A 3ZSQA 3AO3A 4DFJA 1VQ8N 1TK5A 3DRSA 4WYBA 1BUPA 4PKGA 2KZZA 4CK3A 3L2WA 4JI4K 3IAYA 3BP8A 5BPLA 4OJRA 2HVIA 1VHXA 1RDDA 2BE2A 3CHWA 3THYA 1NOYA 4BVOA 4FJHA 5BR8K 4AHRA 4CJTA 2E2PA 3DMJA 4RW7A 4MLHA 1VQLN 4CF0A 1U49A 3VQCA 4E7LA 1Q7YO 3CJ9A 4KH4A 1TKZA 4ELUA 4JI7K 3QINA 2QI2A 4CZMA 1YTAA 2OPSA 3DI6A 4FJGA 4OO1J 1X3MA 3OY9A 1J5EK 2HHHK 4FJ7A 1TYQB 4DHYA 3IMXA 1K9MO 3CCUN 3TSUA 5AQXA 5AQPA 3K5NA 1ZBUA 1VSIA 3OYHA 3G25A 3VQ4A 1VQ9N 5AQSA 4H5NA 1SQKA 3H45C 4N41A 5C0YA 4DF4A 5KQ8A 1LW0A 2P9IA 4BQLA 4J2AA 4KHYA 4OKKA 4Z4GA 2KZMA 3V9XA 3OA9A 1BOTO 3NVKA 5GADP 4NYNA 4DV7K 4FWQA 3RMAA 2QTDA 3MWTA 4BR0A 1WNSA 2WC9A 3PSFA 4WFAL 1KVBA 1TAQA 4IOXA 1EWQA 4BE2A 3O6WA 5C24A 4FJNA 3NGIA 1HMVA 4BR4A 1N6QA 4GV9A 3V81A 3J7AP 3RMCA 2HHIA 1HYSA 1TGOA 3A2FA 3QLHA 3OS1A 3FFKB 3QICA 5LMNK 1TUYA 1I3AA 5LJWA 2VGNA 3LP2A 2ZM6K 4BRHA 4M3RA 2BDPA 3EO3A 4OX9K 1YJWN 4OKJA 5AQIA 1QHAA 4GY2B 4HVJA 4DTRA 4FLZA 1SKSA 3NAEA 4FJIA 2OTJN 4B1XB 2HHWA 3SUOA 3ZSWA 2QK9A 3L2QA 4EHUA 2XY5A 1NGFA 4CJFA 4B3SK 3Q7BA 4AM7A 3UE5A 5GIPA 4ISGA 4BRDA 2GELA 4OPKA 4IKFA 2PYLA 4YHHK 3SK3A 4FM2A 3QNOA 2KFZA 2HHVA 3JSMA 3D45A 1ZYQA 1NK9A 2O8EA 4MLEA 1V4SA 2ZD1A 5AQUA 2WTUA 4Z4FA 1C1BA 3O9TA 5C42A 5KPTA 3CPWM 1DT9A 3MN7A 4X66K 3WNFA 3DLGA 4LFAK 4DSKA 4O44A 3KLFA 2YHYA 3D2EA 1UOCA 2OZSA 3DOLA 3VEVA 4Q5VA 3SCXA 3O9SA 2P9LA 4DV2K 5EY4A 3AY9A 1JLCA 3WT0A 4YFUA 2OA8A 3SZ2A 2QWLA 4Z4IA 1DGKN 4XJXA 1YF5L 4IFEA 1RT3A 2OANA 1VRUA 4FLXA 3OS0A 4M3YA 2UUAK 3RR7A 3UB5A 3NHGA 1R59O 2ZJQL 1JLFA 1VSEA 2WFBA 3O4QA 4FM0A 3VERA 4BE0A 3VEWA 4WQ4A 1NJWA 2O8CB 1IKWA 4HUFA 1Q82O 5AZIB 3ZSZA 1GOCA 3ZLJA 1C6VA 1LWEA 1WUAA 2UXBK 1W97L 1TVRA 3KWGA 3HOTA 1HPZA 4KHPK 3CPEA 4BVPA 3WEEB 1S72N 1N34K 1NLVA 4W5TA 3FZLA 3GL1A 3O4NA 4JI5K 1NJYA 1RT5A 3O9RA 3FR0A 2HMPA 1T3VA 4OKEA 5KRTA 2UU9K 1Z6RA 4CJSA 2E88A 4DSJA 1S9EA 4B1YB 5HP1A 1BGXT 4FK0A 4PL7A 3AVJA 3HTVA 3ZT0A 3OW2M 4JD2A 3ZT1A 4FM1A 5CZ1A 3T1YK 3DXKB 3I56N 1M90O 1FJGK 3MWPA 3PX4A 1JCGA 4BR9A 3THYB 2W00A 2QA4N 1YHQN 4RW4A 2YI1A 3BUZB 3OYNA
chains in the Genus database with same CATH topology
2QWOA 2V52B 3DXMA 5I9EB 1TYQA 3FE1A 1ATSA 3QDKA 3F5TA 3QFPA 4FSVA 3M5RA 3OBWA 4IDHA 3ULEB 1NJIO 2ZGZA 2A5XA 2EWSA 3EE8A 3FZMA 1NGIA 2WBNA 3LM2A 3C7NA 3A5NC 4FWNA 1ZC6A 4JKGA 1BDGA 5AQZA 5EVZA 5JICA 2JWLA 3CD6N 3BEXA 4IJAA 1KXPA 4DCHA 3HOSA 5MLCQ 3AAQA 3P4IA 1E4FT 5F1XA 3CCMN 1S22A 5GAHP 2GWKA 1RDWX 2F7TA 4XH1A 1YJ9N 1YI2N 2HF3A 4IJNA 5TKWA 3PIPL 1K8KB 3ZX0A 5M1FA 1C0FA 1U2VB 2GWJA 3L4IA 4MO5A 4ILJA 3U8XA 5AQLA 4WCEL 2ZJRL 1KAYA 3CMEN 3TU5A 4I6MB 4L3QA 4BRMA 1VQ4N 4BEBA 2DPNA 3UKUB 4RCHA 4H0TB 4WF9L 4UY8O 3ZETB 4CZEA 2A6AA 4CI6A 5GINA 4JKDA 3UKRB 4YOVA 4H5TA 1ATRA 2W40A 3SJHA 3CJCA 4H5WA 3E9OA 2GX9A 3MX5A 4H0XB 1LOTB 4NLBA 3WXMB 3VGLA 3T69A 4M7XA 5AFUA 4A5AA 4J8FA 2NRVA 3ZYYX 3PIOL 1NMDA 4FL9A 4AF1A 5KPRA 5BN8A 2Q31A 1W2BM 3QBWA 4OPAA 2V51B 2ZGYA 1Q81O 5AZJA 1WOQA 3KHYA 3H1QA 1ZXOA 1NM1A 1NGDA 4IZ9A 5M1OA 5B8HA 4M7YA 5F0XA 4BQZA 3BF1A 1SAZA 3RVCA 5AQGA 1NGGA 5BPMA 3P38A 5LY3A 5GIOA 3T7ZA 4R79A 4EHTA 1SS6A 3CCQN 4IEIA 5C15A 3C65A 3W0LA 4JD2B 1KAZA 3HBTA 4H5RA 4FWMA 5CHIA 3EL2A 3L4QA 3TTDA 1GLCG 2NRTA 3CC4N 4BRAA 2IVPA 1Y64A 4WFBL 5ELZA 4ISFA 4E1JA 2A41A 4KH6A 1U6ZA 1RGIA 2BUPA 3DWLA 5AQQA 1HKGA 3U9DA 3VEXA 5ADXA 3EKSA 4IXCA 2Q36A 3ZX3A 3SLCA 2WUSA 4XH5A 2P9SA 1JCFA 2GEMA 3I33A 4BG9A 4EFHA 3BF3A 2ASMA 3CCVN 4YOYA 2CH6A 4CZKA 2FSKA 1G99A 4M63C 3DXMB 4O8KA 1CZAN 1BWFO 1N8RO 3VF6A 4H0PA 1YVNA 4FWOA 1QQMA 2NRZA 2ASOA 3WXLA 3E66A 3C7NB 5EOYA 4JKGB 3WXJA 1GLLO 4FWSA 1X9JA 1NGJA 3ENBA 4H0VB 4JAXA 1Q18A 4H0YB 1EQYA 4JEPA 4IO8A 5BPNA 4CD3A 3O9QA 3MCPA 4FPBA 3SMSA 2YX6A 3EN9A 5M1KA 4A62A 4BRGA 5FPNA 2FSNA 3VPZA 4JK8A 3SBGA 1QVGM 2J4RA 1MDUB 2W41A 2YHWA 4QS7A 4WFNL 4BECA 4Y0WA 3VTIA 3R9PA 4BGBA 2QXLA 4CBUA 1ILYA 1S3XA 3MMVA 3QB0A 3SAGA 5AQKA 5CE3A 2QWMA 3A5MC 3QBXA 4NO7A 2KKZA 2QM1A 3M6GA 5LJVA 3R8EA 2AA4A 3E1YA 1BA1A 4KH5A 1T6CA 3C6HA 3LDPA 1MWKA 5E84A 5AQWA 5FPMA 4JHDB 4IOAL 2RHKA 2QWPA 4FOIA 2QW9A 3AAPA 3E9PA 3CIPA 1EO1A 2NRHA 3K9KA 3KVGA 2PFUA 3CJBA 1BO5O 2HOEA 4GVEA 4Z94A 3TTCA 4FOEA 1VQPN 3O1BA 1NWKA 5C2DA 4H0OA 1NGCA 1P90A 2P9LB 2P9NB 3HM8A 3ID6A 4QS8A 1YITN 3HRGA 1RFQA 3H46O 3A8YA 3J7ZO 3CF5L 5AZJB 3MCAB 3EZWA 4DQ8A 3HZ6A 3W3DA 1NGHA 3MDQA 4JKAA 1KAXA 1P8ZA 2I7NA 2NRWA 3A0IX 4WQ4C 3VGMA 4FO0A 1XQSC 2UYTA 4GNIA 3CETA 4EIAA 3MN9A 4O8UA 1KC8O 1T6DA 5BR9A 5BN9A 3GOIA 4JNEA 4FWKA 1H1VA 2D4WA 1NGAA 1QQNA 2HBMA 5BRDA 4C23A 2P9KB 3AGRA 3LM9A 1HLUA 1QQOA 3FGUA 3WXIA 4A59A 4C1NI 5M1NA 4IEEA 2I7PA 4FVUA 3ATVA 4BE7B 2BH1A 3G6EN 2P9UA 4OPHA 4A61A 4A2BA 4K41A 5EX5A 5AZIA 3SAFA 2D0PA 3NVMA 3CJ1A 4K43A 4DKWA 2QEXN 2AP1A 3IUCA 2HBKA 3D2FB 1T44A 1K73O 3O80A 4CZGA 4JKCA 1ZBSA 3WEEA 5AQRA 2P9PB 3RSEA 4B1VA 3ZEUA 5JMVA 1VQMN 1GLBG 4NB4A 3VGKA 1GLEG 1D4XA 4BG8A 3HSCA 2VYPA 3CQYA 3ENHA 4BC5A 4JKFA 1VQ5N 1DKGD 3A5LC 4YDUA 5AQOA 4BR7A 1JCEA 2NNWA 1BG3A 3J8AA 3OHRA 1ESVA 4WQ5C 1QZ5A 2NZTA 4U7BA 5ADXH 1VQ8N 3H3NO 3IDHA 1VQ6N 4B1UB 2ZWHA 3O8MA 4WYBA 1BUPA 2YCHA 4PKGA 4BC3A 4HTLA 3MN6A 3LDQA 2IIRA 2F9TA 4JKEA 3SAHA 5JLHA 3GBTA 4O5FA 2CGLA 3BP8A 5EXWA 5BPLA 5BRHA 5BRFA 4GV3A 5AQYA 3TSPA 1OVYA 3CHWA 4BR2A 4BC4A 2CGKA 3QFUA 4BVOA 2YJEA 3ZX2A 2E2PA 3F2KA 3LL3A 4BRKA 4MLHA 3H3OB 5M1PA 3DAWA 5KPZA 1VQKN 4JK9A 4NLCA 1VQLN 3JXUA 3ULEA 4CZLA 4FPAA 1Q7YO 2VGMA 3CJ9A 3P31A 3KK7A 4KH4A 4IOCL 2C1GA 3VESA 3FLCO 3CC2N 2QI2A 3VOVA 4CZMA 2FLOA 2YHXA 4OO1J 1X3MA 3EE9A 4B9QA 5GAEP 3CJAA 1TYQB 4DHYA 3IMXA 1NBWA 3TTFA 1K9MO 5FPDA 2KHOA 2V7ZA 3D7EO 3TSUA 3CCUN 3WQUA 4U67L 5AQXA 5AQPA 4PKHA 4AM6A 3DLLL 1VQ9N 3G25A 3B8AX 1K8KA 3LDOA 1U2VA 5AQSA 4H5NA 3VF2A 2QWRA 1C0GA 1SQKA 3H45C 5C0YA 