2P9PA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
412
structure length
388
Chain Sequence
b'GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGKWIKQYTGINAKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 124
structure length 388
sequence length 412
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pA03
4F9OA 2BTFA 4BRLA 3LDOA 5AQMA 1BU6O 3U8XA 1S22A 5AQOA 2A40A 4DQ8A 2D0PA 4BC3A 5BPMA 3TPQA 3QB0A 3HM8A 4Z94A 1HJOA 3H45C 2Q0RA 4BQZA 3J8AA 2VYPA 4AM6A 3A5NC 4BRMA 4BRDA 4JN4A 2IIRA 2V51B 2NZTA 3CIPA 1GLFO 2QXLA 3M6GA 4K43A 2Q97A 5EVZA 4CJ7A 5AQSA 1HKBA 1YUWA 2F9TA 2E8AA 2IVOA 2J4RA 3WEEA 3CJ7A 3F9MA 5AFUA 2FF6A 2QWQA 3R6MA 1HPMA 4C23A 4K42A 3VESA 5EOYA 5EXWA 2NRHA 3IUCA 4I6MB 1QZ5A 3DXKB 4WQ5A 3VGMA 5AQGA 3HTVA 4BROA 3L0QA 3L4IA 3SMPA 5I9EB 3GBTA 2NLXA 2CH6A 5E26A 1NGIA 3DXMB 4A62A 3I33A 4ISEA 2ZGZA 1RFQA 5KPZA 2P9SB 1XUPO 2I7PA 3UKUB 4WQ4A 4MO5A 3D2EB 3UKRA 3ZEUA 4CZIA 1NGJA 3VERA 5BN8A 2A42A 3A0IX 1NGHA 3TU5A 1U2VA 1BA1A 4IZ9A 5LY3A 2ITMA 5BRDA 3H1VX 1NMDA 2P9NB 2P9KA 2D1KA 1TYQA 5BRFA 4WYBA 3D2FB 3WQTA 5BREA 1BA0A 1NWKA 3FFKB 1HX1A 4EHUA 3ATUA 3M1FA 4ISFA 4H5NA 3QFPA 3C0BA 1NBWA 3CETA 5FPDA 1GLDG 3ZX0A 1LOTB 2BUPA 3WEEB 4PL7A 4H0TB 4HWIA 2HF4A 3KZBA 3CJ9A 4IXCA 3BEXA 2YJEA 4JHDA 4CBUA 1J6ZA 2FSJA 4M63C 4JD2B 5BPNA 2FSNA 1KAXA 4FWQA 3WXJA 1NGDA 3LM9A 4YDUC 2E2OA 3FZLA 1QZ6A 4IWVA 1ZBSA 3ULEA 4PL8A 3HBTA 3HZ6A 1DEJA 4PKIA 2AA4A 5LJVA 1G99A 2V52B 3FZMA 5FPEA 3ID8A 3VOVA 3D7EO 1R59O 3EZWA 3C7NA 2A5XA 1JCEA 5AQWA 2ZWHA 1EQYA 1YAGA 1CZAN 3ZEUB 5JLFA 1NGEA 5AQFA 3CJBA 5AZJB 1K8KA 1X3NA 3HI0A 2V7ZA 1YXQA 3SJHA 1XQSC 3A5MC 3ENOA 1WOQA 3O1BA 3GL1A 3KHYA 2YHWA 3EL2A 1T6DA 2P9KB 3VEOA 1BDGA 5BRHA 1TYQB 3BUZB 3QDKA 2D0OA 4FOIA 4KBOA 2ASPA 3ZETA 3MDQA 2CGLA 3BF3A 3WXLA 1Z6RA 4H5TA 1U6ZA 3CERA 2UYTA 4QS8A 3VF6A 2Q36A 3ZX2A 1DGKN 1QQNA 5AQRA 4B1ZA 3LL3A 1T6CA 5AQUA 3EKSA 4BRHA 1T44A 1LCUA 4CZLA 2YCHA 2Q31A 1NGGA 4CZMA 3QICA 3QFUA 4H5RA 3VEVA 5AQKA 3VEZA 1DKGD 4PKHA 4FOEA 1IG8A 5BR9A 4EHTA 3IMXA 3O1WA 5KPTA 4BRKA 4XH1A 2P9LA 1C0GA 2E2PA 2PAVA 4BRQA 4FPBA 2IVNA 3H1QA 3BF1A 4FWPA 4CD1A 1BG3A 4CZJA 4BR4A 3FZFA 5EX5A 4AM7A 3RSEB 5KPRA 3C7NB 5AQPA 2YHYA 4JAXA 1ESVA 1YVNA 4Y0WA 1BOTO 3B8AX 2P9UA 1GLAG 2KHOA 4BVOA 3CJ1A 2AP1A 3FLCO 3IDHA 4FWNA 3U9ZA 2WUSA 5AQLA 3SMSA 3OHRA 3H46O 3ZX3A 4H0OA 1GLJO 3G25A 3VEYA 1H1VA 3O6WA 1V4SA 4B1YB 1P8ZA 4BR2A 4J8FA 5ADXH 2P9IA 3H3NO 3WXKA 2CH5A 4BRAA 4BRFA 4CZKA 1GLCG 2FLOA 4XEIA 5CE3A 5E84A 3HSCA 4BRIA 5KQ8A 3LM2A 2ZF5O 3A5OC 3EO3A 2FSKA 2QM1A 5ELZA 3FZHA 3CJAA 5AQHA 5LJWA 2F9WA 5EY4A 1SQKA 2V7YA 4FWRA 4B1UB 1BWFO 3GDQA 4O5FA 4BRNA 4CZHA 5AQYA 3VEWA 4IJNA 1RGIA 2E88A 2QWLA 1KAZA 5F2RA 3MMVA 4M7YA 4A2BA 4EAHD 2QWNA 2HOEA 3U9DA 1QQMA 3GE1A 4BGBA 3DWLA 4H5WA 5F1XA 4GY2B 1KXPA 3O80A 3W3DA 3H6EA 4BREA 4EFHA 5BPLA 1X9JA 4NO7A 3WUHA 2I7NA 5KQDA 2E1ZA 3P4IA 2E2QA 4FO0A 2YJFA 1E4GT 1ZC6A 1NGCA 1BO5O 3MCPA 3VF2A 3UKRB 2A41A 4FWLA 4HTLA 4IO8A 2CGKA 2EWSA 4BRCA 4BG9A 1GLBG 3JS6A 2D4WA 4XH5A 5AQXA 4B1WB 4FPAA 2ASOA 3SLCA 2QW9A 2P9UB 2W41A 4DCHA 4H0YB 1U2VB 3AY9A 4BC5A 3O08A 4LC9B 4M7XA 4FSVA 3A5LC 3O4WA 3D2EA 4B9QA 3L6QA 3MK6A 5JICA 4BC2A 4BRGA 3VETA 3DAWA 2Q1NA 1E4FT 2P9IB 4CZFA 4PKGA 2GEMA 2P9PA 3QMLA 1MWKA 4MLHA 4FWMA 2PBDA 3CHWA 5ADXA 4RCHA 4JNEA 5AQJA 4B1VA 3W0LA 4CI6A 4YDUA 3EN9A 3AAPA 3LDNA 4H0XB 2ZGYA 2E2NA 3CJCA 1ATRA 4L3QA 3VGKA 3VEXA 3D2FA 1X3MA 2FF3B 4WQ4C 2CGJA 3GOIA 4H0PA 2E1YA 3MN7A 1NGAA 4NB4A 4DB3A 4GNIA 4JHDB 4RTFD 3IFRA 4A61A 1RDWX 3MN6A 2VCPA 3R9PA 3WT0A 4XH4A 1GLEG 5AZIA 1KAYA 3DJCA 3ULEB 5AQIA 4MLEA 3JXUA 1C0FA 1HLUA 2FXUA 4QS9A 1HKGA 4JD2A 2H3GX 2A3ZA 1MA9B 1MWMA 2W40A 1NGBA 5BN9A 1Z05A 2IVPA 3EKUA 3MN5A 3CQXA 4QS7A 4BQLA 1K8KB 5AQZA 3LDPA 4BR5A 1NGFA 3M3ZA 3UB5A 2GTDA 4A2AA 4CZEA 3GG4A 1SAZA 2HF3A 4FWOA 4O8KA 2YHXA 4H0VB 1HUXA 4CZGA 5AZJA 1SZ2A 1V4TA 3ZETB 3A8YA 3FE1A 4BGAA 5AQNA 1GLLO 4E1JA 2GWKA 2P9PB 5B8HA 5JMVA 2QWPA 2ASMA 1TUUA 3LDLA 3VGLA 1TUYA 4FWKA 3MN9A 1XC3A 5TKYA 4FWSA 4CBWA 3FR0A 3H3OB 4ISGA 4DHYA 2QWRA 2GUPA 2OANA 3FGUA 4H5VA 3O5BA 3FZKA 2GWJA 2Q0UA 3VF4A 2P9LB 4BC4A 1QHAA 3WQUA 3R8EA 5AFUH 4BR0A 1HKCA 5F0XA 1BUPA 1NLVA 3QBWA 4B1XB 5AR0A 5AZIB 4BR9A 2DPNA 1JCGA 3SK3A 4MO4A 3CQYA 1D4XA 1JCFA 3U4LA 3UE5A 3VENA 2YI1A 2QWOA 3AARA 4I6MA 4H03B 2GELA 3DXKA 1Y64A 4EIAA 3BP8A 4CD3A 1QQOA 3WXIA 1NM1A 4IJAA 4BRPA 4BVPA 2Q2RA 2VWBA 4K41A 1IJJA 1ZXOA 4RWTA 1OKJA 3KVGA 2A6AA 3DXMA 4K25A 1Q18A 5AQVA 5FPNA 2P9SA 3ATVA 4BR7A 2QWMA 3RSEA 4BG8A 3UKUA 1S3XA 5AQQA 3VPZA 1ATSA 1WUAA 3ENHA 3QBXA 3S41A 3CI5A 5AQTA 2E20A 4WQ5C 3LDQA 5JLHA 5FPMA 2HMPA 2P9NA 4FL9A 3O8MA 3I8BA 1MDUB 4CBXA 1ATNA 3AAQA
chains in the Genus database with same CATH superfamily
4JKEA 1TK8A 4F9OA 1QHTA 4BRLA 3KK3A 2HNDA 4CHNA 5AQOA 2A40A 4BWMA 4LF4K 4JKGA 3TPQA 3CMAN 3HM8A 4Z4EA 2Z1IA 2D0CA 3OYEA 4CJRA 1NJXA 3K0SA 4BRMA 3SQ2A 2VGNA 4E72A 5FROA 3M6GA 4CJ7A 3QETA 5AQSA 3WEEA 1KD1O 4OX9K 4CEEA 3B6OA 4MFBA 4Y1DA 5J2PA 3SQ0A 2QWQA 4C23A 2VWJA 5EOYA 3VQPA 3AVKA 3CFOA 3LP1A 2ZE2A 4R79A 3TWHA 1RCHA 3DXKB 4IFVA 3AO5A 3VGMA 2BDPA 3HTVA 4PUOA 4Z4GA 3EE8A 3L4IA 4FLUA 5I9EB 3LPTA 4CEFA 1C6VA 2NLXA 4HHTA 5E26A 4YOWA 4FJJA 3HJFA 3DXMB 3I33A 4ISEA 1ITGA 2ZGZA 3PX0A 3F2KA 3SJJA 4ZTJA 4M42A 2I7PA 3UKUB 2HMIA 3D2EB 1NGJA 1YVUA 1ASWA 3AO4A 3CCJN 1QSLA 4DKWA 1VSHA 4O44A 1U2VA 4IZ9A 5LY3A 2GUIA 3L3VA 1NMDA 4KAZA 1U49A 1TYQA 1LWCA 3MAQA 3DOKA 3VQ9A 5BREA 1Q86O 3K5OA 3OYGA 1BA0A 3ASMA 4RW4A 4B9NA 3FFKB 1HX1A 3ATUA 3P31A 3S9HA 4DTSA 3O3FA 1MU2A 5FLXO 3NH0A 1GOBA 1GLDG 5GAEP 1NKCA 4EP4A 1LOTB 3NH2A 2FBYA 3K59A 3V4IA 1OH6A 4M63C 4YOVA 1KTQA 1RTDA 4JD2B 3F9KA 3E9LA 2ZJQL 1NG9A 3LM9A 1JLQA 3KD5E 1ZBSA 4DSEA 5LJVA 4WE1A 1G99A 1TK5A 2ITGA 3HOSA 1RT6A 1R59O 3TTCA 5AQWA 3K2PA 3ZEUB 1NGEA 1VQ4N 3CJBA 4JI1K 2UU9K 1X3NA 2YHAA 3HI0A 3N4QA 4LH4A 3ENOA 1LAWA 4CF2A 4OLBA 1WOQA 2HVHA 4CHZA 3TTFA 2FC0A 4CJTA 2YHWA 3EL2A 2HHWA 5M1QA 2C1GA 4XIUA 4ILGB 4WFAL 5BRHA 3CM5A 4IOXA 4C8KA 3PO4A 2ASPA 4FW1A 4YORA 3ZETA 3BF3A 2OZSA 4DR3K 1NK7A 1U6ZA 1D9FA 3OYJA 3CERA 2VG7A 2Q36A 4DTXA 4FVMA 4DQPA 4K0KK 3EKSA 1D9DA 3P5JA 1IBMK 4R5PA 1S1WA 3VEVA 3VEZA 3OYCA 4PKHA 4FOEA 4DS4A 4NCBA 3O1WA 1NJIO 1C0GA 4FM0A 2NRWA 3BF1A 4FWPA 3K5LA 3TARA 5FDLA 1OH5A 1VQMN 4ZTFA 3NDKA 4KTZA 3CMEN 4CERA 4CJPA 3THXB 5EX5A 1RT7A 4TSXA 4B8AB 3QEXA 3NBPA 4DFMA 3HVTA 4JAXA 3J7ZO 2XHBA 3PIPL 4DV2K 1GLAG 1BIUA 4LF6K 3CJ1A 3FLCO 5LL6Z 2XY8A 2WUSA 4JK7A 1WSHA 3NCIA 2X6NA 4X65K 3L2UA 4KHQA 4OPHA 3O6WA 4BR2A 4J8FA 4DR6K 3NGIA 3AA2A 2ZQBA 4BRAA 4CZKA 1T05A 1GLCG 2GX9A 4XEIA 5CE3A 3CCMN 5E84A 4CK1A 3K9JA 3SBGA 4N56A 5KQ8A 1G15A 3UIQA 5ELZA 3PIOL 2NRVA 3C6HA 5AQHA 2F9WA 1YTAA 3LZIA 3AVHA 1W9HA 1HNIA 3EZ5A 4ELVA 3CPEA 1N33K 2E88A 3SUOA 2E6MA 2QWLA 4KI6A 1KAZA 1KLMA 3KK2A 3MMVA 4M7YA 4A2BA 3OBYA 3U9DA 5J2MA 1HQEA 3GE1A 3I8DA 4H5WA 4GY2B 3O80A 2X74A 3RTVA 5BPLA 3OYBA 5JENA 1X9JA 2F4VK 3WUHA 3QESA 2E2QA 2YJFA 4CFDA 2EX3A 3VQBA 3OA9A 4IEEA 4OKJA 2A41A 1XWLA 3G0ZA 1K6YA 4XH5A 2UUBK 2Z1HA 1S1VA 3AY9A 4BC5A 4OO1J 5HL7L 5CZ1A 1VSDA 3SCXA 2YKMA 3O4WA 3D2EA 1NK6A 1VQLN 2OPQA 3MK6A 1VRUA 1JLAA 3VETA 2Q1NA 3A2FA 3CD6N 4MLHA 1N32K 3VA3A 5AQJA 4FZZA 1NOYA 4CI6A 3CC2N 2ZD1A 2ZGYA 3HVRA 3CJCA 4CEZA 1X3MA 4WQ4C 2CGJA 1NK4A 3GOIA 2RKIA 3ZSOA 3MN7A 3AVLA 4OKEA 4RTFD 2RE2A 1TV6A 4BE2A 2XY6A 3MN6A 2VCPA 3KK7A 3R9PA 4O5BA 5AZIA 3KLGA 4E7KA 3HYFA 4BWJA 2HHXA 1C0MA 3I0SA 1KSPA 4X64K 3JXUA 4JD2A 4CF9A 4FXDA 4H8KA 4B9SA 1MA9B 1MWMA 2WFBA 4K8ZA 1D5AA 2O8EB 4DQIA 2IVPA 3EKUA 4PQUA 3AVJA 4RW8A 3G4SN 5AQZA 1YJ9N 1VSKA 2GTDA 4I7FA 3GG4A 4CJFA 4ID1A 3IRXA 2HF3A 4FWOA 3T7ZA 3NF8A 1HUXA 5E41A 1V4TA 3VQ8A 2VG5A 4BGAA 4KTWA 4Q5VA 1GLLO 1QQCA 3L2VA 4FJ8A 5JVGL 5B8HA 5CZ2A 4C1NK 1K73O 3VGLA 1TUUA 1TKXA 4FWKA 2QK9A 1KQSM 1RTIA 3ENBA 1YIJN 4CBWA 3VQ4A 2Y1JA 3LAKA 