2P9RA

Human alpha2-macroglogulin is composed of multiple domains, as predicted by homology with complement component c3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
DSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-2-macroglobulin
publication title Human alpha2-macroglobulin is composed of multiple domains, as predicted by homology with complement component C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01835 MG2 MG2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p9rA00
5JPMA 5FO8A 2WINA 4FXGA 3HS0A 2B39A 2WIIA 5JPNA 5FO7A 2A73A 4FXKA 2PN5A 3L3OA 5FO9A 2ICEA 2I07A 2XWJA 3OHXA 3G6JA 3FRPA 3CU7A 3HRZA 2P9RA 5FOBA 2XWBA 4D94A 5JTWA 4LNVA 2QKIA 3KLSA 3T4AA 2A74A 4KH9A
chains in the Genus database with same CATH superfamily
1AHWA 3S36X 1TTGA 5LCVL 3NJNA 4TULL 4D9LH 1BVZA 1ODAA 1RXLA 1VF5C 4O02A 3DV6B 3STBA 4OD1H 1DQQA 2VO5A 4A7TA 3C12A 1ZHBB 2J8HA 4TNWF 3LEVL 3I75A 4UM9D 1NIFA 4DN4L 1QR4A 3BESR 3MKKA 4LPVA 3JQOB 3KPPB 1ECZA 5HVHB 1YECH 1A6ZB 2F5AL 4EIUA 4UBDC 4JZNA 4ZRGA 2I27N 2W0KA 3C2AL 4ZS6D 5FYLH 2FATL 4YHNA 4Q0XL 4G42A 3IMTA 4V11A 4W4NA 5TDPB 4LXFA 1A14H 2XV3A 4KZDL 1EVTC 1T21A 5FKAA 2XWDA 1JPSH 1R17A 2ESVB 2X6AA 3CFBB 4Q2ZB 4LSUL 1OAYH 4XP6L 4Y4HB 5EA0L 3TS8A 3D69B 2I69A 5T1LD 3MMEB 2OQJA 1CLCA 4L4VB 1YMMA 2NY3B 4UT7H 1ZLVK 2DTSA 3UMNA 4HCGA 2BSDA 3KW7A 3QR2A 5E2UL 2VTFA 1J5OL 4EBQL 4KDTC 1MAKA 3IJHB 1FFOB 3QG6B 2ZCKH 4Q4IA 1KCUL 4TV3A 3OGCA 5ILTL 3SQBB 3V6FB 1TJIL 1IGJA 2R27A 1UWGH 2VLME 1PY0A 4TQPA 1MCJA 2C7FA 3EYVB 5SX4H 4JG5A 1GS7A 1EJ6A 1K4CB 2NXYD 2PCPA 4PJXA 1XR8A 4EIGB 3WS6A 1G0XA 1YYLL 3K5RA 3DX7A 1KIPB 1JZ7A 4RZCB 4XBPA 5AKSA 4RAHA 1MHPL 2VWEC 3K71B 5TTRA 1OV8A 3ATBA 1TZOA 5E8EA 4J3OG 3NIGF 3HAEA 1OP9A 4XN8A 3Q13A 4O02L 1I9EA 4TUJA 4PD4J 5FW6A 1SYVA 2FUQA 2D3LA 2O4EA 3FU3A 5EZIL 3WY2A 3ETBJ 3FT3A 3DJ9A 1GS6X 1SBSH 2APSA 3PWPB 4HFUH 3MACL 4XB8A 5C0FB 3NFPA 2VLKE 2ICEB 3CFNA 2UZPA 1G1OA 2MQ3A 3VDAA 4LSRH 1FORL 1BVLB 1DQJA 4QF1A 3EZ8A 3EYOB 2VLRD 2EC8A 2VN4A 3SDDA 3NP4A 3RL1A 2Q7YA 3DHJA 1UA3A 1DLFH 5FUCC 4AQ1A 3ZL1A 3G5ZB 3QAQA 4E9RA 1W6WA 3FMGH 5EZLA 3PDGA 1W0VB 4J6RH 5K9JH 2NR6C 1RH8A 2VDPL 4I1NB 1UTDA 4L9LC 4OCWH 1BFSA 1S8DB 4KXDA 5B3SB 5E4OA 2VAJA 2CMRH 2E9JA 4L0ZA 3G7TA 3QWOB 2E9WA 4ZUWA 2AQRA 2OULB 4A6YH 4ZG1A 2ARJA 2BNUB 2OMXB 4P2OD 4XNYL 4DQAA 3VTTA 2LLGA 2OMUA 1XGPB 1U9KA 3A6BL 3GZKA 3QSKB 4ENED 4U31A 3GSNH 4JNXA 1Z5LB 3CDZA 4ATWA 4PIRF 4AZ8B 5IIEA 2CIIA 1ZT1A 2NRDA 2FEDC 1QSFD 1QO3A 4LEEA 1YNLH 1AZZC 1PKQB 2L7UA 3PWUA 4I13B 5FGCB 3KR3L 4QHUA 5C0BD 3CC5B 4P5TC 4X5XA 4MHHI 4NQXB 1VFAA 1J0KA 1R9FA 3V4PH 1S2EA 2H4EA 4WUUB 2WZ5A 1U8QA 4YDKL 2C9UA 2D31B 2B8OT 3WXVH 4I3RL 4OZFB 1FE8H 4JFEA 1RAMA 4DO5A 2EICA 4PG9A 4BRVA 4FGMA 4DTGL 4H7VA 2GI0A 2HTKD 3S3CB 4ZMXA 4YE4H 4U1LB 4ONHB 3UJTH 4ZO9A 4ADIA 3IDNA 1EBAA 1J9SA 3X13B 2CCWA 1YO4A 1M3JA 2BOBA 4UANA 1CDGA 5F6IB 1CXLA 1HHIA 3OMZA 1A7RH 1YQVL 4NHUA 4XNBA 2R0ZL 3LZNA 4RFOH 5JORA 1OB1B 1RZJL 2JVUA 4DUWA 1WFJA 3ECUA 3ABGA 4HF5L 1IGTA 2BC4B 2DLTA 1U4EA 3K6NA 4H1LB 3HC0A 4NCDA 1HNYA 5AG9A 2D7NA 4JFVA 4EE2A 5KS9B 1BYOA 3N40F 5TH2A 1YPZA 2DQIH 3MOBH 1CMOA 1CPUA 1A3RL 1TCRA 3QUKA 3G6JE 1THCA 1EZLA 4IM8A 2IXQA 5F3HB 3PU7A 4EQ3A 4GW1B 3CFUA 1E4XL 3AADB 3Q8CA 4FULA 3GMLA 3RDJA 1ETB1 4C56D 1U58B 2QQNH 1RFDL 5CEXA 1TETH 2EDWA 3MU3A 1ZPUA 4YDVB 1JZEA 2OX5B 5FOBB 5KSUB 4J3WA 4PJEA 1DBBH 2ROYA 3B9VA 3QXWA 1YEHH 1EEYB 4L1HA 3VCLA 4RMQA 3OLEA 2J3SA 4NKIL 2APTA 4NO0B 3TBYA 2ZOUA 1AGBA 3E38A 5FO2A 1UADC 3GI8H 3NIFF 3O9WA 3QCVH 3VD4A 3G08B 5HHPB 1CYGA 1KLFB 5FXCH 2BP8A 4PGCB 4P05A 4PB9L 4RQQB 5FFLA 4G7SB 4OZHA 1KCKA 4JFZH 1MFCL 3ESUF 5DVNA 1TEGA 4G8GA 4GRLA 4DP2X 2GI7A 2AANA 5BPPA 3HZKA 4F9LC 1KFGA 5CJBA 1Z9SA 2OSLB 2XFGB 2EO1A 1T83A 2DJMA 3KYMA 4E0RA 4Q9CA 4LEBA 2HRLA 4Y5YC 3B1TA 4Y19A 5ESVA 1Z5HA 5KAQG 1WV7T 1UFUA 2P5PA 3VA2C 2EILB 4O00A 1PZAA 4YR6B 1O7VA 3K72A 3KVQA 3O2DA 1RK0A 1XEDA 2R69H 3QE5A 4JANB 3O45B 5D7IF 3PGDB 4YPGA 3PYCA 2VDRH 2X1XR 2OJEB 3TPUA 3L4CA 4WSKA 1E6JH 3P4MA 5CGBA 2XXMB 2DBJA 1SUHA 1MIMH 3KGSA 4PJ7B 4P2RB 4AGPA 3P30H 5C97A 4HJSA 2H32A 2VB5A 4LL1A 4QRPD 4C58B 4MQTB 1N2RB 2VKXA 3EDFA 3I02A 2F54E 1VB9A 2F19H 2I60H 2ATKB 3EGDB 3TNMB 4ZFGL 2CLVB 3GBNH 3NPSC 1FFNA 4DZ8B 1ONQB 1W8EA 4LLUA 4LDOB 1JZDC 4KJWD 4RMUA 1R5WB 3RKDC 2IDQA 2LOEA 1P84K 3EXLA 5JW5B 3N91A 2G75B 3QDHA 4JGMA 3SCMD 1QR1A 2HCZX 4HS6A 1JHTA 3T0EE 2QDVA 4HXBH 1NGZB 3D39D 5LXVA 4PG2C 4LK4A 2J55A 3M8OL 5I6XB 4JFPA 4JVWA 3V4VA 2B9BA 1JYWA 4FQXA 4NSKA 2P8MA 4M6ML 4WWOA 1EHAA 4NUGL 4HXAL 4QTIL 5DZ9A 3WLBA 4E5XB 3BT2H 3CXDH 2R2HB 3HE7A 4ZDHB 3MYZA 4MQXC 3QIWA 4IKLA 3EOBA 1NOAA 5LGJB 