2P9PA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
412
structure length
388
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGKWIKQYTGINAKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 124
structure length 388
sequence length 412
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pA03
3QFUA 2P9IA 3VETA 3ZX0A 2A42A 4PKGA 4H5TA 4WYBA 1T6DA 1Q18A 2NZTA 1Y64A 4FPAA 4IXCA 3ZETA 1QHAA 2E2NA 4AM6A 2YHXA 3FZHA 4BG9A 1BO5O 1BOTO 1BG3A 2BTFA 4BC3A 3BF3A 3GE1A 4LC9B 2W40A 2IVOA 3L6QA 3ZX2A 4ISFA 4BRPA 3ID8A 4QS9A 2YHWA 1GLCG 4MLEA 2V7YA 4FOIA 4H5VA 4MO4A 5B8HA 4O5FA 1IJJA 2OANA 3ENHA 3I8BA 2FF3B 4HTLA 1LCUA 4L3QA 2P9UA 2UYTA 2PBDA 4H0XB 4BR0A 2VYPA 4DCHA 1EQYA 4AM7A 2HOEA 2D0PA 2YCHA 1JCEA 4WQ4C 3EN9A 3FLCO 4BR2A 3D7EO 1E4FT 4B9QA 2Q36A 4ISEA 5FPEA 1JCGA 3VENA 1E4GT 5AQPA 3BEXA 3VEWA 1NWKA 2P9PB 3SLCA 4EHTA 3QBWA 4M63C 4WQ4A 4BRNA 4BR4A 3DXKB 4CBWA 4H5RA 2YJFA 4DQ8A 4XH4A 3QDKA 3A0IX 4HWIA 1G99A 1BU6O 3CIPA 3O4WA 2IIRA 2AP1A 2IVNA 4ISGA 5AZIB 2AA4A 5AQLA 3CJ7A 3VEOA 3LL3A 5LJVA 3VF4A 5AQJA 5KQ8A 2GUPA 3OHRA 3ZETB 3DAWA 2P9SB 3CJ1A 1DKGD 2Q2RA 3AAPA 4CBUA 3ATVA 4JD2B 3QICA 3IUCA 3CI5A 4BR5A 4CZFA 1GLJO 1QQNA 1ATNA 4BC5A 4NB4A 5KPZA 1U2VA 3H1VX 2E1ZA 5FPDA 2I7NA 3CHWA 1BWFO 5EVZA 3VESA 3VGMA 5BPMA 1HKBA 4IO8A 4CZEA 3LDPA 4FWRA 2D0OA 4JAXA 2QWOA 3O5BA 2QXLA 4J8FA 1LOTB 3DWLA 2A6AA 1GLLO 1K8KA 1U6ZA 3RSEB 3EO3A 3KVGA 5FPNA 2E2PA 5AQWA 2YI1A 4I6MA 3GBTA 3O80A 4BRMA 2D1KA 2J4RA 3W3DA 2A3ZA 3HBTA 3EKUA 5EY4A 4O8KA 3CJ9A 3UB5A 4BRIA 3HZ6A 1QQMA 1J6ZA 3HI0A 3JXUA 3ZX3A 2F9TA 4IJNA 2E8AA 4FPBA 4FOEA 4H5WA 2BUPA 2ASMA 5JMVA 1NGJA 2YHYA 4Y0WA 5AQFA 3EL2A 3U8XA 3VOVA 4B1ZA 4H0TB 1YVNA 2NLXA 3WXJA 3O6WA 4H5NA 3H6EA 4H0YB 4PL8A 3QMLA 3VEZA 3VERA 3A5NC 2VCPA 2Q1NA 2ZGZA 3QFPA 5AZJB 4BVOA 5KQDA 5KPTA 1HX1A 5AFUA 3CQYA 4BQLA 4JHDB 3GOIA 3U9DA 3WXKA 4CZIA 4EFHA 1BA0A 5BPLA 4BRFA 4FO0A 2P9KB 2ITMA 5F2RA 4GY2B 5TKYA 4BRQA 3AARA 1NGAA 3FZFA 1NBWA 3WEEB 4A2BA 1ZXOA 5EX5A 1RGIA 2ASPA 4FL9A 2A5XA 4FWMA 1Z6RA 3IDHA 3CJCA 3J8AA 1KAXA 5EOYA 3W0LA 4CZHA 3M1FA 3HTVA 3MN9A 4MLHA 3VF2A 5BRDA 1QZ6A 3CERA 3TU5A 1HPMA 4BVPA 3DJCA 4MO5A 2QWRA 3VEYA 3WEEA 5AQHA 4Z94A 5JICA 2Q97A 2I7PA 1TYQB 3SJHA 3ENOA 4BC4A 4BRHA 2E1YA 4DHYA 3D2FB 2CGLA 2CGKA 4WQ5A 1SQKA 3MN5A 1GLDG 1NGGA 4CZLA 3O8MA 3FFKB 3D2EB 3ULEB 1XC3A 3WXLA 4CBXA 3GG4A 4B1YB 1NGEA 3GDQA 2P9PA 5AQSA 4CJ7A 3ZEUA 4C23A 3C7NB 4JN4A 4B1WB 2ZWHA 1ATRA 1WOQA 5EXWA 2FLOA 3L0QA 2GTDA 4YDUA 3O1BA 3BUZB 1X9JA 3FR0A 3M3ZA 3U4LA 2KHOA 2EWSA 1NGFA 2P9UB 3WXIA 2FSJA 2YJEA 4A62A 4BRKA 4CD3A 1V4SA 2QWQA 3CJBA 4BREA 4FWNA 4YDUC 3EKSA 4XEIA 5AQOA 3L4IA 3SK3A 2F9WA 3TPQA 5AZJA 1NGIA 4BQZA 1ATSA 3IMXA 1IG8A 4BRGA 3QB0A 2V7ZA 5AQNA 1GLBG 3SMPA 4IJAA 4XH1A 2V51B 5AQUA 4PL7A 4BRLA 5JLFA 1YAGA 2GELA 1HJOA 2WUSA 3R6MA 4QS7A 4RWTA 1V4TA 1X3NA 4JNEA 3SMSA 3A8YA 3MN6A 1TYQA 2FF6A 2HF3A 5E84A 2E20A 3O08A 3UKUB 1WUAA 3LDNA 1C0FA 2P9KA 3AAQA 2HF4A 4FWQA 3R8EA 1XUPO 2ZF5O 3KZBA 1D4XA 3G25A 2FSNA 1KAZA 4M7YA 1TUYA 2P9IB 4RTFD 5JLHA 2QWPA 3CETA 3BF1A 5AQYA 3VEVA 4PKIA 1JCFA 1QZ5A 3DXKA 5AFUH 4B1UB 3M6GA 4BGAA 3BP8A 3H3OB 3R9PA 3O1WA 1ZBSA 4IZ9A 4B1XB 4EIAA 4CI6A 1SZ2A 1MA9B 4H0OA 2Q0UA 1BA1A 3MMVA 5BR9A 2P9LA 4FWOA 3DXMB 2ASOA 2CH6A 2E2QA 4FWSA 3D2EA 2A41A 1NMDA 3F9MA 2P9SA 4WQ5C 4KBOA 1RFQA 1SAZA 5E26A 2E88A 3H1QA 1NGDA 3VGKA 2VWBA 3H45C 4GNIA 5ADXH 2FSKA 1XQSC 3ZEUB 1T44A 3B8AX 1MDUB 1P8ZA 1Z05A 2IVPA 5AR0A 4BC2A 1ZC6A 2Q31A 4CZJA 1KXPA 3WQUA 2Q0RA 3A5LC 3VEXA 3FGUA 1S3XA 3S41A 2PAVA 2CGJA 3GL1A 3JS6A 1QQOA 3UE5A 5CE3A 4FWKA 2V52B 2ZGYA 4F9OA 5BRHA 3VGLA 4H03B 3D2FA 2W41A 5BREA 3UKUA 1R59O 4BR7A 5FPMA 3AY9A 4XH5A 4BRCA 1HKGA 5AQKA 1KAYA 4A61A 4BROA 1HLUA 3FZMA 1K8KB 4H0PA 4K42A 3VF6A 4M7XA 2QM1A 1BUPA 3WQTA 3WUHA 1YXQA 2QWMA 4PKHA 5AQIA 3DXMA 3MCPA 3WT0A 3A5OC 5LY3A 1NGCA 4QS8A 2H3GX 5AQGA 5I9EB 3MDQA 1T6CA 1MWKA 1C0GA 1CZAN 1U2VB 2E2OA 2P9NA 2GWKA 2HMPA 4I6MB 2D4WA 4K43A 5AQTA 2QWNA 2GEMA 4RCHA 3ATUA 3RSEA 4EAHD 4JD2A 4FSVA 5AQVA 4CZGA 2QWLA 1S22A 5ADXA 3U9ZA 4CD1A 5F0XA 4CZMA 4BRAA 2P9LB 3H46O 1TUUA 3C0BA 3FZLA 3IFRA 2CH5A 2QW9A 3P4IA 4JHDA 3KHYA 1ESVA 1DGKN 1NLVA 1BDGA 2FXUA 3LM2A 3C7NA 4NO7A 1X3MA 2NRHA 4H0VB 1H1VA 3EZWA 3LDQA 1RDWX 4FWPA 1HUXA 1GLFO 4IWVA 3H3NO 1GLEG 3MK6A 4E1JA 3ULEA 5BRFA 3I33A 2P9NB 3FZKA 5LJWA 5BN9A 4BG8A 4B1VA 4A2AA 3LDLA 3UKRA 4CZKA 4DB3A 5BN8A 1NM1A 4BGBA 3MN7A 5AZIA 4K41A 3QBXA 2A40A 3FE1A 3CJAA 1MWMA 5AQMA 2DPNA 1GLAG 4FWLA 5F1XA 5BPNA 1YUWA 5KPRA 1NGBA 4K25A 3LDOA 4EHUA 5AQZA 5ELZA 4BR9A 5AQQA 3UKRB 3LM9A 2GWJA 3CQXA 1NGHA 3VPZA 1DEJA 3HSCA 3HM8A 5AQRA 5AQXA 3A5MC 4BRDA 1HKCA 1OKJA
chains in the Genus database with same CATH superfamily
4FK4A 4CCHA 4DSLA 2UXDK 3K9KA 2BGGA 3A2FA 1WSEA 1T05A 5SZTA 1WSFA 3L4QA 2P5GA 1BG3A 3TI0A 1BI4B 3MEEA 4C8NA 3CCVN 1VQ9N 3LP2A 4CF2A 2RKIA 1Q7YO 1K9MO 2W40A 3LPTA 3M8QA 3L6QA 4E7KA 1RT7A 3TWHA 4FVMA 2HHTA 3CCLN 4BDPA 1VQMN 4MO4A 3CCSN 4E7JA 4FM0A 2FBYA 1EKEA 2PZSA 2UYTA 2PBDA 2VQFK 1EQYA 5CR4A 1VSLA 4DR3K 3HSTB 1HYZA 3D7EO 4DSEA 1E4FT 3SUNA 2IDOA 2HBMA 4N5SA 3NE6A 1QE1A 1WNSA 3TAMA 3VENA 2HHIA 5AQPA 4FLTA 4GVEA 2BH1A 3QBWA 4WQ4A 4BRNA 4BR4A 1YF5L 4CHNA 1SKSA 2W00A 3OYLA 3A0IX 2XO7A 2X6NA 3SYZA 4CK1A 2AP1A 4YOYA 4EP5A 5AZIB 4OPKA 2AA4A 5AQLA 3VEOA 1IV0A 5E41A 1VSJA 5LJVA 3ZETB 1N5YA 4OKEA 3CJ1A 3J7ZO 2O8DA 1N32K 4LSLA 4CBUA 3T69A 4JD2B 1SL0A 1NOZA 1Z25A 4BC5A 4NB4A 1U2VA 3VGMA 4CK3A 4FJ9A 3F73A 3SQ1A 4JAXA 5HRNA 2EX3A 2QXLA 4FZZA 2A6AA 1BCOA 1GLLO 4Y1CA 5IWAK 4C8MA 4BY9C 2E2PA 4AHUA 2ZM6K 3D6RA 3QEXA 4O44A 5I42A 1OH7A 3TAPA 1OH5A 2D0CA 3GBTA 4BRMA 3W3DA 1Y97A 4PHTX 3EKUA 4B08A 4O8KA 3CJ9A 3T3FA 2YHBA 2O8FB 4IJNA 1LAWA 4HUFA 4JI5K 2DFFA 2X6SA 2W6LA 4FOEA 4H5WA 4DTNA 2BUPA 2F8SA 2ASMA 1N36K 1KC8O 3DLRA 1KVBA 1O1WA 3EL2A 3HO1A 4DFJA 4JI0K 4H0TB 1YVNA 3WXJA 4DFMA 1WAJA 4H5NA 3H6EA 4O8UA 4RW6A 4PL8A 3QMLA 1Q82O 1UWBA 4M42A 5CZ1A 3DOLA 5KRTA 5KPTA 4M3UA 4O55A 3O9QA 1YI2N 2QXFA 1B9DA 1XHXA 4JKBA 3U9DA 4CGFA 4LY7A 2NRWA 4FJXA 5BPLA 2P9KB 3RMAA 4IFYA 1X9MA 2NRXA 1LAVA 4TSXA 3PIPL 3AARA 3SCXA 2KFZA 2KKZA 2KW4A 5EX5A 3U6FA 4FJHA 4B3OA 3U3YA 4NXMK 1Z6RA 4A57A 1SUQA 4I2PA 4E7IA 3RMDA 1VQLN 3HTVA 3IKMA 4E0DA 3AVCA 1HNWK 3OBYA 1TGOA 3ZSYA 3K5NA 4DV4K 1WN7A 2YKNA 1HPMA 4E72A 4OGCA 3DJCA 5C2FA 4MO5A 3IRXA 4H4MA 4CIFA 4B8CA 2HHVA 2G8IA 4BRHA 4CJ3A 2CGLA 1GLDG 1NGGA 2X78A 3C65A 3O8MA 3FFKB 2IGIA 1C0UA 1QHTA 4OVLA 1WSGA 3C95A 3OYEA 1NGEA 2Y1JA 5AQSA 4CJ7A 3ZEUA 2OTLN 4U7BA 4JN4A 4B1WB 4J2EA 3P1GA 2ZWHA 4F4KA 1WOQA 4R79A 2VG5A 5CYQA 3O1BA 3O9UA 4JK9A 5C25A 5J2PA 4N41A 3U4LA 2EWSA 3AVHA 2FSJA 4A62A 4BRKA 3OYAA 5M1FA 3CJBA 4YDUC 1TV6A 1D8YA 4XEIA 3L4IA 3AVKA 1TVRA 4X64K 3OS0A 4FJ7A 4JEPA 4IEIA 3ZSOA 2V7ZA 1GLBG 1D9DA 3SMPA 2YNGA 4CEFA 4PL7A 4BRLA 3K59A 1YAGA 3CMAN 4FZYA 4JI2K 4B9VA 4BWJA 3MN6A 2WC9A 3ZSWA 5E84A 4GMJB 1WUAA 3PIOL 3LDNA 2O8FA 2UUBK 4FWQA 3O9RA 3ZLJA 4AH9A 3BF1A 5J1EA 1YJNN 3M6GA 3PUFA 3AVIA 3T19A 3R9PA 1SL2A 3HPHA 3OYDA 4YOTA 4CI6A 4O5BA 5GADP 1MA9B 2Q0UA 1TK8A 4E7LA 1NK5A 3AA5X 2P9LA 4FWOA 3SUOA 3DI6A 1HQEA 2A41A 1C0TA 3HL8A 4DSIA 4KBOA 3LWLA 3ZT2A 5M1NA 1SAZA 5GINA 4AQYK 4DTJA 1NKCA 3CD6N 1B92A 3H1QA 4E19A 3ZSRA 1NGDA 3P83D 2VWBA 5ADXH 4NCGA 1JLAA 3ZEUB 1T44A 2IVPA 1Z05A 3QEPA 4DR1K 3HM9A 4BC2A 2Q31A 2R7YA 4FJJA 1KXPA 1CLQA 3DLGA 4KV8A 3A5LC 4N76A 3NGZA 4JKCA 3CCEN 4CJRA 1RTIA 3MWPA 4JKAA 3JS6A 4DS4A 2F96A 4FWKA 3LDSA 4DV3K 3CG7A 1EP4A 1N8RO 2UXCK 5BREA 3UKUA 4BR7A 3F9KA 2HMIA 3TR8A 1RT3A 4XH5A 4IEEA 1JXEA 4BE0A 2Z1JA 3DM2A 5CY4A 1HLUA 4FYDA 1K8KB 3BGRA 3SZ2A 1QVFM 4H0PA 1SKWA 3AVGA 2QM1A 3WQTA 3WUHA 3MCPA 1C1AA 5I9EB 1ZBFA 4JS4A 1GOAA 1C0GA 2IC3A 2X74A 3L3VA 2QWNA 1BISA 2OCEA 4M3RA 2VWJA 4FSVA 5AQVA 4CZGA 3U9ZA 5J2QA 4J2BA 5F0XA 2G8WA 3IFRA 5DM7L 1ESVA 3WXMB 1NLVA 1TL1A 4DF8A 