2OANA 3FZKA 1RT3A 3G6EN 2NRTA 2KQ2A 4OPKA 1N34K 2C1IA 5AFUH 4BR0A 3V9UA 4CEBA 2BANA 4DTRA 1VQ5N 1L3SA 1YHQN 1KLNA 5AR0A 3AA5X 1IO2A 4JI2K 3ZSWA 4BR9A 4CW7B 2DPNA 1NK9A 3U4LA 2QWOA 1NK8A 1NNEA 1VQNN 3EEQA 4KV8A 1K8AO 2OTJN 3BP8A 1QQOA 3O4QA 4I2QA 1VAZA 4IJAA 2VWBA 3G71N 2FBVA 4O4GA 3LZJA 4XJXA 1DLOA 1Q18A 5AQVA 2P9SA 3ATVA 5M1OA 2QWMA 4CEQA 1S3XA 4GVMA 3VPZA 3ZT0A 1ATSA 3VQ5A 4IOAL 1WBBA 1CXQA 3ENHA 5J2QA 3CI5A 4CJUA 1IKXA 1KRPA 3I56N 5FPMA 2P9NA 1Q81O 1X9WA 4CBXA 1ATNA 3AAQA 4FLTA 4AHVA 2KW4A 1SKRA 5GIPA 2B4JA 3LDOA 5AQMA 1BU6O 1S22A 1YF5L 4DQ8A 2HSTA 2D0PA 4FJHA 3QB0A 4IEIA 4IFYA 4Z94A 2Q0RA 3M8PA 1C0TA 4DTUA 3A5NC 4BRDA 1IV0A 4FM2A 2QXLA 1QS4A 2Q97A 1JLEA 1HRHA 1HKBA 3CG7A 1N5YA 1RDAA 4W5TA 4NCGA 4CJ3A 3OW2M 3VESA 1UA0A 3IUCA 2O4GA 1QZ5A 4WQ5A 1SL2A 4BROA 4RG8A 3NF7A 4BY9C 1NGIA 3PSIA 4A62A 4DTJA 2R7YA 3RRGA 1JXEA 1KVAA 4G1QA 2IAJA 1XUPO 2KZZA 4WQ4A 4B8CA 1NKBA 2PY5A 2GV9A 4CF0A 5BN8A 3JYTA 4JK9A 4IKFA 3AVAA 3IKMA 3TU5A 2ITMA 5BRDA 1XMOK 3H1VX 5HRSA 3AO1A 3CM6A 3VMFB 1O1WA 1TKDA 5GIOA 1S6PA 4OGCA 5C25A 4EHUA 4CIEA 4B9MA 3QFPA 1HNWK 4J2DA 3NGYA 3VQQA 3CETA 1ZBUA 4PA1A 4DQRA 3IS9A 3O9QA 4BE0A 5FPDA 3TAQA 2O8FA 3MWTA 3LWLA 3M5RA 2YKNA 4HWIA 1L5UA 4JI8K 4IXCA 3TAPA 1SUQA 3BEXA 3ZLJA 2HHTA 1HYVA 2PZSA 4KKOA 2FSNA 4A57A 4CEAA 1NGDA 3V9ZA 3P1GA 2E2OA 1QZ6A 3FZLA 3AVCA 4PL8A 3HBTA 3HZ6A 4EP5A 4KB0A 3AVIA 3ID6A 2V52B 3NE6A 5FPEA 3KLFA 3C7NA 1JCEA 4CJ4A 2ZWHA 1YAGA 1YT3A 2O8EA 1CZAN 4V19S 3SJHA 1KVBA 2HBJA 4B9VA 3O1BA 3GL1A 3KHYA 4Z4IA 4W5RA 2P9KB 5AJ3K 3VEOA 1RDUA 3BUZB 3TABA 4KBOA 2D0OA 3JSMA 2CGLA 3U6FA 4AQYK 1ZBLA 3O3GA 2HVIA 1DGKN 4KHPK 1QQNA 1EETA 3AGRA 1J9AA 5AQUA 4JI3K 1IG9A 1LCUA 4A5BA 5DM6L 4H5RA 3QFUA 4JI5K 2G8HA 4CFCA 4QCLA 5AQKA 2G8VA 1HJRA 1GOAA 5LMUK 2XO7A 1IG8A 1YITN 3TSQA 3DRPA 1J5EK 2DFEA 3DLLL 2E2PA 3G10A 4GKJK 4BRQA 3KLIA 2VQEK 1RBVA 4ELUA 3KKRA 4IG3A 4LF7K 4YY3K 5FRNA 3HK2A 1W0HA 3QEPA 4M41A 2E6LA 4BR4A 5HOOA 2F7TA 1I3AA 4CGIA 5AQPA 1NJWA 4U67L 4JS4A 4E3SA 3C6TA 1YVNA 1UAXA 2EHGA 3B8AX 2O8CA 3BY5A 1HMVA 2VQFK 2P9UA 4FJNA 5J1EA 3SAHA 3OYDA 1WAFA 3IDHA 3U9ZA 4CIGA 3SMSA 2DFFA 3ZX3A 3T1HK 1KFDA 4JRPA 1GLJO 4KHYA 3F5TA 1H1VA 3C95A 5ADXH 1RNHA 1S1XA 2P9IA 1E3MA 2CH5A 4BRFA 4N47A 4FVUA 4G9ZA 3EYZA 3MXMA 4AH9A 2P5OA 5I3UA 3ZT4A 3E9OA 4ID5A 3V9SA 2HHHK 3D0PA 3A5OC 3FZHA 1J54A 2NRXA 4FWRA 4B1UB 1BWFO 4O5FA 4GV6A 4BDPA 1M1KO 4IJNA 1RGIA 5DMRA 4HVJA 4M3TA 1BCOA 4EAHD 2QWNA 4B3TK 2HOEA 1QQMA 3DWLA 5F1XA 1KXPA 3W3DA 3PUFA 2E4LA 2W6KA 2KTQA 4YHHK 2E5LK 2O8BB 4NO7A 5KGWA 5KQDA 4KHNA 1Q9XA 2X78A 1FXXA 1E4GT 3R1XA 1NGCA 1BO5O 2G8WA 3MCPA 4MDBA 3VF2A 3UKRB 3HOTA 3DLRA 2CGKA 3I55N 1X9MA 4LF8K 1VSIA 2D4WA 4B1WB 4RW9A 4FPAA 2ASOA 4DCHA 2W41A 2X6SA 4H0YB 1EWRA 1J53A 1HYSA 3O08A 1YI2N 2JWKA 3CPWM 2ATQA 1WSIA 4FSVA 3CCVN 4DUYK 4EZ9A 1TKTA 3L3UA 4BC2A 4BRGA 3LANA 4JS5A 2P9PA 3LP2A 2PBDA 2NUBA 4RCHA 1LWEA 4JNEA 4M3WA 4FJIA 4M3XA 1BCMA 3LDNA 2JWLA 2G8KA 2E2NA 4BDYA 4L3QA 3VGKA 4FZXC 3OS2A 4C8OA 4MDAA 3SUQA 2E1YA 4NCAA 1RTHA 2HBKA 3IFRA 4A61A 1RDWX 4GMJB 5DM7L 4IBNA 3TTDA 1A5XA 5GADP 2YNGA 4XH4A 1GLEG 3CF5L 5HLFA 1KAYA 3DJCA 3OJSA 4JI7K 3THYA 4CGFA 1RT4A 3NVKA 2HHIA 4ILHA 4MQ3A 5M1PA 1QTMA 3CQXA 3DLEA 3LP0A 1K8KB 4BR5A 4JK8A 4IFEA 2HW3A 3HRGA 4A2AA 1TAUA 1NOZA 3BDPA 1RT1A 4M3UA 1SAZA 3OYMA 4CECA 4HUGA 2G8FA 3NFAA 4CZGA 2YNIA 1WB9A 4DTNA 3A8YA 2GWKA 3KK1A 1XI1A 3SBTA 4CCHA 5FRMA 2ASMA 1TUYA 4DMNA 4Y1CA 4CVNE 3RMCA 1W7AA 4CESA 4K8XA 1XMQK 3FR0A 4DHYA 5C2DA 5HROA 2GUPA 1HNZK 4H5VA 3O5BA 3OS0A 3ZSQA 2GWJA 2KZMA 2Q0UA 1KC8O 1K9MO 3SQ4A 2P9LB 4GW6A 1RDDA 4OPAA 3KD1E 3CCEN 1HKCA 3QBWA 3QEIA 1RBTA 4E19A 2Z1JA 1DT9A 3SK3A 2RN2A 4FJKA 3VENA 1D4XA 3T3FA 4B3OA 1S72N 5JS1A 3QIPA 4DV7K 1IBLK 4FK4A 4CHOA 3AARA 2NRRA 4H03B 3DXKA 1R0AA 1WBDA 3LAMA 4CD3A 2I5JA 1NM1A 4BRPA 2VGMA 4M3ZA 1IJJA 4RWTA 3DXMA 4Z0UA 4K25A 1VQ6N 1XC9A 4BR7A 4HUEA 3UKUA 3T69A 4Z4CA 1BI4B 3QO9A 3QBXA 3S41A 4WQ5C 3DI6A 3LDQA 5EU7A 3VQEA 4N5SA 2UUAK 1VQON 3MXJA 3HPOA 2NRZA 1X1PA 2B5JA 5TKWA 5KTQA 1ILYA 4CGGA 4F2SA 3OYKA 4KHWA 2BTFA 3U8XA 5BPMA 4CFBA 2ZM6K 3ZT1A 1HJOA 4JKAA 1S9GA 4BQZA 2VYPA 4FJ7A 4K43A 3CIPA 3VA0A 5EVZA 1VQ9N 2IVOA 2J4RA 2IGIA 3RMBA 3QNOA 3CJ7A 4DSJA 2HHUA 2FF6A 1VHXA 3R6MA 1LW0A 4K42A 1X9SA 4JRQA 5EXWA 1T7PA 2NRHA 4I6MB 3VQCA 1OVQA 1U04A 3V1OA 3SMPA 1N6QA 1OH7A 5KRSA 3GBTA 4F3TA 1M90O 1Q7YO 1REVA 4CJQA 2CH6A 3AVMA 1EWQA 4DR5K 1U48A 3LWMA 5KPZA 2OA8A 3CCLN 4E7JA 3UKRA 3ZEUA 4CJSA 4DU3A 2B6AA 4KH6A 3VERA 3VQDA 4CF1A 4BE7B 3T1AA 4DSKA 2A42A 2DY4A 4CEOA 3N4PA 3OS1A 1BA1A 5HRPA 4JKHA 4WCEL 1SL1A 3ZSVA 2D1KA 4JKFA 1JLBA 5JVHL 5BRFA 4E1MA 3J7YP 1NJYA 5KI6A 2IOCA 4WYBA 5CR4A 4CGHA 1TGOA 4ISFA 4H5NA 3PV8A 4CHYA 2FBTA 1NBWA 2HHSA 4FJ9A 3AA3A 5HRNA 4QOZB 1XHXA 3V1QA 4B3SK 2O4IA 1LAVA 3CFPA 2ZJRL 2UUCK 3WEEB 4H0TB 3B6PA 3S3NA 2HF4A 3KZBA 3CJ9A 3J81O 2YJEA 1J6ZA 2FSJA 3RR8A 1JKHA 5BPNA 4NYNA 2JLEA 1KAXA 4FWQA 3WXJA 3PLAA 4O0IA 3TSUA 3E9PA 3WNFA 4YDUC 3SV3A 1BISA 4DUZK 4CFAA 4JYAK 3THXA 3OJUA 4DU4A 4CHQA 1C1AA 2UXBK 3EZWA 2A5XA 3D45A 3ISNC 1FK9A 4WFNL 3RR7A 1EQYA 3BZCA 4X62K 5C10A 1K8KA 4B08A 3HXMA 3SPYA 4N41A 1VQ8N 4OLAA 4DSFA 3A5MC 3O9TA 3LPUA 3QEWA 5GAGP 3CC7N 3MECA 3TAFA 4JKDA 1BDGA 3KTQA 1VSLA 4C8MA 1TYQB 3DYAA 4FOIA 2YHBA 3L2WA 2QXFA 3MDQA 2HNZA 3WXLA 1Z6RA 4H5TA 3EE9A 1SKSA 1IBKK 4DLEA 1ZBIA 3MEEA 3AV9A 3V1RA 2UYTA 3NMUA 4F3OA 4QS8A 1L3TA 3WNGA 1T6CA 4BRHA 4KRFA 1T44A 4CZMA 1DTTA 3QICA 4DV4K 1L3UA 5IWAK 1DKGD 3SQ1A 1WAJA 4EHTA 3IMXA 4BRKA 1NKEA 4YFUA 2P9LA 3SV4A 2Q3SA 1NJZA 3SUPA 4ZHRA 3V81A 4FPBA 4FCYA 2IVNA 2XRIA 3H1QA 1U45A 3NVMA 3E01A 4CD1A 1IH7A 3KWIA 3U3GA 2F8SA 3NF6A 3FZFA 4IOCL 5M1FA 5KPRA 2A1RA 2YHYA 4LY7A 5SZTA 1ESVA 1WSJA 1BOTO 2JGUA 4DSLA 4I9QA 4Z4HA 1HNVA 4DR1K 4FLWA 4N76A 3S5TA 2AP1A 1C1BA 4FWNA 5AQLA 3H46O 4J2EA 4W5OA 2HHQA 3G25A 3VEYA 4W5QA 4FK2A 4B1YB 1RT2A 1P8ZA 2RPIA 4OPJA 3NGZA 2XY5A 3KJVA 3H3NO 3WXKA 4UQGA 3RMAA 4B9UA 4LSLA 2FLOA 3MWPA 3K5MA 5SWMA 3NAEA 4JKBA 4FM1A 2ZF5O 1CZ9A 1JL1A 2FSKA 1TAQA 3HP6A 5LJWA 4UY8O 3SAFA 3ALYA 5EY4A 1SQKA 2V7YA 2UXDK 2UXCK 3VEWA 3T1YK 5BR8K 5F2RA 1VQKN 1JJ2M 4CF8A 3ULDA 4BREA 3TAEA 4DLGA 4B3RK 4DV6K 4FO0A 3O9UA 4BE1A 2HHVA 2VG6A 4PWDA 4JI0K 4FWLA 5KGXA 4IO8A 3IAYA 2EWSA 4BG9A 1GLBG 2D5RA 3KLEA 1FW6A 4RW6A 2F96A 3C94A 1LV5A 3KIOA 4LC9B 1I39A 4B3MK 3KLHA 3QINA 3LDSA 4HCBA 1E4FT 4CZFA 1ASUA 2GEMA 1MWKA 1RT5A 4DFJA 4FWMA 3CHWA 2G8UA 4DSIA 1QSYA 2WONA 3OYLA 4YDUA 3AAPA 1VQ7N 3CCUN 5M1NA 4H0XB 3MEDA 3L4QA 4NLCA 1I94K 2OZMA 5CHIA 1XNRK 3WXMB 1C0UA 4NB4A 2KKZA 4JHDB 2OCEA 4FZYA 1S6QA 4KH4A 4LD0A 2RF2A 3HL8A 5IT9O 2O8DB 1BGXT 3WT0A 4BDZA 4KH5A 1TVRA 4LH5A 3ULEB 5AQIA 4MLEA 1OH8A 3OTOK 1W97L 2IC3A 1C0FA 3Q7BA 4B9TA 3LP3A 2FXUA 3C6UA 1HKGA 4CGDA 4DU1A 1NGBA 5BN9A 3QIOA 3THVA 4QS7A 4BQLA 5H1SQ 4JI4K 1WSEA 3LDPA 1D8YA 2P5GA 1UOCA 4JV5K 1BQMA 4FJLA 4WFBL 3THWB 4O8KA 4E0DA 3ITHA 1SZ2A 4DTOA 3SPZA 3ZT3A 4E1JA 1CXUA 3ZCMA 5JMVA 2YV0X 3K57A 2OTLN 4CJEA 3CYGA 4AF1A 3MN9A 3T19A 4FWSA 4KTQA 3EY1A 3K9KA 4ISGA 2QWRA 3DLKA 3FGUA 1IKWA 4HUFA 3TAMA 4CK3A 2BGGA 3PX6A 1WLJA 2YNHA 4A59A 3OYIA 1XHZA 3WQUA 3S3OA 3R8EA 5C42A 3PO5A 4EZ6A 5F0XA 1BUPA 3RVCA 3VQ6A 3AO3A 5AZIB 3CCSN 1JCGA 3MX5A 4MO4A 3UE5A 1JCFA 4M3YA 4IDHA 4LFCK 3HPGA 2FBXA 1F21A 1EP4A 4BVPA 4K41A 4E89A 1ZXOA 4W5NA 3KVGA 2A6AA 4F8RA 3K5NA 4X66K 1O13A 4AHSA 5FPNA 1RDCA 1J5OA 4BG8A 3O9RA 4JLHA 4AHUA 2XY7A 1JXBA 5AQQA 4CJLA 2GBZA 4BEBA 3L2RA 1WUAA 4CK2A 4YNQA 5MLCQ 3TR8A 5AQTA 2E20A 5JLHA 1HQUA 5HP1A 4BECA 2HMPA 3CYMA 1WSGA 4LFBK 4LSNA 3OBWA 4BC3A 5GINA 3H45C 3J8AA 5C24A 4AM6A 3NHGA 1BL3A 4JN4A 3QERA 2IIRA 2V51B 2Y1IA 3HP9A 2NZTA 1GLFO 4OVLA 5C2FA 1N36K 4FYDA 1YUWA 2F9TA 2E8AA 2KFNA 2HBMA 3F9MA 3VN5A 5AFUA 1HPMA 2DFHA 3M8SA 1W2BM 1Z26A 2VWKA 4AILC 3AO2A 1VRTA 1QE1A 1EX4A 3ZSZA 3LALA 2A1SA 5AQGA 3L0QA 3SI6A 