3Q44A 4QOKA 2ZXCA 1R46A 2GEEA 4XNMB 4U3HA 4HAKA 4IRZL 3RNKB 4XPBL 3TZVD 3VU2A 4XVTL 4X5WB 4C54A 1MY7A 1B4TA 4PH8A 1C5BL 1IEAA 1GGIH 4YX2H 3CPLB 1IE4A 2K9FB 3MNMA 5F3BA 1B0GA 2QMKA 2YQGA 3RZWA 2ZUQC 3O2DL 4K5MA 2XNAA 4NPYA 1I7RA 3VSUA 3WOVA 3PIQB 3HPJA 4HS8H 4A1RA 4G7YH 3ULSA 5F9JB 2DMCA 3EO1A 1IEHA 3FUJA 3FU5A 2VDQL 1S7UA 1SEBA 3L3GA 1OSYA 3EF7A 2IWEA 2A77H 1SXBA 2IH1A 2F1EA 4A7QA 3GM8A 1AZNA 4ZOCA 4GXVL 2X4RB 4PJAF 3GJFB 1G6VK 1Y0LA 4XMKH 5T3ZD 1FGVH 2P5EB 4DW2H 4TUOA 3TO2B 3KM2A 4FMKA 4Z5RB 2V9QA 2X9WA 2DQDH 2GQHA 3BDBA 3OKDA 3HCVB 3UCRA 2Y36L 1JGEB 3E3QC 5E8NA 3U1QA 1HXKA 3VFOB 2VW4A 3ZIMA 2KH2B 5AW1B 1U8LB 4GSDL 1BWMA 3BKCH 5D7SH 1SJEB 1UCBH 1E9OA 1REIA 1IT9L 1GL4B 5F7NC 1ZV9A 1A6PA 4D8PB 2G3ZA 3F7LA 2H0EA 3RPBA 3ULUC 4OLVL 4AUYA 4Z0BL 1F90L 3UP6A 4MXQC 5CBEA 1E7UA 4FFYL 4FFZL 1IAOB 1I3RB 1C5CH 4NGHL 5C08A 1FJ1A 3O4LD 4L5FL 4G6ML 4GI8A 4NQEE 2O6FA 5AZUA 3SGKC 2YOAA 1CCZA 1HDMB 3SDDC 3C60A 4JPKH 4OCNC 3LY6A 4P5TB 1RVFL 2GSIB 2X9YA 4KHTH 4KKAD 1CTMA 1L9QA 2P80D 3SKOB 3ZTCC 1DUYA 3GMOA 3KCPB 2AJYL 4AQ1C 2VO8A 1OWRM 3ZL4L 4KRNA 5AUMB 3FTXA 4Y4KD 4RCAA 2CHZA 2CH8A 2Z93B 2IVFC 4IBQA 2DTML 1UJ3A 3UG5A 3BPLC 4M7ZC 5JR1H 2ALWA 5CZVH 4EIZC 4R4FL 1WO2A 3UYOD 2IOIA 2EH8L 3ARFA 3FF7A 4Y8DC 3EGSA 3U0PA 1DVFA 3GXPA 4Z7VE 3BMVA 1TCMA 3JBG7 3NPZB 3MV8A 1KIUA 1AO7A 4JKPH 1D6VH 5L8JB 4U33A 1A1NB 4P2QA 2XA3A 7CGTA 3GLAA 2HJLB 5DEJA 3OAUH 5MEOA 4H0HB 4K3JH 2DMHA 1LO3H 4WU5B 5F70A 3RFZB 5ABDE 3GBMH 3GGWB 4MAUH 1CGWA 3ARWA 4A55A 4DZBB 3KLHC 1UURA 3CMGA 4KUZL 4PLKC 5EOCH 1OGAE 1UC6A 5FM5M 1EAPA 2PLTA 3CHXA 1E2WA 4CVZB 1RMFH 2V17L 1OIOA 3H0TA 4GI6A 2HUEA 1JE6A 3OJDA 4HD5A 3W3BA 5CEZH 1UOKA 1OAXH 3P9LB 3PF2A 1ZS8B 3PP4L 3L2MA 1L0QA 4QRQA 5EC1B 2YBRA 1KJVA 3FT4A 5IROA 3GZQA 4XN9A 1FFRA 3P40A 2WLHA 3LS5L 1TUPA 5CHNB 4B27A 3ILEA 4JG0L 3HI1B 4HSAC 1M1XB 3FO0H 5IV2A 3C9NB 3P4NB 4JFHE 1PGRB 4PJFA 5EPMB 5IBLC 1AR1C 4KITB 1OAUH 4UOQA 2HX8A 2VZOA 4YSDA 4D9RD 1FVDA 2AQNA 1AG0A 3HN5A 4WNQA 3UADA 2FEEL 2WHVA 4Y4FA 5D1QA 1IC7L 2V2TB 2ZTBA 4TOYL 3WIIL 1F11A 5DZPA 4ZPVB 4Y5YB 2K8MA 3IDXH 4TL5A 3G6JF 5DJZB 5F1IA 5KYYB 4MDJA 4BELD 2YAPA 3QFJB 3WY4A 1CD9B 2W9LA 5HJDA 1U8KB 5IF0A 1FNEA 1PU0A 4WY7L 3NJMA 4KZ0A 4MCYB 4FQ2L 3L7FB 3MZGB 4AY0A 5DD5H 2DWDA 2OI9C 4RAUB 2E4FA 1P6WA 3C2AH 3H56A 4XXCC 4AQOA 3O9WC 1N6UA 1JV5A 4M7LL 2WNKA 2ZP0T 2BSTA 4OSUH 1S7TA 3DDFA 4KKBD 3AT0A 2WQSA 3PQYD 3DX6A 4KZDH 3NZ8B 5DMIH 4BHUI 1DJYA 4XP6H 2XX1A 2HPOA 3DBXA 4FX5A 4XB3A 3JTSB 3NPSB 3S35X 1OCWL 1VZIA 4GRLC 3WG7B 3DSFL 4HZLA 1XZ0A 5CZXC 1AHWB 5DS8A 1UH2A 5E2WL 1T83C 4ODTH 1U8NB 2ORBL 3DC0A 4O02B 5FYJE 4XB7A 5ACZA 3GSVA 1BZ8A 5DJXA 5LGYA 2Z6FA 3I75B 5EZJA 4F2MA 1H8LA 4X7DC 3HHRB 4OZGE 4QTHA 1IKFL 4S1SL 1WFTA 1W80A 2ZKWA 2EE2A 3SYPA 1I82A 1YYLH 1BZEA 4JZNB 2BOLA 2ICCA 4QR7A 4G42B 4PM1A 1E7VA 4DN3H 5IR1B 1R3HA 1MHPH 4PLNC 3NQKA 2KLSA 1OKEA 2W9DH 1T21B 5FKAB 3VXNA 2C3VA 1TQTA 1C1EL 4BFJA 4XAWH 4XPHL 5IVXE 4JQIA 4QRSA 2PUQT 3KPRA 2HT4D 1I9IL 4XMZA 4FI8A 2OQJB 1TEFA 1YMMB 1IBBA 2VDPB 3MACH 4X9HA 5HDWA 2VZ1A 3C2SA 3R7QA 3H3PH 2PCYA 3MLZH 1FORH 2X4UA 3D85D 4JM4H 3ZY7A 1NBCA 5I1HL 3OGCB 1TZ8A 3L3OC 4GLRI 3JUZA 3APFA 1IGJB 1TQBB 3EOTL 4IHBA 2WAQA 4N4YB 4O4YL 4OR1A 3QJQB 2PCPB 4PJXB 4KTDL 1XR8B 4Z95H 1MEXL 4WJG3 1F4XH 4TKWA 3WEBA 1N4XL 3JV6A 5HDBB 5AOZA 3B7RL 3CHSA 4M48H 3HE7C 4LBEA 4XBPB 2JIXA 4YAQA 1LE9A 3QIWC 1SXCA 4UINL 5KBDA 3DX9A 4NQDE 1KFAH 3QR0A 4NZUL 4BJLA 3HAEB 3MCKA 5FDWA 3AXHA 3MKGA 2DQHL 4TUJB 1RIVL 1SYVB 5I1JL 5HHME 3V6BR 1I9JL 2V3DA 3I2CH 4HJ1A 4TVPL 3P2BA 5T1KD 1NIBA 1QTYT 2E7HA 3FT3B 1VPOH 4DJMA 2A9AA 1J8HD 5AOMA 3NFPB 3A6BH 5KVFE 1SOKA 1SFDA 3SDCA 3MGOA 1EH9A 3KLSA 4QF1B 1DQJB 4S0TD 3DHUA 4IBUA 1J5DA 3LN4A 2Q1EA 4RISL 3D9AL 3IE9A 3LAFA 3MJ7A 1CLVA 3KXFA 4JDTH 4X6CE 3SDDB 2MCPL 3RL1B 2JK5A 2Q7YB 1PLGL 2Y7LA 4F8QA 4QYAA 4BUQA 3KR3H 4UCFA 4UU9A 4WV1C 4AQ1B 3RX7A 2VLJA 4JQIL 4Q7DA 3T0XA 3RTQD 3WNPA 5IJVA 4M5SA 5IHUL 2Q5BA 5EZLB 3T0AA 1IGCH 2BWIA 4YDKH 4QRFA 3EDJA 1RSFA 4P3WA 3ROLA 5I5MA 3BFWA 3PHOA 3BPLB 1NJ9A 2ERJC 4M7ZB 4DTGH 2X44D 3MUHL 2VN7A 4HHAA 1ED3A 1DQTA 3TIEA 4ZUWB 5K1VA 4XODA 3VAEA 4A63A 3GSRA 1E4KA 2ARJB 1JVOA 2N4IA 1U3HD 1RIUL 1XSOA 2OMUB 2G3NA 5GGVL 2DQTL 2VLKD 1DJIA 3ULVL 4F5CE 1LO5A 4XPAL 4RA3A 4UILH 5F1NB 4AIXA 3CDZB 5IIEB 2VDML 4HF5H 5DO2C 1RURL 2CIIB 1ZT1B 4XP5L 2DIEA 2VMFA 2YPLD 3L3IA 4RGNE 3LNFA 1QO3B 4GB9A 3PWUB 4IRJA 4PS8A 1GYCA 3QYMA 3QZNA 1PNCA 3E6FA 2XN9D 4QHUB 3MOAL 4X5XB 1BXUA 2HJFA 1QBLH 1VFAB 1FV1A 2I7SA 1V7ML 1NFKA 1U8CA 3N9GL 2VR3A 1H3PH 1R4XA 4ELDA 3CZLA 3IMWA 1U8QB 3DVGA 4YBQC 4PW3A 2DD8L 5SX4I 1E4XH 3LIZL 4JFEB 3GNML 5CZKA 2A73A 2FO4A 4PG9B 5EWIL 