2HBJA 4B1ZA 2V7YA 3N4PA 4A5BA 3CQXA 3D6RA 3ZETA 5KQ8A 2P9IA 2ZJPL 3MK6A 3IFRA 1V4TA 3UKRA 3KWIA 4BQLA 1HKBA 1XC3A 2JWKA 2YJFA 4CZJA 3OA9A 1BOTO 3SBTA 5F2RA 2Q1NA 3NVKA 5GADP 1JJ2M 4CBXA 4FWQA 3G4SN 4DB3A 1HJOA 4XJXA 1GLFO 2PBDA 2QTDA 3MWTA 3CCLN 4CZFA 4BR0A 2FF3B 3ZEUB 2HBLA 2WC9A 3M1FA 3FZKA 4PHTX 4WFAL 1VQNN 3H1VX 3NMUA 4IOXA 2RE2A 4FWRA 4QS9A 4XH4A 3O6WA 5KQDA 3VTHA 1Z05A 4KBOA 3FZFA 4BR4A 3TPQA 4CD1A 1J6ZA 4GV9A 4YOUA 1SZ2A 1M1KO 1ATNA 5M1QA 2A40A 3MN5A 3L0QA 3FFKB 5JLFA 5HL7L 3QICA 3VEYA 3GG4A 1TUYA 3JS6A 1IJJA 3FZHA 2D1KA 5LJWA 2VGNA 5AQMA 1MA9B 3WQTA 4BRHA 3HI0A 3IKMA 3EO3A 4BRNA 1YJWN 3VEOA 3DJCA 5AFUH 5AQIA 1QHAA 4GY2B 4A57A 2IVOA 1NGBA 2CH5A 4BRQA 1YAGA 4H03B 3AGKA 2ZF5O 4B1XB 3CXCM 2E1YA 5AQJA 3OBYA 2OTJN 2Q2RA 3A5OC 3MX2A 2P9SB 2VCPA 4JKBA 5H1SQ 4ILGB 4EHUA 4F9OA 3CCRN 1NGFA 4JN4A 3QMLA 1VAZA 3Q7BA 3VF4A 2IVNA 4AM7A 4BRLA 3UE5A 1E4GT 5GIPA 4CZIA 2FF6A 1X3NA 4IWVA 4ISGA 2Q0UA 2GELA 5AQHA 4BRDA 3I55N 4YOTA 5JVGL 1DEJA 3SK3A 3CC7N 4ISEA 2NRXA 4PL8A 1TUUA 4RWTA 4BY9C 4BRFA 3CERA 4CJ7A 5CR4A 4ILHA 4CZHA 5DM6L 5FPEA 2PAVA 4LC9B 1V4SA 4MLEA 5AQUA 4EAHD 3AARA 1QZ6A 2E8AA 3PLAA 2KLAA 2P9IB 3O08A 4CBWA 3CJ7A 3O9TA 4GV6A 2A42A 5KPTA 3CPWM 1DT9A 3MN7A 2BTFA 1XUPO 2GUPA 3DXKA 3I8BA 4MDAA 4RTFD 4JHDA 2E2OA 1QVFM 2YHYA 3F9MA 5AR0A 3D2EA 3CCSN 1GLJO 4HWIA 1BU6O 3GE1A 3O1WA 4K25A 3VEVA 3O5BA 4FWPA 1NGEA 2FXUA 5AQTA 3O9SA 4FWLA 2P9LA 2P9NA 5EY4A 3AY9A 5C10A 3WT0A 4IO9L 3LDNA 2Q0RA 2QWLA 3L6QA 5AQFA 2H3GX 3WUHA 1DGKN 4K42A 2OTLN 1YF5L 2F9WA 1GLDG 3N4QA 4IFEA 3VEZA 4B1WB 5AQVA 2OANA 4JKHA 3U9ZA 1O13A 3LDLA 1RDUA 5BREA 1KQSM 2P9KA 3UB5A 2HSTA 3VETA 3R1XA 1R59O 2ZJQL 3Q7CA 4BGAA 2D0OA 4H5VA 1VQ7N 1LCUA 2WFBA 2Q97A 4I6MA 3WXKA 2E2NA 3EKUA 3VERA 3SMPA 3C6AA 3D2FA 3VEWA 4WQ4A 3UKUA 3ID8A 4YOXA 1YXQA 2P9UB 4C1NK 3KZBA 4YDUC 5HOOA 2E2QA 4JK7A 1VQON 5AZIB 1HUXA 1Q82O 1HPMA 2P9PA 4BREA 4MO4A 1KD1O 2C1IA 1WUAA 3GDQA 3K9JA 1W97L 2VWBA 5C2FA 3KWGA 1GLAG 3HOTA 4BC2A 3CPEA 4BVPA 3U4LA 3WEEB 1YJNN 3E9LA 1S72N 5C12A 2E1ZA 3RSEB 1NLVA 3S41A 2QWQA 3R3LA 2GTDA 2QWNA 3FZLA 3GL1A 5E26A 2FSJA 4YOWA 1OKJA 3O9RA 5DM7L 3FR0A 2HMPA 4YORA 1T3VA 1HKCA 3VENA 4A2AA 4XEIA 1YIJN 3G71N 5GAGP 1Z6RA 2CGJA 1BA0A 2E88A 3M3ZA 5AQNA 4B1YB 2NRRA 3H6EA 1HX1A 3CCJN 1Q86O 1K8AO 4PL7A 3P39A 3HTVA 3OW2M 1YUWA 4JD2A 3C0BA 2ASPA 3R6MA 4BRCA 4BR5A 3CMAN 4G9ZA 4WQ5A 5TKYA 1IG8A 3DXKB 3I56N 3ATUA 1MWMA 4PKIA 4BRIA 3CCEN 3D2EB 1M90O 3CI5A 3MWPA 4BROA 1JCGA 3O9UA 4BR9A 3ENOA 2ITMA 3TSQA 2HF4A 4MDBA 2W00A 2E20A 5JVHL 3O4WA 2A3ZA 2QA4N 1YHQN 2NLXA 3VMFB 2YI1A 3BUZB 4BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO A;  2V52 B;  3DXM A;  5I9E B;  1TYQ A;  3FE1 A;  1ATS A;  3QDK A;  4FSV A;  3QFP A;  3ULE B;  2ZGZ A;  2A5X A;  2EWS A;  3FZM A;  3LM2 A;  1NGI A;  4FWN A;  3C7N A;  3A5N C;  5JIC A;  1ZC6 A;  1BDG A;  5AQZ A;  5EVZ A;  3BEX A;  4IJA A;  1KXP A;  4DCH A;  3AAQ A;  3P4I A;  1E4F T;  5F1X A;  1S22 A;  2GWK A;  1RDW X;  4XH1 A;  2HF3 A;  4IJN A;  1K8K B;  3ZX0 A;  1C0F A;  1U2V B;  2GWJ A;  3L4I A;  4MO5 A;  3U8X A;  5AQL A;  1KAY A;  3TU5 A;  4I6M B;  4L3Q A;  4BRM A;  2DPN A;  3UKU B;  4RCH A;  4H0T B;  3ZET B;  4CZE A;  2A6A A;  4CI6 A;  3UKR B;  4H5T A;  1ATR A;  2W40 A;  3SJH A;  3CJC A;  4H5W A;  4H0X B;  1LOT B;  3VGL A;  4M7X A;  5AFU A;  4J8F A;  1NMD A;  4FL9 A;  5KPR A;  5BN8 A;  2Q31 A;  3QBW A;  2V51 B;  2ZGY A;  5AZJ A;  1WOQ A;  3KHY A;  3H1Q A;  1ZXO A;  1NM1 A;  1NGD A;  4IZ9 A;  5B8H A;  4M7Y A;  5F0X A;  4BQZ A;  3BF1 A;  1SAZ A;  5AQG A;  1NGG A;  5BPM A;  5LY3 A;  4EHT A;  3W0L A;  4JD2 B;  1KAZ A;  3HBT A;  4H5R A;  4FWM A;  3EL2 A;  1GLC G;  4BRA A;  2IVP A;  1Y64 A;  5ELZ A;  4ISF A;  4E1J A;  2A41 A;  1U6Z A;  1RGI A;  2BUP A;  3DWL A;  5AQQ A;  1HKG A;  3U9D A;  3VEX A;  5ADX A;  3EKS A;  4IXC A;  2Q36 A;  3ZX3 A;  3SLC A;  2WUS A;  4XH5 A;  2P9S A;  1JCF A;  2GEM A;  3I33 A;  4BG9 A;  4EFH A;  3BF3 A;  2ASM A;  2CH6 A;  4CZK A;  2FSK A;  1G99 A;  4M63 C;  3DXM B;  4O8K A;  1CZA N;  1BWF O;  3VF6 A;  4H0P A;  1YVN A;  4FWO A;  1QQM A;  2ASO A;  3WXL A;  5EOY A;  3C7N B;  3WXJ A;  1GLL O;  4FWS A;  1X9J A;  1NGJ A;  4H0V B;  4JAX A;  1Q18 A;  4H0Y B;  1EQY A;  4IO8 A;  5BPN A;  4CD3 A;  3MCP A;  4FPB A;  3SMS A;  3EN9 A;  4A62 A;  4BRG A;  5FPN A;  2FSN A;  3VPZ A;  2J4R A;  1MDU B;  2W41 A;  2YHW A;  4QS7 A;  4Y0W A;  3R9P A;  4BGB A;  2QXL A;  4CBU A;  1S3X A;  3MMV A;  3QB0 A;  5AQK A;  5CE3 A;  2QWM A;  3A5M C;  3QBX A;  4NO7 A;  2QM1 A;  3M6G A;  5LJV A;  3R8E A;  2AA4 A;  1BA1 A;  1T6C A;  3LDP A;  1MWK A;  5E84 A;  5AQW A;  5FPM A;  4JHD B;  4FOI A;  2QWP A;  2QW9 A;  3AAP A;  3CIP A;  2NRH A;  3KVG A;  3CJB A;  1BO5 O;  2HOE A;  4Z94 A;  4FOE A;  3O1B A;  1NWK A;  4H0O A;  1NGC A;  2P9L B;  2P9N B;  3HM8 A;  4QS8 A;  1RFQ A;  3H46 O;  3A8Y A;  5AZJ B;  3EZW A;  4DQ8 A;  3HZ6 A;  3W3D A;  1NGH A;  3MDQ A;  1KAX A;  1P8Z A;  2I7N A;  3A0I X;  3VGM A;  4WQ4 C;  4FO0 A;  1XQS C;  2UYT A;  4GNI A;  3CET A;  4EIA A;  3MN9 A;  1T6D A;  5BR9 A;  5BN9 A;  3GOI A;  4JNE A;  4FWK A;  1H1V A;  2D4W A;  1NGA A;  1QQN A;  5BRD A;  4C23 A;  2P9K B;  3LM9 A;  1HLU A;  1QQO A;  3FGU A;  3WXI A;  2I7P A;  3ATV A;  2P9U A;  4A61 A;  4A2B A;  4K41 A;  5EX5 A;  5AZI A;  2D0P A;  3CJ1 A;  4K43 A;  2AP1 A;  3IUC A;  3D2F B;  1T44 A;  3O80 A;  4CZG A;  1ZBS A;  3WEE A;  5AQR A;  2P9P B;  3RSE A;  4B1V A;  3ZEU A;  5JMV A;  1GLB G;  4NB4 A;  3VGK A;  1GLE G;  1D4X A;  4BG8 A;  3HSC A;  2VYP A;  3CQY A;  3ENH A;  4BC5 A;  1DKG D;  3A5L C;  4YDU A;  5AQO A;  4BR7 A;  1JCE A;  1BG3 A;  3J8A A;  3OHR A;  1ESV A;  4WQ5 C;  