3TAGA 3J80O 1JLGA 4E1NA 2Z1GA 2BH1A 4DS5A 4L8RB 1RBRA 1RFQA 2P9SB 2IS3A 3CCRN 4CZIA 4MO5A 5A2QO 3DLBA 1WN7A 3P38A 4M45A 3A0IX 4CJVA 4HTUA 4OGEA 1TK0A 1RTJA 1NGHA 2OPSA 2P9NB 2P9KA 4OJRA 1UWBA 3V9XA 3AVFA 3CCQN 2QA4N 2OPRA 4DR2K 3QLHA 4CJKA 4C8LA 5C15A 1VK0A 4FJXA 3D2FB 3WQTA 2ZJPL 3SNNA 4WF9L 2G8IA 1NWKA 4ICLA 1Q82O 4DV3K 5CY4A 3M1FA 1YTUA 3S3MA 4CHPA 3ZSRA 4I2PA 1JL2A 3C0BA 1TL3A 5T7BA 4DV0K 4KHUA 3ZX0A 1KCFA 1A5WA 4NLBA 1HYZA 1RBSA 3MCAB 4KFBA 3OY9A 2BUPA 4PL7A 1RILA 2WOMA 4JHDA 4CBUA 2WBNA 3E1YA 4BACA 1VSEA 4E7IA 3Q7CA 1Q8IA 2O8DA 4IWVA 3ULEA 4O8UA 1DEJA 4PKIA 2AA4A 4GV9A 3FZMA 4AHTA 3OYNA 4DR4K 3AVGA 3ID8A 3M8RA 1L3VA 3VOVA 3D7EO 3ZSXA 3U3YA 4FJ5A 1RDBA 4NXMK 5JLFA 1NK5A 5AQFA 5AZJB 4CEDA 3F73A 2PFUA 2V7ZA 1YXQA 1XQSC 2P51A 5C0YA 4O55A 3RWUA 3VTIA 1T6DA 3SUNA 1YJNN 3THWA 3QDKA 3J7AP 2F8TA 1BIZA 2PYLA 3MEGA 1P90A 3BZKA 1IKYA 4DF8A 3NH1A 3VF6A 2LSNA 3ZX2A 5AQRA 4B1ZA 3LL3A 4PHTX 1S5JA 1BHLA 3CQ8A 3MXIA 4CZLA 2YCHA 2Q31A 1NGGA 4C1NI 4FLXA 2O8FB 1DTQA 5BR9A 3WNHA 4HCCA 4DF4A 5KPTA 3CC4N 4XH1A 4DQSA 3DM2A 4DQQA 2PAVA 2QI2A 3HSTB 2QTDA 3AVNA 2QKKA 3DOLA 2O8BA 1LW2A 4IO9L 1BG3A 4F4KA 4CZJA 3HM9A 5I42A 4AM7A 3RSEB 1KFSA 3KWGA 4JI6K 3C7NB 2HB5A 1NK0A 2YNFA 4Y0WA 4CGJA 2OYQA 3SAGA 2HNYA 3IG1A 2KHOA 4BVOA 2AJQA 4YOXA 4FJMA 4FLYA 1VSMA 3OHRA 4H0OA 1V4SA 1Z25A 3BGRA 3AGKA 4AHCA 1CZBA 1EO1A 1T03A 3C6AA 4JKGB 4KO0A 3HSCA 1VQPN 3R3LA 4BRIA 4OKKA 4LF9K 1S1UA 2RHKA 2NNWA 3LM2A 3P39A 3EO3A 2QM1A 2QKBA 3CJAA 4B9LA 4KREA 1T3VA 4DFPA 1HNXK 5JS2A 4CJ5A 4FK0A 3GDQA 4CZHA 4BRNA 1FKPA 5LMNK 4DTMA 3AVBA 5AQYA 3NF9A 3RRHA 3O3HA 4DR7K 4H4MA 4PY5A 3ZSYA 1IKVA 3L2QA 1JLFA 3I0RA 4BGBA 2P1JA 1HPZA 4U7BA 4DV5K 3H6EA 4LF5K 4EFHA 3QNNA 2I7NA 2E1ZA 4GV3A 3P4IA 1NMNA 4YOYA 1ZC6A 4C8NA 4FW2A 1ZBFA 1BQNA 4HTLA 4BRCA 2D0AA 3JS6A 5AQXA 1SV5A 2O8CB 5KRTA 3SLCA 2QW9A 2P9UB 1OVYA 1U2VB 4FLZA 4KPYA 1NU0A 1QSSA 3WNEA 1YJWN 4M7XA 2WC9A 3A5LC 4B9QA 5M1KA 3L6QA 5JICA 3QEVA 1SKWA 3DAWA 3CFRA 2P9IB 4KHSA 4PKGA 4DG1A 3QMLA 3FFIA 1SS6A 3MX2A 5ADXA 4RW7A 4B1VA 1TL1A 3W0LA 1ZYQA 3EN9A 2WTUA 1Y97A 1KVCA 4CJWA 3ZYYX 1ATRA 3TSPA 3VEXA 3D2FA 2FF3B 4DWIA 4DV1K 4H0PA 1WSFA 4IG0A 1NGAA 4FLVA 4O0JA 4DB3A 4GNIA 4JKCA 3DRSA 1QVGM 1B9FA 1FKOA 4FJGA 3RMDA 4YOUA 1C1CA 1CLQA 2QEXN 3OYAA 3CXCM 1JLCA 1HLUA 1EKEA 3L8BA 4QS9A 4H4OA 2HBLA 2H3GX 2A3ZA 2W40A 1XNQK 3SZ2A 1A5VA 3KKSA 1Z05A 4DTPA 3VQ7A 4J2BA 3MN5A 3PX4A 1U47A 3VTHA 2W42A 1N8RO 4KI4A 4Z4FA 1NGFA 3M3ZA 2D0BA 4ILJA 3UB5A 5J2NA 1Q9YA 1FJGK 1U4BA 4CZEA 3K58A 4IDKA 4J2AA 1WNSA 1VSJA 4I9LA 3V9WA 1BI4A 4A5AA 1SL0A 4QAGA 2YHXA 4H0VB 5HBMA 2OPPA 5AZJA 4NXNK 3ZETB 3FE1A 3C65A 5AQNA 3HPHA 2P9PB 4Q0BA 1LWFA 2QWPA 4LFAK 5CYQA 3O9SA 3LDLA 1RBUA 4CE9A 1EXQA 1XC3A 4E7HA 3HT3A 5TKYA 3P83D 1B9DA 3H3OB 2W00A 4JEPA 4ELTA 1B92A 3V6DA 3TI0A 3PY8A 3VF4A 1ASVA 4BC4A 1UA1A 1QHAA 4E7LA 4YOTA 1ZBHA 4B1XB 1NLVA 3DMJA 3E66A 5K14A 2IDOA 2BE2A 1VSFA 3CQYA 1GOCA 2YI1A 4NYFA 4GKKK 3SYZA 3OVNA 3JAMO 3THYB 1QVFM 4I6MA 3OYFA 4KB1A 2ETJA 2GELA 3AA4A 1Y64A 1TKZA 3DRRA 3ZT2A 4EIAA 1HR0K 3WXIA 1S1TA 5GAHP 2Q2RA 4GVEA 3D6RA 1T8EA 2PYJA 3PSFA 4M3RA 1OKJA 3O4NA 4F2RA 4AHRA 2KLAA 3VQAA 4CIFA 3RSEA 5C12A 3H08A 3M8QA 5DK5A 3DLGA 2KFZA 3DLHA 5D3GA 2DTUA 1S9EA 3OYHA 5CYMA 3HO1A 3TANA 4FL9A 3O8MA 2YX6A 3I8BA 5HRRA 4DFKA 1MDUB 2W6LA
chains in the Genus database with same CATH topology
4JKEA 4F9OA 5GIPA 2BTFA 4BRLA 3LDOA 5AQMA 1BU6O 3U8XA 1S22A 1YF5L 5AQOA 2A40A 2HSTA 2D0PA 3OBWA 4BC3A 4DQ8A 4JKGA 5BPMA 3TPQA 3QB0A 4IEIA 5GINA 3HM8A 3CMAN 4Z94A 1HJOA 3H45C 4JKAA 2Q0RA 4BQZA 3J8AA 2VYPA 4AM6A 3A5NC 4BRMA 2VGNA 4JN4A 4BRDA 2IIRA 2V51B 2NZTA 1GLFO 2QXLA 3CIPA 3M6GA 4K43A 2Q97A 5EVZA 4CJ7A 5C2FA 5AQSA 1HKBA 1YUWA 2F9TA 1VQ9N 2E8AA 2IVOA 2J4RA 3WEEA 1KD1O 2HBMA 3CJ7A 3F9MA 5AFUA 2FF6A 2QWQA 3R6MA 1HPMA 4C23A 1W2BM 4K42A 3OW2M 3VESA 5EOYA 5EXWA 2NRHA 3IUCA 4R79A 4I6MB 1QZ5A 3DXKB 4WQ5A 3VGMA 5AQGA 3HTVA 4BROA 3EE8A 3L0QA 3L4IA 3SMPA 5I9EB 3GBTA 2NLXA 1M90O 1Q7YO 2CH6A 5E26A 4YOWA 4BY9C 1NGIA 3DXMB 4A62A 2BH1A 3I33A 4ISEA 2ZGZA 1RFQA 3F2KA 5KPZA 2P9SB 3CCLN 1XUPO 3CCRN 2I7PA 3UKUB 4WQ4A 4MO5A 3D2EB 3UKRA 3ZEUA 4CZIA 1NGJA 4KH6A 3CCJN 3VERA 3P38A 5BN8A 4DKWA 4JK9A 4BE7B 2A42A 3A0IX 3IKMA 1NGHA 3N4PA 1U2VA 1BA1A 4IZ9A 3TU5A 5LY3A 2ITMA 5BRDA 3H1VX 1NMDA 2P9NB 2P9KA 4JKHA 4WCEL 2D1KA 4JKFA 5JVHL 1TYQA 3CCQN 5BRFA 2QA4N 4WYBA 5C15A 3VMFB 3D2FB 3WQTA 5CR4A 5BREA 1Q86O 2ZJPL 1BA0A 4WF9L 5GIOA 1NWKA 1Q82O 3FFKB 1HX1A 4EHUA 3ATUA 3M1FA 4ISFA 4H5NA 3P31A 3QFPA 3C0BA 1NBWA 3CETA 3O9QA 5FPDA 1GLDG 3ZX0A 5GAEP 4NLBA 1LOTB 3MCAB 3MWTA 2BUPA 2ZJRL 3M5RA 3WEEB 4PL7A 4H0TB 4HWIA 2HF4A 3KZBA 3CJ9A 4IXCA 3BEXA 2YJEA 4JHDA 4CBUA 2WBNA 1J6ZA 2FSJA 3E1YA 4M63C 4YOVA 4JD2B 5BPNA 2FSNA 1KAXA 3E9LA 4FWQA 3WXJA 4A57A 1NGDA 3Q7CA 2ZJQL 3PLAA 3TSUA 3E9PA 3LM9A 4YDUC 2E2OA 1QZ6A 3FZLA 4IWVA 1ZBSA 3ULEA 4PL8A 3HBTA 4O8UA 3HZ6A 1DEJA 4PKIA 2AA4A 5LJVA 4GV9A 3ID6A 1G99A 2V52B 3FZMA 5FPEA 3ID8A 3HOSA 3VOVA 3D7EO 1R59O 3EZWA 3TTCA 3C7NA 2A5XA 1JCEA 5AQWA 4WFNL 2ZWHA 1EQYA 1YAGA 1CZAN 3ZEUB 5C10A 5JLFA 1NGEA 5AQFA 3CJBA 1VQ4N 5AZJB 1K8KA 1X3NA 2PFUA 3HI0A 2V7ZA 1YXQA 3N4QA 1VQ8N 3SJHA 1XQSC 3A5MC 3ENOA 3O9TA 1WOQA 2HBJA 5C0YA 3TTFA 5GAGP 3O1BA 3GL1A 3KHYA 2YHWA 3CC7N 3EL2A 2C1GA 5M1QA 1T6DA 3VTIA 1YJNN 4ILGB 2P9KB 4JKDA 4WFAL 3VEOA 1BDGA 1RDUA 5BRHA 1TYQB 4IOXA 3BUZB 3QDKA 2D0OA 4FOIA 4KBOA 2ASPA 4YORA 3MDQA 3ZETA 2CGLA 3BF3A 1P90A 3WXLA 1Z6RA 4H5TA 1U6ZA 3EE9A 3CERA 2UYTA 3NMUA 4QS8A 3VF6A 2Q36A 3ZX2A 1DGKN 1QQNA 5AQRA 4B1ZA 3LL3A 1T6CA 4PHTX 3AGRA 3EKSA 5AQUA 4BRHA 1T44A 1LCUA 4CZLA 2YCHA 2Q31A 1NGGA 4A5BA 4C1NI 3QICA 3QFUA 4H5RA 4CZMA 5DM6L 3VEVA 5AQKA 3VEZA 1DKGD 4PKHA 4FOEA 1IG8A 5BR9A 3TSQA 1YITN 4EHTA 3IMXA 3O1WA 5KPTA 1NJIO 4BRKA 3CC4N 4XH1A 2P9LA 3DLLL 1C0GA 2E2PA 2PAVA 2QI2A 2QTDA 4BRQA 4FPBA 2IVNA 3H1QA 3NVMA 2NRWA 3BF1A 4FWPA 4CD1A 4IO9L 1BG3A 1VQMN 3KWIA 4CZJA 4BR4A 5HOOA 3CMEN 3FZFA 4IOCL 5EX5A 2F7TA 4AM7A 3RSEB 5M1FA 3KWGA 5KPRA 3C7NB 5AQPA 2YHYA 4U67L 4JAXA 1ESVA 3J7ZO 1YVNA 3PIPL 4Y0WA 1BOTO 3B8AX 3SAGA 2P9UA 1GLAG 2KHOA 4BVOA 4YOXA 3SAHA 3CJ1A 2AP1A 3FLCO 3IDHA 4FWNA 3U9ZA 2WUSA 4JK7A 5AQLA 3SMSA 3OHRA 3H46O 3ZX3A 4H0OA 1GLJO 3G25A 4OPHA 3F5TA 3VEYA 1H1VA 3O6WA 1V4SA 4B1YB 1P8ZA 4BR2A 4J8FA 5ADXH 3AGKA 2P9IA 3H3NO 3WXKA 2CH5A 4BRAA 4BRFA 1EO1A 4CZKA 4FVUA 1GLCG 4G9ZA 2FLOA 2GX9A 3C6AA 3MWPA 4JKGB 3HSCA 4XEIA 5E84A 5CE3A 3CCMN 3R3LA 3K9JA 1VQPN 3SBGA 3E9OA 4BRIA 5KQ8A 4JKBA 2RHKA 2NNWA 3LM2A 2ZF5O 3A5OC 3P39A 3EO3A 2FSKA 2QM1A 5ELZA 3PIOL 2NRVA 3FZHA 3CJAA 3C6HA 5AQHA 5LJWA 4UY8O 2F9WA 1T3VA 3SAFA 5EY4A 1SQKA 2NRXA 2V7YA 4FWRA 4B1UB 3CPEA 1BWFO 3GDQA 4O5FA 4BRNA 4CZHA 4GV6A 5AQYA 1M1KO 3VEWA 4IJNA 1RGIA 2E88A 2QWLA 1KAZA 5F2RA 3MMVA 4M7YA 4A2BA 4EAHD 2QWNA 2HOEA 3OBYA 3U9DA 1QQMA 3GE1A 4BGBA 3DWLA 4H5WA 1VQKN 5F1XA 4GY2B 1JJ2M 1KXPA 3O80A 3W3DA 4U7BA 3H6EA 4BREA 4EFHA 5BPLA 1X9JA 4NO7A 3WUHA 2I7NA 5KQDA 2E1ZA 4GV3A 3P4IA 2E2QA 4FO0A 2YJFA 1E4GT 3R1XA 3O9UA 1ZC6A 1NGCA 4YOYA 1BO5O 3MCPA 4MDBA 3OA9A 3VF2A 4IEEA 3UKRB 3HOTA 2A41A 4FWLA 4HTLA 4IO8A 2CGKA 3I55N 2EWSA 4BRCA 4BG9A 1GLBG 3JS6A 2D4WA 4XH5A 5AQXA 4B1WB 4FPAA 2ASOA 3SLCA 2QW9A 2P9UB 2W41A 4DCHA 1OVYA 4H0YB 1U2VB 3AY9A 4BC5A 4OO1J 3O08A 4LC9B 1YI2N 1YJWN 2JWKA 3CPWM 4M7XA 5HL7L 2WC9A 4FSVA 3A5LC 3O4WA 3D2EA 4B9QA 5M1KA 3CCVN 1VQLN 3L6QA 3MK6A 5JICA 4BC2A 4BRGA 3VETA 2Q1NA 1E4FT 3DAWA 2P9IB 4CZFA 4PKGA 2GEMA 2P9PA 3QMLA 1MWKA 3CD6N 1SS6A 4MLHA 4FWMA 2PBDA 3CHWA 3MX2A 5ADXA 4RCHA 4JNEA 5AQJA 4B1VA 3W0LA 4CI6A 4YDUA 3EN9A 3AAPA 1VQ7N 3CCUN 3LDNA 5M1NA 3CC2N 4H0XB 2ZGYA 2JWLA 3ZYYX 2E2NA 3CJCA 1ATRA 4L3QA 3VGKA 3TSPA 3VEXA 3L4QA 3D2FA 1X3MA 2FF3B 4WQ4C 2CGJA 4NLCA 4MDAA 3GOIA 4H0PA 2E1YA 3MN7A 5CHIA 3WXMB 1NGAA 4NB4A 2KKZA 4DB3A 2HBKA 4GNIA 4JHDB 4RTFD 4JKCA 3IFRA 4A61A 