3QHFL 1UJ3C 4GW5A 1ICTA 4GG6A 2DM7A 1JCKA 3IDNB 5F7BA 3T6QC 1LM8V 5D7KE 3VXSE 2BOBB 3ARFC 4IKKA 4HOZA 1OF0A 1HHIB 4NHUB 1TYJA 4ZUSA 1OEZW 1A7OL 2IANA 2GJRA 2Q20A 5JORB 1NCTA 1AZRA 2E6JA 1IGTB 3DJZA 4Q9RL 1ZHLA 3U1SL 1IMHC 3HC0B 2HKAA 1AR1B 4W70A 4CBZA 4IIQC 1MFCH 1N26A 5TH2B 1YPZB 4XHQA 2HFGL 1MI5A 1TCRB 3H85A 3K6IA 3LB6D 3LRHA 3N1GC 3QUKB 5DHYA 5PAZA 1KGWA 3TA3D 1INQB 2IXQB 3INUH 3TYGL 4DO4A 1IIKA 5DVMA 4WU7A 5EUKA 1FVCA 3IMRA 1I1FA 3GMLB 5E9DA 2ESVE 1RJLA 4OLXH 5CEXB 4WEBL 5DJAA 4LE8A 2MPVA 2BJMH 3O41A 4YLBA 4MAYD 3ZSSA 2Z7WA 2VDLH 1QPPA 4PJEB 2IMNA 3L2NA 3HMXH 2YAQA 4ORGA 4W9GC 3PG2A 3VCLB 5F2FA 3QYNA 1HC1A 3ESMA 3NACL 2YFNA 3BW9A 4LDLB 5IROC 4HWBA 1AGBB 1UXSA 1NGPL 4EKXA 1MRDH 1FAIL 4APQD 2PPEA 4GKSA 4FJZA 1WICA 2DKSA 1HIML 3ARDD 3P4LA 1N7ML 2BP8B 2XVKA 3MNZA 3GSXA 2CQVA 2YUZA 5A6IA 1IKNA 2HJKA 4KROD 3I3BA 4G8GB 4GRLB 4ADJA 4XR8C 4Y4FC 1WG3A 3DJSA 4XO3A 1A6WL 2ITDA 4ZBJA 1Z9SB 4PHZA 1D6EA 4YZWA 3KYMB 2X4SA 2X4NA 2EDNA 4XH2A 2BVQA 4Y19B 5ESVB 2C1PA 4AUUA 4U7SA 3AVEA 3SDXE 5F7UA 3PWPE 2XWZA 3K72B 3OF6A 4TUUA 1RK0B 3IPEA 1IU1A 3LPWA 3S4SG 3U0WH 1BQ5A 1T0MA 1MW0A 2VR6A 2ROXA 4YPGB 3DOIA 3EDKA 3FBQA 4QTIH 1BYPA 3S8GB 3TPUB 4U3XA 4NWTL 2D73A 3P4MB 3T8XA 3KE0A 1CWVA 4YXKL 2WINA 1CXHA 2BMKA 2F8OA 2VDQB 2WLYA 3NH7L 4Y89A 1HEJC 4GRWB 3QS2A 1PY4A 3QNXA 1AHMA 4IRZH 5GRUL 3HJ0A 4XPBH 4LVEA 2OS7A 1N0XH 3I02B 4KKZA 1C5BH 4L3FA 4MS8D 2C3HA 3UJJL 4PJ8A 1FFNB 4LLUB 1MFBL 4JEGB 1Z6JT 4UNIA 2NNCA 1U2CA 3FFCA 3NCJL 3SE9L 6CGTA 5HVWA 4CU7A 2X6UA 2YD5A 4J3OC 1QR1B 4HS6B 1JHTB 5J1AA 2ARJQ 2WQWA 3F84A 5T5FH 1DVUA 5F7EL 1I8MA 2Y07L 2GBVA 2XC8A 3QJFA 4JFPB 4QJ4B 3V4VB 1LDPL 1WZLA 4GXVH 3T0VA 4FQXB 4NSKB 2P8MB 5F8QC 3WLBB 5E03A 4PJ9C 1SLXA 3HE7B 4FZEH 2EXWC 4UDUA 2ZUUA 3QIWB 1KXQA 1AXIB 3EOBB 1KWKA 2Y36H 1F0LA 1PKQE 1CGUA 1ZD6A 4QOKB 1HH9B 5FGCE 4GJTB 1ADQL 2EJ1A 2A9BA 3LX9A 1NCCH 3FKUS 2CO6B 4ODUA 4MQ7A 5AVUB 3Q2VA 3CH1A 2JCCA 1QEWA 1IEAB 4WUUE 2VDOB 3MGTA 1B0GB 5F3BB 4AK1A 4OLVH 1MFAH 1SMOA 3BD4A 3K8LA 5IVXF 4GG8A 1DHKA 1F90H 2NQ3A 4NPYB 3ESPA 4Z0BH 3SGJC 1I7RB 4F7CA 4FFYH 3S37X 1KJMA 4FFZH 4GQQA 3HPJB 4GFXA 2D9QB 3KDMA 2IJ0C 2JKNA 3ULSB 3K46A 2C4XA 2DEWX 2P44B 3EO1B 3MXVL 4AH2A 2B16A 2FYYA 4HH9A 1S7UB 1SEBB 2G5UA 3L3GB 4G6MH 5C0RH 3GXUB 3NJGA 2IH1B 1DVTA 1RVFH 4F7KA 2J4WL 4HWNA 1Y0LB 4TUOB 4UI2A 4NM8L 3F7KA 4KK6D 3OKDB 2A9ML 1IBZA 2XXFA 5E8NB 3S9DB 5KS9E 5E51A 2DTMH 3F3HA 3WN6A 3ARZA 5AOLA 1E9OB 2O6EA 4EAEA 3UTOA 3G6DL 2XX0A 4BCZA 3X11B 3KAAA 5HYSG 3VXRA 1USQA 3SKJL 2AXGA 2YC1A 3IN2A 2UXFA 1ID5I 3IBOA 3QDGD 3WLWC 5CBEB 4AG4L 1HILA 3EYFA 3QW9A 5DU7A 3TOPA 2PR4L 5C08B 3DKHA 1FJ1B 4F92B 4TRPL 1QUNA 4CU8A 2J7LA 2B1OA 3C60B 4TQHA 5AAPA 2X1WL 5E23A 4LIQH 1GYVA 4OAWA 1EDHA 4OKVA 4X6CF 1E3FA 4UT9L 1DUYB 3GMOB 5FUZL 1JK9B 3N3EA 4LOUD 3TJPA 2V17H 3FK3A 2ZOTA 1JBJA 2W60A 1OM3H 1HWWA 4AL8C 3ILQD 2CR6A 4DOHB 1FDLH 5CJXC 1UJ3B 1TQCC 3PP4H 5BVPL 1TU2A 4E2OA 4P5KA 4DKFL 1B0IA 4FKEA 2ZSWB 3ARFB 3SDAC 3EGSB 4HJ0D 2EVJA 1E4KC 4NNXA 1DVFB 3U0PB 4EKJA 5FK9A 5FFOA 2CHDA 3LS5H 4LSQL 5T5NF 1PS3A 2YD4A 3MV8B 1KIUB 2A4ZA 2R0KL 1AO7B 3IFOA 1QHOA 4JG0H 5C07A 4GAFB 2Y6SD 3QFDA 4P2QB 1XGUA 3L95A 3UROR 5EF3A 2HKHH 4FEIA 3R0MA 4TNGA 1SDAB 5MEOB 2VMEA 3HNSL 5B1JA 1WJ3A 1BZOA 1O9ZA 2V9RA 1CVSC 1NCBL 4V33A 3L8QA 3LPPA 2BVEA 4YBHA 3OG6B 4OJYA 3WBDA 2G3XA 4Z78A 1ZVNA 3CH8A 3ECQA 1KYFA 5J12C 1EAPB 2QVMA 3N0PB 4X6DA 4PJ7E 1IC7H 4FMFA 4P2RE 3WKMH 3WHXA 4PLJD 4KGJA 3BZEB 3CE1A 1RPUA 3JTBA 3WIIH 4TOYH 4EZLA 1RULH 3OJDB 4GUQA 1O7DE 3GDBA 1XF2A 5JW3L 4LSPL 4JO4L 2RA1A 1ASQA 1F6FB 2GFBA 2V7NA 4IBTA 4BFKA 4PWKA 1DANT 1NCOA 4G59C 1A3ZA 3CHPA 1N10A 4QRQB 4B7IA 4NN7B 1NA8A 4I87A 5HVGB 5ISZD 4S1QL 2YBRB 1KJVB 3NAAL 2CUMA 4WY7H 2O61A 3FT4B 4NKMA 4HAFA 3VNYA 4F57L 3U1PA 2N1KA 2NY1C 3FCUB 1A3QA 5IV2B 3BAXA 2OBGA 2CPUA 2NNFA 4YHYC 7FABL 4FNUA 3KYAA 4PJFB 1I8AA 1G6RL 1NEPA 2L7JA 4FJYA 4Q6IA 1O5DT 1RD6A 2H3NA 3MBXH 4LP4A 3QYCA 3OM3B 5LHDA 4G82A 1MRCH 1FVDB 4WNQB 1EXHA 1JOIA 8CGTA 1OT2A 1OGAD 3WGVB 2L0DA 1OCWH 5D1QB 4R90H 2VAAA 5DURB 5BZDA 3VUAA 5E70A 4XHJD 3VTMA 3F58L 3T2PA 3GRGA 1F11B 3VXQA 3QNFA 1ZRUA 5E2WH 2JLPA 4KH9A 5F1IB 1QKZH 1BLNA 4MDJB 5IM7A 4HVBA 2H3XC 5J0BA 2L7EA 5IF0B 1FNEB 4B9JA 4RESB 1BZQK 5F7DA 5A6MA 4JGUA 3SYOA 3BAIA 3GJEA 4M5YH 1OCRB 1IKFH 2DLGA 4FXKA 4ZMYA 2DWDB 1OLZA 3K6FA 3CFKA 1U36A 4OUOA 1G5GA 4LCWA 5HGGS 2OL3L 5DHVH 2BVYA 4L3EA 1JV5B 2DLEA 2BSTB 1S7TB 4IMKC 3A67L 3PUUA 3DX6B 5M95B 4TN9A 5H37A 3MODL 5HHVL 5LN4A 1C1EH 2Y06L 5IVZA 1QEXA 1SHSA 3MUZ1 1IKNC 3DBXB 4XPHH 5EDXA 3WIHH 3US0A 2V0AA 3ATFA 4LEXL 2F08A 1YA5A 4KJQD 3NJFA 3NESA 1OWWA 1MCPL 2BRRL 2H1XA 3MV9A 4NAMA 4BBWA 6FABL 