2P9PA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
412
structure length
388
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGKWIKQYTGINAKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 124
structure length 388
sequence length 412
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pA03
2W40A 3H1QA 2GUPA 4K25A 3EN9A 2ZF5O 4FOEA 3SK3A 3D2EB 3L4IA 4DB3A 3U4LA 5AQKA 2ZGZA 4M7YA 4Z94A 5TKYA 4BRQA 4CZMA 1XUPO 3FZMA 4FWOA 3FZHA 2BUPA 1KAXA 5F2RA 2E2NA 1G99A 4QS8A 4FWNA 4E1JA 4FWPA 1GLJO 5FPMA 1ZBSA 5BN9A 4B1UB 1QQNA 2D0OA 2AP1A 3MCPA 3S41A 4CZFA 3CERA 1YUWA 1Z6RA 3R6MA 1T6CA 4IZ9A 3BF1A 4BRFA 1NGGA 3MK6A 5AQJA 2ASMA 3CJ7A 3GOIA 3VOVA 2CGJA 2DPNA 2QM1A 4B1WB 4BG9A 1BO5O 1ATSA 3QDKA 3A0IX 3OHRA 4C23A 1JCFA 4WQ5C 4IXCA 4MLEA 4H5NA 3VF6A 1T44A 2P9KB 2P9LA 4BR0A 5LJVA 1NGCA 4BRCA 5JLFA 2HMPA 2QWNA 3EKUA 1LCUA 3VEOA 3ZX2A 5E26A 3FE1A 2A40A 2V7YA 4H0VB 4IWVA 5AQPA 1KAYA 1RGIA 1U2VA 4MLHA 1NGBA 5BPLA 3ATUA 1QZ5A 1GLCG 2V52B 3A5NC 4L3QA 5AQMA 4CD1A 5E84A 2FF6A 3D2EA 4QS7A 1GLDG 1IJJA 2Q2RA 2W41A 4BRDA 1WOQA 4BC2A 1X9JA 2P9IB 1K8KA 1NGFA 4BR7A 3D2FB 4I6MA 4ISEA 5KQDA 3UKUB 2CGLA 5CE3A 3W0LA 1JCEA 2ZGYA 4BC5A 1NBWA 3SJHA 4CZIA 4BC4A 1X3MA 4AM6A 5AQZA 3M1FA 3AARA 1QQMA 5BRDA 3O5BA 5BRHA 1TYQA 2A42A 4EIAA 4CJ7A 1Q18A 5KPRA 2FXUA 5AQSA 3WEEA 2P9NB 5AQXA 5AQGA 4ISGA 3LDPA 4NB4A 4XEIA 5F1XA 1NWKA 1NGAA 2Q31A 4FWSA 4FWMA 3RSEA 3CJAA 2QWQA 4BRPA 3SMPA 5FPEA 3C7NB 4QS9A 5AQLA 4A61A 4Y0WA 1XC3A 4BR5A 2I7PA 3B8AX 3KZBA 3M3ZA 5AQHA 1NM1A 1HX1A 2IIRA 3UKRB 2QWRA 4BGAA 3IFRA 4BRLA 3M6GA 4FSVA 3H3NO 1ESVA 4YDUC 3VPZA 2E2PA 2E1ZA 3AAPA 4FWRA 3H46O 4BRKA 1JCGA 5BRFA 2P9UA 4H0TB 5LY3A 3DXMA 1RDWX 3GE1A 4H5VA 4ISFA 4PL7A 4BRGA 2E8AA 5AQVA 4M7XA 3D7EO 5BN8A 4RCHA 4PL8A 3GL1A 1S3XA 1OKJA 3WQTA 3IUCA 1T6DA 1GLFO 2P9IA 3R8EA 4WQ4C 3VEVA 1MA9B 3D2FA 3DAWA 5JLHA 3LDLA 4HWIA 3ZETB 4BVPA 3CQXA 3VERA 1GLBG 3UE5A 3VESA 2FLOA 1D4XA 2F9TA 3HZ6A 3WXJA 5AZJA 2VYPA 3ZX3A 4CBUA 5LJWA 3G25A 3VGMA 1Y64A 1NGIA 4PKHA 4JAXA 4EHUA 1Z05A 4RWTA 3CETA 2Q36A 1ZXOA 3FZFA 3DXKA 4KBOA 4JHDB 1CZAN 5AR0A 4EAHD 1SZ2A 4H0OA 2E88A 4K42A 2F9WA 4FWKA 2HF4A 3JS6A 4A2AA 4WYBA 3VGLA 4B1YB 3O4WA 2HF3A 2FSKA 3O1WA 5JMVA 1HKBA 4H5TA 2P9PA 3H6EA 3IDHA 1BA1A 2D4WA 3JXUA 3MN5A 3O1BA 1YAGA 3O08A 5AFUA 3LM2A 4FL9A 4CZJA 5ADXH 5FPNA 4WQ5A 1HKCA 2I7NA 3EO3A 4FO0A 3VEYA 2YI1A 3QMLA 3ULEB 5EY4A 2A5XA 3O80A 4H0XB 1EQYA 3MDQA 3I33A 4DCHA 2P9SB 3MN9A 4CD3A 1BDGA 3BF3A 3DWLA 3GBTA 1BA0A 3R9PA 3ZETA 5KPZA 2D1KA 3EL2A 4JNEA 3QFPA 4FPAA 5BREA 4BR2A 4CBXA 3FR0A 5FPDA 2IVNA 3GG4A 5EXWA 2ASPA 2FSNA 1NGHA 1BOTO 2YCHA 4A62A 2A41A 2Q0UA 2CH6A 2H3GX 3CI5A 3VGKA 4DQ8A 3WQUA 3CJCA 1E4FT 4H0PA 4BGBA 1XQSC 5AQUA 5KPTA 4FWQA 5BR9A 3W3DA 3IMXA 5AZIB 3P4IA 1DKGD 1DEJA 1KAZA 4BVOA 4RTFD 4FWLA 2E2OA 2NRHA 2YHWA 3WUHA 2WUSA 1V4SA 4HTLA 4BRMA 2FF3B 5ELZA 4B1XB 4EHTA 4CI6A 1C0FA 3HTVA 2P9KA 5JICA 5AQOA 1ATRA 4IJNA 3LDNA 1U6ZA 3ATVA 4XH4A 2GTDA 2QXLA 4H5RA 2QWPA 1TUUA 1SQKA 1R59O 3F9MA 4CZEA 1GLAG 4IO8A 1GLLO 1IG8A 2OANA 4B9QA 3U9DA 3ZX0A 5AQRA 1QZ6A 1HJOA 3TU5A 1C0GA 2NLXA 3H1VX 2P9LB 1NLVA 3BP8A 2YHYA 2NZTA 3ULEA 5F0XA 3LM9A 1ZC6A 2YJEA 1QQOA 2YHXA 4H0YB 4YDUA 4BRNA 1HKGA 1BU6O 5B8HA 3HI0A 4JD2B 3UKUA 4BG8A 1U2VB 4K41A 1NGEA 5EX5A 3FZLA 4H5WA 3U8XA 3QFUA 3QB0A 4EFHA 3EZWA 2PAVA 3QBXA 1NMDA 2AA4A 2J4RA 1E4GT 1K8KB 3QICA 2P9NA 4AM7A 4F9OA 2Q1NA 4XH1A 2BTFA 4BR4A 4I6MB 1GLEG 4O8KA 4PKIA 2A3ZA 4WQ4A 1X3NA 3VETA 3MN6A 3H3OB 4BRIA 2V7ZA 3A5LC 3C7NA 4BREA 1MWMA 5AZIA 1YXQA 4DHYA 4XH5A 2KHOA 2PBDA 2QWMA 3SLCA 1TYQB 4BQLA 3UB5A 3ENHA 3VEZA 2Q0RA 3CIPA 4H03B 4CZLA 3UKRA 3WEEB 3LDQA 5AQYA 4CBWA 1HLUA 1P8ZA 2VWBA 3RSEB 5AQWA 3L0QA 4NO7A 3VF2A 3VF4A 3ZEUB 4MO5A 2VCPA 2GWKA 5AQTA 3VENA 3GDQA 3FFKB 5AQFA 3H45C 5BPMA 2CGKA 4GNIA 4CZGA 3A8YA 1NGDA 1S22A 4LC9B 4O5FA 5AQQA 4FOIA 3HM8A 5AFUH 4BQZA 2QWOA 2QW9A 4GY2B 1MDUB 2P9UB 2QWLA 1H1VA 3DXMB 3ENOA 4JD2A 1J6ZA 4BC3A 5ADXA 4BROA 1YVNA 4IJAA 4BR9A 4MO4A 3C0BA 3WXLA 2UYTA 5EOYA 3VEXA 1BWFO 3CHWA 3I8BA 1NGJA 5I9EB 4CZHA 2HOEA 3AY9A 5BPNA 3TPQA 2E1YA 1BG3A 4B1VA 3A5MC 3BEXA 1DGKN 3ID8A 1KXPA 1WUAA 3LL3A 3CJ9A 1TUYA 2D0PA 4BRHA 3L6QA 4FPBA 1SAZA 2A6AA 4J8FA 4JHDA 4PKGA 2Q97A 2GWJA 1QHAA 2IVPA 3MMVA 1RFQA 2GEMA 5AZJB 4M63C 3HBTA 2FSJA 3WT0A 4CZKA 3J8AA 1BUPA 2YJFA 1HPMA 2E20A 3BUZB 4BRAA 5AQIA 2GELA 1ATNA 3DXKB 2ITMA 3VEWA 3ZEUA 3DJCA 3CJBA 3FZKA 3KHYA 2EWSA 2CH5A 2ZWHA 3CQYA 3U9ZA 3WXKA 2V51B 4JN4A 1LOTB 3KVGA 3O8MA 5EVZA 3WXIA 3A5OC 3LDOA 1V4TA 3SMSA 3QBWA 3HSCA 3AAQA 4K43A 2ASOA 2P9PB 5AQNA 1MWKA 5KQ8A 3EKSA 3O6WA 1HUXA 3MN7A 3CJ1A 4A2BA 2E2QA 4B1ZA 3FGUA 2P9SA 3FLCO 2IVOA
chains in the Genus database with same CATH superfamily
2W40A 3H1QA 1RDAA 4K25A 4CFDA 3TANA 4DQQA 1KFDA 3L4IA 3S5TA 2VQFK 3SUQA 1O13A 4Z94A 3ZLJA 5TKYA 3V9UA 3KWGA 1LWEA 4O0IA 4CF9A 2BUPA 2FC0A 2HSTA 3V9ZA 2E2NA 1G99A 3E1YA 4QS8A 4FJKA 3EZ5A 4NLBA 1HR0K 1RT7A 1EWQA 2NRRA 4N41A 3Q7BA 4IDHA 3VTIA 3SV3A 1OH5A 3QLHA 2AP1A 1NKCA 1TK5A 1DTQA 1Z6RA 3V81A 3MEGA 3BF1A 3E9PA 4RW4A 1SV5A 4BRFA 4JI6K 1FKOA 3MK6A 1HPZA 3CJ7A 2YX6A 4JS5A 5D3GA 2CGJA 2DPNA 3THWB 1EO1A 1BO5O 1L5UA 4F3TA 3PO4A 1C1CA 3I0RA 2ETJA 3U3GA 4WFNL 1S72N 5C24A 4IXCA 1LWFA 4CF1A 3VF6A 1WLJA 1NGCA 1BIUA 2YNHA 5JLFA 3VEOA 4DTPA 3JYTA 4CCHA 4H0VB 4IWVA 4I7FA 1KAYA 1RGIA 1QTMA 3OYEA 2HNZA 1GOAA 2QA4N 3TABA 1FW6A 3ATUA 3L2WA 4OLAA 1GLCG 2FF6A 5GAHP 4QS7A 4CGDA 1NOYA 3TTCA 3WNHA 1X9WA 2W41A 3K9KA 1G15A 4BRDA 3PV8A 4BC2A 2P9IB 1K8KA 3QEWA 2KZMA 3SBGA 4BR7A 3QESA 4ISEA 5CE3A 2CGLA 3W0LA 1JCEA 1IV0A 4BC5A 4OGCA 4LSLA 2BGGA 4CJ7A 4FM0A 4B3RK 5CYQA 3C94A 3WEEA 1VQ7N 3S3MA 1TAUA 1C0TA 1JLQA 3KK3A 5F1XA 2Y1IA 1NWKA 1NGAA 2Q31A 4FWSA 4FWMA 1Z25A 4BRPA 3C7NB 3THWA 3VA3A 3TSUA 5GAGP 3QEVA 3M8QA 3MXIA 2E6MA 2G8FA 5LL6Z 1NM1A 3SUOA 2O4GA 2HBJA 4E19A 3M6GA 1K9MO 4FJHA 2E1ZA 3N4PA 2KQ2A 4DSKA 3FFIA 1JCGA 4V19S 5BRFA 1TL3A 4C8OA 1LAWA 4ISFA 1RBRA 2AJQA 2GBZA 1SUQA 1C0MA 4F8RA 2XY5A 3IUCA 2O8BB 1T6DA 3PSFA 2UXDK 1GLFO 2P9IA 2YHAA 5HL7L 4Q5VA 1Q8IA 3SZ2A 4FK4A 4OPJA 4IO9L 3SCXA 2P5GA 5JLHA 1VSKA 4F3OA 4DS4A 3QEIA 3K5MA 2VYPA 3OVNA 1Y64A 1IBLK 3DLHA 4OGEA 4PKHA 4JAXA 3QETA 3M5RA 3CETA 4CGFA 5J2NA 4IFEA 4KHUA 4Z4EA 1C1AA 1W97L 1ZXOA 3FZFA 1I3AA 1IKYA 4CJUA 2ZQBA 1NJYA 4K42A 4CK1A 4EP5A 4U67L 1VQKN 1KTQA 4FWKA 3JS6A 4WYBA 4W5RA 4CEDA 1T05A 1HKBA 4OO1J 3OYFA 3CF5L 3D0PA 4YORA 5J1EA 1HNZK 4RW7A 3MN5A 3E01A 3E9OA 3JSMA 4DFPA 4LH5A 4JLHA 3VQCA 1S1UA 5AJ3K 4FJJA 4CZJA 1CLQA 1Q9XA 3OBYA 3K5NA 1HKCA 2O8BA 2YI1A 3QMLA 1BQMA 4FLUA 4BDPA 3ZYYX 2A5XA 4H0XB 1U4BA 3CC2N 4CHYA 4CD3A 3GBTA 4JKFA 2RE2A 1QSLA 2JLEA 3QFPA 5CHIA 3M8SA 4DUZK 1Q82O 4DR2K 5EXWA 3ISNC 4NCAA 3TAFA 3A2FA 2KLAA 1IO2A 1JLCA 2H3GX 3VGKA 1VQ4N 3RWUA 2QEXN 4LFCK 3ZSZA 2VGNA 2HHHK 4FJ8A 3LALA 1VHXA 2RKIA 4RTFD 3VQAA 4E7IA 2A1SA 4B9SA 1V4SA 4HTLA 3IRXA 1T03A 4DFMA 5I3UA 4CI6A 1C0FA 3L2UA 3KD5E 1RBUA 4IJNA 4XH4A 4E1MA 3O4NA 3F5TA 2QWPA 3NF9A 1TUUA 4JKGA 5C25A 1SQKA 1R59O 5JS2A 4CZEA 4IO8A 4AHTA 1NKEA 1J54A 2IC3A 1VQLN 3ITHA 1S1VA 3AVCA 1B9FA 2YNGA 3RMDA 1C0GA 3SBTA 4R5PA 3T69A 2Z1IA 3TAEA 3BP8A 4IOAL 2NZTA 2E5LK 1U48A 5F0XA 1ZC6A 2YJEA 4BRNA 1FKPA 1BU6O 5B8HA 4JD2B 4CW7B 3ZT4A 4CK2A 1TVRA 4BG8A 3LDSA 1U2VB 3VQ6A 1QVGM 4CF0A 4CK3A 5EX5A 4KI4A 1ZBLA 1W2BM 4LF6K 2WTUA 4EFHA 1RT5A 2AA4A 2J4RA 2NRTA 3DLBA 1E4GT 3VQ4A 2P9NA 2YKMA 2Q1NA 3ZSQA 2I5JA 4F2RA 4ILJA 2A3ZA 1X3NA 3VETA 4BE7B 1KQSM 2EHGA 1MWMA 2PY5A 2OTJN 3DLEA 3E66A 3UB5A 1KFSA 5HBMA 3HVTA 3AO3A 3NCIA 3U3YA 4G1QA 3AO5A 3LDQA 3NF7A 5M1PA 4DTUA 4WFBL 3RSEB 5AQWA 3VF2A 4AHUA 4CJSA 2OPPA 3LANA 4Z4FA 2VCPA 3GDQA 1C6VA 1VQ8N 3B6OA 3B6PA 3H45C 2HMIA 4CHZA 4Y1CA 1S22A 5C42A 4O5FA 1RT6A 3OYKA 3HM8A 1ZBHA 2HHSA 2W42A 2BANA 3C6HA 3OJUA 1VSEA 4JD2A 1Q86O 3TWHA 3TR8A 4BROA 4KI6A 4BY9C 5EOYA 2C1IA 5I9EB 