1RDWX 2RE2A 5DM7L 1QVGM 4KH4A 3TTDA 4YOUA 5GADP 3MN6A 2VCPA 3KK7A 3R9PA 3WT0A 4XH4A 1GLEG 5AZIA 3CF5L 4KH5A 1KAYA 3DJCA 3ULEB 2QEXN 5AQIA 4MLEA 3CXCM 1W97L 3JXUA 1C0FA 1HLUA 3Q7BA 3NVKA 2FXUA 4QS9A 1HKGA 4JD2A 2HBLA 2H3GX 2A3ZA 1MA9B 1MWMA 2W40A 2WFBA 4ILHA 1NGBA 5BN9A 5M1PA 1Z05A 2IVPA 3EKUA 3MN5A 3CQXA 4QS7A 3VTHA 1K8KB 4BQLA 5H1SQ 3G4SN 5AQZA 1N8RO 3LDPA 4BR5A 1NGFA 3M3ZA 4JK8A 4IFEA 1YJ9N 4ILJA 2GTDA 3HRGA 3UB5A 4A2AA 4CZEA 3GG4A 1SAZA 2HF3A 4A5AA 4WFBL 4FWOA 3T7ZA 4O8KA 2YHXA 4H0VB 1HUXA 4CZGA 5AZJA 1SZ2A 1V4TA 3ZETB 3A8YA 3FE1A 4BGAA 3C65A 5AQNA 1GLLO 4E1JA 2GWKA 5JVGL 2P9PB 5B8HA 3SBTA 4C1NK 5JMVA 2QWPA 2OTLN 3O9SA 2ASMA 1TUUA 3LDLA 3VGLA 1K73O 1TUYA 4FWKA 4AF1A 3MN9A 1XC3A 1KQSM 5TKYA 3ENBA 1YIJN 4FWSA 4CBWA 3FR0A 3H3OB 3K9KA 4ISGA 4DHYA 5C2DA 2W00A 2QWRA 2GUPA 2OANA 3FGUA 4H5VA 3O5BA 3FZKA 4JEPA 3G6EN 2GWJA 2NRTA 2Q0UA 4A59A 1KC8O 3VF4A 1K9MO 2P9LB 2C1IA 4BC4A 1QHAA 3WQUA 3R8EA 4YOTA 5AFUH 4BR0A 4OPAA 1VQ5N 3CCEN 1HKCA 5F0XA 1BUPA 1NLVA 3QBWA 3RVCA 4B1XB 3E66A 1YHQN 5AR0A 5AZIB 4BR9A 1DT9A 2DPNA 3CCSN 1JCGA 3MX5A 4MO4A 3CQYA 1D4XA 1JCFA 3SK3A 4IDHA 3U4LA 2YI1A 2QWOA 3UE5A 3VENA 1S72N 1VQNN 1QVFM 3AARA 4I6MA 2NRRA 4H03B 2GELA 3DXKA 1K8AO 1Y64A 4EIAA 3BP8A 2OTJN 4CD3A 1QQOA 3WXIA 1NM1A 1VAZA 4IJAA 4BRPA 4BVPA 5GAHP 2Q2RA 2VGMA 2VWBA 4K41A 4GVEA 3G71N 3D6RA 1IJJA 1ZXOA 4RWTA 1OKJA 3KVGA 2A6AA 3DXMA 4XJXA 1O13A 4K25A 1VQ6N 1Q18A 2KLAA 5AQVA 5FPNA 2P9SA 3ATVA 5M1OA 4BR7A 2QWMA 3O9RA 3RSEA 4BG8A 5C12A 3UKUA 1S3XA 5AQQA 3VPZA 4BEBA 3T69A 1ATSA 1WUAA 4IOAL 5MLCQ 3ENHA 3QBXA 3S41A 3CI5A 5AQTA 2E20A 4WQ5C 3LDQA 5JLHA 3I56N 1VQON 5FPMA 4BECA 2HMPA 2NRZA 2P9NA 4FL9A 3O8MA 2YX6A 3I8BA 1Q81O 1MDUB 5TKWA 4CBXA 1ATNA 3AAQA 1ILYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9O A;  2BTF A;  4BRL A;  3LDO A;  5AQM A;  1BU6 O;  3U8X A;  1S22 A;  5AQO A;  2A40 A;  4DQ8 A;  2D0P A;  4BC3 A;  5BPM A;  3TPQ A;  3QB0 A;  3HM8 A;  4Z94 A;  1HJO A;  3H45 C;  2Q0R A;  4BQZ A;  3J8A A;  2VYP A;  4AM6 A;  3A5N C;  4BRM A;  4BRD A;  4JN4 A;  2IIR A;  2V51 B;  2NZT A;  3CIP A;  1GLF O;  2QXL A;  3M6G A;  4K43 A;  2Q97 A;  5EVZ A;  4CJ7 A;  5AQS A;  1HKB A;  1YUW A;  2F9T A;  2E8A A;  2IVO A;  2J4R A;  3WEE A;  3CJ7 A;  3F9M A;  5AFU A;  2FF6 A;  2QWQ A;  3R6M A;  1HPM A;  4C23 A;  4K42 A;  3VES A;  5EOY A;  5EXW A;  2NRH A;  3IUC A;  4I6M B;  1QZ5 A;  3DXK B;  4WQ5 A;  3VGM A;  5AQG A;  3HTV A;  4BRO A;  3L0Q A;  3L4I A;  3SMP A;  5I9E B;  3GBT A;  2NLX A;  2CH6 A;  5E26 A;  1NGI A;  3DXM B;  4A62 A;  3I33 A;  4ISE A;  2ZGZ A;  1RFQ A;  5KPZ A;  2P9S B;  1XUP O;  2I7P A;  3UKU B;  4WQ4 A;  4MO5 A;  3D2E B;  3UKR A;  3ZEU A;  4CZI A;  1NGJ A;  3VER A;  5BN8 A;  2A42 A;  3A0I X;  1NGH A;  3TU5 A;  1U2V A;  1BA1 A;  4IZ9 A;  5LY3 A;  2ITM A;  5BRD A;  3H1V X;  1NMD A;  2P9N B;  2P9K A;  2D1K A;  1TYQ A;  5BRF A;  4WYB A;  3D2F B;  3WQT A;  5BRE A;  1BA0 A;  1NWK A;  3FFK B;  1HX1 A;  4EHU A;  3ATU A;  3M1F A;  4ISF A;  4H5N A;  3QFP A;  3C0B A;  1NBW A;  3CET A;  5FPD A;  1GLD G;  3ZX0 A;  1LOT B;  2BUP A;  3WEE B;  4PL7 A;  4H0T B;  4HWI A;  2HF4 A;  3KZB A;  3CJ9 A;  4IXC A;  3BEX A;  2YJE A;  4JHD A;  4CBU A;  1J6Z A;  2FSJ A;  4M63 C;  4JD2 B;  5BPN A;  2FSN A;  1KAX A;  4FWQ A;  3WXJ A;  1NGD A;  3LM9 A;  4YDU C;  2E2O A;  3FZL A;  1QZ6 A;  4IWV A;  1ZBS A;  3ULE A;  4PL8 A;  3HBT A;  3HZ6 A;  1DEJ A;  4PKI A;  2AA4 A;  5LJV A;  1G99 A;  2V52 B;  3FZM A;  5FPE A;  3ID8 A;  3VOV A;  3D7E O;  1R59 O;  3EZW A;  3C7N A;  2A5X A;  1JCE A;  5AQW A;  2ZWH A;  1EQY A;  1YAG A;  1CZA N;  3ZEU B;  5JLF A;  1NGE A;  5AQF A;  3CJB A;  5AZJ B;  1K8K A;  1X3N A;  3HI0 A;  2V7Z A;  1YXQ A;  3SJH A;  1XQS C;  3A5M C;  3ENO A;  1WOQ A;  3O1B A;  3GL1 A;  3KHY A;  2YHW A;  3EL2 A;  1T6D A;  2P9K B;  3VEO A;  1BDG A;  5BRH A;  1TYQ B;  3BUZ B;  3QDK A;  2D0O A;  4FOI A;  4KBO A;  2ASP A;  3ZET A;  3MDQ A;  2CGL A;  3BF3 A;  3WXL A;  1Z6R A;  4H5T A;  1U6Z A;  3CER A;  2UYT A;  4QS8 A;  3VF6 A;  2Q36 A;  3ZX2 A;  1DGK N;  1QQN A;  5AQR A;  4B1Z A;  3LL3 A;  1T6C A;  5AQU A;  3EKS A;  4BRH A;  1T44 A;  1LCU A;  4CZL A;  2YCH A;  2Q31 A;  1NGG A;  4CZM A;  3QIC A;  3QFU A;  4H5R A;  3VEV A;  5AQK A;  3VEZ A;  1DKG D;  4PKH A;  4FOE A;  1IG8 A;  5BR9 A;  4EHT A;  3IMX A;  3O1W A;  5KPT A;  4BRK A;  4XH1 A;  2P9L A;  1C0G A;  2E2P A;  2PAV A;  4BRQ A;  4FPB A;  2IVN A;  3H1Q A;  3BF1 A;  4FWP A;  4CD1 A;  1BG3 A;  4CZJ A;  4BR4 A;  3FZF A;  5EX5 A;  4AM7 A;  3RSE B;  5KPR A;  3C7N B;  5AQP A;  2YHY A;  4JAX A;  1ESV A;  1YVN A;  4Y0W A;  1BOT O;  3B8A X;  2P9U A;  1GLA G;  2KHO A;  4BVO A;  3CJ1 A;  2AP1 A;  3FLC O;  3IDH A;  4FWN A;  3U9Z A;  2WUS A;  5AQL A;  3SMS A;  3OHR A;  3H46 O;  3ZX3 A;  4H0O A;  1GLJ O;  3G25 A;  3VEY A;  1H1V A;  3O6W A;  1V4S A;  4B1Y B;  1P8Z A;  4BR2 A;  4J8F A;  5ADX H;  2P9I A;  3H3N O;  3WXK A;  2CH5 A;  4BRA A;  4BRF A;  4CZK A;  1GLC G;  2FLO A;  4XEI A;  5CE3 A;  5E84 A;  3HSC A;  4BRI A;  5KQ8 A;  3LM2 A;  2ZF5 O;  3A5O C;  3EO3 A;  2FSK A;  2QM1 A;  5ELZ A;  3FZH A;  3CJA A;  5AQH A;  5LJW A;  2F9W A;  5EY4 A;  1SQK A;  2V7Y A;  4FWR A;  4B1U B;  1BWF O;  3GDQ A;  4O5F A;  4BRN A;  4CZH A;  5AQY A;  3VEW A;  4IJN A;  1RGI A;  2E88 A;  2QWL A;  1KAZ A;  5F2R A;  3MMV A;  4M7Y A;  4A2B A;  4EAH D;  2QWN A;  2HOE A;  3U9D A;  1QQM A;  3GE1 A;  4BGB A;  3DWL A;  4H5W A;  5F1X A;  4GY2 B;  1KXP A;  3O80 A;  3W3D A;  3H6E A;  4BRE A;  4EFH A;  5BPL A;  1X9J A;  4NO7 A;  3WUH A;  2I7N A;  5KQD A;  2E1Z A;  3P4I A;  2E2Q A;  4FO0 A;  2YJF A;  1E4G T;  1ZC6 A;  1NGC A;  1BO5 O;  3MCP A;  3VF2 A;  3UKR B;  2A41 A;  4FWL A;  4HTL A;  4IO8 A;  2CGK A;  2EWS A;  4BRC A;  4BG9 A;  1GLB G;  3JS6 A;  2D4W A;  4XH5 A;  5AQX A;  4B1W B;  4FPA A;  2ASO A;  3SLC A;  2QW9 A;  2P9U B;  2W41 A;  4DCH A;  4H0Y B;  1U2V B;  3AY9 A;  4BC5 A;  3O08 A;  4LC9 B;  4M7X A;  4FSV A;  3A5L C;  3O4W A;  3D2E A;  4B9Q A;  3L6Q A;  3MK6 A;  5JIC A;  4BC2 A;  4BRG A;  3VET A;  3DAW A;  2Q1N A;  1E4F T;  2P9I B;  4CZF A;  4PKG A;  2GEM A;  2P9P A;  3QML A;  1MWK A;  4MLH A;  4FWM A;  2PBD A;  3CHW A;  5ADX A;  4RCH A;  4JNE A;  5AQJ A;  4B1V A;  3W0L A;  4CI6 A;  4YDU A;  3EN9 A;  3AAP A;  3LDN A;  4H0X B;  2ZGY A;  2E2N A;  3CJC A;  1ATR A;  4L3Q A;  3VGK A;  3VEX A;  3D2F A;  1X3M A;  2FF3 B;  4WQ4 C;  2CGJ A;  3GOI A;  4H0P A;  2E1Y A;  3MN7 A;  1NGA A;  4NB4 A;  4DB3 A;  4GNI A;  4JHD B;  4RTF D;  3IFR A;  4A61 A;  1RDW X;  3MN6 A;  2VCP A;  3R9P A;  3WT0 A;  4XH4 A;  1GLE G;  5AZI A;  1KAY A;  3DJC A;  3ULE B;  5AQI A;  4MLE A;  3JXU A;  1C0F A;  1HLU A;  2FXU A;  4QS9 A;  1HKG A;  4JD2 A;  2H3G X;  2A3Z A;  1MA9 B;  1MWM A;  2W40 A;  1NGB A;  5BN9 A;  1Z05 A;  2IVP A;  3EKU A;  3MN5 A;  3CQX A;  4QS7 A;  4BQL A;  1K8K B;  5AQZ A;  3LDP A;  4BR5 A;  1NGF A;  3M3Z A;  3UB5 A;  2GTD A;  4A2A A;  4CZE A;  3GG4 A;  1SAZ A;  2HF3 A;  4FWO A;  4O8K A;  2YHX A;  4H0V B;  1HUX A;  4CZG A;  5AZJ A;  1SZ2 A;  1V4T A;  3ZET B;  3A8Y A;  3FE1 A;  4BGA A;  5AQN A;  1GLL O;  4E1J A;  2GWK A;  2P9P B;  5B8H A;  5JMV A;  2QWP A;  2ASM A;  1TUU A;  3LDL A;  3VGL A;  1TUY A;  4FWK A;  3MN9 A;  1XC3 A;  5TKY A;  4FWS A;  4CBW A;  3FR0 A;  3H3O B;  4ISG A;  4DHY A;  2QWR A;  2GUP A;  2OAN A;  3FGU A;  4H5V A;  3O5B A;  3FZK A;  2GWJ A;  2Q0U A;  3VF4 A;  2P9L B;  4BC4 A;  1QHA A;  3WQU A;  3R8E A;  5AFU H;  4BR0 A;  1HKC A;  5F0X A;  1BUP A;  1NLV A;  3QBW A;  4B1X B;  5AR0 A;  5AZI B;  4BR9 A;  2DPN A;  1JCG A;  3SK3 A;  4MO4 A;  3CQY A;  1D4X A;  1JCF A;  3U4L A;  3UE5 A;  3VEN A;  2YI1 A;  2QWO A;  3AAR A;  4I6M A;  4H03 B;  2GEL A;  3DXK A;  1Y64 A;  4EIA A;  3BP8 A;  4CD3 A;  1QQO A;  3WXI A;  1NM1 A;  4IJA A;  4BRP A;  4BVP A;  2Q2R A;  2VWB A;  4K41 A;  1IJJ A;  1ZXO A;  4RWT A;  1OKJ A;  3KVG A;  2A6A A;  3DXM A;  4K25 A;  1Q18 A;  5AQV A;  5FPN A;  2P9S A;  3ATV A;  4BR7 A;  2QWM A;  3RSE A;  4BG8 A;  3UKU A;  1S3X A;  5AQQ A;  3VPZ A;  1ATS A;  1WUA A;  3ENH A;  3QBX A;  3S41 A;  3CI5 A;  5AQT A;  2E20 A;  4WQ5 C;  3LDQ A;  5JLH A;  5FPM A;  2HMP A;  2P9N A;  4FL9 A;  3O8M A;  3I8B A;  1MDU B;  4CBX A;  1ATN A;  3AAQ A; 