4CL7A 3BFQG 3T0BA 5ABAA 1XZ0B 2B0SH 2ZONA 5DS8B 4ONGL 4XN5A 2ZXWB 3Q1SH 2NSXA 1YEGH 4U1GC 5ACZB 3BN9D 3GSVB 2OYLA 4WKXA 4HUXA 1BVNT 5DJXB 5IBUG 4NS0A 3H6JA 4H0LC 5EZJB 4F2MB 2HTLC 2IV9A 4NZ8A 2XVBA 4QTHB 3UBHA 4O4YH 3LQAH 1J0JA 3MLTA 4PRBB 5EH1A 4N0FA 4RDQF 2PWFA 1MEXH 4N8CL 5DUBA 3SDXF 4ANXA 3LN9A 3N1FC 3C5JB 4C83A 1QWNA 3ARGA 4TSAL 3UOAB 1UEMA 1R3HB 4MD5A 3QXDA 4JRFA 1TVHA 1OW0A 2NY6C 3Q3GA 4R7DA 3VXNB 2C3VB 2DQHH 3A4DA 1RIVH 1V10A 4WQOA 5I1JH 2ZPKL 4PRNB 3KPRB 1I9JH 1YDPB 3UTPE 4EOWL 1H5BA 4HLJA 1N5YL 2GTZA 2EUXA 2V7HA 3DA0A 4PJ8C 5DVKA 4DGYH 2IG2L 4XPTL 3VX0A 4L1BA 3DJTA 4Z1PA 2X4UB 2QQLL 3MRQB 5BVJA 2X2UA 4WGVB 1BX2A 3HTLX 1FL5A 1PLGH 3FTYA 4K9JA 4R8WL 2HLFC 1DLHA 3L9YA 3LKSA 1TYEB 4KJYA 3HR5A 2VDMB 3JV6B 1ZGLM 2Y9RT 3HUJE 5IHUH 1R19A 3D4ZA 3I6KB 4YAQB 3MBEB 2GPZA 2JIXB 1LE9B 5F9WB 5I0XA 5T33L 3DX9B 5EG6C 3MRRA 2VQ1A 1CIUA 4IMLA 4K7FA 3K2MC 4Z9KB 1AXSA 4E42A 4DK3A 3MCKB 3W9DB 5FDWB 5J5EA 2D0HA 2XN0A 3P0YL 1IJNA 5D7EA 4JMNA 2NYZA 5E4AA 2FB4L 3LSOA 3L1GA 3IDGA 5HHOA 2MOQA 3MA9L 4FNLH 1BQLL 4NO5A 5GGVH 4NN5C 1PZ2A 3SDCB 3MGOB 4RRPA 5AKVA 4HUMB 3LN4B 4XOEA 1RURH 1UYWL 4XP5H 2WJ7A 3MJ7B 4FNPA 4PD4K 5F7LB 2QR0A 5I8EA 4JS7A 3WUWG 2JK5B 3JXAA 1MPAH 1QHQA 4MLSA 4UU9B 2NZ9C 1KXVC 3FSZA 4PBXA 3APCA 4ZD3L 2GB2A 4N2GA 1A6VL 1V7MH 2VLJB 5IJVB 2A9NL 2XQBH 3QO1A 4Q74A 3KWXA 3E8UL 3IJYA 3LIZH 4IBSA 3GNMH 3ROLB 1XWVA 4JL1A 1TQCB 5EWIH 4P4KD 3BIKA 3VI4E 1NJ9B 1J1PL 5HYIA 1K5NA 1ED3B 3TIEB 4HKZA 2OK0L 4X7TA 4P9HC 3GSRB 5KS9F 1SQMA 4DP0X 4H8WL 2W92A 2GT9A 3U2IA 1TLKA 3GIZL 3ZUCA 1JZFA 2ED9A 4IU3A 3FU0A 1F3DH 1L0PA 4LASL 1MFEH 2AJSL 3NCXA 1G1YA 3QDJA 4XXDA 5HDRA 3RWFA 1LO5B 3QFJE 4P23D 2EIJB 3PCYA 5T1DL 3MQIA 4TNFA 4Q9RH 1OP3K 4ECNA 5I76A 4NJ9L 4I0PD 3U1SH 5KJ7E 3L3IB 5A2IH 1NAKL 3QPKA 2NY4C 2VIRA 3K6OA 4IRJB 4IRSA 3E6FB 1ASOA 4FNSA 2J43A 2HJFB 2HFGH 1EGJA 1B4JH 1JPTL 1FV1B 1U8CB 5DC2A 4C55A 3M07A 3TYGH 1WFMA 1MF2L 1NPJA 5HGDB 3DVGB 2NY7L 2EIBA 3TBSA 3ZYJA 2A73B 1FNGA 2FO4B 3ELQA 3NCMA 1QRKA 5BCAA 5IG7A 4GW5B 4KRPC 3NSCA 5I75C 4GG6B 3KW8A 1Z5YD 3WAKA 3FJTA 2P8PA 3NACH 3UEZA 2YXVA 4OIIL 4ZUSB 4LVNB 3CLWA 5I0YA 3IAPA 2LW3A 5J8OA 1N8ZA 4B9IA 1FAIH 1DL7H 1EX0A 2X4OA 4PRIA 1CLZL 3QB7C 1HIMH 3D34A 1ZHLB 4UM9A 1N7MH 2JKXA 4J27A 4R7NA 4RGND 1P4UA 5IW6A 1YLBB 5B1JC 3RURA 1XH0A 3MNDA 2HRGA 2EC9U 1U0QA 3D51A 3PV7A 1MI5B 4C8XA 2Q7AA 2QVKA 5DHYB 1DYZA 2KI6A 1OP4A 3U6XA 1ZAGA 3VWJD 4YEFA 3RVXD 4WU7B 5EUKB 4FA6A 1FVCB 1I1FB 5E9DB 1RJLB 1F1AA 4TYUA 3KPOA 2P43B 3OKEA 4G71B 5DJAB 4XN1A 3O41B 5DFTA 2FHCA 1NANH 2E9GA 3KH3A 5FYLD 5T1LA 3BGMA 3GDCA 4AW4A 4ORGB 5INCA 1H8OA 2Y6TE 3BW9B 2WXQA 4KK5D 4N2EA 1CFSA 1HHKA 2ZT9C 2VN6A 2EVIA 4NWTH 1ZJAA 2Y7MA 3FO1A 4GKSB 4YBLB 4B9KC 5BOPA 4YXKH 3NH7H 2NY5C 5KYWA 2BP5M 1F3DJ 5GS2H 3MNZB 2F7PA 3GSXB 3WY3A 4Z7QF 3QUMA 3TNNA 4Q6IC 2CIKA 4ZFFA 4QHLA 4BK5A 4DEUA 1MJ8H 2HJKB 5HP5A 1YEKH 2HRHA 5A16B 1WSST 2VXVH 4I77L 2IADA 3UJJH 1OL0A 3HC3H 1MFBH 2ITDB 2B3IA 4ZTPH 4F7PA 5MERA 1NBYA 4JX0A 2BO0A 1D6EB 4M1DL 3S3JA 1C12A 3AITA 1OARL 2X4SB 1UQSA 1JHKH 2X4NB 1J05A 3NCJH 4XH2B 3SE9H 4U1GB 3EJUA 3UPRA 2BVQB 4BKSC 2VDKB 3VG0L 2C1PB 2TRHA 3HE6C 3MJGX 1S9YA 4WI9A 1E4XI 5GISL 1CS6A 2Y07H 4Z7OE 3QO0A 4MJ4A 4HCFA 4QO1A 3BQVA 4DVBB 1T0MB 4JRXD 4GAJL 2IPUK 3NZSA 1XHHA 4FXKC 1CFBA 3I6SA 4HBCL 3Q9PA 3W2DL 3MX0A 2CG9X 1HTYA 1X5GA 1W0YT 4WI0A 1KTLA 3T8XB 4F2FA 2VLRA 2BMKB 2VMCA 2WINB 4OIAA 3V4LA 3MVSA 1WWBX 1YN7B 1ADQH 1HCFX 1OSZA 1XMEB 1KGJA 3GXFA 3GK8L 3QNXB 3A24A 2EDQA 1JGUL 2PTTA 1AQDA 3VVWA 5CKAA 4XMXA 3QHZH 5KVEE 1XH3A 4K5LA 4J1UA 3GMRA 2QLYA 2G30A 4PJ8B 1XQ4A 3K8KA 2F5BL 3FQXA 4HMDA 2OZ4L 5MEPA 5CUSL 2IIJA 1W2KT 3FFCB 4IKIA 4HC1L 1TFHA 4HSCX 2E47A 1FPTH 5J1AB 2OYKA 3CBRA 1OHQA 5HYSA 2G9HA 1B88A 1TTBA 3MXVH 3OXRA 4G6FB 1I8MB 4P2OA 2YKLH 3OQRA 1UXLA 3QJFB 3D52A 1PTZA 3CXHJ 1Q1JL 4YGVA 3JTTA 3QUML 5TE4H 3JT2A 1JI1A 4WI2A 3RVVC 3VSQA 4KQ3H 1WAPA 4DPAX 1V3LA 2D2OA 1GZQA 1OLLA 1D7FA 1QSFA 3ARGC 2XZQH 5LO7A 5KSBF 5IOPA 4XMTA 5C0BA 1OW0C 4ODUB 4U1JA 4MQ7B 3CH1B 1BQSA 1QMUA 4MA8L 1QEWB 4RLDA 3N43B 3MGTB 4JFEE 2P42B 4NN5B 3QH3B 3RRQA 1O0VA 4GG8B 3BIAX 4F7CB 3Q48A 3S7GA 1KJMB 3HBPA 3S96A 1NFIA 3KDMB 3LRMA 3GWJA 3G5YA 4IW4C 2J88L 1NIAA 2WIIA 5IB1A 4AH2B 2GITA 2FYYB 3KLDA 4HH9B 5EO9A 3UO1L 4B7LA 4TRPH 3UTQA 4JRYE 2XPZA 3WDIA 1QSZA 2FYVA 3WEOA 3NFNA 5JZ7D 3H4HA 4JAMA 4UT9H 3EHBC 1OGSA 4GQZA 4B95C 5FUZH 5FX3A 1UOVA 2IBZY 1OAQL 3ZE2E 3I9GH 3Q1EA 4ICWA 5LG1A 5AVTB 1YPZE 4CC4A 3HUJF 3GHPA 3LZFL 2NPLX 1JXJA 1HAWA 4FTVD 1I7ZA 3CDGB 5CN2A 5LWYL 4Y2LA 4HCRH 2QZQA 2DWSA 2X40A 3O3BA 2YD9A 4QT5A 3VXRB 2AXGB 2YC1B 1EV2E 2VSKB 1KLUA 4JZJA 4LSQH 4C56A 1T4WA 2H7WA 