1UAXA 3C7NA 4NLCA 1RDDA 2E6MA 4MQ3A 2Z1GA 3VQ6A 3IAYA 1WB9A 4CEQA 1GLFO 4FK0A 4CJKA 1GLEG 4YHHK 1HR0K 2GV9A 3AA3A 3EY1A 1C1BA 2ETJA 1BCMA 4CJWA 4KHYA 4A2AA 1IH7A 4ZHRA 4CZKA 4DV2K 2B4JA 3QIPA 5BN8A 2XY5A 1N6QA 4JKGA 2NRZA 5AZIA 4BE1A 1SV5A 2A40A 1MWMA 5F1XA 3ZT0A 3OYNA 3CM6A 4K25A 4CJQA 1WBBA 1VQ7N 4FLYA 4JKGB 4O0JA 3UKRB 1IBMK 1X9SA 4FW1A 1TL3A 4CJEA 3NVKA 1NGHA 4FJ5A 4DU3A 5AQRA 3ZT3A 2HHWA 4F2SA 3VA3A 1RDCA 4Q0BA 2P9IA 1JLEA 1J53A 4WYBA 3HVTA 5KI6A 1T6DA 2NZTA 3D0PA 1RTDA 4FPAA 1QHAA 3HRGA 2E2NA 3I56N 2FC0A 3M5RA 5AJ3K 4BG9A 4JRQA 3AVLA 4RW8A 3TTDA 3O3HA 2E4LA 4Z4GA 4BC3A 3GE1A 2IVOA 3QLHA 1ZYQA 4ISFA 3RMBA 4ID5A 4QS9A 2YHWA 1S1WA 2XY8A 4MLEA 4FOIA 3KD5E 1IBLK 1RT4A 4YY3K 1IJJA 2HHSA 3V1QA 4CF1A 4OX9K 3HYFA 1T7PA 4L3QA 4WE1A 3Q7CA 4H0XB 4CHPA 4EZ6A 4CFBA 4CGJA 2HOEA 2D0PA 2YCHA 1HYSA 3VQ5A 3FLCO 4JI7K 4B9QA 1NJZA 2P51A 5C2DA 3RRGA 1VSIA 2ZE2A 3CC2N 3BEXA 1YVUA 4G9ZA 4W5RA 4B3SK 4M63C 3CCJN 2VGNA 3DXKB 2ZJQL 5FROA 1QVGM 4XH4A 3QDKA 5A2QO 2EHGA 4OKJA 2Q3SA 4FVUA 1LW0A 3VMFB 3T1YK 4DQPA 3CYGA 2FBXA 4OPAA 4CIGA 3EE8A 3LL3A 4YOUA 3VF4A 3OHRA 4HCBA 4JS5A 5FDLA 1ASWA 4Z4EA 4OLAA 3ATVA 2UXBK 3QEVA 3QICA 4KI6A 4CHYA 1L5UA 3IUCA 1QQNA 3OJSA 3L2VA 1OVQA 4E1NA 4CK2A 1REVA 5KPZA 3WNFA 1S72N 5FPDA 3OY9A 3CHWA 4HUGA 3HK2A 2NRTA 3F5TA 3VESA 5BPMA 1Q9XA 1ZBHA 4IO8A 1JLQA 3TTCA 4OPJA 3QESA 5C12A 4KHPK 2G8FA 4H8KA 1HYVA 1LOTB 3RMCA 3NCIA 3J7AP 3G0ZA 4KHUA 1NMNA 2HB5A 4NXNK 2ZJRL 4CGDA 2YI1A 4DQRA 1XC9A 3PSFA 1W97L 4F2RA 1HNXK 4DTPA 3L2WA 2J4RA 5J2MA 3MX2A 4I9QA 3DRSA 4M3TA 3UB5A 3TTFA 1QQMA 2GX9A 3ZX3A 4O0IA 2WONA 4IG3A 3KK1A 3BY5A 5JMVA 3CXCM 3LANA 4CF8A 4LH5A 3JYTA 1KQSM 5AQFA 2XHBA 4FLWA 3U8XA 4M3WA 4JYAK 4FJNA 2PFUA 3BDPA 4X65K 1JJ2M 3O6WA 5DM6L 4Z4CA 4FLXA 1J5OA 3MX5A 1IKVA 4YOXA 3QETA 2G8HA 3VERA 1DTQA 2Q1NA 5AZJB 2DFHA 3K9JA 4JHDB 3I8DA 4LH4A 2VG6A 3WXKA 4CZIA 4RW9A 1BA0A 3I0SA 4FM2A 1RT5A 4KKOA 5M1OA 3NH2A 3MEGA 4C1NI 5DK5A 1FJGK 1TKXA 3FZFA 1NBWA 3WEEB 1L3SA 1EO1A 2ASPA 4FL9A 2A5XA 2A1SA 1KAXA 1XMOK 4CZHA 3M1FA 3CQ8A 4MLHA 3AA4A 4JI3K 5BRDA 1C0MA 2IOCA 2HBLA 3TU5A 3SAHA 1IKYA 2D0AA 3VEYA 3WEEA 5AQHA 1BHLA 3SJHA 5C42A 3D2FB 4WQ5A 3MN5A 1KSPA 2WOMA 2I5JA 5I3UA 3S3OA 4DR6K 1LWFA 1XC3A 4L8RB 1F21A 4KAZA 1U47A 3GG4A 4DTXA 2UUAK 4M3YA 1W9HA 5LL6Z 4JLHA 3T7ZA 4C23A 3C7NB 1KTQA 4KHQA 1RCHA 1A5WA 4KTQA 3THYB 4DV0K 3J81O 3VQ8A 5EXWA 3OTOK 4ELTA 4GW6A 4CEAA 4UQGA 5CZ2A 1ASUA 4CF9A 1NKBA 4WFBL 3KKRA 3FR0A 4YOWA 1NGFA 2KLAA 5HL7L 3OYGA 1I39A 1Q8IA 4FWNA 4GKJK 5AQOA 3SPZA 3SK3A 4DU1A 4MDBA 2PYJA 1NK7A 1IG8A 4BRGA 4JKEA 4DTRA 1YTUA 3MXIA 2QKBA 4QCLA 3HJFA 1ASVA 2V51B 3K5LA 4IG0A 4DV6K 1QQCA 2GELA 4M41A 1HJOA 2QA4N 4DTMA 3NDKA 4JNEA 3B6PA 3CCMN 1RT2A 3A8YA 3SJJA 2DY4A 1BL3A 2FF6A 3DRRA 2E20A 4OKKA 1LV5A 5C15A 3P31A 3N4QA 3AAQA 3P5JA 2HNDA 4NCAA 3THXB 2ZF5O 4I9LA 2FSNA 4DG1A 4M7YA 4AHSA 2P9IB 3CETA 5AQYA 3HT3A 3VEVA 4PKIA 3V9UA 3AO1A 4BGAA 2D5RA 3H3OB 1UA1A 2O8EA 4PA1A 2KQ2A 4EIAA 4I2QA 1SZ2A 3SPYA 2OA8A 4FLZA 2E6LA 3CFRA 3SI6A 4KHNA 1G15A 5CYMA 3DXMB 2CH6A 4FWSA 4AHRA 3D2EA 4WQ5C 3M8RA 4KREA 4JI4K 5KGXA 1DT9A 1ZBLA 5LMUK 1VK0A 4CJSA 3H45C 4GNIA 4CEBA 1JLGA 2BDPA 1P8ZA 4CZJA 4B3RK 1VQPN 3ITHA 3CMEN 2HNYA 3WQUA 2Q0RA 2B5JA 3FGUA 3S41A 1S1UA 4RG8A 5FRNA 2PAVA 4XIUA 3OYHA 3UE5A 5BRHA 3KKSA 3THVA 4DFKA 1RDAA 1BQNA 3PLAA 2YNIA 1XWLA 4BRCA 4FJMA 3C6TA 3FZMA 1U45A 1DTTA 3AGRA 4BECA 4H4OA 4ZTJA 3AVFA 5KRSA 3R3LA 1BUPA 1YXQA 3NGYA 4PKHA 5AQIA 5LY3A 3CCRN 3S3MA 1NGCA 3RWUA 5AQGA 3M8PA 1T6CA 1MWKA 3LP1A 1Q81O 3E66A 2HMPA 2D4WA 4DUZK 3ZSXA 2WFBA 4JK8A 1R0AA 4DR7K 1TKTA 1RTJA 2KZMA 2ITGA 5J2NA 3TSPA 4EAHD 1VQKN 4QOZB 1X1PA 4FJGA 4CD1A 4Z4FA 1L3UA 1VSMA 1BI4A 3ASMA 3H46O 2QW9A 3P4IA 3KLHA 1BDGA 4FJKA 3KJVA 2NRHA 1A5VA 1H1VA 3EZWA 1NU0A 3S5TA 1DLOA 1RDWX 1HUXA 2HSTA 4LFBK 3H3NO 4CHZA 1NJYA 3T1AA 3QERA 3MK6A 2O8DB 3RVCA 3VQPA 2P9NB 4FM1A 5BN9A 3CF5L 2O8BA 4B1VA 4DV5K 4DR5K 3UKRA 4DB3A 4DTSA 4E7HA 3NAEA 3CJAA 3FE1A 3V9SA 2DPNA 3ZCMA 1GLAG 4AHTA 4EHUA 5HRRA 2OYQA 4IBNA 3V1OA 5AQQA 1BIUA 2JWKA 4CECA 2HHQA 2GWJA 3OS2A 3LZJA 4B3TK 3VPZA 1NK9A 4KRFA 3HSCA 2F7TA 4LSNA 3DLKA 3RRHA 3MWTA 1RT1A 4OLBA 1KD1O 2AJQA 3PX6A 4H5TA 2D0BA 1K8AO 4IXCA 4NYNA 1OH6A 1OH8A 2XY6A 4BACA 2BTFA 1HMVA 5JS1A 4KFBA 4EP4A 3MXMA 3LAKA 4B9TA 4W5NA 3E9OA 5HLFA 3ID8A 3BZCA 1ILYA 3C6HA 1GLCG 4DV1K 2O4IA 2V7YA 4IDHA 3TABA 4O5FA 5GAEP 5SWMA 2PYLA 3I8BA 3ENHA 2FF3B 1P90A 3OYMA 4HTLA 3HOTA 1FKOA 5FRMA 3ZT1A 1HNZK 4BR0A 4DCHA 3CPEA 3EN9A 3CYMA 3VQQA 1YIJN 1S1XA 4Y1DA 2Q36A 5FPEA 3NF8A 1L3TA 2HHHK 3VEWA 1KFDA 3ENBA 3QINA 4YOVA 4CBWA 1VQ5N 4J2DA 2OZSA 2YJFA 4DQ8A 1G99A 3VN5A 4DQIA 2QEXN 4ILGB 1HNIA 3CIPA 3O4WA 2IIRA 4DU4A 2IVNA 2C1GA 3OYBA 3O4QA 2G8KA 5KQ8A 3ISNC 2P9SB 3S9HA 4NLBA 1DKGD 3SQ2A 3G6EN 1S5JA 1ZBUA 1RTHA 3CI5A 1NJWA 4BR5A 4B8AB 3KTQA 3VA0A 3H1VX 1C6VA 2I7NA 3ZYYX 1BWFO 1EX4A 5EVZA 1HJRA 5CHIA 1BGXT 4NYFA 4J8FA 3QEIA 3DWLA 3NGIA 1YITN 1JL1A 3SV3A 1U6ZA 3RSEB 4DSFA 4K8ZA 5JVHL 4A59A 3IS9A 4I6MA 2O8CB 3O80A 2D1KA 1W2BM 4CHQA 2A3ZA 3HBTA 4CIEA 1SL1A 5EY4A 1K6YA 1S6PA 3QNNA 2Z1HA 4BRIA 4LF6K 3HZ6A 3THXA 1XNRK 3AO3A 3HI0A 1J6ZA 3JXUA 1U48A 2F9TA 2E8AA 4FPBA 4KTWA 4KH5A 3K5MA 1L3VA 1RT6A 3CFOA 2YX6A 3U3GA 1J5EK 1TAQA 3VOVA 4B1ZA 4CGGA 2NLXA 1J9AA 2B6AA 2JLEA 2VQEK 4H0YB 5M1QA 3C94A 5BR8K 1XHZA 3VEZA 4ELUA 5GAGP 1EWRA 2VCPA 2ZGZA 5HROA 1YHQN 1HRHA 4CW7B 4CEZA 1D9FA 1HX1A 1YJWN 4BQLA 1RDUA 2O4GA 2A1RA 2KZZA 4K0KK 4LD0A 4EFHA 1NKEA 3HOSA 1I3AA 4W5QA 3V81A 4DR4K 3CPWM 2HHUA 5F2RA 4BRQA 3EYZA 5C10A 1NGAA 4DKWA 4BWMA 4CJVA 1ZXOA 1TKDA 4FWMA 3CJCA 5EOYA 5JS2A 2ZQBA 3LZIA 1IG9A 5C0YA 3SAFA 1QZ6A 3CERA 4AHCA 3FFIA 4M45A 3B6OA 4JI1K 3V1RA 4Z94A 5JICA 2LSNA 2Q97A 2I7PA 4BC4A 3ENOA 2E1YA 4X62K 4PUOA 2CGKA 4GVMA 3KLIA 3QO9A 4AILC 3ZT4A 4CZLA 3D2EB 3ULEB 2YKMA 4IFEA 3I0RA 3E9LA 3GDQA 2P9PA 1HQUA 1S1TA 3VQEA 2O8EB 4FW2A 4BE2A 1ATRA 1VSHA 3L0QA 4JV5K 4YDUA 3TANA 3H08A 4B9SA 1X9JA 1NK6A 4CF0A 3AVMA 1TKZA 3WXIA 4CFCA 3J80O 2YJEA 4FLVA 1XI1A 1TK0A 1SS6A 3EEQA 4CFDA 3THYA 2QWQA 1MU2A 3EKSA 4FCYA 3KWGA 3TPQA 1LWEA 4KI4A 3SQ0A 3IMXA 1HNVA 3NH1A 4DTUA 3HVRA 3F2KA 3QB0A 1KLMA 3VQ9A 2VGMA 1UOCA 5AQNA 3V9XA 3O9SA 4IJAA 4W5OA 4HHTA 3THWA 2WUSA 1YTAA 3R6MA 4QS7A 5KGWA 4W5TA 4Z4IA 4MFBA 1V4TA 3AO4A 2DFEA 3SQ4A 4Z0UA 1QSSA 3UIQA 1RBTA 4JI6K 3ZSZA 2PY5A 5LMNK 1TYQA 2HF3A 3UKUB 5D3GA 4KO0A 4CFAA 1C0FA 4C8OA 2P9KA 2HF4A 1WBDA 4KB0A 3G25A 3KZBA 1TUYA 5JLHA 4N56A 3HP6A 4HCCA 1RBVA 1JCFA 3DXKA 1UA0A 4A5AA 3O1WA 3P39A 4B1XB 3KLEA 3K57A 4H0OA 5BR9A 1BA1A 4FLUA 2ASOA 2NRRA 1T8EA 3F9MA 1XNQK 2Z1IA 1RFQA 4OO1J 5E26A 2E88A 2FSKA 3AO2A 1W7AA 1ZC6A 4I7FA 3KD1E 3PX0A 3AA2A 1T03A 1U04A 3RR7A 3VQ7A 3SBTA 2CGJA 2YNHA 5CE3A 2V52B 2XY7A 1RBSA 3VGLA 1ITGA 4CE9A 2W41A 2P1JA 1R59O 2P5OA 4C8KA 3AO5A 1HKGA 4CEOA 4IKFA 4ICLA 3CCQN 1JXBA 3LALA 4M7XA 3G71N 4KH4A 1CXQA 3Q7BA 3CFPA 3A5OC 4QS8A 1HPZA 2H3GX 1JL2A 3SBGA 4DQQA 4IOAL 3SV4A 1CZAN 4B3MK 3VQ4A 4F3OA 1JLFA 2E2OA 5H1SQ 1WLJA 2P9NA 4K43A 4M3ZA 2GEMA 3M8SA 3NMUA 4DQSA 4JD2A 3OS1A 2QWLA 2HBKA 1RDBA 5EU7A 4CEEA 3DLEA 4CJPA 3PSIA 1QSYA 1YJ9N 3KLGA 4BRAA 1A5XA 3FZLA 3KHYA 2QK9A 4PWDA 4C8LA 2F8TA 2KTQA 2DTUA 5GIPA 1JLBA 3LDQA 4FWPA 1N34K 3KLFA 3V4IA 4PY5A 4IWVA 3NFAA 2BANA 4E1JA 2OTJN 4GKKK 3I33A 1RNHA 3L3UA 5LJWA 1BQMA 4CESA 1GOBA 3AVJA 3LDLA 4KB1A 2HVHA 1NJIO 3J7YP 3QBXA 1VQON 4FJ8A 4FXDA 1IBKK 3PO4A 3AVBA 5BPNA 4B9UA 4DV7K 5AQZA 3AV9A 1LWCA 4BR9A 4WFAL 1KVAA 3LM9A 4KHSA 3SAGA 5HP1A 3KK2A 3SUQA 3ID6A 3TSUA 4XJXA 1DEJA 4BRDA 1HKCA 4QAGA 3WNEA 3C6UA 3D45A 3QFUA 3VETA 3ZX0A 3ZSQA 4BDYA 2A42A 4CEDA 5JENA 4PKGA 1W0HA 4CGHA 3AVNA 5TKWA 5MLCQ 1Q18A 1Y64A 3ZETA 4LF9K 4AM6A 1VRUA 2YHXA 3FZHA 4DSJA 1VSEA 1BO5O 1BOTO 4CJTA 3NHGA 4U67L 5JVGL 3BF3A 4ILJA 4LC9B 4G1QA 3VQDA 1X9WA 4KHWA 3IG1A 3KK3A 3CCUN 3ZX2A 3NH0A 4IO9L 1ZBIA 1CZ9A 