5BR8K 2ZJRL 2FBYA 4DV4K 1ILYA 3KK7A 4J2EA 4CJQA 3BEXA 1DGKN 5GAEP 1YIJN 3ID8A 2LSNA 2IDOA 3NGIA 1KXPA 5LMUK 3QERA 4JI5K 3OYDA 3L6QA 4FPBA 3PIPL 2EX3A 3V1OA 1VAZA 4DF8A 2GWJA 1NG9A 1JXBA 5AZJB 3ZSXA 4JI7K 2UXBK 2OPRA 1T3VA 3P31A 3QIOA 3J8AA 3ZT3A 3AA3A 3HVRA 3BUZB 3L3VA 4IDKA 5HRRA 4DTXA 5AQIA 2GELA 5EU7A 2ITMA 3WXMB 1XI1A 2OPSA 2BH1A 3IS9A 1B92A 3D45A 2KKZA 1REVA 3NVKA 1LOTB 1JLEA 2O8CA 4I9QA 3TI0A 3CFPA 3CMAN 5JS1A 2P9PB 1MWKA 3HSTB 2YNFA 3NAEA 3T1HK 3VQBA 4ELVA 3QINA 2E2QA 4A5AA 1VQON 2O8FB 2IVOA 2GUPA 4BEBA 4Z4GA 1IKWA 3D2EB 3MCAB 1GOBA 4DSFA 2HBMA 4DB3A 4JRQA 3U4LA 4YHHK 4GVMA 3R3LA 1YJWN 2ZGZA 2X78A 4M7YA 4LFAK 1ZBFA 4BRQA 1XUPO 4E1NA 3SQ2A 1U45A 3C6TA 3FZHA 4JKAA 5F2RA 3I8DA 4CERA 3MX5A 3OBWA 1GLJO 2XHBA 5FPMA 4HCCA 4E7HA 1N32K 3KKRA 3SYZA 2G8VA 4LSNA 5J2QA 3AGKA 4O5BA 4RW6A 3S41A 3CERA 1RDUA 1A5VA 5H1SQ 3VOVA 2Z1HA 4B3MK 1HNVA 1ATSA 1CZ9A 3OW2M 4AHSA 3OHRA 1SKWA 4FLZA 1P90A 1M1KO 4H5NA 1T44A 3KIOA 2P9KB 5KTQA 4BR0A 3IKMA 2XRIA 4BRCA 3KLGA 2QWNA 3CPWM 1LCUA 1YJNN 4JI1K 4DV2K 2OA8A 3FE1A 2A40A 2V7YA 1SL0A 3OYGA 1NGBA 3L2VA 4H4MA 5AQMA 4CD1A 5E84A 3D2EA 3P83D 4KPYA 1X9JA 1NK9A 5M1KA 1JJ2M 4WE1A 4FJ9A 4WCEL 3KKSA 3D2FB 5KQDA 4OKKA 1LW2A 4M3ZA 5M1QA 4CZIA 5J2PA 3SJHA 4DG1A 4AM6A 3WNGA 4Z4CA 5AQZA 3TSQA 3G10A 3M1FA 3AARA 3HK2A 3DI6A 4LFBK 1RTDA 1LAVA 3ZSVA 1TYQA 4NLCA 3PX6A 5KPRA 2FXUA 1VSLA 5AQSA 2KTQA 4KKOA 4HTUA 3SNNA 4MDBA 1N36K 4GV9A 3LDPA 3K5OA 1VRUA 1RDBA 4XEIA 2NRZA 2G8IA 3LAKA 2FBVA 5AQLA 3K5LA 4FCYA 1XC3A 2WOMA 1DTTA 3B8AX 1RCHA 3M3ZA 1QSYA 2IIRA 3UKRB 4BRLA 4YDUC 4KB1A 4CHPA 2IS3A 4YOYA 1VSFA 5KGXA 3UIQA 2P9UA 4H0TB 1FXXA 4AHRA 5LY3A 1RDWX 2OYQA 4C8KA 4M42A 4LD0A 3D7EO 4B8CA 5BN8A 4C1NI 4PL8A 1NK8A 3RVCA 4O4GA 4BDYA 1OKJA 3F2KA 1HYZA 3L2QA 3CC7N 2W6KA 2XO7A 3ZSYA 4JK7A 3ULDA 1X1PA 4WQ4C 3D2FA 1VQPN 1N6QA 3I55N 3LDLA 3J7YP 4ZHRA 2RF2A 4J2BA 4B8AB 2F9TA 3WXJA 4OPAA 4CBUA 3ZX3A 1VQ9N 1NKBA 3G25A 3VGMA 3PO5A 1NGIA 2PZSA 4EHUA 3THXA 3SQ4A 1XC9A 3O9QA 1FK9A 4CJKA 3SUNA 4KBOA 4JHDB 1CZAN 4XJXA 3AGRA 4H0OA 2D5RA 3TARA 2KZZA 3MWPA 4B9VA 4OJRA 3LWLA 2HBKA 3OYHA 1M90O 4B1YB 2DY4A 3O4WA 3O1WA 3L8BA 4AILC 4CF2A 1K73O 3AVNA 3J80O 1HYVA 2D4WA 2X6SA 2OZSA 1YAGA 4E72A 4KHNA 2PFUA 3HP9A 2VGMA 5ADXH 1Q9YA 5FPNA 1TAQA 4CHQA 3AO1A 4CF8A 2I7NA 5C12A 4OLBA 4AH9A 3OYCA 4KH6A 4CJWA 4KTZA 5EY4A 1IBKK 2VG7A 2OZMA 1TKXA 2P9SB 3MN9A 1BDGA 3BF3A 3LPTA 1N8RO 4JKCA 1K8AO 4LF5K 2D1KA 1WSIA 3EL2A 5DK5A 3OYBA 5BREA 4FPAA 3C65A 4PY5A 1S1WA 3DMJA 4CBXA 4DQRA 3O4QA 2IVNA 4OKJA 2FSNA 1NGHA 2VWKA 3OYNA 4A62A 1NJIO 2A41A 2Q0UA 2CH6A 3DRSA 4B3OA 4PHTX 4JK9A 4IFYA 4MQ3A 3WQUA 4CJLA 3CJCA 4H0PA 4FJIA 4BGBA 1D5AA 3EEQA 5AQUA 3AVBA 3P39A 1HJRA 3IMXA 1DKGD 1KAZA 1HNXK 2E2OA 2YHWA 4LF8K 2QK9A 2JWLA 2FF3B 4EHTA 4OPKA 3HTVA 2P1JA 1QSSA 1U6ZA 4AHVA 3CCMN 2GTDA 4M3TA 1HNIA 2RN2A 3ZT2A 1MU2A 1VRTA 3CCRN 3PY8A 1JL2A 4BWJA 3ZX0A 4H8KA 1QZ6A 1D9FA 3Q7CA 1HJOA 3RTVA 2QKKA 4IKFA 1WAJA 1NK6A 2NLXA 2P9LB 3V1RA 1NLVA 1O1WA 3CYGA 3K2PA 4CGGA 3P1GA 1A5XA 1KRPA 4Y1DA 4YDUA 3J7ZO 4KRFA 4K41A 4RW8A 3AVKA 3DLLL 3FZLA 2Q3SA 3SI6A 2D0AA 4CEEA 1QVFM 1BCOA 4IOXA 3NF6A 3CMEN 3QBXA 1C0UA 3EYZA 1TV6A 1VSDA 3KK1A 2G8UA 4J2DA 4BR4A 4KHWA 1VK0A 4I6MB 1GLEG 4E89A 1R0AA 4O8KA 4PKIA 4M45A 4WQ4A 1BIZA 3H3OB 4BRIA 3PX4A 2V7ZA 3C7NA 4DR4K 1YXQA 4BQLA 3VEZA 1ZYQA 4C8NA 2Q0RA 4H03B 4IBNA 2KW4A 3RMBA 4NXMK 1UAXA 2VWBA 4RW9A 3KK2A 3FFKB 5AQFA 1YTUA 3N4QA 3DLKA 4F2SA 3CC4N 1IG9A 2WC9A 4YY3K 4LC9B 5GIPA 4UQGA 5AFUH 2HHQA 3HT3A 2QWOA 3V9SA 4GY2B 1YJ9N 5SZTA 1MDUB 4A59A 3DXMB 3MXJA 4BC3A 1J6ZA 5ADXA 4KREA 1NK4A 3LP1A 4CECA 4ELTA 1S9GA 1VQMN 5FLXO 4LH4A 4DSEA 2UYTA 3VEXA 4GV6A 2C1GA 4FM1A 4KH5A 4CIGA 1YITN 4B3SK 3L2RA 1BG3A 4DR5K 3VQPA 4CIFA 4OX9K 1RBTA 2IOCA 4IOCL 1TUYA 4BRHA 4O55A 4W5TA 2A6AA 5M1OA 1I39A 4DU4A 4CVNE 1QHAA 4DTRA 4M63C 3HBTA 3WT0A 4CZKA 3HPOA 4CJRA 1F21A 2YJFA 3HRGA 1EKEA 3VN5A 1HPMA 1J53A 2D0CA 3T7ZA 1T7PA 3F73A 3IAYA 3AVFA 4BRAA 1CXQA 5IWAK 3DXKB 4DQPA 5IT9O 3VQEA 3CQYA 3U9ZA 1JXEA 1KVCA 4Z0UA 4JN4A 1S1TA 1SKSA 1V4TA 1RTIA 3QBWA 4CFAA 3AAQA 4K43A 2ASOA 3AVJA 2HHVA 3EKSA 3THVA 3PX0A 3O9RA 3O6WA 3K0SA 3THYB 1HUXA 1IBMK 3RMAA 4B1ZA 3HPGA 2YCHA 5TKWA 4DV5K 2ZF5O 4HCBA 3SK3A 4JEPA 4XIUA 4JKBA 1RBVA 4YOXA 5AQKA 3OJSA 4CZMA 3KLHA 3FZMA 4FWOA 4DTOA 1CXUA 3SPZA 4E1JA 4NYNA 4GKKK 4W5QA 5BN9A 3CFOA 1QQNA 3NF8A 4JI8K 4DLEA 3CM5A 1T6CA 2HHXA 3RMCA 4FZZA 4Z4IA 1RTHA 1TKZA 4B9LA 5AQJA 2ASMA 3CCSN 4BG9A 4E7JA 3QDKA 1NU0A 2E4LA 4C23A 1JCFA 4WQ5C 5HP1A 4ILHA 4MLEA 3ZT0A 3OYJA 2RPIA 4FYDA 4PA1A 4DFJA 4B9TA 2UXCK 1WB9A 1YHQN 3EKUA 3KTQA 4CJFA 1N33K 3ZX2A 2HHTA 3NBPA 3O9TA 3J81O 4DMNA 2DFEA 2VWJA 1U2VA 5BPLA 1QZ5A 4L3QA 5HRSA 1EX4A 5JVGL 2Q2RA 4CJEA 3T1YK 1WOQA 4CJ3A 1NGFA 3MWTA 3RR8A 3VQDA 4DR7K 3WNFA 4DF4A 3UKUB 1NBWA 3OYMA 4E3SA 2HB5A 4N47A 1QQMA 4JV5K 1TGOA 5BRDA 5GINA 1WSHA 3O5BA 1JL1A 5BRHA 4DV3K 1ITGA 2A1RA 1UA0A 2XY7A 3MECA 2RHKA 5AQGA 4N5SA 4ISGA 3CQ8A 3V6DA 5HRNA 3HOTA 3RSEA 3CJAA 1HQEA 1BGXT 2QWQA 4DR1K 4QS9A 4A61A 1IKVA 4Y0WA 1X9MA 1UA1A 4DKWA 3AVLA 3L4QA 3NVMA 4PUOA 2HNYA 5AQHA 4CHNA 1HX1A 1JKHA 5I42A 2QWRA 2VG6A 4BGAA 2JWKA 3IFRA 4ID5A 3AA5X 2O8EB 3L3UA 4FSVA 1ESVA 2E2PA 3KWIA 1NJWA 3LP0A 4EZ9A 3H46O 4ELUA 4BRKA 3MEDA 1I94K 4HUFA 3T19A 3GE1A 3EE8A 4PL7A 4WFAL 4WF9L 2O8DB 3OY9A 4UY8O 1VSJA 1BISA 3GL1A 4CEOA 3P38A 3HP6A 3WQTA 3VQ7A 4QAGA 2O4IA 4CJ5A 4K8ZA 5FRNA 3R8EA 1OH7A 4PWDA 1XWLA 2KFNA 2YV0X 4B3TK 1S6PA 3CCVN 3DAWA 4YOUA 5C2FA 4BVPA 3ZETB 4K8XA 4CEQA 3UE5A 4ID1A 4Z4HA 2X74A 5AZJA 4GW6A 1VQ6N 4JYAK 1VSMA 1Z05A 1UOCA 4RWTA 3P5JA 2Q36A 3MAQA 5AR0A 1SZ2A 4E7LA 5CZ1A 1KVBA 4FVMA 3K59A 3O3FA 1RTJA 1JLAA 4DV6K 2HF4A 3VQ8A 4A2AA 2Z1JA 4X62K 1S1XA 5JMVA 2O8EA 1OVYA 2P9PA 3SAGA 1XMOK 1NJXA 3H6EA 3IDHA 3ZSWA 4DU1A 1BA1A 2UUAK 3CD6N 1K6YA 1TK8A 2O8FA 3O1BA 5J2MA 4I9LA 2O8DA 3O08A 3KJVA 1U49A 5JENA 1NNEA 4WQ5A 5FROA 3EO3A 4FO0A 4NYFA 4DFKA 3CCUN 1EQYA 4LF4K 3MDQA 5GIOA 4DCHA 4LY7A 1BA0A 3R9PA 3ZETA 1ASVA 1TK0A 3RR7A 4K0KK 4YNQA 3OS2A 3FR0A 5FPDA 3GG4A 3IG1A 3VTHA 4FJNA 4FM2A 4JS4A 3WNEA 1TKDA 3CI5A 3AVHA 1WSEA 1S9EA 1RNHA 1E4FT 4X64K 4IG3A 4FWQA 1UWBA 2UUCK 3W3DA 5AZIB 3P4IA 4M3RA 1W9HA 2HW3A 4BVOA 4FWLA 4R79A 3WUHA 2KFZA 4BRMA 2G8WA 3AO4A 4G9ZA 2P9KA 5JICA 1VQNN 2UU9K 3NFAA 4AHCA 3LDNA 1BQNA 2QXLA 4H5RA 3KLEA 4W5NA 3V1QA 2ZE2A 1BCMA 3F9MA 1GLAG 4BECA 3U9DA 1WNSA 3NH1A 1RT1A 2OTLN 3TU5A 3H1VX 3G6EN 2YHYA 3CM6A 4H0YB 2YHXA 3C6AA 4DLGA 5CR4A 1XHXA 1HKGA 4FVUA 3CCJN 2Z1GA 2HVIA 3QB0A 4B9NA 5DMRA 1XNRK 1BI4B 2FBTA 4RG8A 3HYFA 4HUGA 1K8KB 4BE0A 4MFBA 4AM7A 4F9OA 1J9AA 2IAJA 4XH1A 3NDKA 3CYMA 4OVLA 3QNNA 1YT3A 3MN6A 4I2QA 4QOZB 3A5LC 4CJ4A 5AZIA 2DTUA 4XH5A 4FLXA 2KHOA 2PBDA 2QWMA 3SLCA 1ASWA 5CZ2A 3NGYA 3CCEN 1QE1A 3ENHA 2BE2A 4HUEA 4FLVA 4GMJB 4O8UA 4DQIA 3H08A 3UKRA 3WEEB 1C1BA 1S5JA 3HOSA 1HLUA 1P8ZA 5GADP 3NHGA 3BGRA 4NO7A 4CJTA 3VF4A 4BE1A 3ZEUB 3O9SA 3VENA 2GWKA 4KHYA 5SWMA 3SJJA 3C6UA 3AO2A 2NUBA 4KHSA 4GNIA 4CZGA 3OYAA 3A8YA 4CJVA 4U7BA 3VQQA 3G4SN 5AQQA 4M3XA 1LV5A 4FOIA 2F96A 2ZJPL 2QW9A 5CY4A 2WONA 4JKHA 3ID6A 3T1AA 4M3UA 2QWLA 1YVUA 1YVNA 2OPQA 4IJAA 3QIPA 1X9SA 1B9DA 4ZTFA 3LWMA 3S3NA 1BWFO 3I8BA 4CEAA 1BI4A 4OPHA 3QO9A 3OS0A 2HOEA 5BPNA 1E3MA 3TPQA 2QXFA 4B1VA 3A5MC 1WAFA 4KFBA 3QNOA 1JLBA 1WSJA 3MXMA 3CJ9A 5KRTA 4JHDA 1L3VA 4DTSA 4GVEA 3QEPA 2IVPA 1RFQA 2GEMA 1KVAA 4IEIA 4IG0A 2G8KA 5T7BA 2FSJA 1WN7A 2PYJA 5JVHL 1BUPA 3HO1A 1L3TA 2E20A 1KD1O 3LAMA 1ATNA 3TTDA 3ZEUA 3CJBA 3FZKA 4KHQA 2CH5A 2ZWHA 3WXKA 1HYSA 4BACA 2V51B 1YI2N 5EVZA 3KVGA 5C10A 3KLFA 3WXIA 3A5OC 1W7AA 5A2QO 4FJ7A 3SMSA 4NXNK 4FJMA 3HSCA 3ZSRA 5KQ8A 3MN7A 3CJ1A 4C1NK 3AA2A 3FGUA 2P9SA 1KCFA 1RT3A 5M1NA 2P5OA 1RBSA 4C8MA 3EN9A 4FOEA 4LF7K 4KHPK 1OH6A 3O3HA 4KV8A 2BDPA 1JLFA 1KAXA 4FWNA 2B5JA 4FWPA 2P51A 1L3SA 3MX2A 3ZSOA 1ZBSA 2F8SA 4C8LA 