1QZ5 A;  2NZT A;  5ADX H;  3H3N O;  3IDH A;  4B1U B;  2ZWH A;  3O8M A;  4WYB A;  1BUP A;  2YCH A;  4PKG A;  4BC3 A;  4HTL A;  3MN6 A;  3LDQ A;  2IIR A;  2F9T A;  5JLH A;  3GBT A;  4O5F A;  2CGL A;  3BP8 A;  5EXW A;  5BPL A;  5BRH A;  5BRF A;  5AQY A;  3CHW A;  4BR2 A;  4BC4 A;  2CGK A;  3QFU A;  4BVO A;  2YJE A;  3ZX2 A;  2E2P A;  3LL3 A;  4BRK A;  4MLH A;  3H3O B;  5KPZ A;  3DAW A;  3JXU A;  3ULE A;  4CZL A;  4FPA A;  3CJ9 A;  3VES A;  3FLC O;  3VOV A;  4CZM A;  2FLO A;  2YHX A;  1X3M A;  4B9Q A;  3CJA A;  1TYQ B;  4DHY A;  3IMX A;  1NBW A;  5FPD A;  2KHO A;  2V7Z A;  3D7E O;  3WQU A;  5AQX A;  5AQP A;  4PKH A;  4AM6 A;  3G25 A;  3B8A X;  1K8K A;  3LDO A;  1U2V A;  5AQS A;  4H5N A;  3VF2 A;  2QWR A;  1C0G A;  1SQK A;  3H45 C;  4B1Z A;  2V7Y A;  3CQX A;  3ZET A;  5KQ8 A;  2P9I A;  3MK6 A;  3IFR A;  1V4T A;  3UKR A;  4BQL A;  1HKB A;  1XC3 A;  2YJF A;  4CZJ A;  1BOT O;  5F2R A;  2Q1N A;  4CBX A;  4FWQ A;  4DB3 A;  1HJO A;  1GLF O;  2PBD A;  4CZF A;  4BR0 A;  2FF3 B;  3ZEU B;  3M1F A;  3FZK A;  3H1V X;  4FWR A;  4QS9 A;  4XH4 A;  3O6W A;  5KQD A;  1Z05 A;  4KBO A;  3FZF A;  4BR4 A;  3TPQ A;  4CD1 A;  1J6Z A;  1SZ2 A;  1ATN A;  2A40 A;  3MN5 A;  3L0Q A;  3FFK B;  5JLF A;  3QIC A;  3VEY A;  3GG4 A;  1TUY A;  3JS6 A;  1IJJ A;  3FZH A;  2D1K A;  5LJW A;  5AQM A;  1MA9 B;  3WQT A;  4BRH A;  3HI0 A;  3EO3 A;  4BRN A;  3VEO A;  3DJC A;  5AFU H;  5AQI A;  1QHA A;  4GY2 B;  2IVO A;  1NGB A;  2CH5 A;  4BRQ A;  1YAG A;  4H03 B;  2ZF5 O;  4B1X B;  2E1Y A;  5AQJ A;  2Q2R A;  3A5O C;  2P9S B;  2VCP A;  4EHU A;  4F9O A;  1NGF A;  4JN4 A;  3QML A;  3VF4 A;  2IVN A;  4AM7 A;  4BRL A;  3UE5 A;  1E4G T;  4CZI A;  2FF6 A;  1X3N A;  4IWV A;  4ISG A;  2Q0U A;  2GEL A;  5AQH A;  4BRD A;  1DEJ A;  3SK3 A;  4ISE A;  4PL8 A;  1TUU A;  4RWT A;  4BRF A;  3CER A;  4CJ7 A;  4CZH A;  5FPE A;  2PAV A;  4LC9 B;  1V4S A;  4MLE A;  5AQU A;  4EAH D;  3AAR A;  1QZ6 A;  2E8A A;  2P9I B;  3O08 A;  4CBW A;  3CJ7 A;  2A42 A;  5KPT A;  3MN7 A;  2BTF A;  1XUP O;  2GUP A;  3DXK A;  3I8B A;  4RTF D;  4JHD A;  2E2O A;  2YHY A;  3F9M A;  5AR0 A;  3D2E A;  1GLJ O;  4HWI A;  1BU6 O;  3GE1 A;  3O1W A;  4K25 A;  3VEV A;  3O5B A;  4FWP A;  1NGE A;  2FXU A;  5AQT A;  4FWL A;  2P9L A;  2P9N A;  5EY4 A;  3AY9 A;  3WT0 A;  3LDN A;  2Q0R A;  2QWL A;  3L6Q A;  5AQF A;  2H3G X;  3WUH A;  1DGK N;  4K42 A;  2F9W A;  3VEZ A;  1GLD G;  4B1W B;  5AQV A;  2OAN A;  3U9Z A;  3LDL A;  5BRE A;  2P9K A;  3UB5 A;  3VET A;  1R59 O;  4BGA A;  2D0O A;  4H5V A;  1LCU A;  2Q97 A;  4I6M A;  3WXK A;  2E2N A;  3EKU A;  3VER A;  3SMP A;  3D2F A;  3VEW A;  4WQ4 A;  3UKU A;  3ID8 A;  1YXQ A;  2P9U B;  3KZB A;  4YDU C;  2E2Q A;  5AZI B;  1HUX A;  1HPM A;  2P9P A;  4BRE A;  4MO4 A;  1WUA A;  3GDQ A;  2VWB A;  1GLA G;  4BC2 A;  4BVP A;  3U4L A;  3WEE B;  2E1Z A;  3RSE B;  1NLV A;  3S41 A;  2QWQ A;  2GTD A;  2QWN A;  3FZL A;  3GL1 A;  5E26 A;  2FSJ A;  1OKJ A;  3FR0 A;  2HMP A;  3VEN A;  1HKC A;  4A2A A;  4XEI A;  1Z6R A;  2CGJ A;  1BA0 A;  2E88 A;  3M3Z A;  5AQN A;  4B1Y B;  3H6E A;  1HX1 A;  4PL7 A;  3HTV A;  1YUW A;  4JD2 A;  3C0B A;  2ASP A;  3R6M A;  4BRC A;  4BR5 A;  4WQ5 A;  5TKY A;  1IG8 A;  3DXK B;  3ATU A;  1MWM A;  4PKI A;  4BRI A;  3D2E B;  3CI5 A;  4BRO A;  1JCG A;  4BR9 A;  3ENO A;  2ITM A;  2HF4 A;  2E20 A;  3O4W A;  2A3Z A;  2NLX A;  2YI1 A;  3BUZ B;  4BRP A; 
#chains in the Genus database with same CATH topology
 2QWO A;  5I9E B;  1S1U A;  4O55 A;  3F5T A;  3M5R A;  4Y1D A;  1NJI O;  4JS4 A;  3FZM A;  1B9F A;  4JKG A;  2B5J A;  3KKS A;  2XY7 A;  4IJA A;  1KXP A;  4DCH A;  3HOS A;  3NH1 A;  1S22 A;  5GAH P;  2GWK A;  1RDW X;  1YJ9 N;  4IJN A;  5TKW A;  3PIP L;  3V9W A;  2Z1I A;  3U8X A;  4FLW A;  1L3T A;  2R7Y A;  3TR8 A;  2A1R A;  2DPN A;  3NGY A;  4RCH A;  4UY8 O;  5J2Q A;  2A6A A;  3NF6 A;  5SWM A;  4JKD A;  1BIZ A;  4Z4H A;  3LP0 A;  3CJC A;  4H5W A;  4H0X B;  1NK0 A;  4LSL A;  4NLB A;  5C25 A;  2LSN A;  4DV4 K;  4J8F A;  1NK4 A;  2NRV A;  4FL9 A;  5KPR A;  2YV0 X;  1ITG A;  1S1W A;  3QBW A;  4KO0 A;  3ZT3 A;  4R5P A;  2V51 B;  2ZGY A;  4KHN A;  4IZ9 A;  1NGD A;  1C0T A;  3VQ5 A;  4M7Y A;  4BQZ A;  1NK8 A;  3RVC A;  1NGG A;  1D9F A;  5GIO A;  1IKY A;  4FWM A;  1TKT A;  3EL2 A;  3L4Q A;  3CC4 N;  3MED A;  3C6T A;  2IVP A;  4F4K A;  3LP3 A;  1HQE A;  3DM2 A;  4ISF A;  3SI6 A;  1RGI A;  5ADX A;  3VEX A;  4DV0 K;  3EKS A;  4DFK A;  4XH5 A;  4O4G A;  1U4B A;  3WNG A;  2P9S A;  4CEB A;  1JCF A;  4EFH A;  3MXM A;  2Z1H A;  3BF3 A;  2XRI A;  4OGE A;  2CH6 A;  4DSI A;  4KI6 A;  3DXM B;  3AV9 A;  1BWF O;  4JRP A;  3VF6 A;  2DFF A;  4FWO A;  2ASO A;  3WXL A;  3C7N B;  1XNR K;  3PO4 A;  4FWS A;  4KRE A;  3O3F A;  4Q0B A;  4LFB K;  1VK0 A;  5BPN A;  4CD3 A;  3MCP A;  4FPB A;  2YX6 A;  5M1K A;  4A62 A;  1C1A A;  3ZCM A;  1QVG M;  2J4R A;  1MDU B;  2YHW A;  4QS7 A;  4PQU A;  4GVM A;  3VN5 A;  3AVM A;  4CBU A;  1ILY A;  3QB0 A;  3T1A A;  2VG6 A;  3A5M C;  4AHV A;  5LJV A;  1UAX A;  3C6H A;  4OVL A;  3LDP A;  1VSM A;  3E9P A;  5KRS A;  3V9Z A;  1EO1 A;  3K0S A;  1Z26 A;  2Y1J A;  3J80 O;  1W0H A;  2HOE A;  4I9L A;  1WSI A;  3TTC A;  4RG8 A;  4ZTF A;  5C2D A;  4B9U A;  2P9L B;  4QS8 A;  1YIT N;  1U04 A;  3H46 O;  3A8Y A;  4F2S A;  4KAZ A;  2FC0 A;  1XMQ K;  3EZW A;  3HZ6 A;  1QSL A;  3W3D A;  1NGH A;  4CFA A;  3SQ0 A;  1T6D A;  3RMD A;  1NGA A;  5BRD A;  1HNI A;  1ASU A;  4FZX C;  1L3U A;  3L3V A;  4DU3 A;  4IEE A;  2HHQ A;  1WAF A;  2I7P A;  1XNQ K;  4FVU A;  4DV1 K;  3G6E N;  4A61 A;  4CJU A;  4KTZ A;  3NVM A;  4K43 A;  5CZ2 A;  4DKW A;  2AP1 A;  2HBK A;  1ZBS A;  