2X87A 1BAWA 4PJEE 1HILB 3GPSA 2A6JA 3EYFB 4N2HA 4U1IA 4YDJA 4KI5C 1P9MA 3HNSH 2NW3A 5SWZD 2F53D 1E5YA 2NY4B 1QUNB 1NCBH 1KV3A 2P24A 3LRSA 3F04A 4JQVA 4OAWB 5DQJA 4OKVB 1DBAL 2DLFH 2EYRA 4PS4L 1FAKT 3NK3A 3ZQXA 5H8DA 4GS7B 2ADYA 3IB4A 1EWHA 3HB3B 2EZ0C 2W60B 4GP5B 1UUSA 5BUAA 3N55A 5JW3H 4LSPH 3BKYH 3KS0J 3BCFA 3E9UA 4JO4H 3QGVA 2HVKA 4KPHL 4KRPB 4G8GE 4AV5A 4EUPG 1TU2B 5DD3L 4PJCA 4P5KB 2OTWA 2GK0A 4UB0L 1O6SA 3RY5A 3NAAH 3VI4F 2GTWA 1D5IL 2N01B 5GRWA 1N9PA 4F57H 3H9ZA 3NA9L 5FK9B 4IDLA 4FFWD 2ITCA 3O2VL 4K4KA 4TLTA 3Q8FA 4Y19E 3QJUB 5C07B 3IFOB 3CGTA 1XD0A 4M56A 2HWZL 3QFDB 4LQFH 1DO5A 2VRAA 3L95B 2GJ6D 4NQTA 7FABH 3NJIA 1WRFA 5HYEA 1G6RH 1ZJBA 4B96A 1X9UA 2YLKA 3QXTA 4ABUA 2CKBL 2JJVA 3II3A 4IRSC 4CVWA 1Q9WA 4Z78B 5C0CD 4LNVA 3IS0X 4X6DB 2YGOA 2YUWA 4TSBH 3WHXB 4GRWE 4LVOB 5EIIA 4B97A 3F7PC 1P4IL 2WKLA 5HSFA 3O6ML 1SXNA 4QRPA 1XF2B 4KKLC 2BNRE 4KMTH 3GHEL 3QEHA 1ANUA 1CTOA 2GFBB 4K7PL 2V7NB 4WWKA 3L5HA 3HNTL 5MEQB 5DZOA 1AKJD 3ZXAC 2O61B 1S9WA 4EXKA 1WAEA 4NKMB 1HINH 5IQ9B 3PJLA 3SPVA 4PGJA 3SCMA 4ORZC 5J11C 3QBTB 4IGBD 3D39A 2OL3H 5BMFL 3A67H 1IQWL 1I8UA 1D5ZA 2DOCA 4Q6IB 5JHLH 5TQ0L 3MODH 2H3NB 2R39A 4FG4A 4MZRA 4X4YA 2Y06H 3VI3F 1KNOA 3GQFA 3W11D 3QCUH 5C0IA 3PV6A 3RX5A 4L5FE 2VAAB 2BRRH 4MHHG 4QOKE 3V95A 4KRMB 4U6XA 5BZDB 4QHKJ 6FABH 4KY2A 4XCFL 1NKOA 5D93B 3VXQB 2FH8A 2GBTA 4ONGH 2WXGA 4G43A 3T8VA 3TZVA 4ZXBD 3D05A 2YUXA 5BZZA 1TMQA 3GJFK 1BLNB 5IM7B 3BC9A 3UPAA 4K3HA 5JIMA 3AC0A 2GC7C 5HI4D 4HJIA 3IGKA 1BSIA 3LNGA 5F7DB 1L6XA 3GJEB 4FXKB 1UG9A 2WQRA 1WGOA 2X9XA 3FYEB 3T2LA 1EHNA 3O3EA 2F8VA 5LBSH 1CIDA 4LCWB 1BFVH 3ZGHA 4TSAH 1BMWA 2R4SH 1GIGL 4L3EB 3WFEH 3CK0L 4EVNA 4H5SA 3WXWL 2IEPA 2DDQH 3TJHD 5IVZB 2VJ0A 3EYUL 4PI0A 1EMTL 1SJXA 2ED6A 5BV7L 1LEKA 3B83A 2G0KA 1N5YH 3MV9B 3CFCL 8FABA 3IKKA 4DGIL 1WVZA 5GPRA 5ADPL 4MDIA 2EDXA 4XPFH 4JB9H 2FEEI 2VQTA 1RUQL 3DK2A 4MZIA 4A2HA 1BQRA 1DCLA 4HUXB 5KOVC 2ZX5A 4ACTA 4JDEA 1BA9A 2QT6A 1MCOH 2F8XC 4R8WH 4XAKE 1SXZA 1EJOL 4N0FB 4URTB 5DUBB 2A0LD 2KZWA 4BUGA 4Z7OF 1MCRA 1RZFH 5C08E 4C83B 3E1F1 5I71C 2D4DA 3MYJA 1YY8B 1O6TA 3ARGB 3O4LA 4D0DA 2AK1L 4MD5B 4ANVA 1UM6L 4ZMAT 5MEND 3QXDB 1CFVL 3LVEA 5AAWA 1TVHB 3BP7A 3L4VA 3Q3GB 1CL7L 4R7DB 4E9YA 4JHVA 2JQZA 2P80A 1AOHA 3P0YH 1EEUA 3V0DA 3IDIA 3D48R 1U42A 4D3CL 1QG3A 2Z35A 3KYKH 4QWWD 4BEIA 2FB4H 1H5BB 1A4KA 2NNRA 1X5KA 2GTZB 2V7HB 5EORH 4DKEH 1BQLH 3L17A 3MV11 3WEXA 4XXWA 2VE6A 4JPQA 1CXFA 1YHPA 2Y7QA 3CFQA 5GS3A 2IH8A 2GK2A 3UL4A 1FG9C 5BVJB 1UYWH 4W9DC 3GBEA 3O3DA 4PVLA 2AF2A 1GSMA 4NHCH 5DO8A 4V1DE 1BX2B 1V05A 5FA4B 1FL5B 3MV8E 5DR5H 2CDFA 5BZWA 3VGHA 1JFQH 1TMCB 3EHBB 2XSKA 4P2QE 1DLHB 3LKSB 4ENEC 4MKMA 1JK8B 3HR5B 4G9FD 4CSSA 4UT6H 2A9NH 1K2DA 4ZX4A 3FHEA 1ZDQA 5I18H 2ZAGA 4NFDA 3RVWC 3E8UH 2R9HC 5A43C 4K3DL 4OQTA 2M1KA 3MRRB 2VQ1B 3OKMA 4IMLB 3GMPA 4E42B 3KWVA 1AXSB 1OAKL 1J1PH 1P69B 4BSWA 4OIBA 5IK3A 4UTAH 2OK0H 4XI5D 2EDKA 2YEVB 3LSOB 2ZUYA 4H8WH 3UTPD 3IDGB 1KBBA 5HHOB 3GIZH 4LASH 1P5VA 2I24N 2LU5A 4NO5B 1NCJA 5AOKA 3QJHA 2RQ8A 1ITCA 3AGVA 4UDTA 3AS1A 5T1DH 5JPNA 1YNTF 3QZOA 4NB7A 2P45B 4NJ9H 2QMJA 2D3JA 2QR0B 2VZTA 1NAKH 5I8EB 5JHDD 3M88A 5CEZD 4NO2A 2ZG3A 1NC4D 3T1FA 4RMTA 5J7CC 2UZYB 2QHRL 3JWNE 3VXUD 1JPTH 2X3BA 2E7BA 3QO1B 2WXIA 3ML8A 1MF2H 2ISDA 3QEQD 1TIUA 5SX5K 3IJYB 5CJOL 3T2QA 4G8IA 3BIKB 1D9KD 3ULAB 2AP2A 3ZE2F 4CC4C 3M1OA 2PYED 4UYQA 5D1QE 4HKZB 3QUYD 3QXVA 1KB5L 1L7TL 3IGUA 4X7TB 3RIKA 4C47A 5GGUA 4BDVA 3HN3A 2YXFA 2GT9B 2ZICA 1YEIL 3B37A 3BWZA 2VR4A 4IU3B 1I8LA 3T1WA 5IREA 3VG9B 3IFNH 4XXDB 2FO8A 4JZJC 3RWFB 2FWLB 3SE4A 1YEFL 2FEJA 2E59A 5I76B 2AXFA 2GJZA 3HG1D 3D09A 3Q05A 2D7OA 2Y5EA 4PJEF 2VIRB 4IRSB 5BJTA 4FYQA 4JQVC 3ATAA 3C6SA 3FH8A 1TQUA 4EN3D 4CGUB 4ODHL 3EADA 5DF0A 1GC1C 3OVUB 5JA8B 5DWUL 4DERA 1A5FH 4ZNCD 3UFIA 5AL8A 3PQYA 5E2TH 1JD9A 3TBSB 4C59B 3B7UX 1FNGB 1T66D 4FA7B 4U1MA 4L1SA 3EJZC 4BFGA 4MKTA 3Q01A 1LILA 3QARA 3MLWL 4ZW8A 1E8XA 2P8PB 4K3GA 5IQMA 4GXFA 4GQ9L 3V8OA 1N8ZB 5E6ZA 5J11B 4GOSA 2YWYA 4HLZH 3JZ7A 4MNQD 4TVPE 1R6VA 1EK3A 3K7UA 1P7BA 2X4OB 1DVQA 1GA2A 3HG0A 5AYQA 5D7IA 5JXAL 4UM9B 4BZ1A 4R7NB 1T7YA 2J1XA 4OFIA 4LZKA 4QD2E 3O8XD 5IW6B 1GHFL 4QXVA 3WFDH 1Q38A 4XVJL 4JPWH 3TBWA 4H20L 3DYOA 1NSNL 4I77H 4Y7OC 1BQUA 3MREA 1MREL 1JZ5A 3V9CA 2J56A 3L5XH 4WJKB 3MLYH 2P7TA 5CSZA 4X5PA 5FW8A 1QVOA 1FH2A 1OD7A 3DETC 3KPOB 3OKEB 4NCC1 4URKA 1UA7A 4WWKC 5T1LB 3BGMB 2VXSL 2WMPA 1CXIA 4KJPD 1IGMH 5INCB 3VRLE 2VM9A 2WM0A 5BRQA 1UACL 2APVA 4GAJH 4KJWC 4HBCH 3OKNA 5DLLA 3VGAB 3W2DH 2DIBA 1CFSB 1HHKB 1B0RA 3SCMC 3D85A 3FO1B 1QI3A 1JZ2A 1CGYA 5FB8A 5KYWB 2CD0A 4NWUL 5DZJA 4N2LA 4FP8L 1QFUH 4DH2A 3GK8H 1DQIA 