2B4JA 4B1UB 4YFUA 3ZT1A 2D0OA 3CFRA 3MCPA 2QKBA 4CZFA 1YUWA 1A5WA 1XHZA 3R6MA 4QCLA 4IZ9A 3EY1A 2VQEK 1NGGA 3E9LA 4DQSA 3GOIA 5KGWA 2QM1A 4B1WB 1OH8A 3A0IX 4DU3A 3U6FA 3OYLA 2P9LA 3NH0A 5LJVA 3MEEA 2YKNA 2HMPA 4FJLA 3I0SA 4AQYK 4JI2K 5E26A 4JKGB 4DTNA 2PYLA 5MLCQ 5AQPA 4MLHA 3OS1A 2UUBK 5K14A 1J5EK 2V52B 3A5NC 1Y97A 3G0ZA 5KI6A 1GLDG 4W5OA 4BE2A 1IJJA 3F9KA 3TSPA 4X66K 1YF5L 5DM7L 5C15A 4I6MA 3K58A 3AVMA 4CEZA 1N34K 4CE9A 2ZGYA 3ALYA 4BC4A 1X3MA 4JKDA 1RILA 1EXQA 2A42A 4EIAA 5FDLA 1Q18A 1XNQK 2P9NB 5AQXA 4HVJA 3BDPA 3S9HA 3AV9A 4NB4A 4N56A 4KTQA 1NK7A 3SMPA 5FPEA 2F4VK 4YOWA 2GUIA 3VMFB 3SAHA 4DV0K 3LZIA 4E7KA 3CCQN 4E0DA 4BR5A 2I7PA 2QI2A 3KZBA 3PIOL 3M8RA 2W6LA 3KLIA 2HHUA 3H3NO 3VPZA 3T3FA 3AAPA 4FWRA 1DT9A 2QTDA 2W00A 1NMNA 4LF9K 3DXMA 4H5VA 4BRGA 2E8AA 5AQVA 4M7XA 1TL1A 2B6AA 3SQ1A 1XMQK 4RCHA 1S3XA 4AF1A 2NRVA 1VSIA 1BHLA 3V9WA 4MDAA 2WFBA 2NRXA 3VEVA 3LZJA 1MA9B 3BZCA 1YTAA 1WBDA 4X65K 1OVQA 4IFVA 4HWIA 3CQXA 3RRHA 3VERA 1RDCA 1GLBG 4FK2A 3VESA 2FLOA 1D4XA 1NOZA 1Q7YO 3S3OA 3HZ6A 4FLYA 5LJWA 5CYMA 2R7YA 1HQUA 4DS5A 1RT2A 3LP3A 4EZ6A 4OKEA 4FJGA 2WBNA 3DXKA 4EAHD 4A5BA 2E88A 4CJPA 2F9WA 2HBLA 4BWMA 2G8HA 3VGLA 4KO0A 3VQ5A 1WSGA 2HF3A 2FSKA 3BY5A 4H5TA 4FLWA 2D0BA 2OCEA 3THYA 4FXDA 3I56N 1QS4A 1Q81O 3JXUA 4GV3A 1KC8O 3HJFA 2FBXA 5HOOA 4FJXA 3NGZA 1U47A 5AFUA 3LM2A 1WBBA 3AVAA 4FL9A 2O8CB 1BL3A 1QHTA 3K57A 3VEYA 2IGIA 3ULEB 4FLTA 1LW0A 4BDZA 3O80A 4DSIA 3CPEA 3I33A 3DWLA 4M3WA 4NCBA 5KPZA 2GV9A 3O9UA 5E41A 4CFCA 4JNEA 1D9DA 4BR2A 2YHBA 3NE6A 1VSHA 3R1XA 4FZYA 2ASPA 2F8TA 2X6NA 2GX9A 1BOTO 4DSJA 1RDDA 3VQ9A 5HROA 5FRMA 1NJZA 4JKEA 4TSXA 4DQ8A 2ZM6K 1FJGK 1TKTA 3KD1E 4FK0A 4DR6K 2XY8A 1XQSC 5KPTA 1T8EA 2ITGA 5BR9A 1DEJA 1SL1A 1ASUA 2NRHA 3TAPA 2DFFA 2WUSA 3JAMO 2VG5A 4CEFA 4CGJA 4KH4A 5ELZA 4B1XB 5AQOA 1ATRA 2ZD1A 3ATVA 4J2AA 2NNWA 1IKXA 3TAMA 1QQCA 4JI3K 1GLLO 1IG8A 4CGHA 1S6QA 2OANA 4B9QA 4NCGA 5AQRA 4A57A 5HRPA 2ZJQL 4FJ5A 3AVIA 3DLRA 3CXCM 4JRPA 5C2DA 3TAGA 3ASMA 1SKRA 4CEBA 3ULEA 2HNDA 3LM9A 1QQOA 1GOCA 4EP4A 3HI0A 3V4IA 3UKUA 1EP4A 4DR3K 3RRGA 1NGEA 4H5WA 3U8XA 3QFUA 3EZWA 4GKJK 4L8RB 2PAVA 1NMDA 1W0HA 2E6LA 4O0JA 1HNWK 1JLGA 4H4OA 1WSFA 4CHOA 3QICA 4YOVA 2BTFA 5LMNK 4F4KA 4DV1K 3NH2A 4Q0BA 4DUYK 5M1FA 4KB0A 1HRHA 1EETA 1U04A 3HM9A 2HHIA 3SQ0A 4BREA 2JGUA 4IEEA 4ZTJA 4DHYA 2NRWA 4CFBA 1TYQB 4JK8A 3PSIA 2Y1JA 3EE9A 3CIPA 4CZLA 3O3GA 1N5YA 4ICLA 5AQYA 4CBWA 1KLMA 3HPHA 3AA4A 1L3UA 3L0QA 4MO5A 5AQTA 2YNIA 1HMVA 4FW1A 4I2PA 3TTFA 1LWCA 3DOLA 1SS6A 5BPMA 2CGKA 3BZKA 3ENBA 1NGDA 4JI0K 3HXMA 1DLOA 4BQZA 3OA9A 4N76A 3OTOK 3NMUA 2P9UB 4FW2A 3OYIA 1H1VA 3ENOA 4B08A 1RT4A 1J5OA 3TAQA 4BR9A 4MO4A 3C0BA 3WXLA 3LPUA 3CHWA 1ZBIA 4PQUA 3DLGA 1NGJA 4CZHA 3J7AP 3LP2A 3CG7A 3AY9A 3SAFA 2E1YA 2HHWA 3C95A 4YOTA 2HVHA 4DWIA 1WUAA 3LL3A 2F7TA 3K9JA 4HHTA 3DYAA 2D0PA 4M3YA 1SAZA 4J8FA 3HL8A 4JI4K 3M8PA 3G71N 4PKGA 4CESA 2Q97A 3DRRA 4CIEA 3SPYA 5HLFA 4KAZA 3MMVA 4B9UA 1CZBA 3AVGA 5DM6L 3V9XA 1NK0A 3ZCMA 3SUPA 4KTWA 2ATQA 4ILGB 3THXB 5KRSA 5C0YA 3QEXA 3PUFA 4DSLA 4M41A 1EWRA 1KLNA 3VEWA 3D6RA 3DM2A 3DJCA 3KHYA 2EWSA 1Z26A 1SL2A 3PLAA 2DFHA 4O44A 1NK5A 3O8MA 3DRPA 3CCLN 4B9MA 4DTJA 1ZBUA 3LDOA 3DOKA 1VQ5N 4CGIA 2XY6A 5AQNA 3VA0A 1D8YA 4A2BA 3SV4A 4DTMA 4FZXC 1KSPA 3FLCO 4DV7K 1IH7A
chains in the Genus database with same CATH topology
2W40A 3H1QA 2GUPA 5M1NA 4K25A 5TKWA 4BEBA 3EN9A 2ZF5O 4FOEA 3SK3A 4JEPA 3D2EB 3MCAB 4JKBA 4YOXA 2HBMA 3L4IA 4DB3A 3U4LA 5AQKA 3R3LA 1YJWN 2ZGZA 1O13A 4M7YA 4Z94A 5TKYA 4BRQA 4CZMA 1XUPO 3FZMA 3KWGA 4FWOA 3FZHA 2BUPA 1KAXA 2HSTA 4JKAA 5F2RA 2E2NA 1G99A 3E1YA 4QS8A 4FWNA 4NLBA 4E1JA 2NRRA 3MX5A 3OBWA 4FWPA 3Q7BA 1GLJO 3MX2A 4IDHA 5FPMA 1ZBSA 3VTIA 5BN9A 4B1UB 1QQNA 2D0OA 2AP1A 3AGKA 3MCPA 3S41A 4CZFA 3CERA 1YUWA 1RDUA 1Z6RA 3R6MA 1T6CA 4IZ9A 3BF1A 3E9PA 4BRFA 5H1SQ 1NGGA 3MK6A 3E9LA 5AQJA 2ASMA 2YX6A 3CJ7A 3CCSN 3GOIA 3VOVA 2CGJA 2DPNA 2QM1A 1EO1A 4B1WB 4BG9A 1BO5O 1ATSA 3OW2M 3QDKA 1S72N 3A0IX 4WFNL 3OHRA 4C23A 1JCFA 4WQ5C 4IXCA 3FLCO 4ILHA 4MLEA 1P90A 1M1KO 4H5NA 3VF6A 1T44A 2P9KB 2P9LA 4BR0A 3IKMA 5LJVA 1NGCA 4BRCA 5JLFA 2HMPA 1YHQN 2QWNA 3EKUA 3CPWM 1LCUA 3VEOA 1YJNN 3ZX2A 3O9TA 5E26A 4JKGB 5MLCQ 3FE1A 2A40A 2V7YA 4H0VB 4IWVA 5AQPA 1KAYA 1RGIA 1U2VA 4MLHA 1NGBA 5BPLA 2QA4N 3ATUA 1QZ5A 1GLCG 2V52B 3A5NC 4L3QA 5AQMA 4CD1A 5E84A 2FF6A 3D2EA 5GAHP 4QS7A 1GLDG 5JVGL 3TTCA 1IJJA 2Q2RA 2W41A 3K9KA 4BRDA 1WOQA 4BC2A 1X9JA 2P9IB 1K8KA 5M1KA 1JJ2M 1NGFA 3MWTA 3TSPA 1YF5L 4WCEL 5DM7L 3SBGA 4BR7A 5C15A 3D2FB 4I6MA 4ISEA 5KQDA 3UKUB 2CGLA 5CE3A 3W0LA 1JCEA 5M1QA 2ZGYA 4BC5A 1NBWA 3SJHA 4CZIA 4BC4A 1X3MA 4AM6A 5AQZA 4JKDA 3TSQA 3M1FA 3AARA 1QQMA 5BRDA 5GINA 3O5BA 5BRHA 1TYQA 2A42A 4EIAA 4NLCA 4CJ7A 1Q18A 5KPRA 2FXUA 5AQSA 3WEEA 1VQ7N 2P9NB 4MDBA 5AQXA 2RHKA 5AQGA 4ISGA 4GV9A 3LDPA 4NB4A 4XEIA 5F1XA 1NWKA 1NGAA 2Q31A 4FWSA 4FWMA 3RSEA 3CJAA 2NRZA 3HOTA 2QWQA 4BRPA 3SMPA 5FPEA 3C7NB 4QS9A 4YOWA 5AQLA 3TSUA 4A61A 4Y0WA 3VMFB 3SAHA 5GAGP 4DKWA 1XC3A 3L4QA 3CCQN 3NVMA 4BR5A 2I7PA 2QI2A 3B8AX 3KZBA 3M3ZA 5AQHA 3PIOL 1NM1A 1HX1A 2IIRA 2HBJA 3UKRB 2QWRA 4BGAA 2JWKA 3IFRA 4BRLA 3M6GA 4FSVA 3H3NO 1ESVA 4YDUC 3VPZA 1K9MO 2E2PA 2E1ZA 3KWIA 3AAPA 3N4PA 4FWRA 4YOYA 3H46O 1DT9A 2QTDA 4BRKA 2W00A 1JCGA 5BRFA 2P9UA 4H0TB 5LY3A 3DXMA 1RDWX 3GE1A 3EE8A 4H5VA 4ISFA 4BRGA 2E8AA 5AQVA 4PL7A 4M7XA 4WF9L 4WFAL 3D7EO 5BN8A 4UY8O 4C1NI 4RCHA 4PL8A 3GL1A 3RVCA 1S3XA 1OKJA 3F2KA 4AF1A 3P38A 2NRVA 3WQTA 3IUCA 3CC7N 1T6DA 1GLFO 2P9IA 4MDAA 2WFBA 4JK7A 3R8EA 5HL7L 4WQ4C 2NRXA 3VEVA 1MA9B 3D2FA 4IO9L 1VQPN 3CCVN 3DAWA 4YOUA 5C2FA 5JLHA 3I55N 3LDLA 4HWIA 3ZETB 4BVPA 3CQXA 3VERA 1GLBG 3UE5A 3VESA 2FLOA 1D4XA 1Q7YO 2F9TA 3HZ6A 4OPAA 3WXJA 5AZJA 2VYPA 3ZX3A 4CBUA 1VQ6N 1VQ9N 5LJWA 3G25A 3VGMA 1Y64A 1NGIA 4PKHA 4JAXA 4EHUA 3M5RA 3O9QA 1Z05A 2WBNA 4RWTA 3CETA 4IFEA 1W97L 2Q36A 1ZXOA 3DXKA 3FZFA 4KBOA 4JHDB 1CZAN 5AR0A 4EAHD 4XJXA 1SZ2A 4A5BA 3AGRA 4H0OA 2E88A 4K42A 4U67L 2F9WA 3MWPA 1VQKN 4FWKA 2HF4A 2HBLA 3JS6A 2HBKA 4WYBA 3VGLA 4A2AA 1M90O 4B1YB 3O4WA 2HF3A 2FSKA 3O1WA 5JMVA 1HKBA 4H5TA 1OVYA 4OO1J 2P9PA 3SAGA 3H6EA 3IDHA 1BA1A 3CD6N 3I56N 1K73O 3CF5L 2D4WA 1Q81O 4YORA 3JXUA 4GV3A 1KC8O 3MN5A 3O1BA 1YAGA 3E9OA 5HOOA 3O08A 5AFUA 3LM2A 2PFUA 2VGMA 4FL9A 4CZJA 5ADXH 5FPNA 4WQ5A 3OBYA 1HKCA 2I7NA 3EO3A 4FO0A 3VEYA 2YI1A 3QMLA 3ULEB 5C12A 4KH6A 5EY4A 3ZYYX 2A5XA 3O80A 4H0XB 3CCUN 1EQYA 3MDQA 5GIOA 3CPEA 3I33A 4DCHA 3CC2N 2P9SB 3MN9A 4CD3A 1BDGA 3BF3A 3DWLA 1N8RO 3GBTA 4JKCA 1BA0A 4JKFA 3R9PA 3ZETA 5KPZA 2RE2A 1K8AO 2D1KA 3O9UA 3EL2A 4JNEA 3QFPA 4FPAA 5BREA 3C65A 5CHIA 4BR2A 1Q82O 4CBXA 3FR0A 3R1XA 5FPDA 2IVNA 3GG4A 5EXWA 2ASPA 2FSNA 3VTHA 1NGHA 2GX9A 1BOTO 2KLAA 4A62A 1NJIO 2A41A 2Q0UA 4JKEA 2CH6A 2H3GX 3CI5A 3VGKA 4DQ8A 4PHTX 1VQ4N 2QEXN 4JK9A 3WQUA 3CJCA 1E4FT 4H0PA 2VGNA 4BGBA 1XQSC 5AQUA 5KPTA 4FWQA 5BR9A 3P39A 3IMXA 5AZIB 3P4IA 1DKGD 3W3DA 1DEJA 1KAZA 4BVOA 4RTFD 4FWLA 2E2OA 2NRHA 2YHWA 4R79A 3WUHA 2WUSA 1V4SA 4HTLA 4BRMA 2JWLA 2FF3B 4KH4A 5ELZA 4B1XB 4EHTA 4CI6A 1C0FA 3HTVA 4G9ZA 2P9KA 5JICA 1VQNN 5AQOA 1ATRA 4IJNA 3LDNA 1U6ZA 3ATVA 4XH4A 2GTDA 3CCMN 2QXLA 2NNWA 4H5RA 3F5TA 2QWPA 1TUUA 4JKGA 1SQKA 1R59O 3F9MA 3CCRN 4CZEA 1GLAG 4IO8A 1GLLO 1IG8A 4BECA 2OANA 4B9QA 3U9DA 3ZX0A 5AQRA 4A57A 1VQLN 2ZJQL 1QZ6A 2OTLN 3Q7CA 1HJOA 3CXCM 3TU5A 1C0GA 3SBTA 2NLXA 3H1VX 5C2DA 2P9LB 3T69A 3G6EN 1NLVA 3BP8A 2YHYA 4IOAL 2NZTA 3ULEA 5F0XA 3LM9A 1ZC6A 2YJEA 1QQOA 2YHXA 3C6AA 4H0YB 4YDUA 4BRNA 5CR4A 3J7ZO 1HKGA 1BU6O 5B8HA 3HI0A 4JD2B 3UKUA 4BG8A 4FVUA 1U2VB 4K41A 3CCJN 1QVGM 1NGEA 5EX5A 3DLLL 3FZLA 4H5WA 1W2BM 3U8XA 3QFUA 3QB0A 4EFHA 3EZWA 2PAVA 1QVFM 4IOXA 3CMEN 3QBXA 1NMDA 2AA4A 2J4RA 2NRTA 1E4GT 1K8KB 3QICA 2P9NA 4AM7A 4F9OA 2Q1NA 4XH1A 4YOVA 2BTFA 4BR4A 4I6MB 1GLEG 4O8KA 4PKIA 4ILJA 2A3ZA 