1CXQ A;  5AQR A;  4CHZ A;  4B1V A;  1NKB A;  1VQM N;  5JMV A;  1GLB G;  3OVN A;  3OJS A;  1VRT A;  1BIU A;  3TI0 A;  2VYP A;  1DKG D;  1BI4 A;  4BR7 A;  1RT1 A;  1CZ9 A;  3OHR A;  1ESV A;  4B8A B;  2NZT A;  5ADX H;  3H3N O;  3IDH A;  1VQ6 N;  2YCH A;  1YT3 A;  4BC3 A;  4CK2 A;  3MN6 A;  3QES A;  2EHG A;  2F9T A;  1BIS A;  4B9M A;  1IO2 A;  4O5F A;  2KW4 A;  4IBN A;  3NH0 A;  1OVY A;  4X65 K;  3AA3 A;  2D5R A;  1N33 K;  4LF8 K;  2YJE A;  1HNV A;  3ZX2 A;  4CF8 A;  3H3O B;  5M1P A;  3DAW A;  4JK9 A;  4NLC A;  3KTQ A;  3JXU A;  4CZL A;  3P31 A;  3OJU A;  3FLC O;  1J5O A;  4CJP A;  4CFD A;  3HJF A;  2FLO A;  4CF2 A;  1RTJ A;  3CJA A;  2HW3 A;  4B3T K;  3HP9 A;  4KHS A;  3TAQ A;  4M41 A;  3WQU A;  1SL2 A;  4ID1 A;  4PKH A;  4AM6 A;  4DTM A;  3PX6 A;  1HNW K;  4KRF A;  3THX A;  5J1E A;  1U2V A;  4CGD A;  4B1Z A;  2V7Y A;  4A5B A;  3CQX A;  4CCH A;  2ZJP L;  1V4T A;  3KWI A;  2YJF A;  4DTO A;  4CZJ A;  1YTU A;  1JLE A;  4CEO A;  4AQY K;  4DB3 A;  4DR2 K;  1HJO A;  2O8B A;  4KKO A;  1GLF O;  4G1Q A;  2KFN A;  3CCL N;  1RNH A;  2FF3 B;  4CHN A;  3B6O A;  1IG9 A;  1QTM A;  1EP4 A;  1OH5 A;  3H1V X;  1KVA A;  2RE2 A;  1WBB A;  1U45 A;  5J2P A;  5KQD A;  1DTQ A;  1Z05 A;  4CD1 A;  5JEN A;  4DS4 A;  1ZBL A;  1LWF A;  3MEC A;  1M1K O;  1XMO K;  1ATN A;  1T05 A;  5M1Q A;  3S9H A;  4AIL C;  3MN5 A;  3GG4 A;  3SJJ A;  2D1K A;  5CY4 A;  5AQM A;  1S1V A;  4CGF A;  4E3S A;  2P5G A;  3IKM A;  1RTI A;  1GOB A;  3AO1 A;  2O8C A;  4DG1 A;  2IVO A;  1NGB A;  3DLK A;  3CXC M;  3DOK A;  3LAN A;  5AQJ A;  2XO7 A;  2P9S B;  1RT7 A;  2VCP A;  1SKR A;  2O8F A;  3E01 A;  3V1O A;  3D0P A;  3CCR N;  2VQF K;  5HRR A;  3QML A;  3VF4 A;  4BRL A;  2QKK A;  2F8T A;  1RT6 A;  1E4G T;  4ELT A;  3M8P A;  1HYZ A;  4CZI A;  2FF6 A;  2UXC K;  3LAM A;  3SPY A;  4PL8 A;  4BRF A;  4CJ7 A;  3VA3 A;  3OYF A;  4EAH D;  2X6N A;  1QHT A;  5K14 A;  3NE6 A;  3CJ7 A;  1UWB A;  1QS4 A;  2BTF A;  3H08 A;  4I9Q A;  3DXK A;  4RTF D;  4JHD A;  5AR0 A;  4HWI A;  1BU6 O;  3GE1 A;  3P1G A;  5DK5 A;  2HNY A;  4FK4 A;  5AQT A;  4LH4 A;  1U48 A;  3SQ2 A;  1G15 A;  1NJX A;  4E1M A;  5FRM A;  3LDN A;  3J81 O;  2Q0R A;  4NCB A;  3L6Q A;  4K42 A;  3N4Q A;  3VQ6 A;  4B1W B;  5AQV A;  4B8C A;  4L8R B;  2P9K A;  3DLH A;  2HST A;  3LZJ A;  4DV3 K;  4CFC A;  3Q7C A;  1R0A A;  3LAK A;  3JYT A;  4H5V A;  2Q97 A;  3WXK A;  2E2N A;  1RBR A;  1IBK K;  3D2F A;  1NKE A;  3P5J A;  5HRS A;  3AO4 A;  3KZB A;  4B08 A;  5HOO A;  1VQO N;  2E5L K;  4TSX A;  2VWB A;  1W7A A;  3RWU A;  3DLB A;  4YNQ A;  4PUO A;  3U4L A;  1SL0 A;  1WLJ A;  1TKX A;  4CJ5 A;  2FSJ A;  4DR3 K;  1JLQ A;  1HKC A;  4I2P A;  1WSJ A;  4DTJ A;  3CM6 A;  5I42 A;  1EET A;  4LF4 K;  5GAG P;  1BI4 B;  3OYD A;  3QO9 A;  4M45 A;  3EYZ A;  1K8A O;  3ZSR A;  1YUW A;  2G8W A;  2ASP A;  4W5N A;  4O0J A;  3CMA N;  1LV5 A;  1IG8 A;  3CFR A;  1MWM A;  3KLI A;  1TKD A;  1N36 K;  4PKI A;  4JRQ A;  4CEA A;  4FZZ A;  3ENO A;  2ITM A;  3TSQ A;  5A2Q O;  3ISN C;  2E20 A;  4CGH A;  4FJ8 A;  5CYM A;  3VMF B;  3S3N A;  4E89 A;  4IFY A;  2V52 B;  3DXM A;  4CHP A;  3QDK A;  3K5M A;  3OBW A;  4EP5 A;  4JLH A;  2ZGZ A;  2A5X A;  2EWS A;  2WBN A;  3C7N A;  2JWL A;  3CD6 N;  4KV8 A;  3SNN A;  2HMI A;  1WSH A;  3TAN A;  4F8R A;  2QKB A;  1LW2 A;  2Y1I A;  4CJL A;  3THX B;  1U2V B;  2GWJ A;  4WCE L;  2ZJR L;  4LSN A;  2HND A;  3G10 A;  4C8O A;  4FW1 A;  1NOZ A;  4DTU A;  4H5T A;  1ATR A;  3F73 A;  1OH7 A;  2W40 A;  4DR6 K;  2GX9 A;  4KTQ A;  3AVG A;  1LOT B;  3VGL A;  4HUG A;  5KI6 A;  2O8B B;  3MAQ A;  5AFU A;  3HK2 A;  3AVK A;  1NMD A;  2FBV A;  3KIO A;  4CIF A;  1OVQ A;  4C8K A;  4AF1 A;  3G0Z A;  1W2B M;  4OPA A;  5T7B A;  1RBV A;  4BDZ A;  3KHY A;  3KLE A;  1K6Y A;  5M1O A;  5B8H A;  4DTP A;  2OPP A;  3BF1 A;  5FLX O;  3BDP A;  5LY3 A;  4JI8 K;  1S1T A;  4R79 A;  1SS6 A;  4HHT A;  4KB0 A;  3MXJ A;  3HBT A;  1BQN A;  2B6A A;  1GLC G;  3TTD A;  1A5V A;  1TL3 A;  4QOZ B;  4CE9 A;  1Y64 A;  4CHO A;  4E1J A;  4QCL A;  2VG7 A;  4QAG A;  4IXC A;  4DQR A;  3SLC A;  2WUS A;  4NCG A;  4BG9 A;  1DTT A;  5KTQ A;  4CZK A;  3RRH A;  4F2R A;  4M63 C;  3ASM A;  4GKK K;  1YVN A;  4ZTJ A;  4OGC A;  2O8F B;  4O5B A;  1NK6 A;  5HRP A;  3ENB A;  1NGJ A;  1WN7 A;  5FRO A;  4H0V B;  4JAX A;  3NGZ A;  1NKC A;  4FLU A;  3C94 A;  3O9Q A;  3SMS A;  1JL2 A;  1S1X A;  3AVI A;  4B3M K;  3SBG A;  4LY7 A;  4FJL A;  3QEV A;  3FFI A;  2OPR A;  4HCC A;  1NK5 A;  1RDA A;  3KK2 A;  2XY8 A;  4J2B A;  3R8E A;  2AA4 A;  3E1Y A;  4NYF A;  3QEW A;  1BA1 A;  4KH5 A;  4HCB A;  1TL1 A;  1MWK A;  4CJ3 A;  5AQW A;  4FYD A;  4JHD B;  4IOA L;  2QWP A;  3VQ7 A;  3O3G A;  3VQE A;  3CIP A;  3CJB A;  4Z94 A;  3LP1 A;  4FOE A;  1HQU A;  4KI4 A;  4I2Q A;  3O1B A;  3OS2 A;  2HB5 A;  4FW2 A;  1NGC A;  3ID6 A;  4FLV A;  3F9K A;  4OPJ A;  1SKW A;  1VSK A;  1RFQ A;  4NXM K;  4DQ8 A;  2ZE2 A;  1I94 K;  3PY8 A;  4DSL A;  4GNI A;  1XQS C;  1ZBF A;  2FBT A;  4EIA A;  1KC8 O;  4PWD A;  5BR9 A;  4EP4 A;  2YHB A;  5BN9 A;  4FWK A;  1H1V A;  2D4W A;  2P9K B;  1HLU A;  1QQO A;  4A59 A;  4C1N I;  4CK1 A;  4DUZ K;  4DTN A;  1WB9 A;  4A2B A;  1HNX K;  2AJQ A;  4K41 A;  5EX5 A;  5HBM A;  1IBM K;  4E72 A;  3O3H A;  3AVB A;  3CJ1 A;  3IUC A;  3D2F B;  1T44 A;  3HT3 A;  3O80 A;  3IG1 A;  4H4M A;  2XY6 A;  3OYC A;  3NF8 A;  4DV5 K;  2O4G A;  4FJK A;  4AHT A;  3WNE A;  5SZT A;  3HP6 A;  5IT9 O;  5KGW A;  3HSC A;  1JLA A;  1IBL K;  4BC5 A;  4JKF A;  3SUQ A;  4WQ5 C;  3OYI A;  1QZ5 A;  4U7B A;  3TAR A;  4DTS A;  3RTV A;  4B1U B;  1ASW A;  2ZWH A;  3O8M A;  2ITG A;  4LF5 K;  1B9D A;  4DR5 K;  4HTL A;  