#chains in the Genus database with same CATH topology
 4JKE A;  1TK8 A;  4F9O A;  1QHT A;  4BRL A;  3KK3 A;  2HND A;  4CHN A;  5AQO A;  2A40 A;  4BWM A;  4LF4 K;  4JKG A;  3TPQ A;  3CMA N;  3HM8 A;  4Z4E A;  2Z1I A;  2D0C A;  3OYE A;  4CJR A;  1NJX A;  3K0S A;  4BRM A;  3SQ2 A;  2VGN A;  4E72 A;  5FRO A;  3M6G A;  4CJ7 A;  3QET A;  5AQS A;  3WEE A;  1KD1 O;  4OX9 K;  4CEE A;  3B6O A;  4MFB A;  4Y1D A;  5J2P A;  3SQ0 A;  2QWQ A;  4C23 A;  2VWJ A;  5EOY A;  3VQP A;  3AVK A;  3CFO A;  3LP1 A;  2ZE2 A;  4R79 A;  3TWH A;  1RCH A;  3DXK B;  4IFV A;  3AO5 A;  3VGM A;  2BDP A;  3HTV A;  4PUO A;  4Z4G A;  3EE8 A;  3L4I A;  4FLU A;  5I9E B;  3LPT A;  4CEF A;  1C6V A;  2NLX A;  4HHT A;  5E26 A;  4YOW A;  4FJJ A;  3HJF A;  3DXM B;  3I33 A;  4ISE A;  1ITG A;  2ZGZ A;  3PX0 A;  3F2K A;  3SJJ A;  4ZTJ A;  4M42 A;  2I7P A;  3UKU B;  2HMI A;  3D2E B;  1NGJ A;  1YVU A;  1ASW A;  3AO4 A;  3CCJ N;  1QSL A;  4DKW A;  1VSH A;  4O44 A;  1U2V A;  4IZ9 A;  5LY3 A;  2GUI A;  3L3V A;  1NMD A;  4KAZ A;  1U49 A;  1TYQ A;  1LWC A;  3MAQ A;  3DOK A;  3VQ9 A;  5BRE A;  1Q86 O;  3K5O A;  3OYG A;  1BA0 A;  3ASM A;  4RW4 A;  4B9N A;  3FFK B;  1HX1 A;  3ATU A;  3P31 A;  3S9H A;  4DTS A;  3O3F A;  1MU2 A;  5FLX O;  3NH0 A;  1GOB A;  1GLD G;  5GAE P;  1NKC A;  4EP4 A;  1LOT B;  3NH2 A;  2FBY A;  3K59 A;  3V4I A;  1OH6 A;  4M63 C;  4YOV A;  1KTQ A;  1RTD A;  4JD2 B;  3F9K A;  3E9L A;  2ZJQ L;  1NG9 A;  3LM9 A;  1JLQ A;  3KD5 E;  1ZBS A;  4DSE A;  5LJV A;  4WE1 A;  1G99 A;  1TK5 A;  2ITG A;  3HOS A;  1RT6 A;  1R59 O;  3TTC A;  5AQW A;  3K2P A;  3ZEU B;  1NGE A;  1VQ4 N;  3CJB A;  4JI1 K;  2UU9 K;  1X3N A;  2YHA A;  3HI0 A;  3N4Q A;  4LH4 A;  3ENO A;  1LAW A;  4CF2 A;  4OLB A;  1WOQ A;  2HVH A;  4CHZ A;  3TTF A;  2FC0 A;  4CJT A;  2YHW A;  3EL2 A;  2HHW A;  5M1Q A;  2C1G A;  4XIU A;  4ILG B;  4WFA L;  5BRH A;  3CM5 A;  4IOX A;  4C8K A;  3PO4 A;  2ASP A;  4FW1 A;  4YOR A;  3ZET A;  3BF3 A;  2OZS A;  4DR3 K;  1NK7 A;  1U6Z A;  1D9F A;  3OYJ A;  3CER A;  2VG7 A;  2Q36 A;  4DTX A;  4FVM A;  4DQP A;  4K0K K;  3EKS A;  1D9D A;  3P5J A;  1IBM K;  4R5P A;  1S1W A;  3VEV A;  3VEZ A;  3OYC A;  4PKH A;  4FOE A;  4DS4 A;  4NCB A;  3O1W A;  1NJI O;  1C0G A;  4FM0 A;  2NRW A;  3BF1 A;  4FWP A;  3K5L A;  3TAR A;  5FDL A;  1OH5 A;  1VQM N;  4ZTF A;  3NDK A;  4KTZ A;  3CME N;  4CER A;  4CJP A;  3THX B;  5EX5 A;  1RT7 A;  4TSX A;  4B8A B;  3QEX A;  3NBP A;  4DFM A;  3HVT A;  4JAX A;  3J7Z O;  2XHB A;  3PIP L;  4DV2 K;  1GLA G;  1BIU A;  4LF6 K;  3CJ1 A;  3FLC O;  5LL6 Z;  2XY8 A;  2WUS A;  4JK7 A;  1WSH A;  3NCI A;  2X6N A;  4X65 K;  3L2U A;  4KHQ A;  4OPH A;  3O6W A;  4BR2 A;  4J8F A;  4DR6 K;  3NGI A;  3AA2 A;  2ZQB A;  4BRA A;  4CZK A;  1T05 A;  1GLC G;  2GX9 A;  4XEI A;  5CE3 A;  3CCM N;  5E84 A;  4CK1 A;  3K9J A;  3SBG A;  4N56 A;  5KQ8 A;  1G15 A;  3UIQ A;  5ELZ A;  3PIO L;  2NRV A;  3C6H A;  5AQH A;  2F9W A;  1YTA A;  3LZI A;  3AVH A;  1W9H A;  1HNI A;  3EZ5 A;  4ELV A;  3CPE A;  1N33 K;  2E88 A;  3SUO A;  2E6M A;  2QWL A;  4KI6 A;  1KAZ A;  1KLM A;  3KK2 A;  3MMV A;  4M7Y A;  4A2B A;  3OBY A;  3U9D A;  5J2M A;  1HQE A;  3GE1 A;  3I8D A;  4H5W A;  4GY2 B;  3O80 A;  2X74 A;  3RTV A;  5BPL A;  3OYB A;  5JEN A;  1X9J A;  2F4V K;  3WUH A;  3QES A;  2E2Q A;  2YJF A;  4CFD A;  2EX3 A;  3VQB A;  3OA9 A;  4IEE A;  4OKJ A;  2A41 A;  1XWL A;  3G0Z A;  1K6Y A;  4XH5 A;  2UUB K;  2Z1H A;  1S1V A;  3AY9 A;  4BC5 A;  4OO1 J;  5HL7 L;  5CZ1 A;  1VSD A;  3SCX A;  2YKM A;  3O4W A;  3D2E A;  1NK6 A;  1VQL N;  2OPQ A;  3MK6 A;  1VRU A;  1JLA A;  3VET A;  2Q1N A;  3A2F A;  3CD6 N;  4MLH A;  1N32 K;  3VA3 A;  5AQJ A;  4FZZ A;  1NOY A;  4CI6 A;  3CC2 N;  2ZD1 A;  2ZGY A;  3HVR A;  3CJC A;  4CEZ A;  1X3M A;  4WQ4 C;  2CGJ A;  1NK4 A;  3GOI A;  2RKI A;  3ZSO A;  3MN7 A;  3AVL A;  4OKE A;  4RTF D;  2RE2 A;  1TV6 A;  4BE2 A;  2XY6 A;  3MN6 A;  2VCP A;  3KK7 A;  3R9P A;  4O5B A;  5AZI A;  3KLG A;  4E7K A;  3HYF A;  4BWJ A;  2HHX A;  1C0M A;  3I0S A;  1KSP A;  4X64 K;  3JXU A;  4JD2 A;  4CF9 A;  4FXD A;  4H8K A;  4B9S A;  1MA9 B;  1MWM A;  2WFB A;  4K8Z A;  1D5A A;  2O8E B;  4DQI A;  2IVP A;  3EKU A;  4PQU A;  3AVJ A;  4RW8 A;  3G4S N;  5AQZ A;  1YJ9 N;  1VSK A;  2GTD A;  4I7F A;  3GG4 A;  4CJF A;  4ID1 A;  3IRX A;  2HF3 A;  4FWO A;  3T7Z A;  3NF8 A;  1HUX A;  5E41 A;  1V4T A;  3VQ8 A;  2VG5 A;  4BGA A;  4KTW A;  4Q5V A;  1GLL O;  1QQC A;  3L2V A;  4FJ8 A;  5JVG L;  5B8H A;  5CZ2 A;  4C1N K;  1K73 O;  3VGL A;  1TUU A;  1TKX A;  4FWK A;  2QK9 A;  1KQS M;  1RTI A;  3ENB A;  1YIJ N;  4CBW A;  3VQ4 A;  2Y1J A;  3LAK A;  2OAN A;  3FZK A;  1RT3 A;  3G6E N;  2NRT A;  2KQ2 A;  4OPK A;  1N34 K;  2C1I A;  5AFU H;  4BR0 A;  3V9U A;  4CEB A;  2BAN A;  4DTR A;  1VQ5 N;  1L3S A;  1YHQ N;  1KLN A;  5AR0 A;  3AA5 X;  1IO2 A;  4JI2 K;  3ZSW A;  4BR9 A;  4CW7 B;  2DPN A;  1NK9 A;  3U4L A;  2QWO A;  1NK8 A;  1NNE A;  1VQN N;  3EEQ A;  4KV8 A;  1K8A O;  2OTJ N;  3BP8 A;  1QQO A;  3O4Q A;  4I2Q A;  1VAZ A;  4IJA A;  2VWB A;  3G71 N;  2FBV A;  4O4G A;  3LZJ A;  4XJX A;  1DLO A;  1Q18 A;  5AQV A;  2P9S A;  3ATV A;  5M1O A;  2QWM A;  4CEQ A;  1S3X A;  4GVM A;  3VPZ A;  3ZT0 A;  1ATS A;  3VQ5 A;  4IOA L;  1WBB A;  1CXQ A;  3ENH A;  5J2Q A;  3CI5 A;  4CJU A;  1IKX A;  1KRP A;  3I56 N;  5FPM A;  2P9N A;  1Q81 O;  1X9W A;  4CBX A;  1ATN A;  3AAQ A;  4FLT A;  4AHV A;  2KW4 A;  1SKR A;  5GIP A;  2B4J A;  3LDO A;  5AQM A;  1BU6 O;  1S22 A;  1YF5 L;  4DQ8 A;  2HST A;  2D0P A;  4FJH A;  3QB0 A;  4IEI A;  4IFY A;  4Z94 A;  2Q0R A;  3M8P A;  1C0T A;  4DTU A;  3A5N C;  4BRD A;  1IV0 A;  4FM2 A;  2QXL A;  1QS4 A;  2Q97 A;  1JLE A;  1HRH A;  1HKB A;  3CG7 A;  1N5Y A;  1RDA A;  4W5T A;  4NCG A;  4CJ3 A;  3OW2 M;  3VES A;  1UA0 A;  3IUC A;  2O4G A;  1QZ5 A;  4WQ5 A;  1SL2 A;  4BRO A;  4RG8 A;  3NF7 A;  4BY9 C;  1NGI A;  3PSI A;  4A62 A;  4DTJ A;  2R7Y A;  3RRG A;  1JXE A;  1KVA A;  4G1Q A;  2IAJ A;  1XUP O;  2KZZ A;  4WQ4 A;  4B8C A;  1NKB A;  2PY5 A;  2GV9 A;  4CF0 A;  5BN8 A;  3JYT A;  4JK9 A;  4IKF A;  3AVA A;  3IKM A;  3TU5 A;  2ITM A;  5BRD A;  1XMO K;  3H1V X;  5HRS A;  3AO1 A;  3CM6 A;  3VMF B;  1O1W A;  1TKD A;  5GIO A;  1S6P A;  4OGC A;  5C25 A;  4EHU A;  4CIE A;  4B9M A;  3QFP A;  1HNW K;  4J2D A;  3NGY A;  3VQQ A;  3CET A;  1ZBU A;  4PA1 A;  4DQR A;  3IS9 A;  3O9Q A;  4BE0 A;  5FPD A;  3TAQ A;  2O8F A;  3MWT A;  3LWL A;  3M5R A;  2YKN A;  4HWI A;  1L5U A;  4JI8 K;  4IXC A;  3TAP A;  1SUQ A;  3BEX A;  3ZLJ A;  2HHT A;  1HYV A;  2PZS A;  4KKO A;  2FSN A;  4A57 A;  4CEA A;  1NGD A;  3V9Z A;  3P1G A;  2E2O A;  1QZ6 A;  3FZL A;  3AVC A;  4PL8 A;  3HBT A;  3HZ6 A;  4EP5 A;  4KB0 A;  3AVI A;  3ID6 A;  2V52 B;  3NE6 A;  5FPE A;  3KLF A;  3C7N A;  1JCE A;  4CJ4 A;  2ZWH A;  1YAG A;  1YT3 A;  2O8E A;  1CZA N;  4V19 S;  3SJH A;  1KVB A;  2HBJ A;  4B9V A;  3O1B A;  3GL1 A;  3KHY A;  4Z4I A;  4W5R A;  2P9K B;  5AJ3 K;  3VEO A;  1RDU A;  3BUZ B;  3TAB A;  4KBO A;  2D0O A;  3JSM A;  2CGL A;  3U6F A;  4AQY K;  1ZBL A;  3O3G A;  2HVI A;  1DGK N;  4KHP K;  1QQN A;  1EET A;  3AGR A;  1J9A A;  5AQU A;  4JI3 K;  1IG9 A;  1LCU A;  4A5B A;  5DM6 L;  4H5R A;  3QFU A;  4JI5 K;  2G8H A;  4CFC A;  4QCL A;  5AQK A;  2G8V A;  