4WQ4A 1X3NA 3VETA 3MN6A 5M1FA 4BE7B 3H3OB 4BRIA 1KQSM 2V7ZA 3A5LC 3C7NA 4IEEA 4BREA 1MWMA 5AZIA 1YXQA 4DHYA 4XH5A 2KHOA 2PBDA 2QWMA 2OTJN 3SLCA 2NRWA 3E66A 1TYQB 4JK8A 3UB5A 4BQLA 3CCEN 3EE9A 3ENHA 3VEZA 2Q0RA 3CIPA 4H03B 4CZLA 4O8UA 3UKRA 3WEEB 5M1PA 3LDQA 5AQYA 4CBWA 3HOSA 1HLUA 1P8ZA 2VWBA 5GADP 3RSEB 4WFBL 5AQWA 3L0QA 4NO7A 3VF2A 3VF4A 3ZEUB 3O9SA 4MO5A 2VCPA 2GWKA 5AQTA 3VENA 3GDQA 3FFKB 5AQFA 3TTFA 1VQ8N 3N4QA 3H45C 1SS6A 5BPMA 2CGKA 4GNIA 3ENBA 4CZGA 3CC4N 3A8YA 4U7BA 2WC9A 1NGDA 1S22A 4LC9B 4O5FA 5AQQA 3G4SN 4FOIA 5GIPA 3HM8A 5AFUH 4BQZA 2ZJPL 2QWOA 2QW9A 3C6HA 3OA9A 4GY2B 3ID6A 4JKHA 1YJ9N 3NMUA 1MDUB 2P9UB 4A59A 2QWLA 1H1VA 3DXMB 3ENOA 4JD2A 1J6ZA 4BC3A 5ADXA 1Q86O 4BROA 1YVNA 4IJAA 4BR9A 4MO4A 3C0BA 3WXLA 1VQMN 2UYTA 5EOYA 3VEXA 1BWFO 4BY9C 3CHWA 3I8BA 4GV6A 2C1IA 1NGJA 5I9EB 4OPHA 4CZHA 2C1GA 4KH5A 2HOEA 1YITN 3AY9A 5BPNA 2ZJRL 3TPQA 3SAFA 2E1YA 1BG3A 4B1VA 3KK7A 1ILYA 4YOTA 3A5MC 3BEXA 1DGKN 5GAEP 1YIJN 3ID8A 1KXPA 1WUAA 3LL3A 2F7TA 3K9JA 3CJ9A 4IOCL 1TUYA 2D0PA 4BRHA 3L6QA 4FPBA 1SAZA 3PIPL 2A6AA 4J8FA 4JHDA 3G71N 4PKGA 5M1OA 2Q97A 1VAZA 4GVEA 2GWJA 1QHAA 2IVPA 3MMVA 1RFQA 2GEMA 4IEIA 5AZJB 4M63C 3HBTA 2FSJA 3WT0A 1T3VA 3P31A 4CZKA 5DM6L 3J8AA 5JVHL 1BUPA 2YJFA 3HRGA 4ILGB 1HPMA 3T7ZA 2E20A 3BUZB 5C0YA 4BRAA 1KD1O 5AQIA 2GELA 1ATNA 3TTDA 3DXKB 2ITMA 3VEWA 3D6RA 3WXMB 3ZEUA 3DJCA 3CJBA 3FZKA 3KHYA 2BH1A 2EWSA 2CH5A 2ZWHA 3CQYA 3U9ZA 2KKZA 3WXKA 2V51B 1YI2N 4JN4A 3NVKA 3PLAA 1LOTB 3KVGA 3O8MA 5EVZA 5C10A 3CCLN 3WXIA 3A5OC 3LDOA 1V4TA 3SMSA 3QBWA 3HSCA 1VQ5N 3CMAN 3AAQA 4K43A 2ASOA 2P9PB 5AQNA 1MWKA 5KQ8A 3EKSA 3O9RA 3O6WA 1HUXA 3MN7A 3CJ1A 4C1NK 4A2BA 2E2QA 4A5AA 4B1ZA 3FGUA 2P9SA 1VQON 2YCHA 2IVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W40 A;  3H1Q A;  2GUP A;  4K25 A;  3EN9 A;  2ZF5 O;  4FOE A;  3SK3 A;  3D2E B;  3L4I A;  4DB3 A;  3U4L A;  5AQK A;  2ZGZ A;  4M7Y A;  4Z94 A;  5TKY A;  4BRQ A;  4CZM A;  1XUP O;  3FZM A;  4FWO A;  3FZH A;  2BUP A;  1KAX A;  5F2R A;  2E2N A;  1G99 A;  4QS8 A;  4FWN A;  4E1J A;  4FWP A;  1GLJ O;  5FPM A;  1ZBS A;  5BN9 A;  4B1U B;  1QQN A;  2D0O A;  2AP1 A;  3MCP A;  3S41 A;  4CZF A;  3CER A;  1YUW A;  1Z6R A;  3R6M A;  1T6C A;  4IZ9 A;  3BF1 A;  4BRF A;  1NGG A;  3MK6 A;  5AQJ A;  2ASM A;  3CJ7 A;  3GOI A;  3VOV A;  2CGJ A;  2DPN A;  2QM1 A;  4B1W B;  4BG9 A;  1BO5 O;  1ATS A;  3QDK A;  3A0I X;  3OHR A;  4C23 A;  1JCF A;  4WQ5 C;  4IXC A;  4MLE A;  4H5N A;  3VF6 A;  1T44 A;  2P9K B;  2P9L A;  4BR0 A;  5LJV A;  1NGC A;  4BRC A;  5JLF A;  2HMP A;  2QWN A;  3EKU A;  1LCU A;  3VEO A;  3ZX2 A;  5E26 A;  3FE1 A;  2A40 A;  2V7Y A;  4H0V B;  4IWV A;  5AQP A;  1KAY A;  1RGI A;  1U2V A;  4MLH A;  1NGB A;  5BPL A;  3ATU A;  1QZ5 A;  1GLC G;  2V52 B;  3A5N C;  4L3Q A;  5AQM A;  4CD1 A;  5E84 A;  2FF6 A;  3D2E A;  4QS7 A;  1GLD G;  1IJJ A;  2Q2R A;  2W41 A;  4BRD A;  1WOQ A;  4BC2 A;  1X9J A;  2P9I B;  1K8K A;  1NGF A;  4BR7 A;  3D2F B;  4I6M A;  4ISE A;  5KQD A;  3UKU B;  2CGL A;  5CE3 A;  3W0L A;  1JCE A;  2ZGY A;  4BC5 A;  1NBW A;  3SJH A;  4CZI A;  4BC4 A;  1X3M A;  4AM6 A;  5AQZ A;  3M1F A;  3AAR A;  1QQM A;  5BRD A;  3O5B A;  5BRH A;  1TYQ A;  2A42 A;  4EIA A;  4CJ7 A;  1Q18 A;  5KPR A;  2FXU A;  5AQS A;  3WEE A;  2P9N B;  5AQX A;  5AQG A;  4ISG A;  3LDP A;  4NB4 A;  4XEI A;  5F1X A;  1NWK A;  1NGA A;  2Q31 A;  4FWS A;  4FWM A;  3RSE A;  3CJA A;  2QWQ A;  4BRP A;  3SMP A;  5FPE A;  3C7N B;  4QS9 A;  5AQL A;  4A61 A;  4Y0W A;  1XC3 A;  4BR5 A;  2I7P A;  3B8A X;  3KZB A;  3M3Z A;  5AQH A;  1NM1 A;  1HX1 A;  2IIR A;  3UKR B;  2QWR A;  4BGA A;  3IFR A;  4BRL A;  3M6G A;  4FSV A;  3H3N O;  1ESV A;  4YDU C;  3VPZ A;  2E2P A;  2E1Z A;  3AAP A;  4FWR A;  3H46 O;  4BRK A;  1JCG A;  5BRF A;  2P9U A;  4H0T B;  5LY3 A;  3DXM A;  1RDW X;  3GE1 A;  4H5V A;  4ISF A;  4PL7 A;  4BRG A;  2E8A A;  5AQV A;  4M7X A;  3D7E O;  5BN8 A;  4RCH A;  4PL8 A;  3GL1 A;  1S3X A;  1OKJ A;  3WQT A;  3IUC A;  1T6D A;  1GLF O;  2P9I A;  3R8E A;  4WQ4 C;  3VEV A;  1MA9 B;  3D2F A;  3DAW A;  5JLH A;  3LDL A;  4HWI A;  3ZET B;  4BVP A;  3CQX A;  3VER A;  1GLB G;  3UE5 A;  3VES A;  2FLO A;  1D4X A;  2F9T A;  3HZ6 A;  3WXJ A;  5AZJ A;  2VYP A;  3ZX3 A;  4CBU A;  5LJW A;  3G25 A;  3VGM A;  1Y64 A;  1NGI A;  4PKH A;  4JAX A;  4EHU A;  1Z05 A;  4RWT A;  3CET A;  2Q36 A;  1ZXO A;  3FZF A;  3DXK A;  4KBO A;  4JHD B;  1CZA N;  5AR0 A;  4EAH D;  1SZ2 A;  4H0O A;  2E88 A;  4K42 A;  2F9W A;  4FWK A;  2HF4 A;  3JS6 A;  4A2A A;  4WYB A;  3VGL A;  4B1Y B;  3O4W A;  2HF3 A;  2FSK A;  3O1W A;  5JMV A;  1HKB A;  4H5T A;  2P9P A;  3H6E A;  3IDH A;  1BA1 A;  2D4W A;  3JXU A;  3MN5 A;  3O1B A;  1YAG A;  3O08 A;  5AFU A;  3LM2 A;  4FL9 A;  4CZJ A;  5ADX H;  5FPN A;  4WQ5 A;  1HKC A;  2I7N A;  3EO3 A;  4FO0 A;  3VEY A;  2YI1 A;  3QML A;  3ULE B;  5EY4 A;  2A5X A;  3O80 A;  4H0X B;  1EQY A;  3MDQ A;  3I33 A;  4DCH A;  2P9S B;  3MN9 A;  4CD3 A;  1BDG A;  3BF3 A;  3DWL A;  3GBT A;  1BA0 A;  3R9P A;  3ZET A;  5KPZ A;  2D1K A;  3EL2 A;  4JNE A;  3QFP A;  4FPA A;  5BRE A;  4BR2 A;  4CBX A;  3FR0 A;  5FPD A;  2IVN A;  3GG4 A;  5EXW A;  2ASP A;  2FSN A;  1NGH A;  1BOT O;  2YCH A;  4A62 A;  2A41 A;  2Q0U A;  2CH6 A;  2H3G X;  3CI5 A;  3VGK A;  4DQ8 A;  3WQU A;  3CJC A;  1E4F T;  4H0P A;  4BGB A;  1XQS C;  5AQU A;  5KPT A;  4FWQ A;  5BR9 A;  3W3D A;  3IMX A;  5AZI B;  3P4I A;  1DKG D;  1DEJ A;  1KAZ A;  4BVO A;  4RTF D;  4FWL A;  2E2O A;  2NRH A;  2YHW A;  3WUH A;  2WUS A;  1V4S A;  4HTL A;  4BRM A;  2FF3 B;  5ELZ A;  4B1X B;  4EHT A;  4CI6 A;  1C0F A;  3HTV A;  2P9K A;  5JIC A;  5AQO A;  1ATR A;  4IJN A;  3LDN A;  1U6Z A;  3ATV A;  4XH4 A;  2GTD A;  2QXL A;  4H5R A;  2QWP A;  1TUU A;  1SQK A;  1R59 O;  3F9M A;  4CZE A;  1GLA G;  4IO8 A;  1GLL O;  1IG8 A;  2OAN A;  4B9Q A;  3U9D A;  3ZX0 A;  5AQR A;  1QZ6 A;  1HJO A;  3TU5 A;  1C0G A;  2NLX A;  3H1V X;  2P9L B;  1NLV A;  3BP8 A;  2YHY A;  2NZT A;  3ULE A;  5F0X A;  3LM9 A;  1ZC6 A;  2YJE A;  1QQO A;  2YHX A;  4H0Y B;  4YDU A;  4BRN A;  1HKG A;  1BU6 O;  5B8H A;  3HI0 A;  4JD2 B;  3UKU A;  4BG8 A;  1U2V B;  4K41 A;  1NGE A;  5EX5 A;  3FZL A;  4H5W A;  3U8X A;  3QFU A;  3QB0 A;  4EFH A;  3EZW A;  2PAV A;  3QBX A;  1NMD A;  2AA4 A;  2J4R A;  1E4G T;  1K8K B;  3QIC A;  2P9N A;  4AM7 A;  4F9O A;  2Q1N A;  4XH1 A;  2BTF A;  4BR4 A;  4I6M B;  1GLE G;  4O8K A;  4PKI A;  2A3Z A;  4WQ4 A;  1X3N A;  3VET A;  3MN6 A;  3H3O B;  4BRI A;  2V7Z A;  3A5L C;  3C7N A;  4BRE A;  1MWM A;  5AZI A;  1YXQ A;  4DHY A;  4XH5 A;  2KHO A;  2PBD A;  2QWM A;  3SLC A;  1TYQ B;  4BQL A;  3UB5 A;  3ENH A;  3VEZ A;  2Q0R A;  3CIP A;  4H03 B;  4CZL A;  3UKR A;  3WEE B;  3LDQ A;  5AQY A;  4CBW A;  1HLU A;  1P8Z A;  2VWB A;  3RSE B;  5AQW A;  3L0Q A;  4NO7 A;  3VF2 A;  3VF4 A;  3ZEU B;  4MO5 A;  2VCP A;  2GWK A;  5AQT A;  3VEN A;  3GDQ A;  3FFK B;  5AQF A;  3H45 C;  5BPM A;  2CGK A;  4GNI A;  4CZG A;  3A8Y A;  1NGD A;  1S22 A;  4LC9 B;  4O5F A;  5AQQ A;  4FOI A;  3HM8 A;  5AFU H;  4BQZ A;  2QWO A;  2QW9 A;  4GY2 B;  1MDU B;  2P9U B;  2QWL A;  1H1V A;  3DXM B;  3ENO A;  4JD2 A;  1J6Z A;  4BC3 A;  5ADX A;  4BRO A;  1YVN A;  4IJA A;  4BR9 A;  4MO4 A;  3C0B A;  3WXL A;  2UYT A;  5EOY A;  3VEX A;  1BWF O;  3CHW A;  3I8B A;  1NGJ A;  5I9E B;  4CZH A;  2HOE A;  3AY9 A;  5BPN A;  3TPQ A;  2E1Y A;  1BG3 A;  4B1V A;  3A5M C;  3BEX A;  1DGK N;  3ID8 A;  1KXP A;  1WUA A;  3LL3 A;  3CJ9 A;  1TUY A;  2D0P A;  4BRH A;  3L6Q A;  4FPB A;  1SAZ A;  2A6A A;  4J8F A;  4JHD A;  4PKG A;  2Q97 A;  2GWJ A;  1QHA A;  2IVP A;  3MMV A;  1RFQ A;  2GEM A;  5AZJ B;  4M63 C;  3HBT A;  2FSJ A;  3WT0 A;  4CZK A;  3J8A A;  1BUP A;  2YJF A;  1HPM A;  2E20 A;  3BUZ B;  4BRA A;  5AQI A;  2GEL A;  1ATN A;  3DXK B;  2ITM A;  3VEW A;  3ZEU A;  3DJC A;  3CJB A;  3FZK A;  3KHY A;  2EWS A;  2CH5 A;  2ZWH A;  3CQY A;  3U9Z A;  3WXK A;  2V51 B;  4JN4 A;  1LOT B;  3KVG A;  3O8M A;  5EVZ A;  3WXI A;  3A5O C;  3LDO A;  1V4T A;  3SMS A;  3QBW A;  3HSC A;  3AAQ A;  4K43 A;  2ASO A;  2P9P B;  5AQN A;  1MWK A;  5KQ8 A;  3EKS A;  3O6W A;  1HUX A;  3MN7 A;  3CJ1 A;  4A2B A;  2E2Q A;  4B1Z A;  3FGU A;  2P9S A;  3FLC O;  2IVO A; 