2PY5 A;  2G8K A;  3LDQ A;  3SAH A;  1S6Q A;  3V4I A;  2O8D B;  5BRF A;  5EXW A;  4GV3 A;  5BRH A;  3SPZ A;  5AQY A;  2ATQ A;  4E0D A;  4BR2 A;  2CGK A;  3CFO A;  3QFU A;  4LH5 A;  4AHS A;  3B6P A;  1VSF A;  5FRN A;  3NDK A;  1REV A;  4BRK A;  3QER A;  4W5O A;  1VQK N;  2RF2 A;  3ULE A;  2GUI A;  2VGM A;  3KK7 A;  3VES A;  4CJE A;  4DU4 A;  3NF7 A;  3MXI A;  5CYQ A;  4Z4C A;  3EE9 A;  4B9Q A;  5GAE P;  1NBW A;  4JI1 K;  4Z0U A;  2V7Z A;  1Y97 A;  3SUN A;  4GW6 A;  3DLL L;  3QET A;  3B8A X;  1S5J A;  2XHB A;  4CER A;  3VF2 A;  2PYJ A;  2QWR A;  3KLH A;  1ZBI A;  3V6D A;  3N4P A;  3D6R A;  3ZET A;  4KTW A;  4DTX A;  4M3Z A;  3MK6 A;  3IFR A;  2P5O A;  3UKR A;  1QQC A;  1WSF A;  4KHQ A;  1NG9 A;  5F2R A;  3NH2 A;  3KD5 E;  2Q1N A;  1JJ2 M;  4CBX A;  1KLN A;  4BE1 A;  2UXD K;  1ZBH A;  2PBD A;  3S3O A;  4CZF A;  3ZEU B;  3LWL A;  4EZ6 A;  3MEG A;  3M1F A;  4B9L A;  4PHT X;  3T19 A;  4KB1 A;  4XH4 A;  5EU7 A;  3QIP A;  3VTH A;  4FXD A;  2RN2 A;  3TPQ A;  1BL3 A;  4KPY A;  5LL6 Z;  4YY3 K;  1KLM A;  5HL7 L;  3L0Q A;  4E1N A;  1WSG A;  4CEF A;  2KTQ A;  4RW8 A;  1IJJ A;  1MA9 B;  2F96 A;  4BWM A;  3HI0 A;  2IDO A;  4BRN A;  3VEO A;  1JL1 A;  3DJC A;  3TAB A;  4M3X A;  4BRQ A;  1YAG A;  4H03 B;  3A5O C;  3MX2 A;  2OZM A;  5H1S Q;  1ASV A;  1N32 K;  2IVN A;  2F4V K;  4BWJ A;  1QSS A;  1DEJ A;  1RIL A;  2NRX A;  2DTU A;  3HYF A;  3CQ8 A;  5CR4 A;  5DM6 L;  5FPE A;  4LC9 B;  3AAR A;  1QZ6 A;  1RBS A;  2E8A A;  3NBP A;  2KLA A;  4DUY K;  3K59 A;  1OH8 A;  4CBW A;  4GV6 A;  2A42 A;  1NNE A;  3OTO K;  3HPG A;  2GUP A;  3I8B A;  1QVF M;  3CYM A;  3F9M A;  3CCS N;  1GLJ O;  3O1W A;  4K25 A;  4B9S A;  3O5B A;  1NGE A;  1U47 A;  5D3G A;  1Q8I A;  4C8M A;  4JYA K;  2GBZ A;  4AH9 A;  1WBD A;  1EKE A;  1BCM A;  3VQD A;  5JS2 A;  5AQF A;  2F9W A;  3VEZ A;  1GLD G;  1O1W A;  1O13 A;  3LPT A;  1KQS M;  1NU0 A;  1SV5 A;  3M8Q A;  3V9U A;  3BGR A;  2DY4 A;  4RW9 A;  4CIG A;  2P51 A;  3VET A;  3R1X A;  3AVL A;  2W42 A;  4IFV A;  4BGA A;  4Z4E A;  2D0O A;  2W6K A;  1LCU A;  4I7F A;  1XC9 A;  1EXQ A;  1SUQ A;  1YXQ A;  1RDB A;  2F8S A;  1JXB A;  4JK7 A;  1HUX A;  2C1I A;  1HPM A;  2P9P A;  4MO4 A;  3GDQ A;  3NFA A;  4HUE A;  5C2F A;  1GLA G;  1XHZ A;  1VSJ A;  2D0C A;  3S41 A;  2QWQ A;  2GTD A;  5E26 A;  4YOW A;  4B3R K;  5DM7 L;  1NJZ A;  4YOR A;  3NCI A;  4A2A A;  1CZB A;  4XIU A;  2A1S A;  2E6L A;  4XEI A;  4E7J A;  3G71 N;  1BA0 A;  4E19 A;  4LD0 A;  4CJV A;  3CCJ N;  1Q86 O;  1JKH A;  1LAW A;  3AVH A;  3C0B A;  4CIE A;  4BRC A;  4BR5 A;  4WQ5 A;  1A5X A;  2NUB A;  4B3O A;  3CI5 A;  4BRO A;  3KD1 E;  2JLE A;  2HF4 A;  4MDB A;  4CHY A;  5JVH L;  3O4W A;  2A3Z A;  4AHU A;  3QIO A;  3ULE B;  1ATS A;  3QFP A;  3LM2 A;  4FWN A;  3A5N C;  1ZC6 A;  1KRP A;  4CVN E;  2HVH A;  4X64 K;  2HHU A;  1L3V A;  1L5U A;  2P1J A;  3AAQ A;  1E4F T;  3LDS A;  5F1X A;  3CCM N;  4K8X A;  2F7T A;  4E7K A;  4XH1 A;  1YI2 N;  3L3U A;  1KSP A;  3ZX0 A;  2HHX A;  5AQL A;  1KAY A;  4GMJ B;  3TU5 A;  4I6M B;  3RMB A;  1VQ4 N;  4BEB A;  4IG0 A;  3UKU B;  3ZET B;  4CI6 A;  5GIN A;  3UKR B;  1Q9Y A;  3SJH A;  3E9O A;  3MX5 A;  3KKR A;  4BDP A;  4M7X A;  3EY1 A;  3ZYY X;  3TAE A;  1L3S A;  3VA0 A;  3TWH A;  4FLY A;  4HTU A;  4JV5 K;  1WOQ A;  4ID5 A;  3S3M A;  3I0R A;  2YKN A;  1SAZ A;  3ULD A;  4EHT A;  4ZHR A;  4IEI A;  5C15 A;  3C65 A;  3W0L A;  4H5R A;  3TAF A;  2NRT A;  3HL8 A;  3L8B A;  4X62 K;  4WFB L;  5ELZ A;  2A41 A;  4DLE A;  4KH6 A;  1U6Z A;  2BUP A;  5AQQ A;  3UIQ A;  3QEP A;  3U3Y A;  2Q3S A;  2GEM A;  3I33 A;  1S9G A;  3CCV N;  4CGI A;  2FSK A;  3LAL A;  1G99 A;  3VQA A;  1HR0 K;  3EEQ A;  4O8K A;  3OYJ A;  3OYM A;  1N8R O;  4H0P A;  1T7P A;  4M3W A;  1J9A A;  1QQM A;  5EOY A;  4DSF A;  2B4J A;  3BZK A;  1KVC A;  1GLL O;  3MEE A;  4FJ9 A;  1Q18 A;  2JGU A;  1EQY A;  3I8D A;  4M3U A;  1D9D A;  4DMN A;  2HHS A;  1HNZ K;  5FPN A;  4JK8 A;  2W41 A;  2YKM A;  4WFN L;  4Y0W A;  1KFS A;  3VTI A;  3R9P A;  1JLB A;  2QXL A;  1S3X A;  1MU2 A;  3MMV A;  3PSI A;  2O8D A;  3QBX A;  4NO7 A;  3M6G A;  3AVN A;  1T6C A;  4CW7 B;  2RHK A;  4FOI A;  2QW9 A;  1C0M A;  3OYB A;  1BHL A;  2NRH A;  3K9K A;  3HO1 A;  1BO5 O;  4GVE A;  1VQP N;  3AVF A;  5FDL A;  3HM8 A;  1RTH A;  3HRG A;  3J7Z O;  5AZJ B;  3MCA B;  1C1C A;  1KTQ A;  1T8E A;  3A0I X;  3AA5 X;  3VGM A;  4FO0 A;  3ZT2 A;  3CET A;  4O8U A;  2YNH A;  1BCO A;  4CF9 A;  2HBM A;  3SUP A;  4C23 A;  3AGR A;  3LM9 A;  3FGU A;  4DQP A;  2EX3 A;  4CJR A;  4DLG A;  2X6S A;  1RBT A;  3LWM A;  3AO5 A;  1Q9X A;  2BH1 A;  2P9U A;  1N5Y A;  1CLQ A;  4UQG A;  2D0P A;  2QEX N;  1NK7 A;  1K73 O;  4JKC A;  3K57 A;  4DQI A;  4LF6 K;  2P9P B;  3RSE A;  3ZEU A;  4W5R A;  1D5A A;  1IV0 A;  2FBX A;  1GLE G;  1VQ5 N;  3IRX A;  3CG7 A;  4OLB A;  2YHA A;  1BG3 A;  3J8A A;  4OLA A;  1XWL A;  2YNI A;  1IKV A;  3C95 A;  3KK1 A;  4LFC K;  2BAN A;  2IIR A;  4JKE A;  5JLH A;  3GBT A;  2CGL A;  2Z1J A;  3TSP A;  1J54 A;  4BC4 A;  3K5O A;  4H4O A;  3HPO A;  1FK9 A;  1LAV A;  3PV8 A;  3F2K A;  3LL3 A;  3M8R A;  5KPZ A;  1TV6 A;  4N47 A;  5HRN A;  4N5S A;  4FPA A;  2C1G A;  1RDC A;  3CC2 N;  1VSH A;  3HST B;  3VOV A;  1RTD A;  2YHX A;  4B9T A;  3TTF A;  5FPD A;  3DRP A;  2KHO A;  3D7E O;  3VQ9 A;  4O0I A;  4DR1 K;  2IOC A;  4U67 L;  2X78 A;  3T3F A;  3LZI A;  1VSD A;  1K8K A;  1HRH A;  3LDO A;  4DF8 A;  3NF9 A;  4M42 A;  1C0G A;  3EZ5 A;  3KJV A;  1TK0 A;  1C0U A;  2HBJ A;  4DR7 K;  3HXM A;  3VQQ A;  1HKB A;  1XC3 A;  2JWK A;  5JS1 A;  3SBT A;  2HHT A;  3G4S N;  1T03 A;  3KK3 A;  1HJR A;  2HBL A;  2IC3 A;  5J2M A;  3FZK A;  1VQN