4BRPA 3K58A 4CJ5A 4UY8O 5B8HA 4H5VA 2GUIA 2OANA 4JKHA 4GV9A 1LCUA 2P9UA 1NNEA 2YNFA 2FBVA 2VYPA 4ZTFA 2E5LK 4AM7A 2G8VA 1JCEA 4WQ4C 5T7BA 4BR2A 4ELVA 3L2UA 1CZBA 4NCBA 4ISEA 1JCGA 2QI2A 1SKRA 3PY8A 1C1CA 1E4GT 1M90O 4B9NA 4LFAK 1NWKA 2P9PB 3E1YA 3SLCA 4EHTA 3G4SN 4WFNL 3SUPA 4GV3A 1O13A 3THWB 4HTUA 4H5RA 3TAQA 4HWIA 5K14A 2W42A 4LFCK 1BU6O 3OW2M 1JLCA 3TAFA 3O4NA 4ISGA 4CJFA 4YNQA 1EXQA 1QTMA 1Q9YA 3CJ7A 1CXUA 1VQ8N 5AQJA 2GUPA 3L2RA 3DAWA 3NF6A 2Q2RA 4FZXC 3AAPA 1TK5A 3MXJA 3I55N 2RF2A 1LW2A 4Q5VA 2JWLA 4M3XA 3V6DA 2FBTA 5HBMA 1WSIA 2ZJPL 4DWIA 4CZFA 1GLJO 3L2QA 4OPHA 2NUBA 4F3TA 1ATNA 3SNNA 1XMQK 1VSKA 2E1ZA 3TAGA 5C24A 1HKBA 4LF7K 1WAFA 3DLHA 4KH6A 4HVJA 4CZEA 3LDPA 4FWRA 5KTQA 2D0OA 3RTVA 3OYKA 2QWOA 3O5BA 4FJIA 3ULDA 1QS4A 1TAUA 4HUEA 3OA9A 1IKXA 1K8KA 3VQCA 4IFVA 5HRSA 1M1KO 3EO3A 3KVGA 5FPNA 4DLGA 3EE9A 4B9LA 5AQWA 3K2PA 4CJUA 3JAMO 4C1NK 2QKKA 3V9WA 4V19S 2OPRA 2OPPA 3DLBA 1IKWA 1VAZA 1GOCA 4FJLA 2W6KA 1FW6A 1KRPA 3VQAA 4IOCL 1NGJA 2O8BB 2YHYA 4Y0WA 3DMJA 1OVYA 2OZMA 3WNHA 3KIOA 4PQUA 3VTIA 2VG7A 2RPIA 3QEWA 3PX4A 1JKHA 3A5NC 2O8CA 3QFPA 4BVOA 5KQDA 3WNGA 1VHXA 4JRPA 5AFUA 1S1VA 3CQYA 4IDKA 2IS3A 3LPUA 2ATQA 1KFSA 3GOIA 3V9ZA 3NVMA 4BRFA 5GIOA 4FO0A 2JGUA 4IOXA 2GBZA 2VWKA 2ITMA 3TAEA 4JI8K 3O9TA 4GY2B 5TKYA 2NRVA 1NK0A 3KK7A 3DOKA 3NF7A 4A2BA 1N33K 1RGIA 3IDHA 3J8AA 3W0LA 3MN9A 1VRTA 3VF2A 1E3MA 3LP0A 3MCAB 3OYIA 4BVPA 3E9PA 4K8XA 2QWRA 1VSFA 1NJXA 3LAMA 3R1XA 4R5PA 2YHAA 3TARA 2G8UA 3K0SA 1TYQB 4DHYA 1QSLA 1KVCA 3ZSVA 1SQKA 2HVIA 3HPGA 3OYFA 4CVNE 4WCEL 3AVAA 3WXLA 4CBXA 1KCFA 3HP9A 4MDAA 4B1YB 5HRPA 1NK4A 4YFUA 3HPOA 4DF4A 1KLNA 3CC7N 1I94K 2IAJA 4YORA 4AF1A 3QNOA 4J2AA 4DUYK 4B9MA 4KPYA 2FLOA 1IO2A 3MEDA 4LF5K 2GTDA 2WTUA 1J54A 1RILA 3BUZB 3OBWA 4KTZA 2HNZA 3M3ZA 2YV0X 2KHOA 4FK2A 2Y1IA 2P9UB 4CD3A 1V4SA 3T1HK 5IT9O 4BREA 4N47A 3RR8A 2F9WA 5AZJA 1NGIA 4BQZA 1ATSA 3VTHA 1K73O 3CC4N 3PO5A 2WBNA 4XH1A 1BIZA 5AQUA 4CERA 2F4VK 4X66K 4CJ4A 5JLFA 1U49A 3P38A 4DMNA 4LF4K 1NG9A 3O3FA 4RWTA 4CGIA 1X3NA 3SMSA 4BEBA 3O08A 2NNWA 3R8EA 1XUPO 1D4XA 1KAZA 4RTFD 2QWPA 4EZ9A 3VQBA 5AFUH 1QZ5A 4B1UB 3OYCA 1EWQA 2XRIA 4JKFA 2QTDA 3DLLL 3BP8A 2UUCK 1ZBSA 4DTOA 4IZ9A 4DSKA 3QIOA 2C1IA 3MMVA 4DR2K 3OJUA 1NOYA 2E2QA 5M1KA 3BZKA 4BE7B 1NMDA 2P9SA 3C6AA 3OVNA 3E01A 1WSJA 4AHVA 4CHOA 4OGEA 3VGKA 4E1MA 3MAQA 1NK8A 4O4GA 1VSDA 1Z26A 2ZD1A 1XQSC 3L8BA 1MDUB 3B8AX 2OPQA 4ID1A 5AR0A 4Z4HA 3DYAA 5DMRA 1VQ4N 3K5OA 3MECA 3VEXA 4CJLA 1S3XA 1S9EA 2OPSA 4E89A 3GL1A 1QQOA 2ZGYA 4F9OA 4RW7A 4H03B 3D2FA 5FLXO 5FPMA 3AY9A 2RHKA 1RBUA 1S9GA 5AQKA 1KAYA 4A61A 4BROA 1WSHA 4K42A 4JK7A 3VF6A 1U4BA 3S3NA 4RW4A 2QWMA 3DXMA 3WT0A 3KWIA 2BE2A 4DS5A 3MDQA 3OYJA 3EZ5A 3DRPA 1FK9A 1U2VB 2KFNA 2GWKA 4I6MB 5AQTA 3TSQA 4BDZA 4RCHA 3ATUA 4ILHA 1B9FA 3RSEA 1D5AA 3ALYA 2RE2A 2HW3A 4JKDA 1S22A 3JSMA 5ADXA 4WF9L 4CZMA 2P9LB 2RN2A 3LP3A 1TUUA 1YT3A 3C0BA 1EETA 2CH5A 4JHDA 4DLEA 1DGKN 1VQNN 2FXUA 3LM2A 3LWMA 2HBJA 4F8RA 3O3GA 1FKPA 2HHXA 4NO7A 2UU9K 1X3MA 4H0VB 3NBPA 3G10A 1VQ6N 3AGKA 4GV6A 4E3SA 3ULEA 5BRFA 1Q86O 3FZKA 5M1PA 4BG8A 5HOOA 3PV8A 1NM1A 4BGBA 3MN7A 4K41A 5GAHP 5AQMA 4FWLA 1RBRA 3N4PA 1YUWA 5KPRA 1NGBA 3LDOA 5ELZA 4A5BA 4DFPA 4OJRA 1FXXA 3CQXA 1S6QA 3HXMA 3HM8A 5AQXA 4LF8K 3A5MC 3CM5A 1OKJA 1T3VA 3NF9A
chains in the Genus database with same CATH topology
3QFUA 2P9IA 3VETA 3ZX0A 2A42A 4PKGA 3K9KA 4H5TA 4WYBA 5TKWA 1K8AO 1T6DA 5MLCQ 1Q18A 2NZTA 1Y64A 4FPAA 4IXCA 3ZETA 1QHAA 3HRGA 2E2NA 4AM6A 3L4QA 2YHXA 3I56N 3FZHA 3M5RA 4BG9A 3TTDA 1BO5O 1BOTO 1BG3A 1VQ9N 3CCVN 2BTFA 4U67L 5JVGL 4BC3A 3BF3A 3GE1A 4ILJA 4LC9B 1Q7YO 1K9MO 2W40A 2IVOA 3L6QA 3CCUN 3ZX2A 4ISFA 4IO9L 4BRPA 3E9OA 3ID8A 4QS9A 2YHWA 4UY8O 1ILYA 3CCLN 3C6HA 1GLCG 4MLEA 1VQMN 2V7YA 4FOIA 4H5VA 4IDHA 4MO4A 4O5FA 5GAEP 5B8HA 3CCSN 1IJJA 2OANA 3ENHA 3I8BA 2FF3B 1P90A 4HTLA 4JKHA 4GV9A 3HOTA 1LCUA 4L3QA 2P9UA 3Q7CA 2UYTA 2PBDA 4H0XB 4BR0A 2VYPA 4DCHA 1EQYA 5CR4A 3CPEA 4AM7A 2HOEA 2D0PA 2YCHA 1JCEA 4WQ4C 3EN9A 3FLCO 4BR2A 3D7EO 1E4FT 1YIJN 4B9QA 2Q36A 4ISEA 5FPEA 2HBMA 5C2DA 1JCGA 2QI2A 3CC2N 3VENA 1E4GT 1M90O 5AQPA 3BEXA 3VEWA 4G9ZA 3ENBA 1NWKA 2P9PB 3E1YA 4GVEA 3SLCA 4EHTA 3G4SN 2BH1A 3QBWA 4M63C 4WQ4A 4WFNL 3CCJN 4GV3A 4BRNA 4BR4A 2VGNA 3DXKB 4YOVA 1O13A 1YF5L 4CBWA 2ZJQL 1QVGM 4H5RA 2YJFA 4DQ8A 1VQ5N 4XH4A 2W00A 3QDKA 3A0IX 4HWIA 1G99A 2QEXN 1BU6O 4ILGB 3CIPA 3OW2M 4FVUA 3VMFB 3O4WA 2IIRA 2AP1A 2IVNA 4ISGA 4YOYA 2C1GA 5AZIB 2AA4A 4OPAA 5AQLA 3CJ7A 3VEOA 3EE8A 3LL3A 4YOUA 1VQ8N 5LJVA 3VF4A 5AQJA 5KQ8A 2GUPA 3OHRA 3ZETB 3DAWA 2P9SB 3CJ1A 4NLBA 1DKGD 2Q2RA 3J7ZO 3G6EN 3AAPA 4CBUA 3T69A 3ATVA 3I55N 4JD2B 3QICA 2JWLA 3IUCA 3CI5A 2ZJPL 4BR5A 4CZFA 1GLJO 1QQNA 4OPHA 1ATNA 4BC5A 4NB4A 5KPZA 1U2VA 2E1ZA 3H1VX 5FPDA 2I7NA 3CHWA 3ZYYX 1S72N 1BWFO 2NRTA 3F5TA 5EVZA 3VESA 3VGMA 5BPMA 1HKBA 5CHIA 4KH6A 4IO8A 4CZEA 3LDPA 4FWRA 3TTCA 2D0OA 4JAXA 5C12A 2QWOA 3O5BA 2QXLA 4J8FA 1LOTB 3DWLA 2A6AA 3OA9A 1YITN 1GLLO 1K8KA 1U6ZA 1M1KO 3RSEB 3EO3A 4BY9C 3KVGA 5FPNA 3EE9A 2E2PA 5AQWA 2ZJRL 4C1NK 3D6RA 5JVHL 2YI1A 4A59A 4I6MA 1W97L 3GBTA 3O80A 4BRMA 2D1KA 1W2BM 2J4RA 3W3DA 2A3ZA 3HBTA 3MX2A 4PHTX 3EKUA 5EY4A 4O8KA 3CJ9A 1VAZA 3UB5A 4BRIA 3HZ6A 3TTFA 1QQMA 1J6ZA 2GX9A 3HI0A 3JXUA 3ZX3A 2F9TA 4IJNA 2E8AA 4FPBA 4FOEA 4H5WA 2BUPA 4KH5A 4IOCL 2ASMA 5JMVA 1NGJA 1KC8O 2YHYA 3CXCM 1KQSM 4Y0WA 5AQFA 2YX6A 3EL2A 3U8XA 3VOVA 4B1ZA 1OVYA 4H0TB 2PFUA 1YVNA 2NLXA 3WXJA 1JJ2M 3O6WA 5DM6L 3VTIA 4H5NA 3H6EA 4H0YB 4O8UA 3MX5A 5M1QA 4PL8A 3QMLA 4YOXA 1Q82O 3VEZA 3VERA 3A5NC 5GAGP 2VCPA 2Q1NA 2ZGZA 3QFPA 5AZJB 4BVOA 5KQDA 5KPTA 1YHQN 1HX1A 3O9QA 1YJWN 5AFUA 3CQYA 4BQLA 1YI2N 1K73O 3K9JA 4JHDB 1RDUA 4JKBA 3GOIA 3U9DA 3WXKA 4CZIA 4EFHA 2NRWA 3HOSA 3NVMA 1BA0A 5BPLA 4BRFA 5GIOA 4FO0A 5M1OA 2P9KB 4IOXA 2ITMA 3CPWM 5F2RA 4C1NI 2NRXA 3O9TA 4GY2B 5TKYA 4BRQA 5C10A 3PIPL 3AARA 1NGAA 2NRVA 3FZFA 3KK7A 4DKWA 1NBWA 2KKZA 3WEEB 1ZXOA 4A2BA 5EX5A 1EO1A 1RGIA 2ASPA 4FL9A 2A5XA 4FWMA 1Z6RA 4A57A 3IDHA 3CJCA 3J8AA 1KAXA 5EOYA 3W0LA 4CZHA 3M1FA 1VQLN 3HTVA 3IKMA 3MN9A 4MLHA 3VF2A 5C0YA 3OBYA 5BRDA 3SAFA 1QZ6A 3CERA 2HBLA 3TU5A 3MCAB 1HPMA 4BVPA 3DJCA 3E9PA 5C2FA 3SAHA 4MO5A 2QWRA 3VEYA 3WEEA 5AQHA 3R1XA 4Z94A 5JICA 2Q97A 2I7PA 1TYQB 3SJHA 3ENOA 4BC4A 4BRHA 2E1YA 4DHYA 3D2FB 2CGLA 2CGKA 4WQ5A 1SQKA 3MN5A 1GLDG 1NGGA 4CZLA 3C65A 3O8MA 3FFKB 3D2EB 3ULEB 1XC3A 4WCEL 3WXLA 4CBXA 3GG4A 4IFEA 4MDAA 4B1YB 3E9LA 1NGEA 3GDQA 2P9PA 5AQSA 4CJ7A 3CC7N 3ZEUA 3T7ZA 4C23A 2OTLN 3C7NB 4U7BA 4YORA 4JN4A 4B1WB 4AF1A 2ZWHA 1ATRA 1WOQA 4R79A 5EXWA 2FLOA 3L0QA 2GTDA 4YDUA 3O1BA 3BUZB 3OBWA 4WFBL 1X9JA 3O9UA 4JK9A 3FR0A 3M3ZA 3U4LA 4YOWA 2KHOA 2EWSA 1NGFA 2P9UB 3WXIA 2FSJA 2KLAA 2YJEA 4A62A 4BRKA 4CD3A 5HL7L 1V4SA 1SS6A 5M1FA 2QWQA 3CJBA 4BREA 4FWNA 4YDUC 3EKSA 3KWGA 4XEIA 5AQOA 3L4IA 3SK3A 2F9WA 3TPQA 4MDBA 5AZJA 1NGIA 4BQZA 1ATSA 3IMXA 4JEPA 1IG8A 4IEIA 4JKEA 4BRGA 3VTHA 3F2KA 3QB0A 2V7ZA 2VGMA 1GLBG 5AQNA 3SMPA 3CC4N 2WBNA 3O9SA 4IJAA 2V51B 4XH1A 5AQUA 4PL7A 4BRLA 5JLFA 1YAGA 2GELA 3CMAN 3P38A 1HJOA 2WUSA 3R6MA 4QS7A 4RWTA 2QA4N 1V4TA 1X3NA 4JNEA 3CCMN 3SMSA 3A8YA 3MN6A 1TYQA 2WC9A 2FF6A 4BEBA 2HF3A 5E84A 2E20A 3O08A 3UKUB 1WUAA 3PIOL 3LDNA 5C15A 1C0FA 2NNWA 3P31A 2P9KA 3N4QA 3AAQA 2HF4A 4FWQA 3R8EA 1XUPO 2ZF5O 3G25A 1D4XA 3KZBA 2FSNA 1KAZA 3O9RA 4M7YA 1TUYA 2P9IB 4RTFD 5JLHA 2QWPA 3CETA 3BF1A 5AQYA 3VEVA 4PKIA 1JCFA 1QZ5A 3DXKA 5AFUH 4B1UB 1YJNN 4JKFA 3M6GA 2QTDA 4BGAA 3DLLL 3BP8A 3H3OB 4A5AA 3R9PA 3O1WA 1ZBSA 3P39A 4IZ9A 4B1XB 4YOTA 4EIAA 4CI6A 1SZ2A 2C1IA 5GADP 1MA9B 4H0OA 2Q0UA 1BA1A 3MMVA 5BR9A 2P9LA 4FWOA 3DXMB 2ASOA 2CH6A 2E2QA 4FWSA 3D2EA 5M1KA 2A41A 2NRRA 4BE7B 1NMDA 3F9MA 2P9SA 4WQ5C 3C6AA 4KBOA 5M1NA 1RFQA 1SAZA 1DT9A 4OO1J 5GINA 5E26A 3CD6N 2E88A 3H1QA 1NGDA 3VGKA 2VWBA 3H45C 4GNIA 5ADXH 2FSKA 