3QUMB 3TNNB 3ULVE 1OGPA 1RZGA 2CIKB 1I9RL 4QHLB 4ZFFB 2NXYB 2WLZA 3BEVA 3FC8A 4HUCA 1MNUL 2IADB 2QDWA 3REVA 2OXGA 5LAXA 5MERB 4KVPA 4F7PB 4P5RA 1NBYB 2OZ4H 3MJ6A 1C12B 3I9PA 3KYOA 2K0RA 4MVBD 5CUSH 1UQSB 5B1BB 4HC1H 3ULUH 3TZVC 3UPRB 1JERA 3SKUD 2EUZA 2EDRA 1SVBA 1IBGH 1S9YB 1WHOA 5T1KA 1LGVA 4J3SA 3QO0B 1J8HA 2BLFA 3OXSA 4QO1B 1Q1JH 3CWGA 4FC3E 4OZIF 2D7TL 2Z4QB 3L16A 3MX0B 3VFMA 5C3IA 5JIDA 12E8L 4NCC2 1A21A 4AEHL 4WI0B 1KTLB 5BUGA 1PZSA 2R15A 2VLRB 1RP9A 2OLDA 3MRBB 4PJAA 3ZL2A 1E65A 1HZKA 4S2SA 1OSZB 2CBTA 2DKMA 4FD0A 1I8IA 2O6CA 1G9ML 4GMTL 2PTTB 1AQDB 2VLJE 2X5PA 4BFRA 4MA8H 4W9JC 1SN2A 3RTQA 1XH3B 4J1UB 2X7LA 1QQDA 3GMRB 3SPJA 2BSBA 4CMHC 4KOBA 3FQXB 4D9QD 5MEPB 3TCTA 3FQ4A 4OGXL 4BXVA 4MA3A 2H41A 1YRKA 1TZHA 5HYSB 2G9HB 2XWJA 3OXRB 5SV3A 1TXKA 1XL6A 4P2OB 4R83A 1U3HA 3TBTA 4R2GD 4AEIL 1UD5A 1DR9A 2RTTA 3LYRA 4HK0A 3JTTB 1F42A 1MJJA 4HWZA 4YGVB 2VLKA 3B43A 1NANI 1BVKA 3P3UA 1ITBB 3GC3A 5FCSH 4CN1A 5FF6A 2OMVB 4JO1L 2YPLA 1FF5A 1ACYL 3B8YA 4UV7H 5D7JA 3P3TA 1QSFB 4UIMA 5TE6L 3UMTA 3FZUD 2OMWA 4IS6A 4LAQL 3TH4T 1ZEAH 5IOPB 3DOHA 2J8OA 2XN9A 1DE4A 3LZFH 5C0BB 4U1JB 2R51A 5LVEA 2D7MA 4KKAC 2B5IC 4ZOAA 3WNJA 2Q2LA 5LWYH 3OHXA 1GMIA 3ENEA 4I48A 4C4KT 4WLCA 1Q72L 3GF8A 4EUPA 3KPNB 1TENA 2WWMD 2IWFA 3D25A 3L9BA 3S96B 4WKZA 1NFIB 1WIOA 3G5YB 3GLZA 4KAQL 3UGUA 2WIIB 3GO1H 2W94A 2YGNA 5IB1B 2GITB 5EO9B 4N0CD 3P0VL 4IBWA 3UTQB 3KPTA 2VQUA 4K94L 2MNUA 2R83A 1IBHA 2V5RA 4F1SA 3NFNB 4JAMB 2WBJD 4AJ0A 3NIDF 4E9SA 5CLYA 1DBAH 1GZPA 2YMTA 2Z8VC 4PS4H 3ZT7A 1ET7A 2IDFA 2Q3XA 1UD6A 1Q0XL 5C09D 1KUMA 1KZQA 1EEQA 1AZVA 1PW3A 3OAWA 4RMWA 3I3EA 5I6PA 3ATEA 5K9QI 2IQ9H 1MI5E 3VD7A 3CU1A 5DD3H 5AAMA 4YHKL 2I5YL 2OXHB 1I7ZB 3OMNB 1JTPA 5D7HA 3TA3A 1K72A 2CRYA 1A8JH 1D5IH 2FD6H 3O3BB 4GAYA 4QT5B 3JWOC 4A7GF 2WXLA 1KLUB 4JZJB 4C56B 5I75B 3O2VH 2GG1A 4ZX3A 2EO9A 1F6AA 4OFVA 5CIPA 3VO0A 3RBGA 32C2A 1S78C 2O6PA 2WXHA 4MAYA 2A6JB 4U1IB 1L9MA 4G5ZL 3QI9D 1QFOA 2L3BA 4OD3H 4YDJB 3U6XS 3WDHA 4AIOA 1JMXA 2KUTA 1ACCA 3LRSB 4N1EA 3OV6A 3S5LG 2CKBH 4JRYD 3RWDA 4F37F 5DQJB 4QKTA 4YUEH 4JJ5A 1DBML 4G11A 4APQA 1KOAA 2EYRB 1ROCA 3ARDA 3WTWA 4KZEL 4NLAA 5JYLA 1HN1A 4QXUL 5J3HD 2VC2H 5BOJA 2HVKB 4K7PH 3NABL 2FK9A 2RCSL 1VENA 3BWUC 4PJGE 4PJCB 2OTWB 2GK0B 4LDCA 1O6SB 2WKOF 4K8RL 2GTWB 1A4JA 4JFWA 5EOQH 3TCLA 1S9KC 2ITCB 2AJUH 1I8LC 2X89D 2LVEA 4AK2A 4DNLA 3EJRA 3POHA 1RZKL 1HCZA 4K5PA 5JIKA 2Y7SA 1UD4A 3SE4C 2J1ZA 1LD9A 4YHZH 5E8DL 5TDOA 1RQ5A 4TTGA 2WN3A 5EHFA 1OT1A 2RMNA 5T3XL 5I1KH 4UOW0 1G9NC 1Q9WB 4ABWA 4HS3A 1GY2A 4P04A 2H32H 3X3GL 3PWJA 3G9AB 3H1ZA 3GB7A 2X88A 4GQRA 5EIIB 1YSOA 2EYTA 3M1CA 4ABQA 4XCFH 4QRPB 4KKBC 4LL9A 3FTSA 3QEHB 4P59H 3BQUD 5DJ0A 5AB9A 4OH2A 1D2OA 2O5ZL 5BV7B 4L1LA 1R0AL 1WBZA 5HVFB 3MI6A 1T80A 1FRGL 1S9WB 3KBPA 5AW5B 5FO8A 1NC2D 2CGYA 3FFCE 3FN0H 1O75A 4HIQA 3MLXL 3SPVB 4P5MA 3SCMB 2AMUA 3TP4A 2WLMA 3M17A 3CFTA 5IBUB 3D39B 2FO1A 2I7OA 4W9EC 1GIGH 2WB7A 3AT8A 3DYPA 4QUOA 3CK0H 5L7XH 3BUQA 3TTSA 1D5ZB 3KWTA 3SD5A 1HZHL 5C8JA 3L54A 4NBZB 3TYFA 1MZZA 2LAAA 1KNOB 4X8JA 5FYKL 4XP1H 2DMKA 3PV6B 3RPIA 5LAPA 1O5PA 2OKMA 4QHKI 4U6XB 5LUMA 2BVUA 3I6LE 5DHDA 3ZHNA 1VFBA 4DGIH 1BGXH 3WFHA 1J8KA 3WI9A 3TZVB 5ADPH 4G43B 1CI5A 2IWGA 3GLDA 2A9CA 2YZ1A 2XVGA 4JG9A 4K15A 1RUQH 3FUKA 4MBOA 3CLFL 1X6LA 1VJSA 1HL4A 4KKCD 4LP8A 3WNIA 2HT4C 4K5OA 4Q14A 2DM2A 1UWXH 1UD8A 4HJEA 1EJOH 1KELL 1V55B 1ECYA 1ZXKA 4M03A 4OU3A 3VRLF 1WS7A 1GOHA 4FI6A 3BZDA 1CFQB 1KCRL 3ZQWA 2DV6A 4AKOA 1QAWA 2AK1H 1B2WL 2CPCA 3QCTL 4H5SB 4EVNB 5JMRA 2WZ0A 2J25A 1D5XA 2DJUA 2WZAA 2R29A 4OF7A 2ED8A 3VA6A 3FUHA 2QGDA 3RWGA 1M42A 3ULVF 4CMHB 3NIGB 4OGZA 8FABB 3ZZSA 1GS8A 2BRQA 4OCSL 5BZXA 4FFVD 4Y2DD 1SQ2N 4MDIB 2OAAA 1IM9D 2AVGA 2ZWNA 4HHGA 4Y8AA 4GMSL 2WTPA 2AJVL 4RDQG 4JDEB 2ZX9A 1ZLWK 2QKSA 3QDGA 5AOIA 5C9JA 3O11A 3MYJB 5KVDE 4M5TA 3O4LB 4D0DB 2R1XA 2DH2A 1N68A 1JRHH 5I19H 3D4CA 1GTNA 3BP7B 3QFGA 3RGHA 4PJBA 5KBMA 3L6FA 1WF5A 1X5LA 3TM6A 3MHZA 5ICYA 3BUBA 3IDIB 2ZAIA 3DSNA 1C7SA 2Z35B 4H40A 2V2WA 3B7YA 1FZJB 1A4KB 3RTQC 4Y4KB 3TT3L 2WWOA 4IEFA 1SJHA 4L3CA 3WEXB 2VE6B 1A65A 2IPUG 2Y7QB 3K0YA 4NUJA 2R56L 4WJ5A 4MJ2A 3F62A 3RIAF 2E74C 3O3DB 4OTXH 4LPWA 2PPCA 5D72L 1U3HC 1FIGL 2CDFB 5BZWB 5C07E 5C0GA 3L1EA 2BW5A 4MCNA 2E6PA 1G0DA 4M3JA 4XAKD 1NWOA 2QHRH 2R29L 3RB7A 3L3JA 4K55A 2F61A 3QQ3B 1K2DB 1IAIM 4F37K 1EJFA 4MJ5A 4LBAA 5D7JC 2NNXA 5DD1H 3WKNA 4X5RA 1Z3RA 2BVOA 4NQEA 1X7QA 2KLRA 3OKMB 3GMPB 4ISVA 5GS1A 5IK3B 4OLWH 3ABLB 4X6DE 5C7XL 1I4FA 1UENA 5HYJE 4DUVA 4LHUD 5L4FA 1FHNA 4FQLL 5IHBA 5KSAC 3IGFA 2ZUSA 2A83A 3E6HA 1YEIH 1KBWA 3QNYA 3OHXC 3QRGL 4N22A 1P5VB 4ADGA 3ARED 4OZFG 3ASOB 4K71C 3VGGA 3QJHB 1G43A 1MWAH 2EADA 4UDTB 3DO3A 5D1ZI 1YEFH 3K1DA 3NYKA 5JPNB 4MA1C 1EO8L 3M46A 2F15A 2J57A 3FQWA 1JAEA 2VQ4A 5B38A 2DBLL 5DHMC 4XMPL 4PCTA 4NO2B 4V1DD 3T1FB 2PABA 1YQ2A 2Z9TA 3BUPA 3ECBA 1FVEA 4ZO6A 5GGRY 4KV5E 3CV5A 4NXKA 3ROOA 3O81A 5GZND 5DWUH 1PFOA 3QUZC 4NNPH 5F7AA 4HD9A 1DEDA 4H1LG 1M3IA 3OSKA 4DETA 4AV0A 1KYOJ 1K6QL 4G8IB 1B6DA 5CU9A 2XXGA 2KZKA 3H3KA 3B2UC 4NPJA 2WVSA 1YUHA 4ZFOL 1OGAA 1LVEA 2XXCB 5BRZD 2WCSA 1PG7X 5AAMC 3N2JA 3WL9A 5GGUB 3LB6C 4BDVB 4F20A 1S5IL 1OE2A 3TA3C 3V9FA 4U6YA 4M8VA 1NDMA 4GQ9H 3DX8A 3ABMB 2XTJE 4CJ1A 3REWA 1JGLL 2PPFA 1YY9D 3B3IA 4MAYC 2BW4A 5JXAH 2X42A 1ZHNA 2AXFB 2B4CL 2GJZB 3BPNC 4L8BA 1JP5A 3NIFB 2PP7A 3NBNA 2XA8H 5BJTB 4Y5VA 4XVJH 1LE5A 2CKNA 3C6SB 2EXYD 4H20H 1HQ4B 2WYHA 2ZZUT 3QJXA 4L3EE 3LV3A 4APQC 3EOYG 3ZBMA 3PWNA 2MCMA 3ZKXB 3VACA 3ARDC 3PQYB 4J8QA 2B39A 1FBIH 4HP5A 1YZZA 3EYSL 4P3DA 4KROC 3RQ3A 5EC2B 4B9YA 4AYEC 2AS5M 2H2SC 3OD3A 3MV9E 4J3OH 4TQIA 3H55A 4AVJA 2P9RA 3S36L 4R3SA 3QDAA 1UACH 4FNRA 2W38A 4ZW7A 4PJGF 4M9PA 4PJHA 4ZODA 2IWKA 1Q0EA 2C9VA 1S3KL 2WK2A 4FCAA 2OMYA 2ZKHH 3WJLA 2KQMA 4FP8H 5ALCL 3DVNA 3SE8L 3AS0A 3NG5A 1I9RH 2NT1A 4H44C 4IBLT 1JVLA 3HNVH 5EB9A 1HZLA 3TBWB 1EPFA 1ZANL 5AW2B 4PV8A 1E42A 2JI1A 4BM7A 3AY4A 4O51A 4O9HL 1TPXC 4FQ1L 4CC0A 5IUCA 4ZZFA 1KXTA 4OLYL 5E6RB 2P7TB 5CSZB 1UKQA 1QVOB 1R34A 3AFLA 4L05A 3HLKA 3WTYA 1LXMA 4MS8C 3UBFA 1I1CA 1X5ZA 1YC7A 4ZW6A 2X2JA 4QHNA 1EIBA 3CFEA 2CJUL 2D7TH 3OKNB 4LU5L 12E8H 2YBGA 1B0RB 1HHHA 3D85B 4C57C 4OCRH 2BHZA 4AEHH 1JVKA 5DRWA 3AG1B 1DVSA 4WW2F 5BRPA 4N86A 2QKIA 5KW9L 4X80H 5FHBL 3IN0A 1G9MH 1RZGB 4GMTH 4ONFL 5KBPA 3BEVB 3DXAD 4LOEA 3ASWA 4UNUA 1L7IL 3NDZE 2E5EA 3REVB 5LAXB 5FLVA 3NSJA 5EUOE 2ZXAA 3AS3A 3P11H 4LARH 3KYOB 2Z7UA 4P9ML 5I66A 1FO0A 1UOLA 5HBBA 5GJSL 3RX8A 5IVXA 5T1KB 1J8HB 4AEIH 3OXSB 3WENA 3CN4A 1OK8A 4BA8A 3VFMB 3C5SA 3TESA 2FIRT 1A4BA 2W95A 3UX9B 1ACYH 5DYOA 1J0ZA 1YJDC 5TE6H 3T0EC 2MCG1 4LAQH 1HL9A 4PJAB 4HIIA 1PZCA 3AXIA 4Y0GA 4X2UA 4S2SB 1UCTA 3A23A 3QG7L 1NH6A 2GVYA 3T3PF 2BIPA 3DMMD 1WBXA 2B1HL 3RTQB 3GRBA 5K1NA 3OAYH 4QRUA 4S0SD 2X7LB 5MHSE 2BY2A 1QQDB 3CBJB 2OP4H 4BFBD 2HPTA 5IEKA 4P4KA 2J6EA 1DANU 4MA3B 4KAQH 1DQLL 3MJ8A 4GO8A 1TZHB 1NFAA 5GJTH 2C3GA 2EDTA 3BSZL 3P0VH 1U3HB 1CVRA 3TBTB 1A7QL 4K94H 4GIPD 4MJHA 4HK0B 1QBBA 4HWZB 2VLKB 1OO2A 1BVKB 2ITFA 2BIQA 2FWOB 2MH4A 1UXMA 4P23A 1YNKL 5F9DC 3S88L 5FF6B 2YPLB 2BFVL 4I0PA 4XCCL 4KQ4L 5D7JB 3VSVA 4UIMB 4Y88A 5G2NA 1TKWA 1BOYA 2YAEA 2OMWB 4X6CA 3RZCC 4MJID 3S5LA 4F24A 4Z77A 3OZLA 1NUGA 4DK6A 2XN9B 1DE4B 1FCGA 1FO0L 3CXHK 2EDHA 1ZT4A 4YHKH 2I5YH 4UTBA 5F7KC 3AU0A 3D7PA 1UASA 1Y6KR 2IDSA 5CU5A 4P99A 1Z9NA 3OHXB 4LOUC 2Q8AH 5EEXA 2X6VA 1IC1A 4I48B 4K71B 4FF9A 3OZKA 5D6CA 1WISA 4EI5D 1PJ9A 4H2CA 3EYQD 3D25B 2AGJH 4WKZB 3BAEH 4G5ZH 4JKMA 3LKRA 3D3VD 4TUKL 1A9BA 4O5LH 3MRDB 4HH8A 4X98B 3TWCL 1B4LA 4HJ0C 2CALA 3QQ9D 4YDIL 2E0PA 5CBAA 1Z66A 2JB6A 5EU6D 1DBMH 3LRLA 1GZPB 4F5CA 4I8DA 2X0WA 1UWFA 2RFXA 2WKGA 3B8SA 3NJHA 1F3RB 2NXZD 4GAAA 5ALBL 2CHXA 4XVSH 2DF3A 2J6EL 3BE1L 5E5LA 2WVUA 1CJYA 4EJ1C 5GS1C 1VFUA 2PO6C 2UXGA 3HVNA 3CFJA 2B1AH 4L23A 3TA3B 3T2NH 3VWJA 1SY6L 4A04A 4G8FA 2GY5A 4PLJC 3H6AA 3JWDL 4E9TA 4NZRL 1T0NA 4X6DF 2Y5QA 3GMNA 2CM6A 3QDMD 3O0LA 3SDYL 3T4AA 1EZVY 1F6AB 3C09B 5CIPB 1CF1A 32C2B 4MAYB 2FBRA 3BPNB 2Z4TA 4NQCD 1AQMA 2WANA 4M1CD 2COVD 4BSJA 4B9FA 3GT6A 3WO4C 4HGKC 5AW8B 4GUOA 1Z1WA 2UXVA 2D0GA 3ZZQA 4GAGH 5DRXA 5T3XH 4XC3L 3RWDB 4F8TA 3VD0A 5IB4B 1BP3B 3G5WA 2FDBP 4JJ5B 1PLCA 4APQB 1EJ8A 3TL5A 1ND0A 3FRPA 1JZIA 3ARDB 3OSVA 1MVYA 3B2MA 4F8PA 1XBDA 3K91A 3U46A 1BMGA 1K3ZA 1MAJA 4TQEL 5DFWH 3TEZA 4I3SL 4KROB 2XKUA 2O5ZH 2W0FA 5JXED 3K1KC 1VZHA 5JQ6L 5FGBA 2VCOA 3LMJH 1FRGH 3PAVA 4PW4A 3OLDA 1A4JB 3B2VL 4MD4A 3ESOA 5GS2D 4X7SH 4O2FA 1KJ3H 3GZOA 4HK3J 3MLXH 4BKTC 5FM8A 1NOFA 1E4HA 5ESQA 2H0JA 4KXBA 1YYML 4P57A 3V0GA 4N3UA 1LD9B 4OGYL 1B0WA 5TDOB 3WKYA 4BQ6A 4YDLC 3RBSA 5DGQA 2XY2A 3I84A 5FYKH 3L08A 4HS3B 4OGQC 5B8CA 3VFSA 2N7BA 3PWJB 4F15C 4OD1L 3GB7B 1X5YA 4F8LA 2CCLA 2EYTB 4A68A 4MXVF 4G3YH 1L5GA 3DI2B 3SBQA 1MCKA 2MRYA 3BWSA 4U4IA 3EYVA 2W07A 3S98A 1YECL 2G5BB 3GLEA 5DJ0B 4JCLA 4G5AA 3CLFH 1WBZB 5FYLL 1O7SA 4U7MA 4KX8A 4RZCA 4QKXB 4KJQC 5FO8B 5I1LB 5HI3C 1THAA 2GHWB 4BXSV 2BS8A 4U2YA 4P5MB 5AW0B 3ZHFA 3NCEB 1OAYL 2QSQA 3M17B 3T65A 3A22A 5AD0A 5CWSA 4FKKA 5IB3A 1DTUA 1KCRH 1H3VA 1FC1A 2K45A 3HC2A 4PRPD 3SDXA 4YHML 3WJLC 5B22A 1R75A 5C8JB 2R2BB 2JSFA 5DD0L 3TYFB 4X8JB 4OB5L 1HYSD 5L2JA 3LQMA 2FZ3A 3N42F 2ZCKL 3RPIB 1QSFE 4A6YA 4QRTA 3U9PH 1AGFA 5E2VL 1X5MA 3AY4C 2AHIA 1VFBB 4OCSH 3WFHB 1L9RA 3NQIA 1B2YA 3GSNA 3WTSA 2HX9A 2YSSA 