N;  3NMU A;  2OPQ A;  3TAG A;  3QNN A;  4FWR A;  4QS9 A;  4IG3 A;  4FJM A;  5E41 A;  3L2V A;  1VSL A;  4KBO A;  3FZF A;  1J6Z A;  4YOU A;  4FLT A;  1SZ2 A;  3SQ4 A;  3V1R A;  2VQE K;  1RBU A;  3DLE A;  2FBY A;  2A40 A;  4WE1 A;  4C8N A;  5JLF A;  4CGG A;  3VEY A;  3JAM O;  3JS6 A;  3FZH A;  4LF7 K;  4DR4 K;  3WQT A;  4W5Q A;  1EX4 A;  3AVA A;  5AFU H;  2BGG A;  3ZT4 A;  4A57 A;  2ETJ A;  2CH5 A;  3AGK A;  2ZF5 O;  2RPI A;  2E1Y A;  3OBY A;  2Q2R A;  4CHQ A;  4JKB A;  1JLG A;  3AA4 A;  4Y1C A;  4ILG B;  4F9O A;  2G8H A;  4JN4 A;  1FKO A;  1VAZ A;  1XHX A;  3PX0 A;  4IWV A;  1EWR A;  1X3N A;  5AQH A;  2Q0U A;  1Z25 A;  3I55 N;  3RR8 A;  2OYQ A;  3S5T A;  4YOT A;  1YVU A;  5JVG L;  3CC7 N;  4KFB A;  4ISE A;  4DSE A;  1CXU A;  1TUU A;  3AVC A;  4RWT A;  4BY9 C;  3CER A;  4ILH A;  4CZH A;  3PUF A;  2PAV A;  2OCE A;  1KCF A;  3WNH A;  4F3T A;  1S6P A;  3PLA A;  1F21 A;  2P9I B;  4FZY A;  3O08 A;  3OYG A;  1XUP O;  1KFD A;  4MDA A;  2E2O A;  5KGX A;  2DFE A;  4BAC A;  2E6M A;  4CFB A;  3THV A;  4FWP A;  3DRR A;  4CF1 A;  2FXU A;  3OYL A;  3THW A;  4EZ9 A;  4AHC A;  2DFH A;  4FWL A;  2P9N A;  5C10 A;  4IO9 L;  4CEQ A;  2IS3 A;  1HYV A;  2Z1G A;  3J7Y P;  2H3G X;  3WUH A;  2OTL N;  5LMU K;  4JKH A;  3U9Z A;  2IAJ A;  3LDL A;  1RDU A;  3IS9 A;  5BRE A;  1WAJ A;  1X9S A;  3LPU A;  1RT4 A;  3U6F A;  1IKX A;  4V19 S;  1VQ7 N;  3SV3 A;  3VQP A;  1NMN A;  4I6M A;  4NCA A;  3EKU A;  3SMP A;  3C6A A;  4LF9 K;  3UKU A;  3ID8 A;  4CED A;  4YOX A;  2P9U B;  4C1N K;  4JI6 K;  4YDU C;  1RT2 A;  2E2Q A;  3L2U A;  4DU1 A;  1KD1 O;  4PY5 A;  4BRE A;  2ZQB A;  4FVM A;  3K9J A;  2D0B A;  3L2R A;  4K0K K;  4BC2 A;  1YJN N;  3E9L A;  5C12 A;  2E1Z A;  3RSE B;  2VWJ A;  3R3L A;  2QWN A;  1OKJ A;  3CFP A;  1X1P A;  3VEN A;  3HPH A;  3SYZ A;  2WOM A;  2UUB K;  3ZSX A;  1YIJ N;  4JI3 K;  3OYE A;  2CGJ A;  4JI2 K;  3M3Z A;  5AQN A;  2O8E B;  2NRR A;  4CEZ A;  4B9N A;  3H6E A;  1HX1 A;  3PO5 A;  4DQS A;  2HNZ A;  2GV9 A;  3P39 A;  1QSY A;  1FKP A;  4DS5 A;  3R6M A;  3HVR A;  4G9Z A;  4JI0 K;  5TKY A;  3ATU A;  2UUC K;  3OYA A;  2G8F A;  4BRI A;  3CCE N;  3D2E B;  3K2P A;  3O9U A;  3ZSO A;  4N56 A;  1A5W A;  3ZSY A;  4MFB A;  2NLX A;  3V1Q A;  4BRP A;  4H8K A;  3VQB A;  1TYQ A;  3FE1 A;  4FSV A;  2VG5 A;  4IDH A;  5AJ3 K;  3EE8 A;  1NGI A;  5JIC A;  1TK8 A;  1BDG A;  5AQZ A;  5EVZ A;  2G8I A;  4DWI A;  3BEX A;  4NXN K;  5MLC Q;  4FJJ A;  3P4I A;  4C8L A;  1IH7 A;  4IDK A;  3BY5 A;  1JXE A;  2HF3 A;  5DMR A;  1K8K B;  5M1F A;  1C0F A;  4GKJ K;  3L4I A;  4MO5 A;  3CM5 A;  1OH6 A;  4ILJ A;  3CME N;  2G8U A;  4BRM A;  4L3Q A;  3SQ1 A;  5HLF A;  2QXF A;  4WF9 L;  4H0T B;  4CZE A;  2I5J A;  4YOV A;  3ALY A;  2RKI A;  3DLR A;  4M3T A;  4F3O A;  1J53 A;  4J2E A;  2PZS A;  3WXM B;  4FJX A;  2WON A;  3T69 A;  1X9W A;  1B92 A;  4A5A A;  3SV4 A;  4DFM A;  3PIO L;  4N76 A;  4E7I A;  5BN8 A;  2Q31 A;  1TAU A;  5IWA K;  3C6U A;  4CGJ A;  1Q81 O;  4ICL A;  5AZJ A;  3I0S A;  3H1Q A;  1ZXO A;  1NM1 A;  5F0X A;  1QE1 A;  5AQG A;  4FCY A;  5BPM A;  3P38 A;  3T7Z A;  4JS5 A;  3CCQ N;  4CJ4 A;  4B9V A;  4JD2 B;  1KAZ A;  5CHI A;  4E7H A;  3AO2 A;  4BRA A;  3CYG A;  3OYK A;  5HRO A;  3K58 A;  1WSE A;  2D0A A;  3DWL A;  3K5L A;  3U9D A;  1HKG A;  1GOA A;  4RW6 A;  2Q36 A;  3ZX3 A;  4MQ3 A;  3QEI A;  4FK2 A;  1XI1 A;  2ASM A;  3BZC A;  4YOY A;  3ZSV A;  1DLO A;  3TAP A;  1BQM A;  3KLG A;  1CZA N;  2YNG A;  4DQQ A;  1LWC A;  2NRZ A;  3E66 A;  4JKG B;  2KQ2 A;  3WXJ A;  1X9J A;  2W6L A;  4H0Y B;  1RCH A;  4JEP A;  4IO8 A;  3M8S A;  1D8Y A;  4DFP A;  3QEX A;  3EN9 A;  1SL1 A;  4BRG A;  2FSN A;  3VPZ A;  3VQ8 A;  4BEC A;  4BGB A;  3SAG A;  5AQK A;  5CE3 A;  2QWM A;  1UA1 A;  2E4L A;  2KKZ A;  2QM1 A;  2VWK A;  3RRG A;  4PA1 A;  5E84 A;  5FPM A;  4KHU A;  3DYA A;  3AAP A;  2O4I A;  3KVG A;  4K8Z A;  2PFU A;  1X9M A;  3THW B;  1NWK A;  2X74 A;  4H0O A;  1P90 A;  2P9N B;  3HVT A;  3CF5 L;  3MDQ A;  4DV6 K;  4JKA A;  2G8V A;  5I3U A;  1KAX A;  1P8Z A;  2I7N A;  2NRW A;  4IOC L;  4WQ4 C;  2UYT A;  3MN9 A;  3HM9 A;  1FW6 A;  3ITH A;  3GOI A;  4JNE A;  3U3G A;  1QQN A;  4CEE A;  4FJ5 A;  4ELV A;  3WXI A;  1FXX A;  3TAM A;  5M1N A;  4CES A;  3ATV A;  4BE7 B;  4OPH A;  5AZI A;  4BDY A;  3T1H K;  3SAF A;  3AA2 A;  1UA0 A;  4KHW A;  2YNF A;  4CZG A;  4CJW A;  3WEE A;  4J2D A;  5J2N A;  4CEC A;  1W9H A;  4CJK A;  2IGI A;  4NB4 A;  3VGK A;  4BG8 A;  1D4X A;  3CQY A;  3ENH A;  3A5L C;  4YDU A;  3P83 D;  3V9S A;  5AQO A;  1E3M A;  4CJQ A;  1JCE A;  2NNW A;  1I39 A;  3ZSQ A;  3AO3 A;  4DFJ A;  1VQ8 N;  1TK5 A;  3DRS A;  4WYB A;  1BUP A;  4PKG A;  2KZZ A;  4CK3 A;  3L2W A;  4JI4 K;  3IAY A;  3BP8 A;  5BPL A;  4OJR A;  2HVI A;  1VHX A;  1RDD A;  2BE2 A;  3CHW A;  3THY A;  1NOY A;  4BVO A;  4FJH A;  5BR8 K;  4AHR A;  4CJT A;  2E2P A;  3DMJ A;  4RW7 A;  4MLH A;  1VQL N;  4CF0 A;  1U49 A;  3VQC A;  4E7L A;  1Q7Y O;  3CJ9 A;  4KH4 A;  1TKZ A;  4ELU A;  4JI7 K;  3QIN A;  2QI2 A;  4CZM A;  1YTA A;  2OPS A;  3DI6 A;  4FJG A;  4OO1 J;  1X3M A;  3OY9 A;  1J5E K;  2HHH K;  4FJ7 A;  1TYQ B;  4DHY A;  3IMX A;  1K9M O;  3CCU N;  3TSU A;  5AQX A;  5AQP A;  3K5N A;  1ZBU A;  1VSI A;  3OYH A;  3G25 A;  3VQ4 A;  1VQ9 N;  5AQS A;  4H5N A;  1SQK A;  3H45 C;  4N41 A;  5C0Y A;  4DF4 A;  5KQ8 A;  1LW0 A;  2P9I A;  4BQL A;  4J2A A;  4KHY A;  4OKK A;  4Z4G A;  2KZM A;  3V9X A;  3OA9 A;  1BOT O;  3NVK A;  5GAD P;  4NYN A;  4DV7 K;  4FWQ A;  3RMA A;  2QTD A;  3MWT A;  4BR0 A;  1WNS A;  2WC9 A;  3PSF A;  4WFA L;  1KVB A;  1TAQ A;  4IOX A;  1EWQ A;  4BE2 A;  3O6W A;  5C24 A;  4FJN A;  3NGI