#chains in the Genus database with same CATH topology
 2W40 A;  3H1Q A;  1RDA A;  4K25 A;  4CFD A;  3TAN A;  4DQQ A;  1KFD A;  3L4I A;  3S5T A;  2VQF K;  3SUQ A;  1O13 A;  4Z94 A;  3ZLJ A;  5TKY A;  3V9U A;  3KWG A;  1LWE A;  4O0I A;  4CF9 A;  2BUP A;  2FC0 A;  2HST A;  3V9Z A;  2E2N A;  1G99 A;  3E1Y A;  4QS8 A;  4FJK A;  3EZ5 A;  4NLB A;  1HR0 K;  1RT7 A;  1EWQ A;  2NRR A;  4N41 A;  3Q7B A;  4IDH A;  3VTI A;  3SV3 A;  1OH5 A;  3QLH A;  2AP1 A;  1NKC A;  1TK5 A;  1DTQ A;  1Z6R A;  3V81 A;  3MEG A;  3BF1 A;  3E9P A;  4RW4 A;  1SV5 A;  4BRF A;  4JI6 K;  1FKO A;  3MK6 A;  1HPZ A;  3CJ7 A;  2YX6 A;  4JS5 A;  5D3G A;  2CGJ A;  2DPN A;  3THW B;  1EO1 A;  1BO5 O;  1L5U A;  4F3T A;  3PO4 A;  1C1C A;  3I0R A;  2ETJ A;  3U3G A;  4WFN L;  1S72 N;  5C24 A;  4IXC A;  1LWF A;  4CF1 A;  3VF6 A;  1WLJ A;  1NGC A;  1BIU A;  2YNH A;  5JLF A;  3VEO A;  4DTP A;  3JYT A;  4CCH A;  4H0V B;  4IWV A;  4I7F A;  1KAY A;  1RGI A;  1QTM A;  3OYE A;  2HNZ A;  1GOA A;  2QA4 N;  3TAB A;  1FW6 A;  3ATU A;  3L2W A;  4OLA A;  1GLC G;  2FF6 A;  5GAH P;  4QS7 A;  4CGD A;  1NOY A;  3TTC A;  3WNH A;  1X9W A;  2W41 A;  3K9K A;  1G15 A;  4BRD A;  3PV8 A;  4BC2 A;  2P9I B;  1K8K A;  3QEW A;  2KZM A;  3SBG A;  4BR7 A;  3QES A;  4ISE A;  5CE3 A;  2CGL A;  3W0L A;  1JCE A;  1IV0 A;  4BC5 A;  4OGC A;  4LSL A;  2BGG A;  4CJ7 A;  4FM0 A;  4B3R K;  5CYQ A;  3C94 A;  3WEE A;  1VQ7 N;  3S3M A;  1TAU A;  1C0T A;  1JLQ A;  3KK3 A;  5F1X A;  2Y1I A;  1NWK A;  1NGA A;  2Q31 A;  4FWS A;  4FWM A;  1Z25 A;  4BRP A;  3C7N B;  3THW A;  3VA3 A;  3TSU A;  5GAG P;  3QEV A;  3M8Q A;  3MXI A;  2E6M A;  2G8F A;  5LL6 Z;  1NM1 A;  3SUO A;  2O4G A;  2HBJ A;  4E19 A;  3M6G A;  1K9M O;  4FJH A;  2E1Z A;  3N4P A;  2KQ2 A;  4DSK A;  3FFI A;  1JCG A;  4V19 S;  5BRF A;  1TL3 A;  4C8O A;  1LAW A;  4ISF A;  1RBR A;  2AJQ A;  2GBZ A;  1SUQ A;  1C0M A;  4F8R A;  2XY5 A;  3IUC A;  2O8B B;  1T6D A;  3PSF A;  2UXD K;  1GLF O;  2P9I A;  2YHA A;  5HL7 L;  4Q5V A;  1Q8I A;  3SZ2 A;  4FK4 A;  4OPJ A;  4IO9 L;  3SCX A;  2P5G A;  5JLH A;  1VSK A;  4F3O A;  4DS4 A;  3QEI A;  3K5M A;  2VYP A;  3OVN A;  1Y64 A;  1IBL K;  3DLH A;  4OGE A;  4PKH A;  4JAX A;  3QET A;  3M5R A;  3CET A;  4CGF A;  5J2N A;  4IFE A;  4KHU A;  4Z4E A;  1C1A A;  1W97 L;  1ZXO A;  3FZF A;  1I3A A;  1IKY A;  4CJU A;  2ZQB A;  1NJY A;  4K42 A;  4CK1 A;  4EP5 A;  4U67 L;  1VQK N;  1KTQ A;  4FWK A;  3JS6 A;  4WYB A;  4W5R A;  4CED A;  1T05 A;  1HKB A;  4OO1 J;  3OYF A;  3CF5 L;  3D0P A;  4YOR A;  5J1E A;  1HNZ K;  4RW7 A;  3MN5 A;  3E01 A;  3E9O A;  3JSM A;  4DFP A;  4LH5 A;  4JLH A;  3VQC A;  1S1U A;  5AJ3 K;  4FJJ A;  4CZJ A;  1CLQ A;  1Q9X A;  3OBY A;  3K5N A;  1HKC A;  2O8B A;  2YI1 A;  3QML A;  1BQM A;  4FLU A;  4BDP A;  3ZYY X;  2A5X A;  4H0X B;  1U4B A;  3CC2 N;  4CHY A;  4CD3 A;  3GBT A;  4JKF A;  2RE2 A;  1QSL A;  2JLE A;  3QFP A;  5CHI A;  3M8S A;  4DUZ K;  1Q82 O;  4DR2 K;  5EXW A;  3ISN C;  4NCA A;  3TAF A;  3A2F A;  2KLA A;  1IO2 A;  1JLC A;  2H3G X;  3VGK A;  1VQ4 N;  3RWU A;  2QEX N;  4LFC K;  3ZSZ A;  2VGN A;  2HHH K;  4FJ8 A;  3LAL A;  1VHX A;  2RKI A;  4RTF D;  3VQA A;  4E7I A;  2A1S A;  4B9S A;  1V4S A;  4HTL A;  3IRX A;  1T03 A;  4DFM A;  5I3U A;  4CI6 A;  1C0F A;  3L2U A;  3KD5 E;  1RBU A;  4IJN A;  4XH4 A;  4E1M A;  3O4N A;  3F5T A;  2QWP A;  3NF9 A;  1TUU A;  4JKG A;  5C25 A;  1SQK A;  1R59 O;  5JS2 A;  4CZE A;  4IO8 A;  4AHT A;  1NKE A;  1J54 A;  2IC3 A;  1VQL N;  3ITH A;  1S1V A;  3AVC A;  1B9F A;  2YNG A;  3RMD A;  1C0G A;  3SBT A;  4R5P A;  3T69 A;  2Z1I A;  3TAE A;  3BP8 A;  4IOA L;  2NZT A;  2E5L K;  1U48 A;  5F0X A;  1ZC6 A;  2YJE A;  4BRN A;  1FKP A;  1BU6 O;  5B8H A;  4JD2 B;  4CW7 B;  3ZT4 A;  4CK2 A;  1TVR A;  4BG8 A;  3LDS A;  1U2V B;  3VQ6 A;  1QVG M;  4CF0 A;  4CK3 A;  5EX5 A;  4KI4 A;  1ZBL A;  1W2B M;  4LF6 K;  2WTU A;  4EFH A;  1RT5 A;  2AA4 A;  2J4R A;  2NRT A;  3DLB A;  1E4G T;  3VQ4 A;  2P9N A;  2YKM A;  2Q1N A;  3ZSQ A;  2I5J A;  4F2R A;  4ILJ A;  2A3Z A;  1X3N A;  3VET A;  4BE7 B;  1KQS M;  2EHG A;  1MWM A;  2PY5 A;  2OTJ N;  3DLE A;  3E66 A;  3UB5 A;  1KFS A;  5HBM A;  3HVT A;  3AO3 A;  3NCI A;  3U3Y A;  4G1Q A;  3AO5 A;  3LDQ A;  3NF7 A;  5M1P A;  4DTU A;  4WFB L;  3RSE B;  5AQW A;  3VF2 A;  4AHU A;  4CJS A;  2OPP A;  3LAN A;  4Z4F A;  2VCP A;  3GDQ A;  1C6V A;  1VQ8 N;  3B6O A;  3B6P A;  3H45 C;  2HMI A;  4CHZ A;  4Y1C A;  1S22 A;  5C42 A;  4O5F A;  1RT6 A;  3OYK A;  3HM8 A;  1ZBH A;  2HHS A;  2W42 A;  2BAN A;  3C6H A;  3OJU A;  1VSE A;  4JD2 A;  1Q86 O;  3TWH A;  3TR8 A;  4BRO A;  4KI6 A;  4BY9 C;  5EOY A;  2C1I A;  5I9E B;  5BR8 K;  2ZJR L;  2FBY A;  4DV4 K;  1ILY A;  3KK7 A;  4J2E A;  4CJQ A;  3BEX A;  1DGK N;  5GAE P;  1YIJ N;  3ID8 A;  2LSN A;  2IDO A;  3NGI A;  1KXP A;  5LMU K;  3QER A;  4JI5 K;  3OYD A;  3L6Q A;  4FPB A;  3PIP L;  2EX3 A;  3V1O A;  1VAZ A;  4DF8 A;  2GWJ A;  1NG9 A;  1JXB A;  5AZJ B;  3ZSX A;  4JI7 K;  2UXB K;  2OPR A;  1T3V A;  3P31 A;  3QIO A;  3J8A A;  3ZT3 A;  3AA3 A;  3HVR A;  3BUZ B;  3L3V A;  4IDK A;  5HRR A;  4DTX A;  5AQI A;  2GEL A;  5EU7 A;  2ITM A;  3WXM B;  1XI1 A;  2OPS A;  2BH1 A;  3IS9 A;  1B92 A;  3D45 A;  2KKZ A;  1REV A;  3NVK A;  1LOT B;  1JLE A;  2O8C A;  4I9Q A;  3TI0 A;  3CFP A;  3CMA N;  5JS1 A;  2P9P B;  1MWK A;  3HST B;  2YNF A;  3NAE A;  3T1H K;  3VQB A;  4ELV A;  3QIN A;  2E2Q A;  4A5A A;  1VQO N;  2O8F B;  2IVO A;  2GUP A;  4BEB A;  4Z4G A;  1IKW A;  3D2E B;  3MCA B;  1GOB A;  4DSF A;  2HBM A;  4DB3 A;  4JRQ A;  3U4L A;  4YHH K;  4GVM A;  3R3L A;  1YJW N;  2ZGZ A;  2X78 A;  4M7Y A;  4LFA K;  1ZBF A;  4BRQ A;  1XUP O;  4E1N A;  3SQ2 A;  1U45 A;  3C6T A;  3FZH A;  4JKA A;  5F2R A;  3I8D A;  4CER A;  3MX5 A;  3OBW A;  1GLJ O;  2XHB A;  5FPM A;  4HCC A;  4E7H A;  1N32 K;  3KKR A;  3SYZ A;  2G8V A;  4LSN A;  5J2Q A;  3AGK A;  4O5B A;  4RW6 A;  3S41 A;  3CER A;  1RDU A;  1A5V A;  5H1S Q;  3VOV A;  2Z1H A;  4B3M K;  1HNV A;  1ATS A;  1CZ9 A;  3OW2 M;  4AHS A;  3OHR A;  1SKW A;  4FLZ A;  1P90 A;  1M1K O;  4H5N A;  1T44 A;  3KIO A;  2P9K B;  5KTQ A;  4BR0 A;  3IKM A;  2XRI A;  4BRC A;  3KLG A;  2QWN A;  3CPW M;  1LCU A;  1YJN N;  4JI1 K;  4DV2 K;  2OA8 A;  3FE1 A;  2A40 A;  2V7Y A;  1SL0 A;  3OYG A;  1NGB A;  3L2V A;  4H4M A;  5AQM A;  4CD1 A;  5E84 A;  3D2E A;  3P83 D;  4KPY A;  1X9J A;  1NK9 A;  5M1K A;  1JJ2 M;  4WE1 A;  4FJ9 A;  4WCE L;  3KKS A;  3D2F B;  5KQD A;  4OKK A;  1LW2 A;  4M3Z A;  5M1Q A;  4CZI A;  5J2P A;  3SJH A;  4DG1 A;  4AM6 A;  3WNG A;  4Z4C A;  5AQZ A;  3TSQ A;  3G10 A;  3M1F A;  3AAR A;  3HK2 A;  3DI6 A;  4LFB K;  1RTD A;  1LAV A;  3ZSV A;  1TYQ A;  4NLC A;  3PX6 A;  5KPR A;  2FXU A;  1VSL A;  5AQS A;  2KTQ A;  4KKO A;  4HTU A;  3SNN A;  4MDB A;  1N36 K;  4GV9 A;  3LDP A;  3K5O A;  1VRU A;  1RDB A;  4XEI A;  2NRZ A;  2G8I A;  3LAK A;  2FBV A;  5AQL A;  3K5L A;  4FCY A;  1XC3 A;  2WOM A;  1DTT A;  3B8A X;  1RCH A;  3M3Z A;  1QSY A;  2IIR A;  3UKR B;  4BRL A;  4YDU C;  4KB1 A;  4CHP A;  2IS3 A;  4YOY A;  1VSF A;  5KGX A;  3UIQ A;  2P9U A;  4H0T B;  1FXX A;  4AHR A;  5LY3 A;  1RDW X;  2OYQ A;  4C8K A;  4M42 A;  4LD0 A;  3D7E O;  4B8C A;  5BN8 A;  4C1N I;  4PL8 A;  1NK8 A;  3RVC A;  4O4G A;  4BDY A;  1OKJ A;  3F2K A;  1HYZ A;  3L2Q A;  3CC7 N;  2W6K A;  2XO7 A;  3ZSY A;  4JK7 A;  3ULD A;  1X1P A;  4WQ4 C;  3D2F A;  1VQP N;  1N6Q A;  3I55 N;  3LDL A;  3J7Y P;  4ZHR A;  2RF2 A;  4J2B A;  4B8A B;  2F9T A;  3WXJ A;  4OPA A;  4CBU A;  3ZX3 A;  1VQ9 N;  1NKB A;  3G25 A;  3VGM A;  3PO5 A;  1NGI A;  2PZS A;  4EHU A;  3THX A;  3SQ4 A;  1XC9 A;  3O9Q A;  1FK9 A;  4CJK A;  3SUN A;  4KBO A;  4JHD B;  1CZA N;  4XJX A;  3AGR A;  4H0O A;  2D5R A;  3TAR A;  2KZZ A;  3MWP A;  4B9V A;  4OJR A;  3LWL A;  2HBK A;  3OYH A;  1M90 O;  4B1Y B;  2DY4 A;  3O4W A;  3O1W A;  3L8B A;  4AIL C;  4CF2 A;  1K73 O;  3AVN A;  3J80 O;  1HYV A;  2D4W A;  2X6S A;  2OZS A;  1YAG A;  4E72 A;  4KHN A;  2PFU A;  3HP9 A;  2VGM A;  5ADX H;  1Q9Y A;  5FPN A;  1TAQ A;  4CHQ A;  3AO1 A;  4CF8 A;  2I7N A;  5C12 A;  4OLB A;  4AH9 A;  3OYC A;  4KH6 A;  4CJW A;  4KTZ A;  5EY4 A;  1IBK K;  2VG7 A;  2OZM A;  1TKX A;  2P9S B;  3MN9 A;  1BDG A;  3BF3 A;  3LPT A;  1N8R O;  4JKC A;  1K8A O;  4LF5 K;  2D1K A;  1WSI A;  3EL2 A;  5DK5 A;  3OYB A;  5BRE A;  4FPA A;  3C65 A;  4PY5 A;  1S1W A;  3DMJ A;  4CBX A;  4DQR A;  3O4Q A;  2IVN A;  4OKJ A;  2FSN A;  1NGH A;  2VWK A;  3OYN A;  4A62 A;  1NJI O;  2A41 A;  2Q0U A;  2CH6 A;  3DRS A;  4B3O A;  4PHT X;  4JK9 A;  4IFY A;  4MQ3 A;  3WQU A;  4CJL A;  3CJC A;  4H0P A;  4FJI A;  4BGB A;  1D5A A;  3EEQ A;  5AQU A;  3AVB A;  3P39 A;  1HJR A;  3IMX A;  1DKG D;  1KAZ A;  1HNX K;  2E2O A;  2YHW A;  4LF8 K;  2QK9 A;  2JWL A;  2FF3 B;  4EHT A;  4OPK A;  3HTV A;  2P1J A;  1QSS A;  1U6Z A;  4AHV A;  3CCM N;  2GTD A;  4M3T A;  1HNI A;  2RN2 A;  3ZT2 A;  1MU2 A;  1VRT A;  3CCR N;  3PY8 A;  1JL2 A;  4BWJ A;  3ZX0 A;  4H8K A;  1QZ6 A;  1D9F A;  3Q7C A;  1HJO A;  3RTV A;  2QKK A;  4IKF A;  1WAJ A;  1NK6 A;  2NLX A;  2P9L B;  3V1R A;  1NLV A;  1O1W A;  3CYG A;  3K2P A;  4CGG A;  3P1G A;  1A5X A;  1KRP A;  4Y1D A;  4YDU A;  3J7Z O;  4KRF A;  4K41 A;  4RW8 A;  3AVK A;  3DLL L;  3FZL A;  2Q3S A;  3SI6 A;  2D0A A;  4CEE A;  1QVF M;  1BCO A;  4IOX A;  3NF6 A;  3CME N;  3QBX A;  1C0U A;  3EYZ A;  1TV6 A;  1VSD A;  3KK1 A;  2G8U A;  4J2D A;  4BR4 A;  4KHW A;  1VK0 A;  4I6M B;  1GLE G;  4E89 A;  1R0A A;  4O8K A;  4PKI A;  4M45 A;  4WQ4 A;  1BIZ A;  3H3O B;  4BRI A;  3PX4 A;  2V7Z A;  3C7N A;  4DR4 K;  1YXQ A;  4BQL A;  3VEZ A;  1ZYQ A;  4C8N A;  2Q0R A;  4H03 B;  4IBN A;  2KW4 A;  3RMB A;  4NXM K;  1UAX A;  2VWB A;  4RW9 A;  3KK2 A;  3FFK B;  5AQF A;  1YTU A;  3N4Q A;  3DLK A;  4F2S A;  3CC4 N;  1IG9 A;  2WC9 A;  4YY3 K;  4LC9 B;  5GIP A;  4UQG A;  5AFU H;  2HHQ A;  3HT3 A;  2QWO A;  3V9S A;  4GY2 B;  1YJ9 N;  5SZT A;  1MDU B;  4A59 A;  3DXM B;  3MXJ A;  4BC3 A;  1J6Z A;  5ADX A;  4KRE A;  1NK4 A;  3LP1 A;  4CEC A;  4ELT A;  1S9G A;  1VQM N;  5FLX O;  4LH4 A;  4DSE A;  2UYT A;  3VEX A;  4GV6 A;  2C1G A;  4FM1 A;  4KH5 A;  4CIG A;  1YIT N;  4B3S K;  3L2R A;  1BG3 A;  4DR5 K;  3VQP A;  4CIF A;  4OX9 K;  1RBT A;  2IOC A;  4IOC L;  1TUY A;  4BRH A;  4O55 A;  4W5T A;  2A6A A;  5M1O A;  1I39 A;  4DU4 A;  4CVN E;  1QHA A;  4DTR A;  4M63 C;  3HBT A;  3WT0 A;  4CZK A;  3HPO A;  4CJR A;  1F21 A;  2YJF A;  3HRG A;  1EKE A;  3VN5 A;  1HPM A;  1J53 A;  2D0C A;  3T7Z A;  1T7P A;  3F73 A;  3IAY A;  3AVF A;  4BRA A;  1CXQ A;  5IWA K;  3DXK B;  4DQP A;  5IT9 O;  3VQE A;  3CQY A;  3U9Z A;  1JXE A;  1KVC A;  4Z0U A;  4JN4 A;  1S1T A;  1SKS A;  1V4T A;  1RTI A;  3QBW A;  4CFA A;  3AAQ A;  4K43 A;  2ASO A;  3AVJ A;  2HHV A;  3EKS A;  3THV A;  3PX0 A;  3O9R A;  3O6W A;  3K0S A;  3THY B;  1HUX A;  1IBM K;  3RMA A;  4B1Z A;  3HPG A;  2YCH A;  5TKW A;  4DV5 K;  2ZF5 O;  4HCB A;  3SK3 A;  4JEP A;  4XIU A;  4JKB A;  1RBV A;  4YOX A;  5AQK A;  3OJS A;  4CZM A;  3KLH A;  3FZM A;  4FWO A;  4DTO A;  1CXU A;  3SPZ A;  4E1J A;  4NYN A;  4GKK K;  4W5Q A;  5BN9 A;  3CFO A;  1QQN A;  3NF8 A;  4JI8 K;  4DLE A;  3CM5 A;  1T6C A;  2HHX A;  3RMC A;  4FZZ A;  4Z4I A;  1RTH A;  1TKZ A;  4B9L A;  5AQJ A;  2ASM A;  3CCS N;  4BG9 A;  4E7J A;  3QDK A;  1NU0 A;  2E4L A;  4C23 A;  1JCF A;  4WQ5 C;  5HP1 A;  4ILH A;  4MLE A;  3ZT0 A;  3OYJ A;  2RPI A;  4FYD A;  4PA1 A;  4DFJ A;  4B9T A;  2UXC K;  1WB9 A;  1YHQ N;  3EKU A;  3KTQ A;  4CJF A;  1N33 K;  3ZX2 A;  2HHT A;  3NBP A;  3O9T A;  3J81 O;  4DMN A;  2DFE A;  2VWJ A;  1U2V A;  5BPL A;  1QZ5 A;  4L3Q A;  5HRS A;  1EX4 A;  5JVG L;  2Q2R A;  4CJE A;  3T1Y K;  1WOQ A;  4CJ3 A;  1NGF A;  3MWT A;  3RR8 A;  3VQD A;  4DR7 K;  3WNF A;  4DF4 A;  3UKU B;  1NBW A;  3OYM A;  4E3S A;  2HB5 A;  4N47 A;  1QQM A;  4JV5 K;  1TGO A;  5BRD A;  5GIN A;  1WSH A;  3O5B A;  1JL1 A;  5BRH A;  4DV3 K;  1ITG A;  2A1R A;  1UA0 A;  2XY7 A;  3MEC A;  2RHK A;  5AQG A;  4N5S A;  4ISG A;  3CQ8 A;  3V6D A;  5HRN A;  3HOT A;  3RSE A;  3CJA A;  1HQE A;  1BGX T;  2QWQ A;  4DR1 K;  4QS9 A;  4A61 A;  1IKV A;  4Y0W A;  1X9M A;  1UA1 A;  4DKW A;  3AVL A;  3L4Q A;  3NVM A;  4PUO A;  2HNY A;  5AQH A;  4CHN A;  1HX1 A;  1JKH A;  5I42 A;  2QWR A;  2VG6 A;  4BGA A;  2JWK A;  3IFR A;  4ID5 A;  3AA5 X;  2O8E B;  3L3U A;  4FSV A;  1ESV A;  2E2P A;  3KWI A;  1NJW A;  3LP0 A;  4EZ9 A;  3H46 O;  4ELU A;  4BRK A;  3MED A;  1I94 K;  4HUF A;  3T19 A;  3GE1 A;  3EE8 A;  4PL7 A;  4WFA L;  4WF9 L;  2O8D B;  3OY9 A;  4UY8 O;  1VSJ A;  1BIS A;  3GL1 A;  4CEO A;  3P38 A;  3HP6 A;  3WQT A;  3VQ7 A;  4QAG A;  2O4I A;  4CJ5 A;  4K8Z A;  5FRN A;  3R8E A;  1OH7 A;  4PWD A;  1XWL A;  2KFN A;  2YV0 X;  4B3T K;  1S6P A;  3CCV N;  3DAW A;  4YOU A;  5C2F A;  4BVP A;  3ZET B;  4K8X A;  4CEQ A;  3UE5 A;  4ID1 A;  4Z4H A;  2X74 A;  5AZJ A;  4GW6 A;  1VQ6 N;  4JYA K;  1VSM A;  1Z05 A;  1UOC A;  4RWT A;  3P5J A;  2Q36 A;  3MAQ A;  5AR0 A;  1SZ2 A;  4E7L A;  5CZ1 A;  1KVB A;  4FVM A;  3K59 A;  3O3F A;  1RTJ A;  1JLA A;  4DV6 K;  2HF4 A;  3VQ8 A;  4A2A A;  2Z1J A;  4X62 K;  1S1X A;  5JMV A;  2O8E A;  1OVY A;  2P9P A;  3SAG A;  1XMO K;  1NJX A;  3H6E A;  3IDH A;  3ZSW A;  4DU1 A;  1BA1 A;  2UUA K;  3CD6 N;  1K6Y A;  1TK8 A;  2O8F A;  3O1B A;  5J2M A;  4I9L A;  2O8D A;  3O08 A;  3KJV A;  1U49 A;  5JEN A;  1NNE A;  4WQ5 A;  5FRO A;  3EO3 A;  4FO0 A;  4NYF A;  4DFK A;  3CCU N;  1EQY A;  4LF4 K;  3MDQ A;  5GIO A;  4DCH A;  4LY7 A;  1BA0 A;  3R9P A;  3ZET A;  1ASV A;  1TK0 A;  3RR7 A;  4K0K K;  4YNQ A;  3OS2 A;  3FR0 A;  5FPD A;  3GG4 A;  3IG1 A;  3VTH A;  4FJN A;  4FM2 A;  4JS4 A;  3WNE A;  1TKD A;  3CI5 A;  3AVH A;  1WSE A;  1S9E A;  1RNH A;  1E4F T;  4X64 K;  4IG3 A;  4FWQ A;  1UWB A;  2UUC K;  3W3D A;  5AZI B;  3P4I A;  4M3R A;  1W9H A;  2HW3 A;  4BVO A;  4FWL A;  4R79 A;  3WUH A;  2KFZ A;  4BRM A;  2G8W A;  3AO4 A;  4G9Z A;  2P9K A;  5JIC A;  1VQN N;  2UU9 K;  3NFA A;  4AHC A;  3LDN A;  1BQN A;  2QXL A;  4H5R A;  3KLE A;  4W5N A;  3V1Q A;  2ZE2 A;  1BCM A;  3F9M A;  1GLA G;  4BEC A;  3U9D A;  1WNS A;  3NH1 A;  1RT1 A;  2OTL N;  3TU5 A;  3H1V X;  3G6E N;  2YHY A;  3CM6 A;  4H0Y B;  2YHX A;  3C6A A;  4DLG A;  5CR4 A;  1XHX A;  1HKG A;  4FVU A;  3CCJ N;  2Z1G A;  2HVI A;  3QB0 A;  4B9N A;  5DMR A;  1XNR K;  1BI4 B;  2FBT A;  4RG8 A;  3HYF A;  4HUG A;  1K8K B;  4BE0 A;  4MFB A;  4AM7 A;  4F9O A;  1J9A A;  2IAJ A;  4XH1 A;  3NDK A;  3CYM A;  4OVL A;  3QNN A;  1YT3 A;  3MN6 A;  4I2Q A;  4QOZ B;  3A5L C;  4CJ4 A;  5AZI A;  2DTU A;  4XH5 A;  4FLX A;  2KHO A;  2PBD A;  2QWM A;  3SLC A;  1ASW A;  5CZ2 A;  3NGY A;  3CCE N;  1QE1 A;  3ENH A;  2BE2 A;  4HUE A;  4FLV A;  4GMJ B;  4O8U A;  4DQI A;  3H08 A;  3UKR A;  3WEE B;  1C1B A;  1S5J A;  3HOS A;  1HLU A;  1P8Z A;  5GAD P;  3NHG A;  3BGR A;  4NO7 A;  4CJT A;  3VF4 A;  4BE1 A;  3ZEU B;  3O9S A;  3VEN A;  2GWK A;  4KHY A;  5SWM A;  3SJJ A;  3C6U A;  3AO2 A;  2NUB A;  4KHS A;  4GNI A;  4CZG A;  3OYA A;  3A8Y A;  