1XQSC 3ZEUB 1T44A 3B8AX 2IVPA 1MDUB 1P8ZA 1Z05A 5AR0A 4BC2A 1ZC6A 2Q31A 4CZJA 1VQPN 1KXPA 3CMEN 3WQUA 1VQ4N 2Q0RA 3A5LC 3VEXA 3FGUA 1S3XA 4JKCA 3CCEN 3S41A 3MWPA 4JKAA 2PAVA 3SBTA 2CGJA 3GL1A 3JS6A 1QQOA 3UE5A 5CE3A 4FWKA 2V52B 2ZGYA 4F9OA 5BRHA 1N8RO 3VGLA 4H03B 3D2FA 2W41A 5BREA 3UKUA 1R59O 4BR7A 3PLAA 5FPMA 3AY9A 4IEEA 4XH5A 1HKGA 2RHKA 5AQKA 4BRCA 1KAYA 4A61A 4BROA 1HLUA 3FZMA 1K8KB 3AGRA 4H0PA 4JK7A 4K42A 3VF6A 3CCQN 1QVFM 4BECA 4M7XA 3R3LA 3G71N 4KH4A 2QM1A 1BUPA 3WQTA 3WUHA 1YXQA 2QWMA 4PKHA 3Q7BA 5AQIA 3DXMA 3MCPA 3WT0A 3A5OC 3KWIA 1NGCA 4QS8A 5LY3A 2H3GX 3CCRN 3SBGA 5AQGA 5I9EB 3MDQA 4IOAL 1T6CA 1MWKA 1C0GA 1CZAN 1U2VB 5H1SQ 2E2OA 1Q81O 2P9NA 2GWKA 2HMPA 3E66A 2D4WA 4I6MB 4K43A 5AQTA 2QWNA 2WFBA 3TSQA 4JK8A 2GEMA 4RCHA 3ATUA 4ILHA 3NMUA 3RSEA 3TSPA 4EAHD 4JD2A 1VQKN 4FSVA 5AQVA 4CZGA 2QWLA 2HBKA 2RE2A 4JKDA 1S22A 5ADXA 3U9ZA 4CD1A 5F0XA 4CZMA 4WF9L 1YJ9N 4BRAA 2P9LB 3H46O 1TUUA 3C0BA 3FZLA 3IFRA 2CH5A 2QW9A 3P4IA 4JHDA 5DM7L 1ESVA 1DGKN 3KHYA 3WXMB 1VQNN 1NLVA 1BDGA 2FXUA 3LM2A 2HBJA 4NLCA 3C7NA 4NO7A 1X3MA 5GIPA 2NRHA 4H0VB 1H1VA 3EZWA 3LDQA 1RDWX 1VQ6N 4FWPA 1HUXA 3AGKA 1GLFO 2HSTA 4GV6A 4IWVA 3H3NO 1GLEG 3MK6A 4E1JA 3ULEA 5BRFA 3RVCA 2OTJN 1Q86O 3I33A 2P9NB 3FZKA 5M1PA 5LJWA 5BN9A 4BG8A 5HOOA 3CF5L 4B1VA 4A2AA 3LDLA 3UKRA 4CZKA 4DB3A 5BN8A 1NJIO 1NM1A 4JKGA 2NRZA 4BGBA 3MN7A 5AZIA 4K41A 3QBXA 1VQON 2A40A 3CJAA 3FE1A 1MWMA 5AQMA 2DPNA 5GAHP 1GLAG 4FWLA 3N4PA 5F1XA 5BPNA 1YUWA 5KPRA 1NGBA 4K25A 3LDOA 1VQ7N 4EHUA 5AQZA 5ELZA 4A5BA 4JKGB 4BR9A 4WFAL 5AQQA 2JWKA 3UKRB 3LM9A 2GWJA 3SAGA 3CQXA 3NVKA 1NGHA 3ID6A 3TSUA 4XJXA 3VPZA 1DEJA 3HSCA 3HM8A 5AQRA 5AQXA 2F7TA 3A5MC 4BRDA 1HKCA 1OKJA 3MWTA 1T3VA 1KD1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFU A;  2P9I A;  3VET A;  3ZX0 A;  2A42 A;  4PKG A;  4H5T A;  4WYB A;  1T6D A;  1Q18 A;  2NZT A;  1Y64 A;  4FPA A;  4IXC A;  3ZET A;  1QHA A;  2E2N A;  4AM6 A;  2YHX A;  3FZH A;  4BG9 A;  1BO5 O;  1BOT O;  1BG3 A;  2BTF A;  4BC3 A;  3BF3 A;  3GE1 A;  4LC9 B;  2W40 A;  2IVO A;  3L6Q A;  3ZX2 A;  4ISF A;  4BRP A;  3ID8 A;  4QS9 A;  2YHW A;  1GLC G;  4MLE A;  2V7Y A;  4FOI A;  4H5V A;  4MO4 A;  5B8H A;  4O5F A;  1IJJ A;  2OAN A;  3ENH A;  3I8B A;  2FF3 B;  4HTL A;  1LCU A;  4L3Q A;  2P9U A;  2UYT A;  2PBD A;  4H0X B;  4BR0 A;  2VYP A;  4DCH A;  1EQY A;  4AM7 A;  2HOE A;  2D0P A;  2YCH A;  1JCE A;  4WQ4 C;  3EN9 A;  3FLC O;  4BR2 A;  3D7E O;  1E4F T;  4B9Q A;  2Q36 A;  4ISE A;  5FPE A;  1JCG A;  3VEN A;  1E4G T;  5AQP A;  3BEX A;  3VEW A;  1NWK A;  2P9P B;  3SLC A;  4EHT A;  3QBW A;  4M63 C;  4WQ4 A;  4BRN A;  4BR4 A;  3DXK B;  4CBW A;  4H5R A;  2YJF A;  4DQ8 A;  4XH4 A;  3QDK A;  3A0I X;  4HWI A;  1G99 A;  1BU6 O;  3CIP A;  3O4W A;  2IIR A;  2AP1 A;  2IVN A;  4ISG A;  5AZI B;  2AA4 A;  5AQL A;  3CJ7 A;  3VEO A;  3LL3 A;  5LJV A;  3VF4 A;  5AQJ A;  5KQ8 A;  2GUP A;  3OHR A;  3ZET B;  3DAW A;  2P9S B;  3CJ1 A;  1DKG D;  2Q2R A;  3AAP A;  4CBU A;  3ATV A;  4JD2 B;  3QIC A;  3IUC A;  3CI5 A;  4BR5 A;  4CZF A;  1GLJ O;  1QQN A;  1ATN A;  4BC5 A;  4NB4 A;  5KPZ A;  1U2V A;  3H1V X;  2E1Z A;  5FPD A;  2I7N A;  3CHW A;  1BWF O;  5EVZ A;  3VES A;  3VGM A;  5BPM A;  1HKB A;  4IO8 A;  4CZE A;  3LDP A;  4FWR A;  2D0O A;  4JAX A;  2QWO A;  3O5B A;  2QXL A;  4J8F A;  1LOT B;  3DWL A;  2A6A A;  1GLL O;  1K8K A;  1U6Z A;  3RSE B;  3EO3 A;  3KVG A;  5FPN A;  2E2P A;  5AQW A;  2YI1 A;  4I6M A;  3GBT A;  3O80 A;  4BRM A;  2D1K A;  2J4R A;  3W3D A;  2A3Z A;  3HBT A;  3EKU A;  5EY4 A;  4O8K A;  3CJ9 A;  3UB5 A;  4BRI A;  3HZ6 A;  1QQM A;  1J6Z A;  3HI0 A;  3JXU A;  3ZX3 A;  2F9T A;  4IJN A;  2E8A A;  4FPB A;  4FOE A;  4H5W A;  2BUP A;  2ASM A;  5JMV A;  1NGJ A;  2YHY A;  4Y0W A;  5AQF A;  3EL2 A;  3U8X A;  3VOV A;  4B1Z A;  4H0T B;  1YVN A;  2NLX A;  3WXJ A;  3O6W A;  4H5N A;  3H6E A;  4H0Y B;  4PL8 A;  3QML A;  3VEZ A;  3VER A;  3A5N C;  2VCP A;  2Q1N A;  2ZGZ A;  3QFP A;  5AZJ B;  4BVO A;  5KQD A;  5KPT A;  1HX1 A;  5AFU A;  3CQY A;  4BQL A;  4JHD B;  3GOI A;  3U9D A;  3WXK A;  4CZI A;  4EFH A;  1BA0 A;  5BPL A;  4BRF A;  4FO0 A;  2P9K B;  2ITM A;  5F2R A;  4GY2 B;  5TKY A;  4BRQ A;  3AAR A;  1NGA A;  3FZF A;  1NBW A;  3WEE B;  4A2B A;  1ZXO A;  5EX5 A;  1RGI A;  2ASP A;  4FL9 A;  2A5X A;  4FWM A;  1Z6R A;  3IDH A;  3CJC A;  3J8A A;  1KAX A;  5EOY A;  3W0L A;  4CZH A;  3M1F A;  3HTV A;  3MN9 A;  4MLH A;  3VF2 A;  5BRD A;  1QZ6 A;  3CER A;  3TU5 A;  1HPM A;  4BVP A;  3DJC A;  4MO5 A;  2QWR A;  3VEY A;  3WEE A;  5AQH A;  4Z94 A;  5JIC A;  2Q97 A;  2I7P A;  1TYQ B;  3SJH A;  3ENO A;  4BC4 A;  4BRH A;  2E1Y A;  4DHY A;  3D2F B;  2CGL A;  2CGK A;  4WQ5 A;  1SQK A;  3MN5 A;  1GLD G;  1NGG A;  4CZL A;  3O8M A;  3FFK B;  3D2E B;  3ULE B;  1XC3 A;  3WXL A;  4CBX A;  3GG4 A;  4B1Y B;  1NGE A;  3GDQ A;  2P9P A;  5AQS A;  4CJ7 A;  3ZEU A;  4C23 A;  3C7N B;  4JN4 A;  4B1W B;  2ZWH A;  1ATR A;  1WOQ A;  5EXW A;  2FLO A;  3L0Q A;  2GTD A;  4YDU A;  3O1B A;  3BUZ B;  1X9J A;  3FR0 A;  3M3Z A;  3U4L A;  2KHO A;  2EWS A;  1NGF A;  2P9U B;  3WXI A;  2FSJ A;  2YJE A;  4A62 A;  4BRK A;  4CD3 A;  1V4S A;  2QWQ A;  3CJB A;  4BRE A;  4FWN A;  4YDU C;  3EKS A;  4XEI A;  5AQO A;  3L4I A;  3SK3 A;  2F9W A;  3TPQ A;  5AZJ A;  1NGI A;  4BQZ A;  1ATS A;  3IMX A;  1IG8 A;  4BRG A;  3QB0 A;  2V7Z A;  5AQN A;  1GLB G;  3SMP A;  4IJA A;  4XH1 A;  2V51 B;  5AQU A;  4PL7 A;  4BRL A;  5JLF A;  1YAG A;  2GEL A;  1HJO A;  2WUS A;  3R6M A;  4QS7 A;  4RWT A;  1V4T A;  1X3N A;  4JNE A;  3SMS A;  3A8Y A;  3MN6 A;  1TYQ A;  2FF6 A;  2HF3 A;  5E84 A;  2E20 A;  3O08 A;  3UKU B;  1WUA A;  3LDN A;  1C0F A;  2P9K A;  3AAQ A;  2HF4 A;  4FWQ A;  3R8E A;  1XUP O;  2ZF5 O;  3KZB A;  1D4X A;  3G25 A;  2FSN A;  1KAZ A;  4M7Y A;  1TUY A;  2P9I B;  4RTF D;  5JLH A;  2QWP A;  3CET A;  3BF1 A;  5AQY A;  3VEV A;  4PKI A;  1JCF A;  1QZ5 A;  3DXK A;  5AFU H;  4B1U B;  3M6G A;  4BGA A;  3BP8 A;  3H3O B;  3R9P A;  3O1W A;  1ZBS A;  4IZ9 A;  4B1X B;  4EIA A;  4CI6 A;  1SZ2 A;  1MA9 B;  4H0O A;  2Q0U A;  1BA1 A;  3MMV A;  5BR9 A;  2P9L A;  4FWO A;  3DXM B;  2ASO A;  2CH6 A;  2E2Q A;  4FWS A;  3D2E A;  2A41 A;  1NMD A;  3F9M A;  2P9S A;  4WQ5 C;  4KBO A;  1RFQ A;  1SAZ A;  5E26 A;  2E88 A;  3H1Q A;  1NGD A;  3VGK A;  2VWB A;  3H45 C;  4GNI A;  5ADX H;  2FSK A;  1XQS C;  3ZEU B;  1T44 A;  3B8A X;  1MDU B;  1P8Z A;  1Z05 A;  2IVP A;  5AR0 A;  4BC2 A;  1ZC6 A;  2Q31 A;  4CZJ A;  1KXP A;  3WQU A;  2Q0R A;  3A5L C;  3VEX A;  3FGU A;  1S3X A;  3S41 A;  2PAV A;  2CGJ A;  3GL1 A;  3JS6 A;  1QQO A;  3UE5 A;  5CE3 A;  4FWK A;  2V52 B;  2ZGY A;  4F9O A;  5BRH A;  3VGL A;  4H03 B;  3D2F A;  2W41 A;  5BRE A;  3UKU A;  1R59 O;  4BR7 A;  5FPM A;  3AY9 A;  4XH5 A;  4BRC A;  1HKG A;  5AQK A;  1KAY A;  4A61 A;  4BRO A;  1HLU A;  3FZM A;  1K8K B;  4H0P A;  4K42 A;  3VF6 A;  4M7X A;  2QM1 A;  1BUP A;  3WQT A;  3WUH A;  1YXQ A;  2QWM A;  4PKH A;  5AQI A;  3DXM A;  3MCP A;  3WT0 A;  3A5O C;  5LY3 A;  1NGC A;  4QS8 A;  2H3G X;  5AQG A;  5I9E B;  3MDQ A;  1T6C A;  1MWK A;  1C0G A;  1CZA N;  1U2V B;  2E2O A;  2P9N A;  2GWK A;  2HMP A;  4I6M B;  2D4W A;  4K43 A;  5AQT A;  2QWN A;  2GEM A;  4RCH A;  3ATU A;  3RSE A;  4EAH D;  4JD2 A;  4FSV A;  5AQV A;  4CZG A;  2QWL A;  1S22 A;  5ADX A;  3U9Z A;  4CD1 A;  5F0X A;  4CZM A;  4BRA A;  2P9L B;  3H46 O;  1TUU A;  3C0B A;  3FZL A;  3IFR A;  2CH5 A;  2QW9 A;  3P4I A;  4JHD A;  3KHY A;  1ESV A;  1DGK N;  1NLV A;  1BDG A;  2FXU A;  3LM2 A;  3C7N A;  4NO7 A;  1X3M A;  2NRH A;  4H0V B;  1H1V A;  3EZW A;  3LDQ A;  1RDW X;  4FWP A;  1HUX A;  1GLF O;  4IWV A;  3H3N O;  1GLE G;  3MK6 A;  4E1J A;  3ULE A;  5BRF A;  3I33 A;  2P9N B;  3FZK A;  5LJW A;  5BN9 A;  4BG8 A;  4B1V A;  4A2A A;  3LDL A;  3UKR A;  4CZK A;  4DB3 A;  5BN8 A;  1NM1 A;  4BGB A;  3MN7 A;  5AZI A;  4K41 A;  3QBX A;  2A40 A;  3FE1 A;  3CJA A;  1MWM A;  5AQM A;  2DPN A;  1GLA G;  4FWL A;  5F1X A;  5BPN A;  1YUW A;  5KPR A;  1NGB A;  4K25 A;  3LDO A;  4EHU A;  5AQZ A;  5ELZ A;  4BR9 A;  5AQQ A;  3UKR B;  3LM9 A;  2GWJ A;  3CQX A;  1NGH A;  3VPZ A;  1DEJ A;  3HSC A;  3HM8 A;  5AQR A;  5AQX A;  3A5M C;  4BRD A;  1HKC A;  1OKJ A; 