1HJR A;  1GOA A;  5LMU K;  2XO7 A;  1IG8 A;  1YIT N;  3TSQ A;  3DRP A;  1J5E K;  2DFE A;  3DLL L;  2E2P A;  3G10 A;  4GKJ K;  4BRQ A;  3KLI A;  2VQE K;  1RBV A;  4ELU A;  3KKR A;  4IG3 A;  4LF7 K;  4YY3 K;  5FRN A;  3HK2 A;  1W0H A;  3QEP A;  4M41 A;  2E6L A;  4BR4 A;  5HOO A;  2F7T A;  1I3A A;  4CGI A;  5AQP A;  1NJW A;  4U67 L;  4JS4 A;  4E3S A;  3C6T A;  1YVN A;  1UAX A;  2EHG A;  3B8A X;  2O8C A;  3BY5 A;  1HMV A;  2VQF K;  2P9U A;  4FJN A;  5J1E A;  3SAH A;  3OYD A;  1WAF A;  3IDH A;  3U9Z A;  4CIG A;  3SMS A;  2DFF A;  3ZX3 A;  3T1H K;  1KFD A;  4JRP A;  1GLJ O;  4KHY A;  3F5T A;  1H1V A;  3C95 A;  5ADX H;  1RNH A;  1S1X A;  2P9I A;  1E3M A;  2CH5 A;  4BRF A;  4N47 A;  4FVU A;  4G9Z A;  3EYZ A;  3MXM A;  4AH9 A;  2P5O A;  5I3U A;  3ZT4 A;  3E9O A;  4ID5 A;  3V9S A;  2HHH K;  3D0P A;  3A5O C;  3FZH A;  1J54 A;  2NRX A;  4FWR A;  4B1U B;  1BWF O;  4O5F A;  4GV6 A;  4BDP A;  1M1K O;  4IJN A;  1RGI A;  5DMR A;  4HVJ A;  4M3T A;  1BCO A;  4EAH D;  2QWN A;  4B3T K;  2HOE A;  1QQM A;  3DWL A;  5F1X A;  1KXP A;  3W3D A;  3PUF A;  2E4L A;  2W6K A;  2KTQ A;  4YHH K;  2E5L K;  2O8B B;  4NO7 A;  5KGW A;  5KQD A;  4KHN A;  1Q9X A;  2X78 A;  1FXX A;  1E4G T;  3R1X A;  1NGC A;  1BO5 O;  2G8W A;  3MCP A;  4MDB A;  3VF2 A;  3UKR B;  3HOT A;  3DLR A;  2CGK A;  3I55 N;  1X9M A;  4LF8 K;  1VSI A;  2D4W A;  4B1W B;  4RW9 A;  4FPA A;  2ASO A;  4DCH A;  2W41 A;  2X6S A;  4H0Y B;  1EWR A;  1J53 A;  1HYS A;  3O08 A;  1YI2 N;  2JWK A;  3CPW M;  2ATQ A;  1WSI A;  4FSV A;  3CCV N;  4DUY K;  4EZ9 A;  1TKT A;  3L3U A;  4BC2 A;  4BRG A;  3LAN A;  4JS5 A;  2P9P A;  3LP2 A;  2PBD A;  2NUB A;  4RCH A;  1LWE A;  4JNE A;  4M3W A;  4FJI A;  4M3X A;  1BCM A;  3LDN A;  2JWL A;  2G8K A;  2E2N A;  4BDY A;  4L3Q A;  3VGK A;  4FZX C;  3OS2 A;  4C8O A;  4MDA A;  3SUQ A;  2E1Y A;  4NCA A;  1RTH A;  2HBK A;  3IFR A;  4A61 A;  1RDW X;  4GMJ B;  5DM7 L;  4IBN A;  3TTD A;  1A5X A;  5GAD P;  2YNG A;  4XH4 A;  1GLE G;  3CF5 L;  5HLF A;  1KAY A;  3DJC A;  3OJS A;  4JI7 K;  3THY A;  4CGF A;  1RT4 A;  3NVK A;  2HHI A;  4ILH A;  4MQ3 A;  5M1P A;  1QTM A;  3CQX A;  3DLE A;  3LP0 A;  1K8K B;  4BR5 A;  4JK8 A;  4IFE A;  2HW3 A;  3HRG A;  4A2A A;  1TAU A;  1NOZ A;  3BDP A;  1RT1 A;  4M3U A;  1SAZ A;  3OYM A;  4CEC A;  4HUG A;  2G8F A;  3NFA A;  4CZG A;  2YNI A;  1WB9 A;  4DTN A;  3A8Y A;  2GWK A;  3KK1 A;  1XI1 A;  3SBT A;  4CCH A;  5FRM A;  2ASM A;  1TUY A;  4DMN A;  4Y1C A;  4CVN E;  3RMC A;  1W7A A;  4CES A;  4K8X A;  1XMQ K;  3FR0 A;  4DHY A;  5C2D A;  5HRO A;  2GUP A;  1HNZ K;  4H5V A;  3O5B A;  3OS0 A;  3ZSQ A;  2GWJ A;  2KZM A;  2Q0U A;  1KC8 O;  1K9M O;  3SQ4 A;  2P9L B;  4GW6 A;  1RDD A;  4OPA A;  3KD1 E;  3CCE N;  1HKC A;  3QBW A;  3QEI A;  1RBT A;  4E19 A;  2Z1J A;  1DT9 A;  3SK3 A;  2RN2 A;  4FJK A;  3VEN A;  1D4X A;  3T3F A;  4B3O A;  1S72 N;  5JS1 A;  3QIP A;  4DV7 K;  1IBL K;  4FK4 A;  4CHO A;  3AAR A;  2NRR A;  4H03 B;  3DXK A;  1R0A A;  1WBD A;  3LAM A;  4CD3 A;  2I5J A;  1NM1 A;  4BRP A;  2VGM A;  4M3Z A;  1IJJ A;  4RWT A;  3DXM A;  4Z0U A;  4K25 A;  1VQ6 N;  1XC9 A;  4BR7 A;  4HUE A;  3UKU A;  3T69 A;  4Z4C A;  1BI4 B;  3QO9 A;  3QBX A;  3S41 A;  4WQ5 C;  3DI6 A;  3LDQ A;  5EU7 A;  3VQE A;  4N5S A;  2UUA K;  1VQO N;  3MXJ A;  3HPO A;  2NRZ A;  1X1P A;  2B5J A;  5TKW A;  5KTQ A;  1ILY A;  4CGG A;  4F2S A;  3OYK A;  4KHW A;  2BTF A;  3U8X A;  5BPM A;  4CFB A;  2ZM6 K;  3ZT1 A;  1HJO A;  4JKA A;  1S9G A;  4BQZ A;  2VYP A;  4FJ7 A;  4K43 A;  3CIP A;  3VA0 A;  5EVZ A;  1VQ9 N;  2IVO A;  2J4R A;  2IGI A;  3RMB A;  3QNO A;  3CJ7 A;  4DSJ A;  2HHU A;  2FF6 A;  1VHX A;  3R6M A;  1LW0 A;  4K42 A;  1X9S A;  4JRQ A;  5EXW A;  1T7P A;  2NRH A;  4I6M B;  3VQC A;  1OVQ A;  1U04 A;  3V1O A;  3SMP A;  1N6Q A;  1OH7 A;  5KRS A;  3GBT A;  4F3T A;  1M90 O;  1Q7Y O;  1REV A;  4CJQ A;  2CH6 A;  3AVM A;  1EWQ A;  4DR5 K;  1U48 A;  3LWM A;  5KPZ A;  2OA8 A;  3CCL N;  4E7J A;  3UKR A;  3ZEU A;  4CJS A;  4DU3 A;  2B6A A;  4KH6 A;  3VER A;  3VQD A;  4CF1 A;  4BE7 B;  3T1A A;  4DSK A;  2A42 A;  2DY4 A;  4CEO A;  3N4P A;  3OS1 A;  1BA1 A;  5HRP A;  4JKH A;  4WCE L;  1SL1 A;  3ZSV A;  2D1K A;  4JKF A;  1JLB A;  5JVH L;  5BRF A;  4E1M A;  3J7Y P;  1NJY A;  5KI6 A;  2IOC A;  4WYB A;  5CR4 A;  4CGH A;  1TGO A;  4ISF A;  4H5N A;  3PV8 A;  4CHY A;  2FBT A;  1NBW A;  2HHS A;  4FJ9 A;  3AA3 A;  5HRN A;  4QOZ B;  1XHX A;  3V1Q A;  4B3S K;  2O4I A;  1LAV A;  3CFP A;  2ZJR L;  2UUC K;  3WEE B;  4H0T B;  3B6P A;  3S3N A;  2HF4 A;  3KZB A;  3CJ9 A;  3J81 O;  2YJE A;  1J6Z A;  2FSJ A;  3RR8 A;  1JKH A;  5BPN A;  4NYN A;  2JLE A;  1KAX A;  4FWQ A;  3WXJ A;  3PLA A;  4O0I A;  3TSU A;  3E9P A;  3WNF A;  4YDU C;  3SV3 A;  1BIS A;  4DUZ K;  4CFA A;  4JYA K;  3THX A;  3OJU A;  4DU4 A;  4CHQ A;  1C1A A;  2UXB K;  3EZW A;  2A5X A;  3D45 A;  3ISN C;  1FK9 A;  4WFN L;  3RR7 A;  1EQY A;  3BZC A;  4X62 K;  5C10 A;  1K8K A;  4B08 A;  3HXM A;  3SPY A;  4N41 A;  1VQ8 N;  4OLA A;  4DSF A;  3A5M C;  3O9T A;  3LPU A;  3QEW A;  5GAG P;  3CC7 N;  3MEC A;  3TAF A;  4JKD A;  1BDG A;  3KTQ A;  1VSL A;  4C8M A;  1TYQ B;  3DYA A;  4FOI A;  2YHB A;  3L2W A;  2QXF A;  3MDQ A;  2HNZ A;  3WXL A;  1Z6R A;  4H5T A;  3EE9 A;  1SKS A;  1IBK K;  4DLE A;  1ZBI A;  3MEE A;  3AV9 A;  3V1R A;  2UYT A;  3NMU A;  4F3O A;  4QS8 A;  1L3T A;  3WNG A;  1T6C A;  4BRH A;  4KRF A;  1T44 A;  4CZM A;  1DTT A;  3QIC A;  4DV4 K;  1L3U A;  5IWA K;  1DKG D;  3SQ1 A;  1WAJ A;  4EHT A;  3IMX A;  4BRK A;  1NKE A;  4YFU A;  2P9L A;  3SV4 A;  2Q3S A;  1NJZ A;  3SUP A;  4ZHR A;  3V81 A;  4FPB A;  4FCY A;  2IVN A;  2XRI A;  3H1Q A;  1U45 A;  3NVM A;  3E01 A;  4CD1 A;  1IH7 A;  3KWI A;  3U3G A;  2F8S A;  3NF6 A;  3FZF A;  4IOC L;  5M1F A;  5KPR A;  2A1R A;  2YHY A;  4LY7 A;  5SZT A;  1ESV A;  1WSJ A;  1BOT O;  2JGU A;  4DSL A;  4I9Q A;  4Z4H A;  1HNV A;  4DR1 K;  4FLW A;  4N76 A;  3S5T A;  2AP1 A;  1C1B A;  4FWN A;  5AQL A;  3H46 O;  4J2E A;  4W5O A;  2HHQ A;  3G25 A;  3VEY A;  4W5Q A;  4FK2 A;  4B1Y B;  1RT2 A;  1P8Z A;  2RPI A;  4OPJ A;  3NGZ A;  2XY5 A;  3KJV A;  3H3N O;  3WXK A;  4UQG A;  3RMA A;  4B9U A;  4LSL A;  2FLO A;  3MWP A;  3K5M A;  5SWM A;  3NAE A;  4JKB A;  4FM1 A;  2ZF5 O;  1CZ9 A;  1JL1 A;  2FSK A;  1TAQ A;  3HP6 A;  5LJW A;  4UY8 O;  3SAF A;  3ALY A;  5EY4 A;  1SQK A;  2V7Y A;  2UXD K;  2UXC K;  3VEW A;  3T1Y K;  5BR8 K;  5F2R A;  1VQK N;  1JJ2 M;  4CF8 A;  3ULD A;  4BRE A;  3TAE A;  4DLG A;  4B3R K;  4DV6 K;  4FO0 A;  3O9U A;  4BE1 A;  2HHV A;  2VG6 A;  4PWD A;  4JI0 K;  4FWL A;  5KGX A;  4IO8 A;  3IAY A;  2EWS A;  4BG9 A;  1GLB G;  2D5R A;  3KLE A;  1FW6 A;  4RW6 A;  2F96 A;  3C94 A;  1LV5 A;  3KIO A;  4LC9 B;  1I39 A;  4B3M K;  3KLH A;  3QIN A;  3LDS A;  4HCB A;  1E4F T;  4CZF A;  1ASU A;  2GEM A;  1MWK A;  1RT5 A;  4DFJ A;  4FWM A;  3CHW A;  2G8U A;  4DSI A;  1QSY A;  2WON A;  3OYL A;  4YDU A;  3AAP A;  1VQ7 N;  3CCU N;  5M1N A;  4H0X B;  3MED A;  3L4Q A;  4NLC A;  1I94 K;  2OZM A;  5CHI A;  1XNR K;  3WXM B;  1C0U A;  4NB4 A;  2KKZ A;  4JHD B;  2OCE A;  4FZY A;  1S6Q A;  4KH4 A;  4LD0 A;  2RF2 A;  3HL8 A;  5IT9 O;  2O8D B;  1BGX T;  3WT0 A;  4BDZ A;  4KH5 A;  1TVR A;  4LH5 A;  3ULE B;  5AQI A;  4MLE A;  1OH8 A;  3OTO K;  1W97 L;  2IC3 A;  1C0F A;  3Q7B A;  4B9T A;  3LP3 A;  2FXU A;  3C6U A;  1HKG A;  4CGD A;  4DU1 A;  1NGB A;  5BN9 A;  3QIO A;  3THV A;  4QS7 A;  4BQL A;  5H1S Q;  4JI4 K;  1WSE A;  3LDP A;  1D8Y A;  2P5G A;  1UOC A;  4JV5 K;  1BQM A;  4FJL A;  4WFB L;  3THW B;  4O8K A;  4E0D A;  3ITH A;  1SZ2 A;  4DTO A;  3SPZ A;  3ZT3 A;  4E1J A;  1CXU A;  3ZCM A;  5JMV A;  2YV0 X;  3K57 A;  2OTL N;  4CJE A;  3CYG A;  4AF1 A;  3MN9 A;  3T19 A;  4FWS