A;  1HMV A;  4BR4 A;  1N6Q A;  4GV9 A;  3V81 A;  3J7A P;  3RMC A;  2HHI A;  1HYS A;  1TGO A;  3A2F A;  3QLH A;  3OS1 A;  3FFK B;  3QIC A;  5LMN K;  1TUY A;  1I3A A;  5LJW A;  2VGN A;  3LP2 A;  2ZM6 K;  4BRH A;  4M3R A;  2BDP A;  3EO3 A;  4OX9 K;  1YJW N;  4OKJ A;  5AQI A;  1QHA A;  4GY2 B;  4HVJ A;  4DTR A;  4FLZ A;  1SKS A;  3NAE A;  4FJI A;  2OTJ N;  4B1X B;  2HHW A;  3SUO A;  3ZSW A;  2QK9 A;  3L2Q A;  4EHU A;  2XY5 A;  1NGF A;  4CJF A;  4B3S K;  3Q7B A;  4AM7 A;  3UE5 A;  5GIP A;  4ISG A;  4BRD A;  2GEL A;  4OPK A;  4IKF A;  2PYL A;  4YHH K;  3SK3 A;  4FM2 A;  3QNO A;  2KFZ A;  2HHV A;  3JSM A;  3D45 A;  1ZYQ A;  1NK9 A;  2O8E A;  4MLE A;  1V4S A;  2ZD1 A;  5AQU A;  2WTU A;  4Z4F A;  1C1B A;  3O9T A;  5C42 A;  5KPT A;  3CPW M;  1DT9 A;  3MN7 A;  4X66 K;  3WNF A;  3DLG A;  4LFA K;  4DSK A;  4O44 A;  3KLF A;  2YHY A;  3D2E A;  1UOC A;  2OZS A;  3DOL A;  3VEV A;  4Q5V A;  3SCX A;  3O9S A;  2P9L A;  4DV2 K;  5EY4 A;  3AY9 A;  1JLC A;  3WT0 A;  4YFU A;  2OA8 A;  3SZ2 A;  2QWL A;  4Z4I A;  1DGK N;  4XJX A;  1YF5 L;  4IFE A;  1RT3 A;  2OAN A;  1VRU A;  4FLX A;  3OS0 A;  4M3Y A;  2UUA K;  3RR7 A;  3UB5 A;  3NHG A;  1R59 O;  2ZJQ L;  1JLF A;  1VSE A;  2WFB A;  3O4Q A;  4FM0 A;  3VER A;  4BE0 A;  3VEW A;  4WQ4 A;  1NJW A;  2O8C B;  1IKW A;  4HUF A;  1Q82 O;  5AZI B;  3ZSZ A;  1GOC A;  3ZLJ A;  1C6V A;  1LWE A;  1WUA A;  2UXB K;  1W97 L;  1TVR A;  3KWG A;  3HOT A;  1HPZ A;  4KHP K;  3CPE A;  4BVP A;  3WEE B;  1S72 N;  1N34 K;  1NLV A;  4W5T A;  3FZL A;  3GL1 A;  3O4N A;  4JI5 K;  1NJY A;  1RT5 A;  3O9R A;  3FR0 A;  2HMP A;  1T3V A;  4OKE A;  5KRT A;  2UU9 K;  1Z6R A;  4CJS A;  2E88 A;  4DSJ A;  1S9E A;  4B1Y B;  5HP1 A;  1BGX T;  4FK0 A;  4PL7 A;  3AVJ A;  3HTV A;  3ZT0 A;  3OW2 M;  4JD2 A;  3ZT1 A;  4FM1 A;  5CZ1 A;  3T1Y K;  3DXK B;  3I56 N;  1M90 O;  1FJG K;  3MWP A;  3PX4 A;  1JCG A;  4BR9 A;  3THY B;  2W00 A;  2QA4 N;  1YHQ N;  4RW4 A;  2YI1 A;  3BUZ B;  3OYN A; 
#chains in the Genus database with same CATH homology
 2QWO A;  2V52 B;  3DXM A;  5I9E B;  1TYQ A;  3FE1 A;  1ATS A;  3QDK A;  3F5T A;  3QFP A;  4FSV A;  3M5R A;  3OBW A;  4IDH A;  3ULE B;  1NJI O;  2ZGZ A;  2A5X A;  2EWS A;  3EE8 A;  3FZM A;  1NGI A;  2WBN A;  3LM2 A;  3C7N A;  3A5N C;  4FWN A;  1ZC6 A;  4JKG A;  1BDG A;  5AQZ A;  5EVZ A;  5JIC A;  2JWL A;  3CD6 N;  3BEX A;  4IJA A;  1KXP A;  4DCH A;  3HOS A;  5MLC Q;  3AAQ A;  3P4I A;  1E4F T;  5F1X A;  3CCM N;  1S22 A;  5GAH P;  2GWK A;  1RDW X;  2F7T A;  4XH1 A;  1YJ9 N;  1YI2 N;  2HF3 A;  4IJN A;  5TKW A;  3PIP L;  1K8K B;  3ZX0 A;  5M1F A;  1C0F A;  1U2V B;  2GWJ A;  3L4I A;  4MO5 A;  4ILJ A;  3U8X A;  5AQL A;  4WCE L;  2ZJR L;  1KAY A;  3CME N;  3TU5 A;  4I6M B;  4L3Q A;  4BRM A;  1VQ4 N;  4BEB A;  2DPN A;  3UKU B;  4RCH A;  4H0T B;  4WF9 L;  4UY8 O;  3ZET B;  4CZE A;  2A6A A;  4CI6 A;  5GIN A;  4JKD A;  3UKR B;  4YOV A;  4H5T A;  1ATR A;  2W40 A;  3SJH A;  3CJC A;  4H5W A;  3E9O A;  2GX9 A;  3MX5 A;  4H0X B;  1LOT B;  4NLB A;  3WXM B;  3VGL A;  3T69 A;  4M7X A;  5AFU A;  4A5A A;  4J8F A;  2NRV A;  3ZYY X;  3PIO L;  1NMD A;  4FL9 A;  4AF1 A;  5KPR A;  5BN8 A;  2Q31 A;  1W2B M;  3QBW A;  4OPA A;  2V51 B;  2ZGY A;  1Q81 O;  5AZJ A;  1WOQ A;  3KHY A;  3H1Q A;  1ZXO A;  1NM1 A;  1NGD A;  4IZ9 A;  5M1O A;  5B8H A;  4M7Y A;  5F0X A;  4BQZ A;  3BF1 A;  1SAZ A;  3RVC A;  5AQG A;  1NGG A;  5BPM A;  3P38 A;  5LY3 A;  5GIO A;  3T7Z A;  4R79 A;  4EHT A;  1SS6 A;  3CCQ N;  4IEI A;  5C15 A;  3C65 A;  3W0L A;  4JD2 B;  1KAZ A;  3HBT A;  4H5R A;  4FWM A;  5CHI A;  3EL2 A;  3L4Q A;  3TTD A;  1GLC G;  2NRT A;  3CC4 N;  4BRA A;  2IVP A;  1Y64 A;  4WFB L;  5ELZ A;  4ISF A;  4E1J A;  2A41 A;  4KH6 A;  1U6Z A;  1RGI A;  2BUP A;  3DWL A;  5AQQ A;  1HKG A;  3U9D A;  3VEX A;  5ADX A;  3EKS A;  4IXC A;  2Q36 A;  3ZX3 A;  3SLC A;  2WUS A;  4XH5 A;  2P9S A;  1JCF A;  2GEM A;  3I33 A;  4BG9 A;  4EFH A;  3BF3 A;  2ASM A;  3CCV N;  4YOY A;  2CH6 A;  4CZK A;  2FSK A;  1G99 A;  4M63 C;  3DXM B;  4O8K A;  1CZA N;  1BWF O;  1N8R O;  3VF6 A;  4H0P A;  1YVN A;  4FWO A;  1QQM A;  2NRZ A;  2ASO A;  3WXL A;  3E66 A;  3C7N B;  5EOY A;  4JKG B;  3WXJ A;  1GLL O;  4FWS A;  1X9J A;  1NGJ A;  3ENB A;  4H0V B;  4JAX A;  1Q18 A;  4H0Y B;  1EQY A;  4JEP A;  4IO8 A;  5BPN A;  4CD3 A;  3O9Q A;  3MCP A;  4FPB A;  3SMS A;  2YX6 A;  3EN9 A;  5M1K A;  4A62 A;  4BRG A;  5FPN A;  2FSN A;  3VPZ A;  4JK8 A;  3SBG A;  1QVG M;  2J4R A;  1MDU B;  2W41 A;  2YHW A;  4QS7 A;  4WFN L;  4BEC A;  4Y0W A;  3VTI A;  3R9P A;  4BGB A;  2QXL A;  4CBU A;  1ILY A;  1S3X A;  3MMV A;  3QB0 A;  3SAG A;  5AQK A;  5CE3 A;  2QWM A;  3A5M C;  3QBX A;  4NO7 A;  2KKZ A;  2QM1 A;  3M6G A;  5LJV A;  3R8E A;  2AA4 A;  3E1Y A;  1BA1 A;  4KH5 A;  1T6C A;  3C6H A;  3LDP A;  1MWK A;  5E84 A;  5AQW A;  5FPM A;  4JHD B;  4IOA L;  2RHK A;  2QWP A;  4FOI A;  2QW9 A;  3AAP A;  3E9P A;  3CIP A;  1EO1 A;  2NRH A;  3K9K A;  3KVG A;  2PFU A;  3CJB A;  1BO5 O;  2HOE A;  4GVE A;  4Z94 A;  3TTC A;  4FOE A;  1VQP N;  3O1B A;  1NWK A;  5C2D A;  4H0O A;  1NGC A;  1P90 A;  2P9L B;  2P9N B;  3HM8 A;  3ID6 A;  4QS8 A;  1YIT N;  3HRG A;  1RFQ A;  3H46 O;  3A8Y A;  3J7Z O;  3CF5 L;  5AZJ B;  3MCA B;  3EZW A;  4DQ8 A;  3HZ6 A;  3W3D A;  1NGH A;  3MDQ A;  4JKA A;  1KAX A;  1P8Z A;  2I7N A;  2NRW A;  3A0I X;  4WQ4 C;  3VGM A;  4FO0 A;  1XQS C;  2UYT A;  4GNI A;  3CET A;  4EIA A;  3MN9 A;  4O8U A;  1KC8 O;  1T6D A;  5BR9 A;  5BN9 A;  3GOI A;  4JNE A;  4FWK A;  1H1V A;  2D4W A;  1NGA A;  1QQN A;  2HBM A;  5BRD A;  4C23 A;  2P9K B;  3AGR A;  3LM9 A;  1HLU A;  1QQO A;  3FGU A;  3WXI