#chains in the Genus database with same CATH topology
 4FK4 A;  4CCH A;  4DSL A;  2UXD K;  3K9K A;  2BGG A;  3A2F A;  1WSE A;  1T05 A;  5SZT A;  1WSF A;  3L4Q A;  2P5G A;  1BG3 A;  3TI0 A;  1BI4 B;  3MEE A;  4C8N A;  3CCV N;  1VQ9 N;  3LP2 A;  4CF2 A;  2RKI A;  1Q7Y O;  1K9M O;  2W40 A;  3LPT A;  3M8Q A;  3L6Q A;  4E7K A;  1RT7 A;  3TWH A;  4FVM A;  2HHT A;  3CCL N;  4BDP A;  1VQM N;  4MO4 A;  3CCS N;  4E7J A;  4FM0 A;  2FBY A;  1EKE A;  2PZS A;  2UYT A;  2PBD A;  2VQF K;  1EQY A;  5CR4 A;  1VSL A;  4DR3 K;  3HST B;  1HYZ A;  3D7E O;  4DSE A;  1E4F T;  3SUN A;  2IDO A;  2HBM A;  4N5S A;  3NE6 A;  1QE1 A;  1WNS A;  3TAM A;  3VEN A;  2HHI A;  5AQP A;  4FLT A;  4GVE A;  2BH1 A;  3QBW A;  4WQ4 A;  4BRN A;  4BR4 A;  1YF5 L;  4CHN A;  1SKS A;  2W00 A;  3OYL A;  3A0I X;  2XO7 A;  2X6N A;  3SYZ A;  4CK1 A;  2AP1 A;  4YOY A;  4EP5 A;  5AZI B;  4OPK A;  2AA4 A;  5AQL A;  3VEO A;  1IV0 A;  5E41 A;  1VSJ A;  5LJV A;  3ZET B;  1N5Y A;  4OKE A;  3CJ1 A;  3J7Z O;  2O8D A;  1N32 K;  4LSL A;  4CBU A;  3T69 A;  4JD2 B;  1SL0 A;  1NOZ A;  1Z25 A;  4BC5 A;  4NB4 A;  1U2V A;  3VGM A;  4CK3 A;  4FJ9 A;  3F73 A;  3SQ1 A;  4JAX A;  5HRN A;  2EX3 A;  2QXL A;  4FZZ A;  2A6A A;  1BCO A;  1GLL O;  4Y1C A;  5IWA K;  4C8M A;  4BY9 C;  2E2P A;  4AHU A;  2ZM6 K;  3D6R A;  3QEX A;  4O44 A;  5I42 A;  1OH7 A;  3TAP A;  1OH5 A;  2D0C A;  3GBT A;  4BRM A;  3W3D A;  1Y97 A;  4PHT X;  3EKU A;  4B08 A;  4O8K A;  3CJ9 A;  3T3F A;  2YHB A;  2O8F B;  4IJN A;  1LAW A;  4HUF A;  4JI5 K;  2DFF A;  2X6S A;  2W6L A;  4FOE A;  4H5W A;  4DTN A;  2BUP A;  2F8S A;  2ASM A;  1N36 K;  1KC8 O;  3DLR A;  1KVB A;  1O1W A;  3EL2 A;  3HO1 A;  4DFJ A;  4JI0 K;  4H0T B;  1YVN A;  3WXJ A;  4DFM A;  1WAJ A;  4H5N A;  3H6E A;  4O8U A;  4RW6 A;  4PL8 A;  3QML A;  1Q82 O;  1UWB A;  4M42 A;  5CZ1 A;  3DOL A;  5KRT A;  5KPT A;  4M3U A;  4O55 A;  3O9Q A;  1YI2 N;  2QXF A;  1B9D A;  1XHX A;  4JKB A;  3U9D A;  4CGF A;  4LY7 A;  2NRW A;  4FJX A;  5BPL A;  2P9K B;  3RMA A;  4IFY A;  1X9M A;  2NRX A;  1LAV A;  4TSX A;  3PIP L;  3AAR A;  3SCX A;  2KFZ A;  2KKZ A;  2KW4 A;  5EX5 A;  3U6F A;  4FJH A;  4B3O A;  3U3Y A;  4NXM K;  1Z6R A;  4A57 A;  1SUQ A;  4I2P A;  4E7I A;  3RMD A;  1VQL N;  3HTV A;  3IKM A;  4E0D A;  3AVC A;  1HNW K;  3OBY A;  1TGO A;  3ZSY A;  3K5N A;  4DV4 K;  1WN7 A;  2YKN A;  1HPM A;  4E72 A;  4OGC A;  3DJC A;  5C2F A;  4MO5 A;  3IRX A;  4H4M A;  4CIF A;  4B8C A;  2HHV A;  2G8I A;  4BRH A;  4CJ3 A;  2CGL A;  1GLD G;  1NGG A;  2X78 A;  3C65 A;  3O8M A;  3FFK B;  2IGI A;  1C0U A;  1QHT A;  4OVL A;  1WSG A;  3C95 A;  3OYE A;  1NGE A;  2Y1J A;  5AQS A;  4CJ7 A;  3ZEU A;  2OTL N;  4U7B A;  4JN4 A;  4B1W B;  4J2E A;  3P1G A;  2ZWH A;  4F4K A;  1WOQ A;  4R79 A;  2VG5 A;  5CYQ A;  3O1B A;  3O9U A;  4JK9 A;  5C25 A;  5J2P A;  4N41 A;  3U4L A;  2EWS A;  3AVH A;  2FSJ A;  4A62 A;  4BRK A;  3OYA A;  5M1F A;  3CJB A;  4YDU C;  1TV6 A;  1D8Y A;  4XEI A;  3L4I A;  3AVK A;  1TVR A;  4X64 K;  3OS0 A;  4FJ7 A;  4JEP A;  4IEI A;  3ZSO A;  2V7Z A;  1GLB G;  1D9D A;  3SMP A;  2YNG A;  4CEF A;  4PL7 A;  4BRL A;  3K59 A;  1YAG A;  3CMA N;  4FZY A;  4JI2 K;  4B9V A;  4BWJ A;  3MN6 A;  2WC9 A;  3ZSW A;  5E84 A;  4GMJ B;  1WUA A;  3PIO L;  3LDN A;  2O8F A;  2UUB K;  4FWQ A;  3O9R A;  3ZLJ A;  4AH9 A;  3BF1 A;  5J1E A;  1YJN N;  3M6G A;  3PUF A;  3AVI A;  3T19 A;  3R9P A;  1SL2 A;  3HPH A;  3OYD A;  4YOT A;  4CI6 A;  4O5B A;  5GAD P;  1MA9 B;  2Q0U A;  1TK8 A;  4E7L A;  1NK5 A;  3AA5 X;  2P9L A;  4FWO A;  3SUO A;  3DI6 A;  1HQE A;  2A41 A;  1C0T A;  3HL8 A;  4DSI A;  4KBO A;  3LWL A;  3ZT2 A;  5M1N A;  1SAZ A;  5GIN A;  4AQY K;  4DTJ A;  1NKC A;  3CD6 N;  1B92 A;  3H1Q A;  4E19 A;  3ZSR A;  1NGD A;  3P83 D;  2VWB A;  5ADX H;  4NCG A;  1JLA A;  3ZEU B;  1T44 A;  2IVP A;  1Z05 A;  3QEP A;  4DR1 K;  3HM9 A;  4BC2 A;  2Q31 A;  2R7Y A;  4FJJ A;  1KXP A;  1CLQ A;  3DLG A;  4KV8 A;  3A5L C;  4N76 A;  3NGZ A;  4JKC A;  3CCE N;  4CJR A;  1RTI A;  3MWP A;  4JKA A;  3JS6 A;  4DS4 A;  2F96 A;  4FWK A;  3LDS A;  4DV3 K;  3CG7 A;  1EP4 A;  1N8R O;  2UXC K;  5BRE A;  3UKU A;  4BR7 A;  3F9K A;  2HMI A;  3TR8 A;  1RT3 A;  4XH5 A;  4IEE A;  1JXE A;  4BE0 A;  2Z1J A;  3DM2 A;  5CY4 A;  1HLU A;  4FYD A;  1K8K B;  3BGR A;  3SZ2 A;  1QVF M;  4H0P A;  1SKW A;  3AVG A;  2QM1 A;  3WQT A;  3WUH A;  3MCP A;  1C1A A;  5I9E B;  1ZBF A;  4JS4 A;  1GOA A;  1C0G A;  2IC3 A;  2X74 A;  3L3V A;  2QWN A;  1BIS A;  2OCE A;  4M3R A;  2VWJ A;  4FSV A;  5AQV A;  4CZG A;  3U9Z A;  5J2Q A;  4J2B A;  5F0X A;  2G8W A;  3IFR A;  5DM7 L;  1ESV A;  3WXM B;  1NLV A;  1TL1 A;  4DF8 A;  1UAX A;  3C7N A;  4NLC A;  1RDD A;  2E6M A;  4MQ3 A;  2Z1G A;  3VQ6 A;  3IAY A;  1WB9 A;  4CEQ A;  1GLF O;  4FK0 A;  4CJK A;  1GLE G;  4YHH K;  1HR0 K;  2GV9 A;  3AA3 A;  3EY1 A;  1C1B A;  2ETJ A;  1BCM A;  4CJW A;  4KHY A;  4A2A A;  1IH7 A;  4ZHR A;  4CZK A;  4DV2 K;  2B4J A;  3QIP A;  5BN8 A;  2XY5 A;  1N6Q A;  4JKG A;  2NRZ A;  5AZI A;  4BE1 A;  1SV5 A;  2A40 A;  1MWM A;  5F1X A;  3ZT0 A;  3OYN A;  3CM6 A;  4K25 A;  4CJQ A;  1WBB A;  1VQ7 N;  4FLY A;  4JKG B;  4O0J A;  3UKR B;  1IBM K;  1X9S A;  4FW1 A;  1TL3 A;  4CJE A;  3NVK A;  1NGH A;  4FJ5 A;  4DU3 A;  5AQR A;  3ZT3 A;  2HHW A;  4F2S A;  3VA3 A;  1RDC A;  4Q0B A;  2P9I A;  1JLE A;  1J53 A;  4WYB A;  3HVT A;  5KI6 A;  1T6D A;  2NZT A;  3D0P A;  1RTD A;  4FPA A;  1QHA A;  3HRG A;  2E2N A;  3I56 N;  2FC0 A;  3M5R A;  5AJ3 K;  4BG9 A;  4JRQ A;  3AVL A;  4RW8 A;  3TTD A;  3O3H A;  2E4L A;  4Z4G A;  4BC3 A;  3GE1 A;  2IVO A;  3QLH A;  1ZYQ A;  4ISF A;  3RMB A;  4ID5 A;  4QS9 A;  2YHW A;  1S1W A;  2XY8 A;  4MLE A;  4FOI A;  3KD5 E;  1IBL K;  1RT4 A;  4YY3 K;  1IJJ A;  2HHS A;  3V1Q A;  4CF1 A;  4OX9 K;  3HYF A;  1T7P A;  4L3Q A;  4WE1 A;  3Q7C A;  4H0X B;  4CHP A;  4EZ6 A;  4CFB A;  4CGJ A;  2HOE A;  2D0P A;  2YCH A;  1HYS A;  3VQ5 A;  3FLC O;  4JI7 K;  4B9Q A;  1NJZ A;  2P51 A;  5C2D A;  3RRG A;  1VSI A;  2ZE2 A;  3CC2 N;  3BEX A;  1YVU A;  4G9Z A;  4W5R A;  4B3S K;  4M63 C;  3CCJ N;  2VGN A;  3DXK B;  2ZJQ L;  5FRO A;  1QVG M;  4XH4 A;  3QDK A;  5A2Q O;  2EHG A;  4OKJ A;  2Q3S A;  4FVU A;  1LW0 A;  3VMF B;  3T1Y K;  4DQP A;  3CYG A;  2FBX A;  4OPA A;  4CIG A;  3EE8 A;  3LL3 A;  4YOU A;  3VF4 A;  3OHR A;  4HCB A;  4JS5 A;  5FDL A;  1ASW A;  4Z4E A;  4OLA A;  3ATV A;  2UXB K;  3QEV A;  3QIC A;  4KI6 A;  4CHY A;  1L5U A;  3IUC A;  1QQN A;  3OJS A;  3L2V A;  1OVQ A;  4E1N A;  4CK2 A;  1REV A;  5KPZ A;  3WNF A;  1S72 N;  5FPD A;  3OY9 A;  3CHW A;  4HUG A;  3HK2 A;  2NRT A;  3F5T A;  3VES A;  5BPM A;  1Q9X A;  1ZBH A;  4IO8 A;  1JLQ A;  3TTC A;  4OPJ A;  3QES A;  5C12 A;  4KHP K;  2G8F A;  4H8K A;  1HYV A;  1LOT B;  3RMC A;  3NCI A;  3J7A P;  3G0Z A;  4KHU A;  1NMN A;  2HB5 A;  4NXN K;  2ZJR L;  4CGD A;  2YI1 A;  4DQR A;  1XC9 A;  3PSF A;  1W97 L;  4F2R A;  1HNX K;  4DTP A;  3L2W A;  2J4R A;  5J2M A;  3MX2 A;  4I9Q A;  3DRS A;  4M3T A;  3UB5 A;  3TTF A;  1QQM A;  2GX9 A;  3ZX3 A;  4O0I A;  2WON A;  4IG3 A;  3KK1 A;  3BY5 A;  5JMV A;  3CXC M;  3LAN A;  4CF8 A;  4LH5 A;  3JYT A;  1KQS M;  5AQF A;  2XHB A;  4FLW A;  3U8X A;  4M3W A;  4JYA K;  4FJN A;  2PFU A;  3BDP A;  4X65 K;  1JJ2 M;  3O6W A;  5DM6 L;  