4CJV A;  4U7B A;  3VQQ A;  3G4S N;  5AQQ A;  4M3X A;  1LV5 A;  4FOI A;  2F96 A;  2ZJP L;  2QW9 A;  5CY4 A;  2WON A;  4JKH A;  3ID6 A;  3T1A A;  4M3U A;  2QWL A;  1YVU A;  1YVN A;  2OPQ A;  4IJA A;  3QIP A;  1X9S A;  1B9D A;  4ZTF A;  3LWM A;  3S3N A;  1BWF O;  3I8B A;  4CEA A;  1BI4 A;  4OPH A;  3QO9 A;  3OS0 A;  2HOE A;  5BPN A;  1E3M A;  3TPQ A;  2QXF A;  4B1V A;  3A5M C;  1WAF A;  4KFB A;  3QNO A;  1JLB A;  1WSJ A;  3MXM A;  3CJ9 A;  5KRT A;  4JHD A;  1L3V A;  4DTS A;  4GVE A;  3QEP A;  2IVP A;  1RFQ A;  2GEM A;  1KVA A;  4IEI A;  4IG0 A;  2G8K A;  5T7B A;  2FSJ A;  1WN7 A;  2PYJ A;  5JVH L;  1BUP A;  3HO1 A;  1L3T A;  2E20 A;  1KD1 O;  3LAM A;  1ATN A;  3TTD A;  3ZEU A;  3CJB A;  3FZK A;  4KHQ A;  2CH5 A;  2ZWH A;  3WXK A;  1HYS A;  4BAC A;  2V51 B;  1YI2 N;  5EVZ A;  3KVG A;  5C10 A;  3KLF A;  3WXI A;  3A5O C;  1W7A A;  5A2Q O;  4FJ7 A;  3SMS A;  4NXN K;  4FJM A;  3HSC A;  3ZSR A;  5KQ8 A;  3MN7 A;  3CJ1 A;  4C1N K;  3AA2 A;  3FGU A;  2P9S A;  1KCF A;  1RT3 A;  5M1N A;  2P5O A;  1RBS A;  4C8M A;  3EN9 A;  4FOE A;  4LF7 K;  4KHP K;  1OH6 A;  3O3H A;  4KV8 A;  2BDP A;  1JLF A;  1KAX A;  4FWN A;  2B5J A;  4FWP A;  2P51 A;  1L3S A;  3MX2 A;  3ZSO A;  1ZBS A;  2F8S A;  4C8L A;  2B4J A;  4B1U B;  4YFU A;  3ZT1 A;  2D0O A;  3CFR A;  3MCP A;  2QKB A;  4CZF A;  1YUW A;  1A5W A;  1XHZ A;  3R6M A;  4QCL A;  4IZ9 A;  3EY1 A;  2VQE K;  1NGG A;  3E9L A;  4DQS A;  3GOI A;  5KGW A;  2QM1 A;  4B1W B;  1OH8 A;  3A0I X;  4DU3 A;  3U6F A;  3OYL A;  2P9L A;  3NH0 A;  5LJV A;  3MEE A;  2YKN A;  2HMP A;  4FJL A;  3I0S A;  4AQY K;  4JI2 K;  5E26 A;  4JKG B;  4DTN A;  2PYL A;  5MLC Q;  5AQP A;  4MLH A;  3OS1 A;  2UUB K;  5K14 A;  1J5E K;  2V52 B;  3A5N C;  1Y97 A;  3G0Z A;  5KI6 A;  1GLD G;  4W5O A;  4BE2 A;  1IJJ A;  3F9K A;  3TSP A;  4X66 K;  1YF5 L;  5DM7 L;  5C15 A;  4I6M A;  3K58 A;  3AVM A;  4CEZ A;  1N34 K;  4CE9 A;  2ZGY A;  3ALY A;  4BC4 A;  1X3M A;  4JKD A;  1RIL A;  1EXQ A;  2A42 A;  4EIA A;  5FDL A;  1Q18 A;  1XNQ K;  2P9N B;  5AQX A;  4HVJ A;  3BDP A;  3S9H A;  3AV9 A;  4NB4 A;  4N56 A;  4KTQ A;  1NK7 A;  3SMP A;  5FPE A;  2F4V K;  4YOW A;  2GUI A;  3VMF B;  3SAH A;  4DV0 K;  3LZI A;  4E7K A;  3CCQ N;  4E0D A;  4BR5 A;  2I7P A;  2QI2 A;  3KZB A;  3PIO L;  3M8R A;  2W6L A;  3KLI A;  2HHU A;  3H3N O;  3VPZ A;  3T3F A;  3AAP A;  4FWR A;  1DT9 A;  2QTD A;  2W00 A;  1NMN A;  4LF9 K;  3DXM A;  4H5V A;  4BRG A;  2E8A A;  5AQV A;  4M7X A;  1TL1 A;  2B6A A;  3SQ1 A;  1XMQ K;  4RCH A;  1S3X A;  4AF1 A;  2NRV A;  1VSI A;  1BHL A;  3V9W A;  4MDA A;  2WFB A;  2NRX A;  3VEV A;  3LZJ A;  1MA9 B;  3BZC A;  1YTA A;  1WBD A;  4X65 K;  1OVQ A;  4IFV A;  4HWI A;  3CQX A;  3RRH A;  3VER A;  1RDC A;  1GLB G;  4FK2 A;  3VES A;  2FLO A;  1D4X A;  1NOZ A;  1Q7Y O;  3S3O A;  3HZ6 A;  4FLY A;  5LJW A;  5CYM A;  2R7Y A;  1HQU A;  4DS5 A;  1RT2 A;  3LP3 A;  4EZ6 A;  4OKE A;  4FJG A;  2WBN A;  3DXK A;  4EAH D;  4A5B A;  2E88 A;  4CJP A;  2F9W A;  2HBL A;  4BWM A;  2G8H A;  3VGL A;  4KO0 A;  3VQ5 A;  1WSG A;  2HF3 A;  2FSK A;  3BY5 A;  4H5T A;  4FLW A;  2D0B A;  2OCE A;  3THY A;  4FXD A;  3I56 N;  1QS4 A;  1Q81 O;  3JXU A;  4GV3 A;  1KC8 O;  3HJF A;  2FBX A;  5HOO A;  4FJX A;  3NGZ A;  1U47 A;  5AFU A;  3LM2 A;  1WBB A;  3AVA A;  4FL9 A;  2O8C B;  1BL3 A;  1QHT A;  3K57 A;  3VEY A;  2IGI A;  3ULE B;  4FLT A;  1LW0 A;  4BDZ A;  3O80 A;  4DSI A;  3CPE A;  3I33 A;  3DWL A;  4M3W A;  4NCB A;  5KPZ A;  2GV9 A;  3O9U A;  5E41 A;  4CFC A;  4JNE A;  1D9D A;  4BR2 A;  2YHB A;  3NE6 A;  1VSH A;  3R1X A;  4FZY A;  2ASP A;  2F8T A;  2X6N A;  2GX9 A;  1BOT O;  4DSJ A;  1RDD A;  3VQ9 A;  5HRO A;  5FRM A;  1NJZ A;  4JKE A;  4TSX A;  4DQ8 A;  2ZM6 K;  1FJG K;  1TKT A;  3KD1 E;  4FK0 A;  4DR6 K;  2XY8 A;  1XQS C;  5KPT A;  1T8E A;  2ITG A;  5BR9 A;  1DEJ A;  1SL1 A;  1ASU A;  2NRH A;  3TAP A;  2DFF A;  2WUS A;  3JAM O;  2VG5 A;  4CEF A;  4CGJ A;  4KH4 A;  5ELZ A;  4B1X B;  5AQO A;  1ATR A;  2ZD1 A;  3ATV A;  4J2A A;  2NNW A;  1IKX A;  3TAM A;  1QQC A;  4JI3 K;  1GLL O;  1IG8 A;  4CGH A;  1S6Q A;  2OAN A;  4B9Q A;  4NCG A;  5AQR A;  4A57 A;  5HRP A;  2ZJQ L;  4FJ5 A;  3AVI A;  3DLR A;  3CXC M;  4JRP A;  5C2D A;  3TAG A;  3ASM A;  1SKR A;  4CEB A;  3ULE A;  2HND A;  3LM9 A;  1QQO A;  1GOC A;  4EP4 A;  3HI0 A;  3V4I A;  3UKU A;  1EP4 A;  4DR3 K;  3RRG A;  1NGE A;  4H5W A;  3U8X A;  3QFU A;  3EZW A;  4GKJ K;  4L8R B;  2PAV A;  1NMD A;  1W0H A;  2E6L A;  4O0J A;  1HNW K;  1JLG A;  4H4O A;  1WSF A;  4CHO A;  3QIC A;  4YOV A;  2BTF A;  5LMN K;  4F4K A;  4DV1 K;  3NH2 A;  4Q0B A;  4DUY K;  5M1F A;  4KB0 A;  1HRH A;  1EET A;  1U04 A;  3HM9 A;  2HHI A;  3SQ0 A;  4BRE A;  2JGU A;  4IEE A;  4ZTJ A;  4DHY A;  2NRW A;  4CFB A;  1TYQ B;  4JK8 A;  3PSI A;  2Y1J A;  3EE9 A;  3CIP A;  4CZL A;  3O3G A;  1N5Y A;  4ICL A;  5AQY A;  4CBW A;  1KLM A;  3HPH A;  3AA4 A;  1L3U A;  3L0Q A;  4MO5 A;  5AQT A;  2YNI A;  1HMV A;  4FW1 A;  4I2P A;  3TTF A;  1LWC A;  3DOL A;  1SS6 A;  5BPM A;  2CGK A;  3BZK A;  3ENB A;  1NGD A;  4JI0 K;  3HXM A;  1DLO A;  4BQZ A;  3OA9 A;  4N76 A;  3OTO K;  3NMU A;  2P9U B;  4FW2 A;  3OYI A;  1H1V A;  3ENO A;  4B08 A;  1RT4 A;  1J5O A;  3TAQ A;  4BR9 A;  4MO4 A;  3C0B A;  3WXL A;  3LPU A;  3CHW A;  1ZBI A;  4PQU A;  3DLG A;  1NGJ A;  4CZH A;  3J7A P;  3LP2 A;  3CG7 A;  3AY9 A;  3SAF A;  2E1Y A;  2HHW A;  3C95 A;  4YOT A;  2HVH A;  4DWI A;  1WUA A;  3LL3 A;  2F7T A;  3K9J A;  4HHT A;  3DYA A;  2D0P A;  4M3Y A;  1SAZ A;  4J8F A;  3HL8 A;  4JI4 K;  3M8P A;  3G71 N;  4PKG A;  4CES A;  2Q97 A;  3DRR A;  4CIE A;  3SPY A;  5HLF A;  4KAZ A;  3MMV A;  4B9U A;  1CZB A;  3AVG A;  5DM6 L;  3V9X A;  1NK0 A;  3ZCM A;  3SUP A;  4KTW A;  2ATQ A;  4ILG B;  3THX B;  5KRS A;  5C0Y A;  3QEX A;  3PUF A;  4DSL A;  4M41 A;  1EWR A;  1KLN A;  3VEW A;  3D6R A;  3DM2 A;  3DJC A;  3KHY A;  2EWS A;  1Z26 A;  1SL2 A;  3PLA A;  2DFH A;  4O44 A;  1NK5 A;  3O8M A;  3DRP A;  3CCL N;  4B9M A;  4DTJ A;  1ZBU A;  3LDO A;  3DOK A;  1VQ5 N;  4CGI A;  2XY6 A;  5AQN A;  3VA0 A;  1D8Y A;  4A2B A;  3SV4 A;  4DTM A;  4FZX C;  1KSP A;  3FLC O;  4DV7 K;  1IH7 A; 
#chains in the Genus database with same CATH homology
 2W40 A;  3H1Q A;  2GUP A;  5M1N A;  4K25 A;  5TKW A;  4BEB A;  3EN9 A;  2ZF5 O;  4FOE A;  3SK3 A;  4JEP A;  3D2E B;  3MCA B;  4JKB A;  4YOX A;  2HBM A;  3L4I A;  4DB3 A;  3U4L A;  5AQK A;  3R3L A;  1YJW N;  2ZGZ A;  1O13 A;  4M7Y A;  4Z94 A;  5TKY A;  4BRQ A;  4CZM A;  1XUP O;  3FZM A;  3KWG A;  4FWO A;  3FZH A;  2BUP A;  1KAX A;  2HST A;  4JKA A;  5F2R A;  2E2N A;  1G99 A;  3E1Y A;  4QS8 A;  4FWN A;  4NLB A;  4E1J A;  2NRR A;  3MX5 A;  3OBW A;  4FWP A;  3Q7B A;  1GLJ O;  3MX2 A;  4IDH A;  5FPM A;  1ZBS A;  3VTI A;  5BN9 A;  4B1U B;  1QQN A;  2D0O A;  2AP1 A;  3AGK A;  3MCP A;  3S41 A;  4CZF A;  3CER A;  1YUW A;  1RDU A;  1Z6R A;  3R6M A;  1T6C A;  4IZ9 A;  3BF1 A;  3E9P A;  4BRF A;  5H1S Q;  1NGG A;  3MK6 A;  3E9L A;  5AQJ A;  2ASM A;  2YX6 A;  3CJ7 A;  3CCS N;  3GOI A;  3VOV A;  2CGJ A;  2DPN A;  2QM1 A;  1EO1 A;  4B1W B;  4BG9 A;  1BO5 O;  1ATS A;  3OW2 M;  3QDK A;  1S72 N;  3A0I X;  4WFN L;  3OHR A;  4C23 A;  1JCF A;  4WQ5 C;  4IXC A;  3FLC O;  4ILH A;  4MLE A;  1P90 A;  1M1K O;  4H5N A;  3VF6 A;  1T44 A;  2P9K B;  2P9L A;  4BR0 A;  3IKM A;  5LJV A;  1NGC A;  4BRC A;  5JLF A;  2HMP A;  1YHQ N;  2QWN A;  3EKU A;  3CPW M;  1LCU A;  3VEO A;  1YJN N;  3ZX2 A;  3O9T A;  5E26 A;  4JKG B;  5MLC Q;  3FE1 A;  2A40 A;  2V7Y A;  4H0V B;  4IWV A;  5AQP A;  1KAY A;  1RGI A;  1U2V A;  4MLH A;  1NGB A;  5BPL A;  2QA4 N;  3ATU A;  1QZ5 A;  1GLC G;  2V52 B;  3A5N C;  4L3Q A;  5AQM A;  4CD1 A;  5E84 A;  2FF6 A;  3D2E A;  5GAH P;  