A;  4KTQ A;  3EY1 A;  3K9K A;  4ISG A;  2QWR A;  3DLK A;  3FGU A;  1IKW A;  4HUF A;  3TAM A;  4CK3 A;  2BGG A;  3PX6 A;  1WLJ A;  2YNH A;  4A59 A;  3OYI A;  1XHZ A;  3WQU A;  3S3O A;  3R8E A;  5C42 A;  3PO5 A;  4EZ6 A;  5F0X A;  1BUP A;  3RVC A;  3VQ6 A;  3AO3 A;  5AZI B;  3CCS N;  1JCG A;  3MX5 A;  4MO4 A;  3UE5 A;  1JCF A;  4M3Y A;  4IDH A;  4LFC K;  3HPG A;  2FBX A;  1F21 A;  1EP4 A;  4BVP A;  4K41 A;  4E89 A;  1ZXO A;  4W5N A;  3KVG A;  2A6A A;  4F8R A;  3K5N A;  4X66 K;  1O13 A;  4AHS A;  5FPN A;  1RDC A;  1J5O A;  4BG8 A;  3O9R A;  4JLH A;  4AHU A;  2XY7 A;  1JXB A;  5AQQ A;  4CJL A;  2GBZ A;  4BEB A;  3L2R A;  1WUA A;  4CK2 A;  4YNQ A;  5MLC Q;  3TR8 A;  5AQT A;  2E20 A;  5JLH A;  1HQU A;  5HP1 A;  4BEC A;  2HMP A;  3CYM A;  1WSG A;  4LFB K;  4LSN A;  3OBW A;  4BC3 A;  5GIN A;  3H45 C;  3J8A A;  5C24 A;  4AM6 A;  3NHG A;  1BL3 A;  4JN4 A;  3QER A;  2IIR A;  2V51 B;  2Y1I A;  3HP9 A;  2NZT A;  1GLF O;  4OVL A;  5C2F A;  1N36 K;  4FYD A;  1YUW A;  2F9T A;  2E8A A;  2KFN A;  2HBM A;  3F9M A;  3VN5 A;  5AFU A;  1HPM A;  2DFH A;  3M8S A;  1W2B M;  1Z26 A;  2VWK A;  4AIL C;  3AO2 A;  1VRT A;  1QE1 A;  1EX4 A;  3ZSZ A;  3LAL A;  2A1S A;  5AQG A;  3L0Q A;  3SI6 A;  3TAG A;  3J80 O;  1JLG A;  4E1N A;  2Z1G A;  2BH1 A;  4DS5 A;  4L8R B;  1RBR A;  1RFQ A;  2P9S B;  2IS3 A;  3CCR N;  4CZI A;  4MO5 A;  5A2Q O;  3DLB A;  1WN7 A;  3P38 A;  4M45 A;  3A0I X;  4CJV A;  4HTU A;  4OGE A;  1TK0 A;  1RTJ A;  1NGH A;  2OPS A;  2P9N B;  2P9K A;  4OJR A;  1UWB A;  3V9X A;  3AVF A;  3CCQ N;  2QA4 N;  2OPR A;  4DR2 K;  3QLH A;  4CJK A;  4C8L A;  5C15 A;  1VK0 A;  4FJX A;  3D2F B;  3WQT A;  2ZJP L;  3SNN A;  4WF9 L;  2G8I A;  1NWK A;  4ICL A;  1Q82 O;  4DV3 K;  5CY4 A;  3M1F A;  1YTU A;  3S3M A;  4CHP A;  3ZSR A;  4I2P A;  1JL2 A;  3C0B A;  1TL3 A;  5T7B A;  4DV0 K;  4KHU A;  3ZX0 A;  1KCF A;  1A5W A;  4NLB A;  1HYZ A;  1RBS A;  3MCA B;  4KFB A;  3OY9 A;  2BUP A;  4PL7 A;  1RIL A;  2WOM A;  4JHD A;  4CBU A;  2WBN A;  3E1Y A;  4BAC A;  1VSE A;  4E7I A;  3Q7C A;  1Q8I A;  2O8D A;  4IWV A;  3ULE A;  4O8U A;  1DEJ A;  4PKI A;  2AA4 A;  4GV9 A;  3FZM A;  4AHT A;  3OYN A;  4DR4 K;  3AVG A;  3ID8 A;  3M8R A;  1L3V A;  3VOV A;  3D7E O;  3ZSX A;  3U3Y A;  4FJ5 A;  1RDB A;  4NXM K;  5JLF A;  1NK5 A;  5AQF A;  5AZJ B;  4CED A;  3F73 A;  2PFU A;  2V7Z A;  1YXQ A;  1XQS C;  2P51 A;  5C0Y A;  4O55 A;  3RWU A;  3VTI A;  1T6D A;  3SUN A;  1YJN N;  3THW A;  3QDK A;  3J7A P;  2F8T A;  1BIZ A;  2PYL A;  3MEG A;  1P90 A;  3BZK A;  1IKY A;  4DF8 A;  3NH1 A;  3VF6 A;  2LSN A;  3ZX2 A;  5AQR A;  4B1Z A;  3LL3 A;  4PHT X;  1S5J A;  1BHL A;  3CQ8 A;  3MXI A;  4CZL A;  2YCH A;  2Q31 A;  1NGG A;  4C1N I;  4FLX A;  2O8F B;  1DTQ A;  5BR9 A;  3WNH A;  4HCC A;  4DF4 A;  5KPT A;  3CC4 N;  4XH1 A;  4DQS A;  3DM2 A;  4DQQ A;  2PAV A;  2QI2 A;  3HST B;  2QTD A;  3AVN A;  2QKK A;  3DOL A;  2O8B A;  1LW2 A;  4IO9 L;  1BG3 A;  4F4K A;  4CZJ A;  3HM9 A;  5I42 A;  4AM7 A;  3RSE B;  1KFS A;  3KWG A;  4JI6 K;  3C7N B;  2HB5 A;  1NK0 A;  2YNF A;  4Y0W A;  4CGJ A;  2OYQ A;  3SAG A;  2HNY A;  3IG1 A;  2KHO A;  4BVO A;  2AJQ A;  4YOX A;  4FJM A;  4FLY A;  1VSM A;  3OHR A;  4H0O A;  1V4S A;  1Z25 A;  3BGR A;  3AGK A;  4AHC A;  1CZB A;  1EO1 A;  1T03 A;  3C6A A;  4JKG B;  4KO0 A;  3HSC A;  1VQP N;  3R3L A;  4BRI A;  4OKK A;  4LF9 K;  1S1U A;  2RHK A;  2NNW A;  3LM2 A;  3P39 A;  3EO3 A;  2QM1 A;  2QKB A;  3CJA A;  4B9L A;  4KRE A;  1T3V A;  4DFP A;  1HNX K;  5JS2 A;  4CJ5 A;  4FK0 A;  3GDQ A;  4CZH A;  4BRN A;  1FKP A;  5LMN K;  4DTM A;  3AVB A;  5AQY A;  3NF9 A;  3RRH A;  3O3H A;  4DR7 K;  4H4M A;  4PY5 A;  3ZSY A;  1IKV A;  3L2Q A;  1JLF A;  3I0R A;  4BGB A;  2P1J A;  1HPZ A;  4U7B A;  4DV5 K;  3H6E A;  4LF5 K;  4EFH A;  3QNN A;  2I7N A;  2E1Z A;  4GV3 A;  3P4I A;  1NMN A;  4YOY A;  1ZC6 A;  4C8N A;  4FW2 A;  1ZBF A;  1BQN A;  4HTL A;  4BRC A;  2D0A A;  3JS6 A;  5AQX A;  1SV5 A;  2O8C B;  5KRT A;  3SLC A;  2QW9 A;  2P9U B;  1OVY A;  1U2V B;  4FLZ A;  4KPY A;  1NU0 A;  1QSS A;  3WNE A;  1YJW N;  4M7X A;  2WC9 A;  3A5L C;  4B9Q A;  5M1K A;  3L6Q A;  5JIC A;  3QEV A;  1SKW A;  3DAW A;  3CFR A;  2P9I B;  4KHS A;  4PKG A;  4DG1 A;  3QML A;  3FFI A;  1SS6 A;  3MX2 A;  5ADX A;  4RW7 A;  4B1V A;  1TL1 A;  3W0L A;  1ZYQ A;  3EN9 A;  2WTU A;  1Y97 A;  1KVC A;  4CJW A;  3ZYY X;  1ATR A;  3TSP A;  3VEX A;  3D2F A;  2FF3 B;  4DWI A;  4DV1 K;  4H0P A;  1WSF A;  4IG0 A;  1NGA A;  4FLV A;  4O0J A;  4DB3 A;  4GNI A;  4JKC A;  3DRS A;  1QVG M;  1B9F A;  1FKO A;  4FJG A;  3RMD A;  4YOU A;  1C1C A;  1CLQ A;  2QEX N;  3OYA A;  3CXC M;  1JLC A;  1HLU A;  1EKE A;  3L8B A;  4QS9 A;  4H4O A;  2HBL A;  2H3G X;  2A3Z A;  2W40 A;  1XNQ K;  3SZ2 A;  1A5V A;  3KKS A;  1Z05 A;  4DTP A;  3VQ7 A;  4J2B A;  3MN5 A;  3PX4 A;  1U47 A;  3VTH A;  2W42 A;  1N8R O;  4KI4 A;  4Z4F A;  1NGF A;  3M3Z A;  2D0B A;  4ILJ A;  3UB5 A;  5J2N A;  1Q9Y A;  1FJG K;  1U4B A;  4CZE A;  3K58 A;  4IDK A;  4J2A A;  1WNS A;  1VSJ A;  4I9L A;  3V9W A;  1BI4 A;  4A5A A;  1SL0 A;  4QAG A;  2YHX A;  4H0V B;  5HBM A;  2OPP A;  5AZJ A;  4NXN K;  3ZET B;  3FE1 A;  3C65 A;  5AQN A;  3HPH A;  2P9P B;  4Q0B A;  1LWF A;  2QWP A;  4LFA K;  5CYQ A;  3O9S A;  3LDL A;  1RBU A;  4CE9 A;  1EXQ A;  1XC3 A;  4E7H A;  3HT3 A;  5TKY A;  3P83 D;  1B9D A;  3H3O B;  2W00 A;  4JEP A;  4ELT A;  1B92 A;  3V6D A;  3TI0 A;  3PY8 A;  3VF4 A;  1ASV A;  4BC4 A;  1UA1 A;  1QHA A;  4E7L A;  4YOT A;  1ZBH A;  4B1X B;  1NLV A;  3DMJ A;  3E66 A;  5K14 A;  2IDO A;  2BE2 A;  1VSF A;  3CQY A;  1GOC A;  2YI1 A;  4NYF A;  4GKK K;  3SYZ A;  3OVN A;  3JAM O;  3THY B;  1QVF M;  4I6M A;  3OYF A;  4KB1 A;  2ETJ A;  2GEL A;  3AA4 A;  1Y64 A;  1TKZ A;  3DRR A;  3ZT2 A;  4EIA A;  1HR0 K;  3WXI A;  1S1T A;  5GAH P;  2Q2R A;  4GVE A;  3D6R A;  1T8E A;  2PYJ A;  3PSF A;  4M3R A;  1OKJ A;  3O4N A;  4F2R A;  4AHR A;  2KLA A;  3VQA A;  4CIF A;  3RSE A;  5C12 A;  3H08 A;  3M8Q A;  5DK5 A;  3DLG A;  2KFZ A;  3DLH A;  5D3G A;  2DTU A;  1S9E A;  3OYH A;  5CYM A;  3HO1 A;  3TAN A;  4FL9 A;  3O8M A;  2YX6 A;  3I8B A;  5HRR A;  4DFK A;  1MDU B;  2W6L A; 
#chains in the Genus database with same CATH homology
 4JKE A;  4F9O A;  5GIP A;  2BTF A;  4BRL A;  3LDO A;  5AQM A;  1BU6 O;  3U8X A;  1S22 A;  1YF5 L;  5AQO A;  2A40 A;  2HST A;  2D0P A;  3OBW A;  4BC3 A;  4DQ8 A;  4JKG A;  5BPM A;  3TPQ A;  3QB0 A;  4IEI A;  5GIN A;  3HM8 A;  3CMA N;  4Z94 A;  1HJO A;  3H45 C;  4JKA A;  2Q0R A;  4BQZ A;  3J8A A;  2VYP A;  4AM6 A;  3A5N C;  4BRM A;  2VGN A;  4JN4 A;  4BRD A;  2IIR A;  2V51 B;  2NZT A;  1GLF O;  2QXL A;  3CIP A;  3M6G A;  4K43 A;  2Q97 A;  5EVZ A;  4CJ7 A;  5C2F A;  5AQS A;  1HKB A;  1YUW A;  2F9T A;  1VQ9 N;  2E8A A;  2IVO A;  2J4R A;  3WEE A;  1KD1 O;  2HBM A;  3CJ7 A;  3F9M A;  5AFU A;  2FF6 A;  2QWQ A;  3R6M A;  1HPM A;  4C23 A;  1W2B M;  4K42 A;  3OW2 M;  3VES A;  5EOY A;  5EXW A;  2NRH A;  3IUC A;  4R79 A;  4I6M B;  1QZ5 A;  3DXK B;  4WQ5 A;  3VGM A;  5AQG A;  3HTV A;  4BRO A;  3EE8 A;  3L0Q A;  3L4I A;  3SMP A;  5I9E B;  3GBT A;  2NLX A;  1M90 O;  1Q7Y O;  2CH6 A;  5E26 A;  4YOW A;  4BY9 C;  1NGI A;  3DXM B;  4A62 A;  2BH1 A;  3I33 A;  4ISE A;  2ZGZ A;  1RFQ A;  3F2K A;  5KPZ A;  2P9S B;  3CCL N;  1XUP O;  3CCR N;  2I7P A;  3UKU B;  4WQ4 A;  4MO5 A;  3D2E B;  3UKR A;  3ZEU A;  4CZI A;  1NGJ A;  4KH6 A;  3CCJ N;  3VER A;  3P38 A;  5BN8 A;  4DKW A;  4JK9 A;  4BE7 B;  2A42 A;  3A0I X;  3IKM A;  1NGH A;  3N4P A;  1U2V A;  1BA1 A;  4IZ9 A;  3TU5 A;  5LY3 A;  2ITM A;  5BRD A;  3H1V X;  1NMD A;  2P9N B;  2P9K A;  4JKH A;  4WCE L;  2D1K A;  4JKF A;  5JVH L;  1TYQ A;  3CCQ N;  5BRF A;  2QA4 N;  4WYB A;  5C15 A;  3VMF B;  