4Z4C A;  4FLX A;  1J5O A;  3MX5 A;  1IKV A;  4YOX A;  3QET A;  2G8H A;  3VER A;  1DTQ A;  2Q1N A;  5AZJ B;  2DFH A;  3K9J A;  4JHD B;  3I8D A;  4LH4 A;  2VG6 A;  3WXK A;  4CZI A;  4RW9 A;  1BA0 A;  3I0S A;  4FM2 A;  1RT5 A;  4KKO A;  5M1O A;  3NH2 A;  3MEG A;  4C1N I;  5DK5 A;  1FJG K;  1TKX A;  3FZF A;  1NBW A;  3WEE B;  1L3S A;  1EO1 A;  2ASP A;  4FL9 A;  2A5X A;  2A1S A;  1KAX A;  1XMO K;  4CZH A;  3M1F A;  3CQ8 A;  4MLH A;  3AA4 A;  4JI3 K;  5BRD A;  1C0M A;  2IOC A;  2HBL A;  3TU5 A;  3SAH A;  1IKY A;  2D0A A;  3VEY A;  3WEE A;  5AQH A;  1BHL A;  3SJH A;  5C42 A;  3D2F B;  4WQ5 A;  3MN5 A;  1KSP A;  2WOM A;  2I5J A;  5I3U A;  3S3O A;  4DR6 K;  1LWF A;  1XC3 A;  4L8R B;  1F21 A;  4KAZ A;  1U47 A;  3GG4 A;  4DTX A;  2UUA K;  4M3Y A;  1W9H A;  5LL6 Z;  4JLH A;  3T7Z A;  4C23 A;  3C7N B;  1KTQ A;  4KHQ A;  1RCH A;  1A5W A;  4KTQ A;  3THY B;  4DV0 K;  3J81 O;  3VQ8 A;  5EXW A;  3OTO K;  4ELT A;  4GW6 A;  4CEA A;  4UQG A;  5CZ2 A;  1ASU A;  4CF9 A;  1NKB A;  4WFB L;  3KKR A;  3FR0 A;  4YOW A;  1NGF A;  2KLA A;  5HL7 L;  3OYG A;  1I39 A;  1Q8I A;  4FWN A;  4GKJ K;  5AQO A;  3SPZ A;  3SK3 A;  4DU1 A;  4MDB A;  2PYJ A;  1NK7 A;  1IG8 A;  4BRG A;  4JKE A;  4DTR A;  1YTU A;  3MXI A;  2QKB A;  4QCL A;  3HJF A;  1ASV A;  2V51 B;  3K5L A;  4IG0 A;  4DV6 K;  1QQC A;  2GEL A;  4M41 A;  1HJO A;  2QA4 N;  4DTM A;  3NDK A;  4JNE A;  3B6P A;  3CCM N;  1RT2 A;  3A8Y A;  3SJJ A;  2DY4 A;  1BL3 A;  2FF6 A;  3DRR A;  2E20 A;  4OKK A;  1LV5 A;  5C15 A;  3P31 A;  3N4Q A;  3AAQ A;  3P5J A;  2HND A;  4NCA A;  3THX B;  2ZF5 O;  4I9L A;  2FSN A;  4DG1 A;  4M7Y A;  4AHS A;  2P9I B;  3CET A;  5AQY A;  3HT3 A;  3VEV A;  4PKI A;  3V9U A;  3AO1 A;  4BGA A;  2D5R A;  3H3O B;  1UA1 A;  2O8E A;  4PA1 A;  2KQ2 A;  4EIA A;  4I2Q A;  1SZ2 A;  3SPY A;  2OA8 A;  4FLZ A;  2E6L A;  3CFR A;  3SI6 A;  4KHN A;  1G15 A;  5CYM A;  3DXM B;  2CH6 A;  4FWS A;  4AHR A;  3D2E A;  4WQ5 C;  3M8R A;  4KRE A;  4JI4 K;  5KGX A;  1DT9 A;  1ZBL A;  5LMU K;  1VK0 A;  4CJS A;  3H45 C;  4GNI A;  4CEB A;  1JLG A;  2BDP A;  1P8Z A;  4CZJ A;  4B3R K;  1VQP N;  3ITH A;  3CME N;  2HNY A;  3WQU A;  2Q0R A;  2B5J A;  3FGU A;  3S41 A;  1S1U A;  4RG8 A;  5FRN A;  2PAV A;  4XIU A;  3OYH A;  3UE5 A;  5BRH A;  3KKS A;  3THV A;  4DFK A;  1RDA A;  1BQN A;  3PLA A;  2YNI A;  1XWL A;  4BRC A;  4FJM A;  3C6T A;  3FZM A;  1U45 A;  1DTT A;  3AGR A;  4BEC A;  4H4O A;  4ZTJ A;  3AVF A;  5KRS A;  3R3L A;  1BUP A;  1YXQ A;  3NGY A;  4PKH A;  5AQI A;  5LY3 A;  3CCR N;  3S3M A;  1NGC A;  3RWU A;  5AQG A;  3M8P A;  1T6C A;  1MWK A;  3LP1 A;  1Q81 O;  3E66 A;  2HMP A;  2D4W A;  4DUZ K;  3ZSX A;  2WFB A;  4JK8 A;  1R0A A;  4DR7 K;  1TKT A;  1RTJ A;  2KZM A;  2ITG A;  5J2N A;  3TSP A;  4EAH D;  1VQK N;  4QOZ B;  1X1P A;  4FJG A;  4CD1 A;  4Z4F A;  1L3U A;  1VSM A;  1BI4 A;  3ASM A;  3H46 O;  2QW9 A;  3P4I A;  3KLH A;  1BDG A;  4FJK A;  3KJV A;  2NRH A;  1A5V A;  1H1V A;  3EZW A;  1NU0 A;  3S5T A;  1DLO A;  1RDW X;  1HUX A;  2HST A;  4LFB K;  3H3N O;  4CHZ A;  1NJY A;  3T1A A;  3QER A;  3MK6 A;  2O8D B;  3RVC A;  3VQP A;  2P9N B;  4FM1 A;  5BN9 A;  3CF5 L;  2O8B A;  4B1V A;  4DV5 K;  4DR5 K;  3UKR A;  4DB3 A;  4DTS A;  4E7H A;  3NAE A;  3CJA A;  3FE1 A;  3V9S A;  2DPN A;  3ZCM A;  1GLA G;  4AHT A;  4EHU A;  5HRR A;  2OYQ A;  4IBN A;  3V1O A;  5AQQ A;  1BIU A;  2JWK A;  4CEC A;  2HHQ A;  2GWJ A;  3OS2 A;  3LZJ A;  4B3T K;  3VPZ A;  1NK9 A;  4KRF A;  3HSC A;  2F7T A;  4LSN A;  3DLK A;  3RRH A;  3MWT A;  1RT1 A;  4OLB A;  1KD1 O;  2AJQ A;  3PX6 A;  4H5T A;  2D0B A;  1K8A O;  4IXC A;  4NYN A;  1OH6 A;  1OH8 A;  2XY6 A;  4BAC A;  2BTF A;  1HMV A;  5JS1 A;  4KFB A;  4EP4 A;  3MXM A;  3LAK A;  4B9T A;  4W5N A;  3E9O A;  5HLF A;  3ID8 A;  3BZC A;  1ILY A;  3C6H A;  1GLC G;  4DV1 K;  2O4I A;  2V7Y A;  4IDH A;  3TAB A;  4O5F A;  5GAE P;  5SWM A;  2PYL A;  3I8B A;  3ENH A;  2FF3 B;  1P90 A;  3OYM A;  4HTL A;  3HOT A;  1FKO A;  5FRM A;  3ZT1 A;  1HNZ K;  4BR0 A;  4DCH A;  3CPE A;  3EN9 A;  3CYM A;  3VQQ A;  1YIJ N;  1S1X A;  4Y1D A;  2Q36 A;  5FPE A;  3NF8 A;  1L3T A;  2HHH K;  3VEW A;  1KFD A;  3ENB A;  3QIN A;  4YOV A;  4CBW A;  1VQ5 N;  4J2D A;  2OZS A;  2YJF A;  4DQ8 A;  1G99 A;  3VN5 A;  4DQI A;  2QEX N;  4ILG B;  1HNI A;  3CIP A;  3O4W A;  2IIR A;  4DU4 A;  2IVN A;  2C1G A;  3OYB A;  3O4Q A;  2G8K A;  5KQ8 A;  3ISN C;  2P9S B;  3S9H A;  4NLB A;  1DKG D;  3SQ2 A;  3G6E N;  1S5J A;  1ZBU A;  1RTH A;  3CI5 A;  1NJW A;  4BR5 A;  4B8A B;  3KTQ A;  3VA0 A;  3H1V X;  1C6V A;  2I7N A;  3ZYY X;  1BWF O;  1EX4 A;  5EVZ A;  1HJR A;  5CHI A;  1BGX T;  4NYF A;  4J8F A;  3QEI A;  3DWL A;  3NGI A;  1YIT N;  1JL1 A;  3SV3 A;  1U6Z A;  3RSE B;  4DSF A;  4K8Z A;  5JVH L;  4A59 A;  3IS9 A;  4I6M A;  2O8C B;  3O80 A;  2D1K A;  1W2B M;  4CHQ A;  2A3Z A;  3HBT A;  4CIE A;  1SL1 A;  5EY4 A;  1K6Y A;  1S6P A;  3QNN A;  2Z1H A;  4BRI A;  4LF6 K;  3HZ6 A;  3THX A;  1XNR K;  3AO3 A;  3HI0 A;  1J6Z A;  3JXU A;  1U48 A;  2F9T A;  2E8A A;  4FPB A;  4KTW A;  4KH5 A;  3K5M A;  1L3V A;  1RT6 A;  3CFO A;  2YX6 A;  3U3G A;  1J5E K;  1TAQ A;  3VOV A;  4B1Z A;  4CGG A;  2NLX A;  1J9A A;  2B6A A;  2JLE A;  2VQE K;  4H0Y B;  5M1Q A;  3C94 A;  5BR8 K;  1XHZ A;  3VEZ A;  4ELU A;  5GAG P;  1EWR A;  2VCP A;  2ZGZ A;  5HRO A;  1YHQ N;  1HRH A;  4CW7 B;  4CEZ A;  1D9F A;  1HX1 A;  1YJW N;  4BQL A;  1RDU A;  2O4G A;  2A1R A;  2KZZ A;  4K0K K;  4LD0 A;  4EFH A;  1NKE A;  3HOS A;  1I3A A;  4W5Q A;  3V81 A;  4DR4 K;  3CPW M;  2HHU A;  5F2R A;  4BRQ A;  3EYZ A;  5C10 A;  1NGA A;  4DKW A;  4BWM A;  4CJV A;  1ZXO A;  1TKD A;  4FWM A;  3CJC A;  5EOY A;  5JS2 A;  2ZQB A;  3LZI A;  1IG9 A;  5C0Y A;  3SAF A;  1QZ6 A;  3CER A;  4AHC A;  3FFI A;  4M45 A;  3B6O A;  4JI1 K;  3V1R A;  4Z94 A;  5JIC A;  2LSN A;  2Q97 A;  2I7P A;  4BC4 A;  3ENO A;  2E1Y A;  4X62 K;  4PUO A;  2CGK A;  4GVM A;  3KLI A;  3QO9 A;  4AIL C;  3ZT4 A;  4CZL A;  3D2E B;  3ULE B;  2YKM A;  4IFE A;  3I0R A;  3E9L A;  3GDQ A;  2P9P A;  1HQU A;  1S1T A;  3VQE A;  2O8E B;  4FW2 A;  4BE2 A;  1ATR A;  1VSH A;  3L0Q A;  4JV5 K;  4YDU A;  3TAN A;  3H08 A;  4B9S A;  1X9J A;  1NK6 A;  4CF0 A;  3AVM A;  1TKZ A;  3WXI A;  4CFC A;  3J80 O;  2YJE A;  4FLV A;  1XI1 A;  1TK0 A;  1SS6 A;  3EEQ A;  4CFD A;  3THY A;  2QWQ A;  1MU2 A;  3EKS A;  4FCY A;  3KWG A;  3TPQ A;  1LWE A;  4KI4 A;  3SQ0 A;  3IMX A;  1HNV A;  3NH1 A;  4DTU A;  3HVR A;  3F2K A;  3QB0 A;  1KLM A;  3VQ9 A;  2VGM A;  1UOC A;  5AQN A;  3V9X A;  3O9S A;  4IJA A;  4W5O A;  4HHT A;  3THW A;  2WUS A;  1YTA A;  3R6M A;  4QS7 A;  5KGW A;  4W5T A;  4Z4I A;  4MFB A;  1V4T A;  3AO4 A;  2DFE A;  3SQ4 A;  4Z0U A;  1QSS A;  3UIQ A;  1RBT A;  4JI6 K;  3ZSZ A;  2PY5 A;  5LMN K;  1TYQ A;  2HF3 A;  3UKU B;  5D3G A;  4KO0 A;  4CFA A;  1C0F A;  4C8O A;  2P9K A;  2HF4 A;  1WBD A;  4KB0 A;  3G25 A;  3KZB A;  1TUY A;  5JLH A;  4N56 A;  3HP6 A;  4HCC A;  1RBV A;  1JCF A;  3DXK A;  1UA0 A;  4A5A A;  3O1W A;  3P39 A;  4B1X B;  3KLE A;  3K57 A;  4H0O A;  5BR9 A;  1BA1 A;  4FLU A;  2ASO A;  2NRR A;  1T8E A;  3F9M A;  1XNQ K;  2Z1I A;  1RFQ A;  4OO1 J;  5E26 A;  2E88 A;  2FSK A;  3AO2 A;  1W7A A;  1ZC6 A;  4I7F A;  3KD1 E;  3PX0 A;  3AA2 A;  1T03 A;  1U04 A;  3RR7 A;  3VQ7 A;  3SBT A;  2CGJ A;  2YNH A;  5CE3 A;  2V52 B;  2XY7 A;  1RBS A;  3VGL A;  1ITG A;  4CE9 A;  2W41 A;  2P1J A;  1R59 O;  2P5O A;  4C8K A;  3AO5 A;  1HKG A;  4CEO A;  4IKF A;  4ICL A;  3CCQ N;  1JXB A;  3LAL A;  4M7X A;  3G71 N;  4KH4 A;  1CXQ A;  3Q7B A;  3CFP A;  3A5O C;  4QS8 A;  1HPZ A;  2H3G X;  1JL2 A;  3SBG A;  4DQQ A;  4IOA L;  3SV4 A;  1CZA N;  4B3M K;  3VQ4 A;  4F3O A;  1JLF A;  2E2O A;  5H1S Q;  1WLJ A;  2P9N A;  