A;  4A59 A;  4C1N I;  5M1N A;  4IEE A;  2I7P A;  4FVU A;  3ATV A;  4BE7 B;  2BH1 A;  3G6E N;  2P9U A;  4OPH A;  4A61 A;  4A2B A;  4K41 A;  5EX5 A;  5AZI A;  3SAF A;  2D0P A;  3NVM A;  3CJ1 A;  4K43 A;  4DKW A;  2QEX N;  2AP1 A;  3IUC A;  2HBK A;  3D2F B;  1T44 A;  1K73 O;  3O80 A;  4CZG A;  4JKC A;  1ZBS A;  3WEE A;  5AQR A;  2P9P B;  3RSE A;  4B1V A;  3ZEU A;  5JMV A;  1VQM N;  1GLB G;  4NB4 A;  3VGK A;  1GLE G;  1D4X A;  4BG8 A;  3HSC A;  2VYP A;  3CQY A;  3ENH A;  4BC5 A;  4JKF A;  1VQ5 N;  1DKG D;  3A5L C;  4YDU A;  5AQO A;  4BR7 A;  1JCE A;  2NNW A;  1BG3 A;  3J8A A;  3OHR A;  1ESV A;  4WQ5 C;  1QZ5 A;  2NZT A;  4U7B A;  5ADX H;  1VQ8 N;  3H3N O;  3IDH A;  1VQ6 N;  4B1U B;  2ZWH A;  3O8M A;  4WYB A;  1BUP A;  2YCH A;  4PKG A;  4BC3 A;  4HTL A;  3MN6 A;  3LDQ A;  2IIR A;  2F9T A;  4JKE A;  3SAH A;  5JLH A;  3GBT A;  4O5F A;  2CGL A;  3BP8 A;  5EXW A;  5BPL A;  5BRH A;  5BRF A;  4GV3 A;  5AQY A;  3TSP A;  1OVY A;  3CHW A;  4BR2 A;  4BC4 A;  2CGK A;  3QFU A;  4BVO A;  2YJE A;  3ZX2 A;  2E2P A;  3F2K A;  3LL3 A;  4BRK A;  4MLH A;  3H3O B;  5M1P A;  3DAW A;  5KPZ A;  1VQK N;  4JK9 A;  4NLC A;  1VQL N;  3JXU A;  3ULE A;  4CZL A;  4FPA A;  1Q7Y O;  2VGM A;  3CJ9 A;  3P31 A;  3KK7 A;  4KH4 A;  4IOC L;  2C1G A;  3VES A;  3FLC O;  3CC2 N;  2QI2 A;  3VOV A;  4CZM A;  2FLO A;  2YHX A;  4OO1 J;  1X3M A;  3EE9 A;  4B9Q A;  5GAE P;  3CJA A;  1TYQ B;  4DHY A;  3IMX A;  1NBW A;  3TTF A;  1K9M O;  5FPD A;  2KHO A;  2V7Z A;  3D7E O;  3TSU A;  3CCU N;  3WQU A;  4U67 L;  5AQX A;  5AQP A;  4PKH A;  4AM6 A;  3DLL L;  1VQ9 N;  3G25 A;  3B8A X;  1K8K A;  3LDO A;  1U2V A;  5AQS A;  4H5N A;  3VF2 A;  2QWR A;  1C0G A;  1SQK A;  3H45 C;  5C0Y A;  2HBJ A;  4B1Z A;  2V7Y A;  3N4P A;  4A5B A;  3CQX A;  3D6R A;  3ZET A;  5KQ8 A;  2P9I A;  2ZJP L;  3MK6 A;  3IFR A;  1V4T A;  3UKR A;  3KWI A;  4BQL A;  1HKB A;  1XC3 A;  2JWK A;  2YJF A;  4CZJ A;  3OA9 A;  1BOT O;  3SBT A;  5F2R A;  2Q1N A;  3NVK A;  5GAD P;  1JJ2 M;  4CBX A;  4FWQ A;  3G4S N;  4DB3 A;  1HJO A;  4XJX A;  1GLF O;  2PBD A;  2QTD A;  3MWT A;  3CCL N;  4CZF A;  4BR0 A;  2FF3 B;  3ZEU B;  2HBL A;  2WC9 A;  3M1F A;  3FZK A;  4PHT X;  4WFA L;  1VQN N;  3H1V X;  3NMU A;  4IOX A;  2RE2 A;  4FWR A;  4QS9 A;  4XH4 A;  3O6W A;  5KQD A;  3VTH A;  1Z05 A;  4KBO A;  3FZF A;  4BR4 A;  3TPQ A;  4CD1 A;  1J6Z A;  4GV9 A;  4YOU A;  1SZ2 A;  1M1K O;  1ATN A;  5M1Q A;  2A40 A;  3MN5 A;  3L0Q A;  3FFK B;  5JLF A;  5HL7 L;  3QIC A;  3VEY A;  3GG4 A;  1TUY A;  3JS6 A;  1IJJ A;  3FZH A;  2D1K A;  5LJW A;  2VGN A;  5AQM A;  1MA9 B;  3WQT A;  4BRH A;  3HI0 A;  3IKM A;  3EO3 A;  4BRN A;  1YJW N;  3VEO A;  3DJC A;  5AFU H;  5AQI A;  1QHA A;  4GY2 B;  4A57 A;  2IVO A;  1NGB A;  2CH5 A;  4BRQ A;  1YAG A;  4H03 B;  3AGK A;  2ZF5 O;  4B1X B;  3CXC M;  2E1Y A;  5AQJ A;  3OBY A;  2OTJ N;  2Q2R A;  3A5O C;  3MX2 A;  2P9S B;  2VCP A;  4JKB A;  5H1S Q;  4ILG B;  4EHU A;  4F9O A;  3CCR N;  1NGF A;  4JN4 A;  3QML A;  1VAZ A;  3Q7B A;  3VF4 A;  2IVN A;  4AM7 A;  4BRL A;  3UE5 A;  1E4G T;  5GIP A;  4CZI A;  2FF6 A;  1X3N A;  4IWV A;  4ISG A;  2Q0U A;  2GEL A;  5AQH A;  4BRD A;  3I55 N;  4YOT A;  5JVG L;  1DEJ A;  3SK3 A;  3CC7 N;  4ISE A;  2NRX A;  4PL8 A;  1TUU A;  4RWT A;  4BY9 C;  4BRF A;  3CER A;  4CJ7 A;  5CR4 A;  4ILH A;  4CZH A;  5DM6 L;  5FPE A;  2PAV A;  4LC9 B;  1V4S A;  4MLE A;  5AQU A;  4EAH D;  3AAR A;  1QZ6 A;  2E8A A;  3PLA A;  2KLA A;  2P9I B;  3O08 A;  4CBW A;  3CJ7 A;  3O9T A;  4GV6 A;  2A42 A;  5KPT A;  3CPW M;  1DT9 A;  3MN7 A;  2BTF A;  1XUP O;  2GUP A;  3DXK A;  3I8B A;  4MDA A;  4RTF D;  4JHD A;  2E2O A;  1QVF M;  2YHY A;  3F9M A;  5AR0 A;  3D2E A;  3CCS N;  1GLJ O;  4HWI A;  1BU6 O;  3GE1 A;  3O1W A;  4K25 A;  3VEV A;  3O5B A;  4FWP A;  1NGE A;  2FXU A;  5AQT A;  3O9S A;  4FWL A;  2P9L A;  2P9N A;  5EY4 A;  3AY9 A;  5C10 A;  3WT0 A;  4IO9 L;  3LDN A;  2Q0R A;  2QWL A;  3L6Q A;  5AQF A;  2H3G X;  3WUH A;  1DGK N;  4K42 A;  2OTL N;  1YF5 L;  2F9W A;  1GLD G;  3N4Q A;  4IFE A;  3VEZ A;  4B1W B;  5AQV A;  2OAN A;  4JKH A;  3U9Z A;  1O13 A;  3LDL A;  1RDU A;  5BRE A;  1KQS M;  2P9K A;  3UB5 A;  2HST A;  3VET A;  3R1X A;  1R59 O;  2ZJQ L;  3Q7C A;  4BGA A;  2D0O A;  4H5V A;  1VQ7 N;  1LCU A;  2WFB A;  2Q97 A;  4I6M A;  3WXK A;  2E2N A;  3EKU A;  3VER A;  3SMP A;  3C6A A;  3D2F A;  3VEW A;  4WQ4 A;  3UKU A;  3ID8 A;  4YOX A;  1YXQ A;  2P9U B;  4C1N K;  3KZB A;  4YDU C;  5HOO A;  2E2Q A;  4JK7 A;  1VQO N;  5AZI B;  1HUX A;  1Q82 O;  1HPM A;  2P9P A;  4BRE A;  4MO4 A;  1KD1 O;  2C1I A;  1WUA A;  3GDQ A;  3K9J A;  1W97 L;  2VWB A;  5C2F A;  3KWG A;  1GLA G;  3HOT A;  4BC2 A;  3CPE A;  4BVP A;  3U4L A;  3WEE B;  1YJN N;  3E9L A;  1S72 N;  5C12 A;  2E1Z A;  3RSE B;  1NLV A;  3S41 A;  2QWQ A;  3R3L A;  2GTD A;  2QWN A;  3FZL A;  3GL1 A;  5E26 A;  2FSJ A;  4YOW A;  1OKJ A;  3O9R A;  5DM7 L;  3FR0 A;  2HMP A;  4YOR A;  1T3V A;  1HKC A;  3VEN A;  4A2A A;  4XEI A;  1YIJ N;  3G71 N;  5GAG P;  1Z6R A;  2CGJ A;  1BA0 A;  2E88 A;  3M3Z A;  5AQN A;  4B1Y B;  2NRR A;  3H6E A;  1HX1 A;  3CCJ N;  1Q86 O;  1K8A O;  4PL7 A;  3P39 A;  3HTV A;  3OW2 M;  1YUW A;  4JD2 A;  3C0B A;  2ASP A;  3R6M A;  4BRC A;  4BR5 A;  3CMA N;  4G9Z A;  4WQ5 A;  5TKY A;  1IG8 A;  3DXK B;  3I56 N;  3ATU A;  1MWM A;  4PKI A;  4BRI A;  3CCE N;  3D2E B;  1M90 O;  3CI5 A;  3MWP A;  4BRO A;  1JCG A;  3O9U A;  4BR9 A;  3ENO A;  2ITM A;  3TSQ A;  2HF4 A;  4MDB A;  2W00 A;  2E20 A;  5JVH L;  3O4W A;  2A3Z A;  2QA4 N;  1YHQ N;  2NLX A;  3VMF B;  2YI1 A;  3BUZ B;  4BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...