3D2F B;  3WQT A;  5CR4 A;  5BRE A;  1Q86 O;  2ZJP L;  1BA0 A;  4WF9 L;  5GIO A;  1NWK A;  1Q82 O;  3FFK B;  1HX1 A;  4EHU A;  3ATU A;  3M1F A;  4ISF A;  4H5N A;  3P31 A;  3QFP A;  3C0B A;  1NBW A;  3CET A;  3O9Q A;  5FPD A;  1GLD G;  3ZX0 A;  5GAE P;  4NLB A;  1LOT B;  3MCA B;  3MWT A;  2BUP A;  2ZJR L;  3M5R A;  3WEE B;  4PL7 A;  4H0T B;  4HWI A;  2HF4 A;  3KZB A;  3CJ9 A;  4IXC A;  3BEX A;  2YJE A;  4JHD A;  4CBU A;  2WBN A;  1J6Z A;  2FSJ A;  3E1Y A;  4M63 C;  4YOV A;  4JD2 B;  5BPN A;  2FSN A;  1KAX A;  3E9L A;  4FWQ A;  3WXJ A;  4A57 A;  1NGD A;  3Q7C A;  2ZJQ L;  3PLA A;  3TSU A;  3E9P A;  3LM9 A;  4YDU C;  2E2O A;  1QZ6 A;  3FZL A;  4IWV A;  1ZBS A;  3ULE A;  4PL8 A;  3HBT A;  4O8U A;  3HZ6 A;  1DEJ A;  4PKI A;  2AA4 A;  5LJV A;  4GV9 A;  3ID6 A;  1G99 A;  2V52 B;  3FZM A;  5FPE A;  3ID8 A;  3HOS A;  3VOV A;  3D7E O;  1R59 O;  3EZW A;  3TTC A;  3C7N A;  2A5X A;  1JCE A;  5AQW A;  4WFN L;  2ZWH A;  1EQY A;  1YAG A;  1CZA N;  3ZEU B;  5C10 A;  5JLF A;  1NGE A;  5AQF A;  3CJB A;  1VQ4 N;  5AZJ B;  1K8K A;  1X3N A;  2PFU A;  3HI0 A;  2V7Z A;  1YXQ A;  3N4Q A;  1VQ8 N;  3SJH A;  1XQS C;  3A5M C;  3ENO A;  3O9T A;  1WOQ A;  2HBJ A;  5C0Y A;  3TTF A;  5GAG P;  3O1B A;  3GL1 A;  3KHY A;  2YHW A;  3CC7 N;  3EL2 A;  2C1G A;  5M1Q A;  1T6D A;  3VTI A;  1YJN N;  4ILG B;  2P9K B;  4JKD A;  4WFA L;  3VEO A;  1BDG A;  1RDU A;  5BRH A;  1TYQ B;  4IOX A;  3BUZ B;  3QDK A;  2D0O A;  4FOI A;  4KBO A;  2ASP A;  4YOR A;  3MDQ A;  3ZET A;  2CGL A;  3BF3 A;  1P90 A;  3WXL A;  1Z6R A;  4H5T A;  1U6Z A;  3EE9 A;  3CER A;  2UYT A;  3NMU A;  4QS8 A;  3VF6 A;  2Q36 A;  3ZX2 A;  1DGK N;  1QQN A;  5AQR A;  4B1Z A;  3LL3 A;  1T6C A;  4PHT X;  3AGR A;  3EKS A;  5AQU A;  4BRH A;  1T44 A;  1LCU A;  4CZL A;  2YCH A;  2Q31 A;  1NGG A;  4A5B A;  4C1N I;  3QIC A;  3QFU A;  4H5R A;  4CZM A;  5DM6 L;  3VEV A;  5AQK A;  3VEZ A;  1DKG D;  4PKH A;  4FOE A;  1IG8 A;  5BR9 A;  3TSQ A;  1YIT N;  4EHT A;  3IMX A;  3O1W A;  5KPT A;  1NJI O;  4BRK A;  3CC4 N;  4XH1 A;  2P9L A;  3DLL L;  1C0G A;  2E2P A;  2PAV A;  2QI2 A;  2QTD A;  4BRQ A;  4FPB A;  2IVN A;  3H1Q A;  3NVM A;  2NRW A;  3BF1 A;  4FWP A;  4CD1 A;  4IO9 L;  1BG3 A;  1VQM N;  3KWI A;  4CZJ A;  4BR4 A;  5HOO A;  3CME N;  3FZF A;  4IOC L;  5EX5 A;  2F7T A;  4AM7 A;  3RSE B;  5M1F A;  3KWG A;  5KPR A;  3C7N B;  5AQP A;  2YHY A;  4U67 L;  4JAX A;  1ESV A;  3J7Z O;  1YVN A;  3PIP L;  4Y0W A;  1BOT O;  3B8A X;  3SAG A;  2P9U A;  1GLA G;  2KHO A;  4BVO A;  4YOX A;  3SAH A;  3CJ1 A;  2AP1 A;  3FLC O;  3IDH A;  4FWN A;  3U9Z A;  2WUS A;  4JK7 A;  5AQL A;  3SMS A;  3OHR A;  3H46 O;  3ZX3 A;  4H0O A;  1GLJ O;  3G25 A;  4OPH A;  3F5T A;  3VEY A;  1H1V A;  3O6W A;  1V4S A;  4B1Y B;  1P8Z A;  4BR2 A;  4J8F A;  5ADX H;  3AGK A;  2P9I A;  3H3N O;  3WXK A;  2CH5 A;  4BRA A;  4BRF A;  1EO1 A;  4CZK A;  4FVU A;  1GLC G;  4G9Z A;  2FLO A;  2GX9 A;  3C6A A;  3MWP A;  4JKG B;  3HSC A;  4XEI A;  5E84 A;  5CE3 A;  3CCM N;  3R3L A;  3K9J A;  1VQP N;  3SBG A;  3E9O A;  4BRI A;  5KQ8 A;  4JKB A;  2RHK A;  2NNW A;  3LM2 A;  2ZF5 O;  3A5O C;  3P39 A;  3EO3 A;  2FSK A;  2QM1 A;  5ELZ A;  3PIO L;  2NRV A;  3FZH A;  3CJA A;  3C6H A;  5AQH A;  5LJW A;  4UY8 O;  2F9W A;  1T3V A;  3SAF A;  5EY4 A;  1SQK A;  2NRX A;  2V7Y A;  4FWR A;  4B1U B;  3CPE A;  1BWF O;  3GDQ A;  4O5F A;  4BRN A;  4CZH A;  4GV6 A;  5AQY A;  1M1K O;  3VEW A;  4IJN A;  1RGI A;  2E88 A;  2QWL A;  1KAZ A;  5F2R A;  3MMV A;  4M7Y A;  4A2B A;  4EAH D;  2QWN A;  2HOE A;  3OBY A;  3U9D A;  1QQM A;  3GE1 A;  4BGB A;  3DWL A;  4H5W A;  1VQK N;  5F1X A;  4GY2 B;  1JJ2 M;  1KXP A;  3O80 A;  3W3D A;  4U7B A;  3H6E A;  4BRE A;  4EFH A;  5BPL A;  1X9J A;  4NO7 A;  3WUH A;  2I7N A;  5KQD A;  2E1Z A;  4GV3 A;  3P4I A;  2E2Q A;  4FO0 A;  2YJF A;  1E4G T;  3R1X A;  3O9U A;  1ZC6 A;  1NGC A;  4YOY A;  1BO5 O;  3MCP A;  4MDB A;  3OA9 A;  3VF2 A;  4IEE A;  3UKR B;  3HOT A;  2A41 A;  4FWL A;  4HTL A;  4IO8 A;  2CGK A;  3I55 N;  2EWS A;  4BRC A;  4BG9 A;  1GLB G;  3JS6 A;  2D4W A;  4XH5 A;  5AQX A;  4B1W B;  4FPA A;  2ASO A;  3SLC A;  2QW9 A;  2P9U B;  2W41 A;  4DCH A;  1OVY A;  4H0Y B;  1U2V B;  3AY9 A;  4BC5 A;  4OO1 J;  3O08 A;  4LC9 B;  1YI2 N;  1YJW N;  2JWK A;  3CPW M;  4M7X A;  5HL7 L;  2WC9 A;  4FSV A;  3A5L C;  3O4W A;  3D2E A;  4B9Q A;  5M1K A;  3CCV N;  1VQL N;  3L6Q A;  3MK6 A;  5JIC A;  4BC2 A;  4BRG A;  3VET A;  2Q1N A;  1E4F T;  3DAW A;  2P9I B;  4CZF A;  4PKG A;  2GEM A;  2P9P A;  3QML A;  1MWK A;  3CD6 N;  1SS6 A;  4MLH A;  4FWM A;  2PBD A;  3CHW A;  3MX2 A;  5ADX A;  4RCH A;  4JNE A;  5AQJ A;  4B1V A;  3W0L A;  4CI6 A;  4YDU A;  3EN9 A;  3AAP A;  1VQ7 N;  3CCU N;  3LDN A;  5M1N A;  3CC2 N;  4H0X B;  2ZGY A;  2JWL A;  3ZYY X;  2E2N A;  3CJC A;  1ATR A;  4L3Q A;  3VGK A;  3TSP A;  3VEX A;  3L4Q A;  3D2F A;  1X3M A;  2FF3 B;  4WQ4 C;  2CGJ A;  4NLC A;  4MDA A;  3GOI A;  4H0P A;  2E1Y A;  3MN7 A;  5CHI A;  3WXM B;  1NGA A;  4NB4 A;  2KKZ A;  4DB3 A;  2HBK A;  4GNI A;  4JHD B;  4RTF D;  4JKC A;  3IFR A;  4A61 A;  1RDW X;  2RE2 A;  5DM7 L;  1QVG M;  4KH4 A;  3TTD A;  4YOU A;  5GAD P;  3MN6 A;  2VCP A;  3KK7 A;  3R9P A;  3WT0 A;  4XH4 A;  1GLE G;  5AZI A;  3CF5 L;  4KH5 A;  1KAY A;  3DJC A;  3ULE B;  2QEX N;  5AQI A;  4MLE A;  3CXC M;  1W97 L;  3JXU A;  1C0F A;  1HLU A;  3Q7B A;  3NVK A;  2FXU A;  4QS9 A;  1HKG A;  4JD2 A;  2HBL A;  2H3G X;  2A3Z A;  1MA9 B;  1MWM A;  2W40 A;  2WFB A;  4ILH A;  1NGB A;  5BN9 A;  5M1P A;  1Z05 A;  2IVP A;  3EKU A;  3MN5 A;  3CQX A;  4QS7 A;  3VTH A;  1K8K B;  4BQL A;  5H1S Q;  3G4S N;  5AQZ A;  1N8R O;  3LDP A;  4BR5 A;  1NGF A;  3M3Z A;  4JK8 A;  4IFE A;  1YJ9 N;  4ILJ A;  2GTD A;  3HRG A;  3UB5 A;  4A2A A;  4CZE A;  3GG4 A;  1SAZ A;  2HF3 A;  4A5A A;  4WFB L;  4FWO A;  3T7Z A;  4O8K A;  2YHX A;  4H0V B;  1HUX A;  4CZG A;  5AZJ A;  1SZ2 A;  1V4T A;  3ZET B;  3A8Y A;  3FE1 A;  4BGA A;  3C65 A;  5AQN A;  1GLL O;  4E1J A;  2GWK A;  5JVG L;  2P9P B;  5B8H A;  3SBT A;  4C1N K;  5JMV A;  2QWP A;  2OTL N;  3O9S A;  2ASM A;  1TUU A;  3LDL A;  3VGL A;  1K73 O;  1TUY A;  4FWK A;  4AF1 A;  3MN9 A;  1XC3 A;  1KQS M;  5TKY A;  3ENB A;  1YIJ N;  4FWS A;  4CBW A;  3FR0 A;  3H3O B;  3K9K A;  4ISG A;  4DHY A;  5C2D A;  2W00 A;  2QWR A;  2GUP A;  2OAN A;  3FGU A;  4H5V A;  3O5B A;  3FZK A;  4JEP A;  3G6E N;  2GWJ A;  2NRT A;  2Q0U A;  4A59 A;  1KC8 O;  3VF4 A;  1K9M O;  2P9L B;  2C1I A;  4BC4 A;  1QHA A;  3WQU A;  3R8E A;  4YOT A;  5AFU H;  4BR0 A;  4OPA A;  1VQ5 N;  3CCE N;  1HKC A;  5F0X A;  1BUP A;  1NLV A;  3QBW A;  3RVC A;  4B1X B;  3E66 A;  1YHQ N;  5AR0 A;  5AZI B;  4BR9 A;  1DT9 A;  2DPN A;  3CCS N;  1JCG A;  3MX5 A;  4MO4 A;  3CQY A;  1D4X A;  1JCF A;  3SK3 A;  4IDH A;  3U4L A;  2YI1 A;  2QWO A;  3UE5 A;  3VEN A;  1S72 N;  1VQN N;  1QVF M;  3AAR A;  4I6M A;  2NRR A;  4H03 B;  2GEL A;  3DXK A;  1K8A O;  1Y64 A;  4EIA A;  3BP8 A;  2OTJ N;  4CD3 A;  1QQO A;  3WXI A;  1NM1 A;  1VAZ A;  4IJA A;  4BRP A;  4BVP A;  5GAH P;  2Q2R A;  2VGM A;  2VWB A;  4K41 A;  4GVE A;  3G71 N;  3D6R A;  1IJJ A;  1ZXO A;  4RWT A;  1OKJ A;  3KVG A;  2A6A A;  3DXM A;  4XJX A;  1O13 A;  4K25 A;  1VQ6 N;  1Q18 A;  2KLA A;  5AQV A;  5FPN A;  2P9S A;  3ATV A;  5M1O A;  4BR7 A;  2QWM A;  3O9R A;  3RSE A;  4BG8 A;  5C12 A;  3UKU A;  1S3X A;  5AQQ A;  3VPZ A;  4BEB A;  3T69 A;  1ATS A;  1WUA A;  4IOA L;  5MLC Q;  3ENH A;  3QBX A;  3S41 A;  3CI5 A;  5AQT A;  2E20 A;  4WQ5 C;  3LDQ A;  5JLH A;  3I56 N;  1VQO N;  5FPM A;  4BEC A;  2HMP A;  2NRZ A;  2P9N A;  4FL9 A;  3O8M A;  2YX6 A;  3I8B A;  1Q81 O;  1MDU B;  5TKW A;  4CBX A;  1ATN A;  3AAQ A;  1ILY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...