4K43 A;  4M3Z A;  2GEM A;  3M8S A;  3NMU A;  4DQS A;  4JD2 A;  3OS1 A;  2QWL A;  2HBK A;  1RDB A;  5EU7 A;  4CEE A;  3DLE A;  4CJP A;  3PSI A;  1QSY A;  1YJ9 N;  3KLG A;  4BRA A;  1A5X A;  3FZL A;  3KHY A;  2QK9 A;  4PWD A;  4C8L A;  2F8T A;  2KTQ A;  2DTU A;  5GIP A;  1JLB A;  3LDQ A;  4FWP A;  1N34 K;  3KLF A;  3V4I A;  4PY5 A;  4IWV A;  3NFA A;  2BAN A;  4E1J A;  2OTJ N;  4GKK K;  3I33 A;  1RNH A;  3L3U A;  5LJW A;  1BQM A;  4CES A;  1GOB A;  3AVJ A;  3LDL A;  4KB1 A;  2HVH A;  1NJI O;  3J7Y P;  3QBX A;  1VQO N;  4FJ8 A;  4FXD A;  1IBK K;  3PO4 A;  3AVB A;  5BPN A;  4B9U A;  4DV7 K;  5AQZ A;  3AV9 A;  1LWC A;  4BR9 A;  4WFA L;  1KVA A;  3LM9 A;  4KHS A;  3SAG A;  5HP1 A;  3KK2 A;  3SUQ A;  3ID6 A;  3TSU A;  4XJX A;  1DEJ A;  4BRD A;  1HKC A;  4QAG A;  3WNE A;  3C6U A;  3D45 A;  3QFU A;  3VET A;  3ZX0 A;  3ZSQ A;  4BDY A;  2A42 A;  4CED A;  5JEN A;  4PKG A;  1W0H A;  4CGH A;  3AVN A;  5TKW A;  5MLC Q;  1Q18 A;  1Y64 A;  3ZET A;  4LF9 K;  4AM6 A;  1VRU A;  2YHX A;  3FZH A;  4DSJ A;  1VSE A;  1BO5 O;  1BOT O;  4CJT A;  3NHG A;  4U67 L;  5JVG L;  3BF3 A;  4ILJ A;  4LC9 B;  4G1Q A;  3VQD A;  1X9W A;  4KHW A;  3IG1 A;  3KK3 A;  3CCU N;  3ZX2 A;  3NH0 A;  4IO9 L;  1ZBI A;  1CZ9 A;  4BRP A;  3K58 A;  4CJ5 A;  4UY8 O;  5B8H A;  4H5V A;  2GUI A;  2OAN A;  4JKH A;  4GV9 A;  1LCU A;  2P9U A;  1NNE A;  2YNF A;  2FBV A;  2VYP A;  4ZTF A;  2E5L K;  4AM7 A;  2G8V A;  1JCE A;  4WQ4 C;  5T7B A;  4BR2 A;  4ELV A;  3L2U A;  1CZB A;  4NCB A;  4ISE A;  1JCG A;  2QI2 A;  1SKR A;  3PY8 A;  1C1C A;  1E4G T;  1M90 O;  4B9N A;  4LFA K;  1NWK A;  2P9P B;  3E1Y A;  3SLC A;  4EHT A;  3G4S N;  4WFN L;  3SUP A;  4GV3 A;  1O13 A;  3THW B;  4HTU A;  4H5R A;  3TAQ A;  4HWI A;  5K14 A;  2W42 A;  4LFC K;  1BU6 O;  3OW2 M;  1JLC A;  3TAF A;  3O4N A;  4ISG A;  4CJF A;  4YNQ A;  1EXQ A;  1QTM A;  1Q9Y A;  3CJ7 A;  1CXU A;  1VQ8 N;  5AQJ A;  2GUP A;  3L2R A;  3DAW A;  3NF6 A;  2Q2R A;  4FZX C;  3AAP A;  1TK5 A;  3MXJ A;  3I55 N;  2RF2 A;  1LW2 A;  4Q5V A;  2JWL A;  4M3X A;  3V6D A;  2FBT A;  5HBM A;  1WSI A;  2ZJP L;  4DWI A;  4CZF A;  1GLJ O;  3L2Q A;  4OPH A;  2NUB A;  4F3T A;  1ATN A;  3SNN A;  1XMQ K;  1VSK A;  2E1Z A;  3TAG A;  5C24 A;  1HKB A;  4LF7 K;  1WAF A;  3DLH A;  4KH6 A;  4HVJ A;  4CZE A;  3LDP A;  4FWR A;  5KTQ A;  2D0O A;  3RTV A;  3OYK A;  2QWO A;  3O5B A;  4FJI A;  3ULD A;  1QS4 A;  1TAU A;  4HUE A;  3OA9 A;  1IKX A;  1K8K A;  3VQC A;  4IFV A;  5HRS A;  1M1K O;  3EO3 A;  3KVG A;  5FPN A;  4DLG A;  3EE9 A;  4B9L A;  5AQW A;  3K2P A;  4CJU A;  3JAM O;  4C1N K;  2QKK A;  3V9W A;  4V19 S;  2OPR A;  2OPP A;  3DLB A;  1IKW A;  1VAZ A;  1GOC A;  4FJL A;  2W6K A;  1FW6 A;  1KRP A;  3VQA A;  4IOC L;  1NGJ A;  2O8B B;  2YHY A;  4Y0W A;  3DMJ A;  1OVY A;  2OZM A;  3WNH A;  3KIO A;  4PQU A;  3VTI A;  2VG7 A;  2RPI A;  3QEW A;  3PX4 A;  1JKH A;  3A5N C;  2O8C A;  3QFP A;  4BVO A;  5KQD A;  3WNG A;  1VHX A;  4JRP A;  5AFU A;  1S1V A;  3CQY A;  4IDK A;  2IS3 A;  3LPU A;  2ATQ A;  1KFS A;  3GOI A;  3V9Z A;  3NVM A;  4BRF A;  5GIO A;  4FO0 A;  2JGU A;  4IOX A;  2GBZ A;  2VWK A;  2ITM A;  3TAE A;  4JI8 K;  3O9T A;  4GY2 B;  5TKY A;  2NRV A;  1NK0 A;  3KK7 A;  3DOK A;  3NF7 A;  4A2B A;  1N33 K;  1RGI A;  3IDH A;  3J8A A;  3W0L A;  3MN9 A;  1VRT A;  3VF2 A;  1E3M A;  3LP0 A;  3MCA B;  3OYI A;  4BVP A;  3E9P A;  4K8X A;  2QWR A;  1VSF A;  1NJX A;  3LAM A;  3R1X A;  4R5P A;  2YHA A;  3TAR A;  2G8U A;  3K0S A;  1TYQ B;  4DHY A;  1QSL A;  1KVC A;  3ZSV A;  1SQK A;  2HVI A;  3HPG A;  3OYF A;  4CVN E;  4WCE L;  3AVA A;  3WXL A;  4CBX A;  1KCF A;  3HP9 A;  4MDA A;  4B1Y B;  5HRP A;  1NK4 A;  4YFU A;  3HPO A;  4DF4 A;  1KLN A;  3CC7 N;  1I94 K;  2IAJ A;  4YOR A;  4AF1 A;  3QNO A;  4J2A A;  4DUY K;  4B9M A;  4KPY A;  2FLO A;  1IO2 A;  3MED A;  4LF5 K;  2GTD A;  2WTU A;  1J54 A;  1RIL A;  3BUZ B;  3OBW A;  4KTZ A;  2HNZ A;  3M3Z A;  2YV0 X;  2KHO A;  4FK2 A;  2Y1I A;  2P9U B;  4CD3 A;  1V4S A;  3T1H K;  5IT9 O;  4BRE A;  4N47 A;  3RR8 A;  2F9W A;  5AZJ A;  1NGI A;  4BQZ A;  1ATS A;  3VTH A;  1K73 O;  3CC4 N;  3PO5 A;  2WBN A;  4XH1 A;  1BIZ A;  5AQU A;  4CER A;  2F4V K;  4X66 K;  4CJ4 A;  5JLF A;  1U49 A;  3P38 A;  4DMN A;  4LF4 K;  1NG9 A;  3O3F A;  4RWT A;  4CGI A;  1X3N A;  3SMS A;  4BEB A;  3O08 A;  2NNW A;  3R8E A;  1XUP O;  1D4X A;  1KAZ A;  4RTF D;  2QWP A;  4EZ9 A;  3VQB A;  5AFU H;  1QZ5 A;  4B1U B;  3OYC A;  1EWQ A;  2XRI A;  4JKF A;  2QTD A;  3DLL L;  3BP8 A;  2UUC K;  1ZBS A;  4DTO A;  4IZ9 A;  4DSK A;  3QIO A;  2C1I A;  3MMV A;  4DR2 K;  3OJU A;  1NOY A;  2E2Q A;  5M1K A;  3BZK A;  4BE7 B;  1NMD A;  2P9S A;  3C6A A;  3OVN A;  3E01 A;  1WSJ A;  4AHV A;  4CHO A;  4OGE A;  3VGK A;  4E1M A;  3MAQ A;  1NK8 A;  4O4G A;  1VSD A;  1Z26 A;  2ZD1 A;  1XQS C;  3L8B A;  1MDU B;  3B8A X;  2OPQ A;  4ID1 A;  5AR0 A;  4Z4H A;  3DYA A;  5DMR A;  1VQ4 N;  3K5O A;  3MEC A;  3VEX A;  4CJL A;  1S3X A;  1S9E A;  2OPS A;  4E89 A;  3GL1 A;  1QQO A;  2ZGY A;  4F9O A;  4RW7 A;  4H03 B;  3D2F A;  5FLX O;  5FPM A;  3AY9 A;  2RHK A;  1RBU A;  1S9G A;  5AQK A;  1KAY A;  4A61 A;  4BRO A;  1WSH A;  4K42 A;  4JK7 A;  3VF6 A;  1U4B A;  3S3N A;  4RW4 A;  2QWM A;  3DXM A;  3WT0 A;  3KWI A;  2BE2 A;  4DS5 A;  3MDQ A;  3OYJ A;  3EZ5 A;  3DRP A;  1FK9 A;  1U2V B;  2KFN A;  2GWK A;  4I6M B;  5AQT A;  3TSQ A;  4BDZ A;  4RCH A;  3ATU A;  4ILH A;  1B9F A;  3RSE A;  1D5A A;  3ALY A;  2RE2 A;  2HW3 A;  4JKD A;  1S22 A;  3JSM A;  5ADX A;  4WF9 L;  4CZM A;  2P9L B;  2RN2 A;  3LP3 A;  1TUU A;  1YT3 A;  3C0B A;  1EET A;  2CH5 A;  4JHD A;  4DLE A;  1DGK N;  1VQN N;  2FXU A;  3LM2 A;  3LWM A;  2HBJ A;  4F8R A;  3O3G A;  1FKP A;  2HHX A;  4NO7 A;  2UU9 K;  1X3M A;  4H0V B;  3NBP A;  3G10 A;  1VQ6 N;  3AGK A;  4GV6 A;  4E3S A;  3ULE A;  5BRF A;  1Q86 O;  3FZK A;  5M1P A;  4BG8 A;  5HOO A;  3PV8 A;  1NM1 A;  4BGB A;  3MN7 A;  4K41 A;  5GAH P;  5AQM A;  4FWL A;  1RBR A;  3N4P A;  1YUW A;  5KPR A;  1NGB A;  3LDO A;  5ELZ A;  4A5B A;  4DFP A;  4OJR A;  1FXX A;  3CQX A;  1S6Q A;  3HXM A;  3HM8 A;  5AQX A;  4LF8 K;  3A5M C;  3CM5 A;  1OKJ A;  1T3V A;  3NF9 A; 
#chains in the Genus database with same CATH homology
 3QFU A;  2P9I A;  3VET A;  3ZX0 A;  2A42 A;  4PKG A;  3K9K A;  4H5T A;  4WYB A;  5TKW A;  1K8A O;  1T6D A;  5MLC Q;  1Q18 A;  2NZT A;  1Y64 A;  4FPA A;  4IXC A;  3ZET A;  1QHA A;  3HRG A;  2E2N A;  4AM6 A;  3L4Q A;  2YHX A;  3I56 N;  3FZH A;  3M5R A;  4BG9 A;  3TTD A;  1BO5 O;  1BOT O;  1BG3 A;  1VQ9 N;  3CCV N;  2BTF A;  4U67 L;  5JVG L;  4BC3 A;  3BF3 A;  3GE1 A;  4ILJ A;  4LC9 B;  1Q7Y O;  1K9M O;  2W40 A;  2IVO A;  3L6Q A;  3CCU N;  3ZX2 A;  4ISF A;  4IO9 L;  4BRP A;  3E9O A;  3ID8 A;  4QS9 A;  2YHW A;  4UY8 O;  1ILY A;  3CCL N;  3C6H A;  1GLC G;  4MLE A;  1VQM N;  2V7Y A;  4FOI A;  4H5V A;  4IDH A;  4MO4 A;  4O5F A;  5GAE P;  5B8H A;  3CCS N;  1IJJ A;  2OAN A;  3ENH A;  3I8B A;  2FF3 B;  1P90 A;  4HTL A;  4JKH A;  4GV9 A;  3HOT A;  1LCU A;  4L3Q A;  2P9U A;  3Q7C A;  2UYT A;  2PBD A;  4H0X B;  4BR0 A;  2VYP A;  4DCH A;  1EQY A;  5CR4 A;  3CPE A;  4AM7 A;  2HOE A;  2D0P A;  2YCH A;  1JCE A;  4WQ4 C;  3EN9 A;  3FLC O;  4BR2 A;  3D7E O;  1E4F T;  1YIJ N;  4B9Q A;  2Q36 A;  4ISE A;  5FPE A;  2HBM A;  5C2D A;  1JCG A;  2QI2 A;  3CC2 N;  3VEN A;  1E4G T;  1M90 O;  5AQP A;  3BEX A;  3VEW A;  4G9Z A;  3ENB A;  1NWK A;  2P9P B;  3E1Y A;  4GVE A;  3SLC A;  4EHT A;  3G4S N;  2BH1 A;  3QBW A;  4M63 C;  4WQ4 A;  4WFN L;  3CCJ N;  4GV3 A;  4BRN A;  4BR4 A;  2VGN A;  3DXK B;  4YOV A;  1O13 A;  1YF5 L;  4CBW A;  2ZJQ L;  1QVG M;  4H5R A;  2YJF A;  4DQ8 A;  1VQ5 N;  4XH4 A;  2W00 A;  3QDK A;  3A0I X;  4HWI A;  1G99 A;  2QEX N;  1BU6 