4QS7 A;  1GLD G;  5JVG L;  3TTC A;  1IJJ A;  2Q2R A;  2W41 A;  3K9K A;  4BRD A;  1WOQ A;  4BC2 A;  1X9J A;  2P9I B;  1K8K A;  5M1K A;  1JJ2 M;  1NGF A;  3MWT A;  3TSP A;  1YF5 L;  4WCE L;  5DM7 L;  3SBG A;  4BR7 A;  5C15 A;  3D2F B;  4I6M A;  4ISE A;  5KQD A;  3UKU B;  2CGL A;  5CE3 A;  3W0L A;  1JCE A;  5M1Q A;  2ZGY A;  4BC5 A;  1NBW A;  3SJH A;  4CZI A;  4BC4 A;  1X3M A;  4AM6 A;  5AQZ A;  4JKD A;  3TSQ A;  3M1F A;  3AAR A;  1QQM A;  5BRD A;  5GIN A;  3O5B A;  5BRH A;  1TYQ A;  2A42 A;  4EIA A;  4NLC A;  4CJ7 A;  1Q18 A;  5KPR A;  2FXU A;  5AQS A;  3WEE A;  1VQ7 N;  2P9N B;  4MDB A;  5AQX A;  2RHK A;  5AQG A;  4ISG A;  4GV9 A;  3LDP A;  4NB4 A;  4XEI A;  5F1X A;  1NWK A;  1NGA A;  2Q31 A;  4FWS A;  4FWM A;  3RSE A;  3CJA A;  2NRZ A;  3HOT A;  2QWQ A;  4BRP A;  3SMP A;  5FPE A;  3C7N B;  4QS9 A;  4YOW A;  5AQL A;  3TSU A;  4A61 A;  4Y0W A;  3VMF B;  3SAH A;  5GAG P;  4DKW A;  1XC3 A;  3L4Q A;  3CCQ N;  3NVM A;  4BR5 A;  2I7P A;  2QI2 A;  3B8A X;  3KZB A;  3M3Z A;  5AQH A;  3PIO L;  1NM1 A;  1HX1 A;  2IIR A;  2HBJ A;  3UKR B;  2QWR A;  4BGA A;  2JWK A;  3IFR A;  4BRL A;  3M6G A;  4FSV A;  3H3N O;  1ESV A;  4YDU C;  3VPZ A;  1K9M O;  2E2P A;  2E1Z A;  3KWI A;  3AAP A;  3N4P A;  4FWR A;  4YOY A;  3H46 O;  1DT9 A;  2QTD A;  4BRK A;  2W00 A;  1JCG A;  5BRF A;  2P9U A;  4H0T B;  5LY3 A;  3DXM A;  1RDW X;  3GE1 A;  3EE8 A;  4H5V A;  4ISF A;  4BRG A;  2E8A A;  5AQV A;  4PL7 A;  4M7X A;  4WF9 L;  4WFA L;  3D7E O;  5BN8 A;  4UY8 O;  4C1N I;  4RCH A;  4PL8 A;  3GL1 A;  3RVC A;  1S3X A;  1OKJ A;  3F2K A;  4AF1 A;  3P38 A;  2NRV A;  3WQT A;  3IUC A;  3CC7 N;  1T6D A;  1GLF O;  2P9I A;  4MDA A;  2WFB A;  4JK7 A;  3R8E A;  5HL7 L;  4WQ4 C;  2NRX A;  3VEV A;  1MA9 B;  3D2F A;  4IO9 L;  1VQP N;  3CCV N;  3DAW A;  4YOU A;  5C2F A;  5JLH A;  3I55 N;  3LDL A;  4HWI A;  3ZET B;  4BVP A;  3CQX A;  3VER A;  1GLB G;  3UE5 A;  3VES A;  2FLO A;  1D4X A;  1Q7Y O;  2F9T A;  3HZ6 A;  4OPA A;  3WXJ A;  5AZJ A;  2VYP A;  3ZX3 A;  4CBU A;  1VQ6 N;  1VQ9 N;  5LJW A;  3G25 A;  3VGM A;  1Y64 A;  1NGI A;  4PKH A;  4JAX A;  4EHU A;  3M5R A;  3O9Q A;  1Z05 A;  2WBN A;  4RWT A;  3CET A;  4IFE A;  1W97 L;  2Q36 A;  1ZXO A;  3DXK A;  3FZF A;  4KBO A;  4JHD B;  1CZA N;  5AR0 A;  4EAH D;  4XJX A;  1SZ2 A;  4A5B A;  3AGR A;  4H0O A;  2E88 A;  4K42 A;  4U67 L;  2F9W A;  3MWP A;  1VQK N;  4FWK A;  2HF4 A;  2HBL A;  3JS6 A;  2HBK A;  4WYB A;  3VGL A;  4A2A A;  1M90 O;  4B1Y B;  3O4W A;  2HF3 A;  2FSK A;  3O1W A;  5JMV A;  1HKB A;  4H5T A;  1OVY A;  4OO1 J;  2P9P A;  3SAG A;  3H6E A;  3IDH A;  1BA1 A;  3CD6 N;  3I56 N;  1K73 O;  3CF5 L;  2D4W A;  1Q81 O;  4YOR A;  3JXU A;  4GV3 A;  1KC8 O;  3MN5 A;  3O1B A;  1YAG A;  3E9O A;  5HOO A;  3O08 A;  5AFU A;  3LM2 A;  2PFU A;  2VGM A;  4FL9 A;  4CZJ A;  5ADX H;  5FPN A;  4WQ5 A;  3OBY A;  1HKC A;  2I7N A;  3EO3 A;  4FO0 A;  3VEY A;  2YI1 A;  3QML A;  3ULE B;  5C12 A;  4KH6 A;  5EY4 A;  3ZYY X;  2A5X A;  3O80 A;  4H0X B;  3CCU N;  1EQY A;  3MDQ A;  5GIO A;  3CPE A;  3I33 A;  4DCH A;  3CC2 N;  2P9S B;  3MN9 A;  4CD3 A;  1BDG A;  3BF3 A;  3DWL A;  1N8R O;  3GBT A;  4JKC A;  1BA0 A;  4JKF A;  3R9P A;  3ZET A;  5KPZ A;  2RE2 A;  1K8A O;  2D1K A;  3O9U A;  3EL2 A;  4JNE A;  3QFP A;  4FPA A;  5BRE A;  3C65 A;  5CHI A;  4BR2 A;  1Q82 O;  4CBX A;  3FR0 A;  3R1X A;  5FPD A;  2IVN A;  3GG4 A;  5EXW A;  2ASP A;  2FSN A;  3VTH A;  1NGH A;  2GX9 A;  1BOT O;  2KLA A;  4A62 A;  1NJI O;  2A41 A;  2Q0U A;  4JKE A;  2CH6 A;  2H3G X;  3CI5 A;  3VGK A;  4DQ8 A;  4PHT X;  1VQ4 N;  2QEX N;  4JK9 A;  3WQU A;  3CJC A;  1E4F T;  4H0P A;  2VGN A;  4BGB A;  1XQS C;  5AQU A;  5KPT A;  4FWQ A;  5BR9 A;  3P39 A;  3IMX A;  5AZI B;  3P4I A;  1DKG D;  3W3D A;  1DEJ A;  1KAZ A;  4BVO A;  4RTF D;  4FWL A;  2E2O A;  2NRH A;  2YHW A;  4R79 A;  3WUH A;  2WUS A;  1V4S A;  4HTL A;  4BRM A;  2JWL A;  2FF3 B;  4KH4 A;  5ELZ A;  4B1X B;  4EHT A;  4CI6 A;  1C0F A;  3HTV A;  4G9Z A;  2P9K A;  5JIC A;  1VQN N;  5AQO A;  1ATR A;  4IJN A;  3LDN A;  1U6Z A;  3ATV A;  4XH4 A;  2GTD A;  3CCM N;  2QXL A;  2NNW A;  4H5R A;  3F5T A;  2QWP A;  1TUU A;  4JKG A;  1SQK A;  1R59 O;  3F9M A;  3CCR N;  4CZE A;  1GLA G;  4IO8 A;  1GLL O;  1IG8 A;  4BEC A;  2OAN A;  4B9Q A;  3U9D A;  3ZX0 A;  5AQR A;  4A57 A;  1VQL N;  2ZJQ L;  1QZ6 A;  2OTL N;  3Q7C A;  1HJO A;  3CXC M;  3TU5 A;  1C0G A;  3SBT A;  2NLX A;  3H1V X;  5C2D A;  2P9L B;  3T69 A;  3G6E N;  1NLV A;  3BP8 A;  2YHY A;  4IOA L;  2NZT A;  3ULE A;  5F0X A;  3LM9 A;  1ZC6 A;  2YJE A;  1QQO A;  2YHX A;  3C6A A;  4H0Y B;  4YDU A;  4BRN A;  5CR4 A;  3J7Z O;  1HKG A;  1BU6 O;  5B8H A;  3HI0 A;  4JD2 B;  3UKU A;  4BG8 A;  4FVU A;  1U2V B;  4K41 A;  3CCJ N;  1QVG M;  1NGE A;  5EX5 A;  3DLL L;  3FZL A;  4H5W A;  1W2B M;  3U8X A;  3QFU A;  3QB0 A;  4EFH A;  3EZW A;  2PAV A;  1QVF M;  4IOX A;  3CME N;  3QBX A;  1NMD A;  2AA4 A;  2J4R A;  2NRT A;  1E4G T;  1K8K B;  3QIC A;  2P9N A;  4AM7 A;  4F9O A;  2Q1N A;  4XH1 A;  4YOV A;  2BTF A;  4BR4 A;  4I6M B;  1GLE G;  4O8K A;  4PKI A;  4ILJ A;  2A3Z A;  4WQ4 A;  1X3N A;  3VET A;  3MN6 A;  5M1F A;  4BE7 B;  3H3O B;  4BRI A;  1KQS M;  2V7Z A;  3A5L C;  3C7N A;  4IEE A;  4BRE A;  1MWM A;  5AZI A;  1YXQ A;  4DHY A;  4XH5 A;  2KHO A;  2PBD A;  2QWM A;  2OTJ N;  3SLC A;  2NRW A;  3E66 A;  1TYQ B;  4JK8 A;  3UB5 A;  4BQL A;  3CCE N;  3EE9 A;  3ENH A;  3VEZ A;  2Q0R A;  3CIP A;  4H03 B;  4CZL A;  4O8U A;  3UKR A;  3WEE B;  5M1P A;  3LDQ A;  5AQY A;  4CBW A;  3HOS A;  1HLU A;  1P8Z A;  2VWB A;  5GAD P;  3RSE B;  4WFB L;  5AQW A;  3L0Q A;  4NO7 A;  3VF2 A;  3VF4 A;  3ZEU B;  3O9S A;  4MO5 A;  2VCP A;  2GWK A;  5AQT A;  3VEN A;  3GDQ A;  3FFK B;  5AQF A;  3TTF A;  1VQ8 N;  3N4Q A;  3H45 C;  1SS6 A;  5BPM A;  2CGK A;  4GNI A;  3ENB A;  4CZG A;  3CC4 N;  3A8Y A;  4U7B A;  2WC9 A;  1NGD A;  1S22 A;  4LC9 B;  4O5F A;  5AQQ A;  3G4S N;  4FOI A;  5GIP A;  3HM8 A;  5AFU H;  4BQZ A;  2ZJP L;  2QWO A;  2QW9 A;  3C6H A;  3OA9 A;  4GY2 B;  3ID6 A;  4JKH A;  1YJ9 N;  3NMU A;  1MDU B;  2P9U B;  4A59 A;  2QWL A;  1H1V A;  3DXM B;  3ENO A;  4JD2 A;  1J6Z A;  4BC3 A;  5ADX A;  1Q86 O;  4BRO A;  1YVN A;  4IJA A;  4BR9 A;  4MO4 A;  3C0B A;  3WXL A;  1VQM N;  2UYT A;  5EOY A;  3VEX A;  1BWF O;  4BY9 C;  3CHW A;  3I8B A;  4GV6 A;  2C1I A;  1NGJ A;  5I9E B;  4OPH A;  4CZH A;  2C1G A;  4KH5 A;  2HOE A;  1YIT N;  3AY9 A;  5BPN A;  2ZJR L;  3TPQ A;  3SAF A;  2E1Y A;  1BG3 A;  4B1V A;  3KK7 A;  1ILY A;  4YOT A;  3A5M C;  3BEX A;  1DGK N;  5GAE P;  1YIJ N;  3ID8 A;  1KXP A;  1WUA A;  3LL3 A;  2F7T A;  3K9J A;  3CJ9 A;  4IOC L;  1TUY A;  2D0P A;  4BRH A;  3L6Q A;  4FPB A;  1SAZ A;  3PIP L;  2A6A A;  4J8F A;  4JHD A;  3G71 N;  4PKG A;  5M1O A;  2Q97 A;  1VAZ A;  4GVE A;  2GWJ A;  1QHA A;  2IVP A;  3MMV A;  1RFQ A;  2GEM A;  4IEI A;  5AZJ B;  4M63 C;  3HBT A;  2FSJ A;  3WT0 A;  1T3V A;  3P31 A;  4CZK A;  5DM6 L;  3J8A A;  5JVH L;  1BUP A;  2YJF A;  3HRG A;  4ILG B;  1HPM A;  3T7Z A;  2E20 A;  3BUZ B;  5C0Y A;  4BRA A;  1KD1 O;  5AQI A;  2GEL A;  1ATN A;  3TTD A;  3DXK B;  2ITM A;  3VEW A;  3D6R A;  3WXM B;  3ZEU A;  3DJC A;  3CJB A;  3FZK A;  3KHY A;  2BH1 A;  2EWS A;  2CH5 A;  2ZWH A;  3CQY A;  3U9Z A;  2KKZ A;  3WXK A;  2V51 B;  1YI2 N;  4JN4 A;  3NVK A;  3PLA A;  1LOT B;  3KVG A;  3O8M A;  5EVZ A;  5C10 A;  3CCL N;  3WXI A;  3A5O C;  3LDO A;  1V4T A;  3SMS A;  3QBW A;  3HSC A;  1VQ5 N;  3CMA N;  3AAQ A;  4K43 A;  2ASO A;  2P9P B;  5AQN A;  1MWK A;  5KQ8 A;  3EKS A;  3O9R A;  3O6W A;  1HUX A;  3MN7 A;  3CJ1 A;  4C1N K;  4A2B A;  2E2Q A;  4A5A A;  4B1Z A;  3FGU A;  2P9S A;  1VQO N;  2YCH A;  2IVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...