O;  4ILG B;  3CIP A;  3OW2 M;  4FVU A;  3VMF B;  3O4W A;  2IIR A;  2AP1 A;  2IVN A;  4ISG A;  4YOY A;  2C1G A;  5AZI B;  2AA4 A;  4OPA A;  5AQL A;  3CJ7 A;  3VEO A;  3EE8 A;  3LL3 A;  4YOU A;  1VQ8 N;  5LJV A;  3VF4 A;  5AQJ A;  5KQ8 A;  2GUP A;  3OHR A;  3ZET B;  3DAW A;  2P9S B;  3CJ1 A;  4NLB A;  1DKG D;  2Q2R A;  3J7Z O;  3G6E N;  3AAP A;  4CBU A;  3T69 A;  3ATV A;  3I55 N;  4JD2 B;  3QIC A;  2JWL A;  3IUC A;  3CI5 A;  2ZJP L;  4BR5 A;  4CZF A;  1GLJ O;  1QQN A;  4OPH A;  1ATN A;  4BC5 A;  4NB4 A;  5KPZ A;  1U2V A;  2E1Z A;  3H1V X;  5FPD A;  2I7N A;  3CHW A;  3ZYY X;  1S72 N;  1BWF O;  2NRT A;  3F5T A;  5EVZ A;  3VES A;  3VGM A;  5BPM A;  1HKB A;  5CHI A;  4KH6 A;  4IO8 A;  4CZE A;  3LDP A;  4FWR A;  3TTC A;  2D0O A;  4JAX A;  5C12 A;  2QWO A;  3O5B A;  2QXL A;  4J8F A;  1LOT B;  3DWL A;  2A6A A;  3OA9 A;  1YIT N;  1GLL O;  1K8K A;  1U6Z A;  1M1K O;  3RSE B;  3EO3 A;  4BY9 C;  3KVG A;  5FPN A;  3EE9 A;  2E2P A;  5AQW A;  2ZJR L;  4C1N K;  3D6R A;  5JVH L;  2YI1 A;  4A59 A;  4I6M A;  1W97 L;  3GBT A;  3O80 A;  4BRM A;  2D1K A;  1W2B M;  2J4R A;  3W3D A;  2A3Z A;  3HBT A;  3MX2 A;  4PHT X;  3EKU A;  5EY4 A;  4O8K A;  3CJ9 A;  1VAZ A;  3UB5 A;  4BRI A;  3HZ6 A;  3TTF A;  1QQM A;  1J6Z A;  2GX9 A;  3HI0 A;  3JXU A;  3ZX3 A;  2F9T A;  4IJN A;  2E8A A;  4FPB A;  4FOE A;  4H5W A;  2BUP A;  4KH5 A;  4IOC L;  2ASM A;  5JMV A;  1NGJ A;  1KC8 O;  2YHY A;  3CXC M;  1KQS M;  4Y0W A;  5AQF A;  2YX6 A;  3EL2 A;  3U8X A;  3VOV A;  4B1Z A;  1OVY A;  4H0T B;  2PFU A;  1YVN A;  2NLX A;  3WXJ A;  1JJ2 M;  3O6W A;  5DM6 L;  3VTI A;  4H5N A;  3H6E A;  4H0Y B;  4O8U A;  3MX5 A;  5M1Q A;  4PL8 A;  3QML A;  4YOX A;  1Q82 O;  3VEZ A;  3VER A;  3A5N C;  5GAG P;  2VCP A;  2Q1N A;  2ZGZ A;  3QFP A;  5AZJ B;  4BVO A;  5KQD A;  5KPT A;  1YHQ N;  1HX1 A;  3O9Q A;  1YJW N;  5AFU A;  3CQY A;  4BQL A;  1YI2 N;  1K73 O;  3K9J A;  4JHD B;  1RDU A;  4JKB A;  3GOI A;  3U9D A;  3WXK A;  4CZI A;  4EFH A;  2NRW A;  3HOS A;  3NVM A;  1BA0 A;  5BPL A;  4BRF A;  5GIO A;  4FO0 A;  5M1O A;  2P9K B;  4IOX A;  2ITM A;  3CPW M;  5F2R A;  4C1N I;  2NRX A;  3O9T A;  4GY2 B;  5TKY A;  4BRQ A;  5C10 A;  3PIP L;  3AAR A;  1NGA A;  2NRV A;  3FZF A;  3KK7 A;  4DKW A;  1NBW A;  2KKZ A;  3WEE B;  1ZXO A;  4A2B A;  5EX5 A;  1EO1 A;  1RGI A;  2ASP A;  4FL9 A;  2A5X A;  4FWM A;  1Z6R A;  4A57 A;  3IDH A;  3CJC A;  3J8A A;  1KAX A;  5EOY A;  3W0L A;  4CZH A;  3M1F A;  1VQL N;  3HTV A;  3IKM A;  3MN9 A;  4MLH A;  3VF2 A;  5C0Y A;  3OBY A;  5BRD A;  3SAF A;  1QZ6 A;  3CER A;  2HBL A;  3TU5 A;  3MCA B;  1HPM A;  4BVP A;  3DJC A;  3E9P A;  5C2F A;  3SAH A;  4MO5 A;  2QWR A;  3VEY A;  3WEE A;  5AQH A;  3R1X A;  4Z94 A;  5JIC A;  2Q97 A;  2I7P A;  1TYQ B;  3SJH A;  3ENO A;  4BC4 A;  4BRH A;  2E1Y A;  4DHY A;  3D2F B;  2CGL A;  2CGK A;  4WQ5 A;  1SQK A;  3MN5 A;  1GLD G;  1NGG A;  4CZL A;  3C65 A;  3O8M A;  3FFK B;  3D2E B;  3ULE B;  1XC3 A;  4WCE L;  3WXL A;  4CBX A;  3GG4 A;  4IFE A;  4MDA A;  4B1Y B;  3E9L A;  1NGE A;  3GDQ A;  2P9P A;  5AQS A;  4CJ7 A;  3CC7 N;  3ZEU A;  3T7Z A;  4C23 A;  2OTL N;  3C7N B;  4U7B A;  4YOR A;  4JN4 A;  4B1W B;  4AF1 A;  2ZWH A;  1ATR A;  1WOQ A;  4R79 A;  5EXW A;  2FLO A;  3L0Q A;  2GTD A;  4YDU A;  3O1B A;  3BUZ B;  3OBW A;  4WFB L;  1X9J A;  3O9U A;  4JK9 A;  3FR0 A;  3M3Z A;  3U4L A;  4YOW A;  2KHO A;  2EWS A;  1NGF A;  2P9U B;  3WXI A;  2FSJ A;  2KLA A;  2YJE A;  4A62 A;  4BRK A;  4CD3 A;  5HL7 L;  1V4S A;  1SS6 A;  5M1F A;  2QWQ A;  3CJB A;  4BRE A;  4FWN A;  4YDU C;  3EKS A;  3KWG A;  4XEI A;  5AQO A;  3L4I A;  3SK3 A;  2F9W A;  3TPQ A;  4MDB A;  5AZJ A;  1NGI A;  4BQZ A;  1ATS A;  3IMX A;  4JEP A;  1IG8 A;  4IEI A;  4JKE A;  4BRG A;  3VTH A;  3F2K A;  3QB0 A;  2V7Z A;  2VGM A;  1GLB G;  5AQN A;  3SMP A;  3CC4 N;  2WBN A;  3O9S A;  4IJA A;  2V51 B;  4XH1 A;  5AQU A;  4PL7 A;  4BRL A;  5JLF A;  1YAG A;  2GEL A;  3CMA N;  3P38 A;  1HJO A;  2WUS A;  3R6M A;  4QS7 A;  4RWT A;  2QA4 N;  1V4T A;  1X3N A;  4JNE A;  3CCM N;  3SMS A;  3A8Y A;  3MN6 A;  1TYQ A;  2WC9 A;  2FF6 A;  4BEB A;  2HF3 A;  5E84 A;  2E20 A;  3O08 A;  3UKU B;  1WUA A;  3PIO L;  3LDN A;  5C15 A;  1C0F A;  2NNW A;  3P31 A;  2P9K A;  3N4Q A;  3AAQ A;  2HF4 A;  4FWQ A;  3R8E A;  1XUP O;  2ZF5 O;  3G25 A;  1D4X A;  3KZB A;  2FSN A;  1KAZ A;  3O9R A;  4M7Y A;  1TUY A;  2P9I B;  4RTF D;  5JLH A;  2QWP A;  3CET A;  3BF1 A;  5AQY A;  3VEV A;  4PKI A;  1JCF A;  1QZ5 A;  3DXK A;  5AFU H;  4B1U B;  1YJN N;  4JKF A;  3M6G A;  2QTD A;  4BGA A;  3DLL L;  3BP8 A;  3H3O B;  4A5A A;  3R9P A;  3O1W A;  1ZBS A;  3P39 A;  4IZ9 A;  4B1X B;  4YOT A;  4EIA A;  4CI6 A;  1SZ2 A;  2C1I A;  5GAD P;  1MA9 B;  4H0O A;  2Q0U A;  1BA1 A;  3MMV A;  5BR9 A;  2P9L A;  4FWO A;  3DXM B;  2ASO A;  2CH6 A;  2E2Q A;  4FWS A;  3D2E A;  5M1K A;  2A41 A;  2NRR A;  4BE7 B;  1NMD A;  3F9M A;  2P9S A;  4WQ5 C;  3C6A A;  4KBO A;  5M1N A;  1RFQ A;  1SAZ A;  1DT9 A;  4OO1 J;  5GIN A;  5E26 A;  3CD6 N;  2E88 A;  3H1Q A;  1NGD A;  3VGK A;  2VWB A;  3H45 C;  4GNI A;  5ADX H;  2FSK A;  1XQS C;  3ZEU B;  1T44 A;  3B8A X;  2IVP A;  1MDU B;  1P8Z A;  1Z05 A;  5AR0 A;  4BC2 A;  1ZC6 A;  2Q31 A;  4CZJ A;  1VQP N;  1KXP A;  3CME N;  3WQU A;  1VQ4 N;  2Q0R A;  3A5L C;  3VEX A;  3FGU A;  1S3X A;  4JKC A;  3CCE N;  3S41 A;  3MWP A;  4JKA A;  2PAV A;  3SBT A;  2CGJ A;  3GL1 A;  3JS6 A;  1QQO A;  3UE5 A;  5CE3 A;  4FWK A;  2V52 B;  2ZGY A;  4F9O A;  5BRH A;  1N8R O;  3VGL A;  4H03 B;  3D2F A;  2W41 A;  5BRE A;  3UKU A;  1R59 O;  4BR7 A;  3PLA A;  5FPM A;  3AY9 A;  4IEE A;  4XH5 A;  1HKG A;  2RHK A;  5AQK A;  4BRC A;  1KAY A;  4A61 A;  4BRO A;  1HLU A;  3FZM A;  1K8K B;  3AGR A;  4H0P A;  4JK7 A;  4K42 A;  3VF6 A;  3CCQ N;  1QVF M;  4BEC A;  4M7X A;  3R3L A;  3G71 N;  4KH4 A;  2QM1 A;  1BUP A;  3WQT A;  3WUH A;  1YXQ A;  2QWM A;  4PKH A;  3Q7B A;  5AQI A;  3DXM A;  3MCP A;  3WT0 A;  3A5O C;  3KWI A;  1NGC A;  4QS8 A;  5LY3 A;  2H3G X;  3CCR N;  3SBG A;  5AQG A;  5I9E B;  3MDQ A;  4IOA L;  1T6C A;  1MWK A;  1C0G A;  1CZA N;  1U2V B;  5H1S Q;  2E2O A;  1Q81 O;  2P9N A;  2GWK A;  2HMP A;  3E66 A;  2D4W A;  4I6M B;  4K43 A;  5AQT A;  2QWN A;  2WFB A;  3TSQ A;  4JK8 A;  2GEM A;  4RCH A;  3ATU A;  4ILH A;  3NMU A;  3RSE A;  3TSP A;  4EAH D;  4JD2 A;  1VQK N;  4FSV A;  5AQV A;  4CZG A;  2QWL A;  2HBK A;  2RE2 A;  4JKD A;  1S22 A;  5ADX A;  3U9Z A;  4CD1 A;  5F0X A;  4CZM A;  4WF9 L;  1YJ9 N;  4BRA A;  2P9L B;  3H46 O;  1TUU A;  3C0B A;  3FZL A;  3IFR A;  2CH5 A;  2QW9 A;  3P4I A;  4JHD A;  5DM7 L;  1ESV A;  1DGK N;  3KHY A;  3WXM B;  1VQN N;  1NLV A;  1BDG A;  2FXU A;  3LM2 A;  2HBJ A;  4NLC A;  3C7N A;  4NO7 A;  1X3M A;  5GIP A;  2NRH A;  4H0V B;  1H1V A;  3EZW A;  3LDQ A;  1RDW X;  1VQ6 N;  4FWP A;  1HUX A;  3AGK A;  1GLF O;  2HST A;  4GV6 A;  4IWV A;  3H3N O;  1GLE G;  3MK6 A;  4E1J A;  3ULE A;  5BRF A;  3RVC A;  2OTJ N;  1Q86 O;  3I33 A;  2P9N B;  3FZK A;  5M1P A;  5LJW A;  5BN9 A;  4BG8 A;  5HOO A;  3CF5 L;  4B1V A;  4A2A A;  3LDL A;  3UKR A;  4CZK A;  4DB3 A;  5BN8 A;  1NJI O;  1NM1 A;  4JKG A;  2NRZ A;  4BGB A;  3MN7 A;  5AZI A;  4K41 A;  3QBX A;  1VQO N;  2A40 A;  3CJA A;  3FE1 A;  1MWM A;  5AQM A;  2DPN A;  5GAH P;  1GLA G;  4FWL A;  3N4P A;  5F1X A;  5BPN A;  1YUW A;  5KPR A;  1NGB A;  4K25 A;  3LDO A;  1VQ7 N;  4EHU A;  5AQZ A;  5ELZ A;  4A5B A;  4JKG B;  4BR9 A;  4WFA L;  5AQQ A;  2JWK A;  3UKR B;  3LM9 A;  2GWJ A;  3SAG A;  3CQX A;  3NVK A;  1NGH A;  3ID6 A;  3TSU A;  4XJX A;  3VPZ A;  1DEJ A;  3HSC A;  3HM8 A;  5AQR A;  5AQX A;  2F7T A;  3A5M C;  4BRD A;  1HKC A;  1OKJ A;  3MWT A;  1T3V A;  1KD1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...