5DI8A 4CSZA 5JPMA 1JCVA 4GMSH 4ZMTA 1N6QL 1A1MA 3RG1C 4JE4B 1VCAA 2AJVH 1ASPA 3N85H 1NM4A 2QV4A 4B60A 1XF4A 4R96A 1OCOB 1XAUA 1SOSA 1UEYA 1XCQA 2KLTA 2R23A 3BUDA 5A3IC 1AMXA 3FW6A 3HKFA 1IGYA 3FT0A 2JI2A 4YE0A 4M9OA 3C6EA 2AXHA 1SBSL 4HFUL 4UUJA 3UIZA 1T6VN 1XGPA 2ZWZA 3LRKA 3P9MA 1D5XB 5ECGA 2QKIC 2ADFL 2R0WL 4JY5H 1WT5C 4M6NL 4LSRL 3THML 4YHOL 4KGLA 1KACB 1LYQA 3RWGB 3DURA 4CVXA 3TT3H 1MCNA 4P9HH 4XNDA 4CKVX 2WP3T 2W5PA 4DP5X 5T8IA 4QNPE 2KZBA 1MCBA 1ZVYA 2R56H 3HAEG 4FTVA 4NQXA 5EUOF 1CE1L 1JZGA 4LHQB 3FMGL 4AMXA 4B3EA 1HL5A 4J6RL 5K9JL 4C56E 4TVUA 4OZFA 1TTCA 1FIGH 2PXYD 1M2VA 4J12A 3QDGB 1NCHA 5C9JB 4HCIA 3O11B 3O6FD 1N70A 1A0QL 4RETB 4JBSA 1BM3L 1V54B 1DO6A 2DL2A 2ZF9A 5SWZA 4IOIA 5J57B 2F53A 2R1XB 3D4YA 3UBGA 3MO1A 1J88A 1FSKC 5IHHA 4KNUA 1CXKA 5T1JA 4PJBB 2RQEA 1A66A 1TJXA 3L6FB 5CJ8A 5ANHA 2GJJA 2ZYHA 1MAML 5ICYB 4FS0A 3DSNB 1BG1A 2V2WB 3FUFA 3BMWA 4FQLH 2QTEA 2WCPA 5D1XD 2Z31C 5IJCC 4D0CA 2L04A 4IEFB 2J12B 3QRGH 3P69A 4K9EC 1RSYA 1SJHB 4L3CB 3K81A 3WIFA 3RB5A 2LLNA 3BX7C 5KS9A 4PJCE 4P4KC 2DLHA 1SZNA 4NUJB 1F13A 5IWLA 1MIEH 1UATA 4WJ5B 1QI5A 2UV3A 2Y7NA 3T8MA 1EO8H 2AJXL 3V4PL 4GRMB 3TF7C 4HFWA 2DBLH 3BLPX 4CVUA 3OC8A 3WXVL 5C0GB 4OCLC 3CSPA 4PRHD 1H3TA 3L3JB 2WZPD 2GJ6A 3UJTL 1CGTA 1MXGA 4P23C 5E1AA 1EHLH 4M5ZH 1EEYA 2CUAA 2N3JA 4JW3A 4I0PC 3O4OC 4MJ5B 4PR5A 4WFHD 4UQ3A 2DH3A 2BVOB 4IYKA 3ZIYA 1X7QB 2PW2A 5D7LD 1K6QH 2VDNB 4ISVB 2XIBA 4N8VA 4FG0A 4XP9H 5GS1B 1E9PA 4AW7A 5C0CA 4PWHA 1XF3A 2C9RA 1MVFA 2Q76A 1I4FB 4AEFA 3GRWA 3D07A 4UBDD 5KUMA 5LGKA 2LFEA 4QRPE 2A83B 3E6HB 1CL7I 2R69A 3QNYB 3B9KD 5K5YA 3EBHA 4JDVA 4PBDA 5SWSD 4KO7A 2WQVA 3MOBL 2YAOA 3NRFA 1HHJA 5F93C 5ISZB 1AKJA 1CG9A 2FNBA 3FQWB 1PX4A 5B38B 4XMUA 2MMXA 1OAZL 3CVIH 2QQNL 4MMYA 1TETL 3ECBB 2AW2A 1FVEB 3D39E 2O5NA 2ZOKA 2DQMA 3IF1B 4IGBA 3RTLA 3ROOB 1DBBL 3S6CA 2DRUA 4LLDA 5CP7A 3X1FA 1YEHL 2W1NA 2YA0A 4TXVB 3FYIB 2HX7A 4RGNC 1J0IA 3ZX1A 3GI8L 1YUHB 1OGAB 2IALA 4OV6F 3QCVL 1X4YA 4H13C 3WL9B 1WFUA 7PAZA 5HYJD 2H1LM 2R7EA 3S36H 4QI3A 4N24A 4G72B 3VWJC 3RVXC 4HLEA 5BUPA 3BYTA 4U6YB 1NDMB 4ZXBA 1BQHG 3DX8B 1RUPH 3BD3A 1ZWIB 4XMWA 3SGDH 3REWB 3TNMA 5I23A 1S3KH 3B3IB 2HXAA 1ZHNB 4L8BB 2Z8SA 1CDHA 2BWQA 3FSVA 1T22A 2HT3D 1YG9A 4GBXD 1OP5K 4YDLB 3QISA 4KTYA 5MI0C 3SE8H 3AY2A 3HFMH 3X12A 1VRSA 5GGTA 1T6WA 4Y5VB 1WDAA 1GMEA 1LE5B 1EO5A 1M05A 4F15B 5CM1A 1BXAA 1D7CA 2VUOA 1HK6A 4Z7UF 4DUXA 5I6NA 1TVDA 4MCMA 5JTWA 3LV3B 5KWYC 3IM1A 2OJZL 4FQ1H 3ULUF 4MD0A 1KTDA 2FVNA 2KT6A 3PWNB 4NM4H 3U48A 3AW5A 1NAMA 4FXGB 4OLYH 2HT2D 4LAJH 3S35L 4JKKA 5HVHC 1S9XA 2VW6A 3FQRA 4P3DB 4LFHD 2UZIL 4MS6A 1HOEA 2R2CA 2Z64C 4OF6A 4AM0A 4NBYB 1E6JL 1AGEA 5DC4B 3NIGE 3QEGL 1YUKB 5DFAA 1ROWA 1MIML 4R3SB 5FGBC 3P30L 3NZHL 1QNIA 5PCYA 1BV8A 3SPHA 2CJUH 4PJHB 5IUSA 3WHE0 3V5KA 5D6DC 4QHMB 4QXWA 5EF1A 4HJJL 5TE7L 1INEH 2XTJD 2I60L 5D1ZD 4JN1H 3GBNL 2CBMA 2OMYB 1AG6A 4PGDA 1HOCA 3DVNB 3L4TA 5KW9H 5FHBH 5TFSL 1JXKA 4ONFH 3QQNA 5I6KA 4BQ8A 3FH5A 3ZDZF 1CLOL 2NDFA 4PV8B 4OGAC 5B8CC 3O4LE 3VWKD 4F7MA 1F4YH 3C08L 4O51B 4WFED 1M6UA 3RIFF 5MENA 2D8KA 1T7XA 3RHWK 1KXTB 3NT0A 3TC9A 3FONB 3U2JA 3ORJA 2X4RA 2IBGA 2RB8A 3QUXD 3V0FA 1NEZG 3CXDL 4OVUA 5B7EA 2FJUB 3FN9A 1FNFA 2E75C 3HHSA 1SN0A 4AIEA 1IAIH 3MRPA 1P4BL 3EH5B 4QHNB 2C1OA 3CFEB 3V9EA 1FA4A 4CMMA 2RD0A 4Y9EA 1HHHB 3IDUA 5DRWB 1FFQA 2QKIB 4L4TD 1YVLA 2E7LA 3V6ZA 5C0AD 4AT6A 4HS8L 3JV4A 2B1HH 4G9FA 4WTZA 5KSBA 1R24A 3EF4A 4BFOA 3QUGA 3VW3H 2AXWA 4M1GL 3ZGIA 2BP3A 2A4CA 2XV2A 3ZTDC 3PABA 1HESA 1I7UA 5B1KA 1FO0B 5I66B 4KXZH 1NZRA 1KGIA 1KZYA 1TITA 4AI7A 3BDYH 2BSED 1FGVL 3IPBA 3GIVB 2VGLM 3PHAA 5IVXB 5JPMC 4D0BA 2DQDL 3BSZH 1N0LA 3FOMA 3WNLA 5KUKA 1A7QH 1RJZA 1BM7A 4HALA 1KGYE 2F74A 5IHLB 1LQSR 2DYPD 3C5SB 5FIEA 5D7SL 1J1OH 1Q94A 2CO7A 3SE3A 4UNTA 1YNKH 3LTVA 2JKIS 2BFVH 4XCCH 4KQ4H 5DYOB 2F7OA 4ZUUA 1FSKB 3CDYA 4TQ8A 1RERA 2PWGA 2YMXL 4HIIB 2Q3AA 5JHDA 2CLRA 1HCVA 5GGRA 1V27A 1NC4A 3K6SB 4W6XB 2NQCA 5JZ7C 3F8UB 3VXUA 4Z3TA 1WBXB 4G6AD 5HJ3A 1DVYA 1DZBA 4QRUB 4R4NC 4JFYA 1QNZL 2D3VA 4KRLB 5F89A 3HUJA 5DQ9A 3QEQA 3J27A 4ATTA 1CI3M 3V4UL 4DZBA 4D9RE 2ZAHA 4DWHA 4P4KB 5IEKB 2GSGA 1D9KA 2ENSA 1TJMA 1D5BB 4KHTL 4NKQB 3CU7A 2PYEA 2X70A 4PCKA 4PY7A 3QUYA 3MJ8B 4BQCA 2JCWA 4TUKH 2NLJA 1CFTA 3K4ZA 1W0WA 3TWCH 5C6TL 3QA3A 4BK8A 1XGTA 2JTDA 2DM4A 2AITA 3EH2A 3VX1A 4JY4A 2BXZA 3QZBA 5D2LA 1CFNA 1AANA 4RMVA 4JGJA 3KZ8A 4P23B 4CGTA 1T0PB 5CZVL 4I0PB 3O4OB 3HG1A 1JF6A 1TKWB 4X6CB 5ALBH 3DO7A 5C0DA 3WMPA 4TLSA 2IDTA 5LKNA 5LCVA 6PCYA 1X9RA 3UDWA 4B0MB 4BQ9A 4F93B 1D6VL 1ZT4B 4EN3A 4Z7AA 4TPRL 3CX5K 3FDWA 1PEZA 1J5IA 1XF5A 3IMVA 3OAUL 4ALAC 4K3JL 1OE3A 3PQYE 3HI6L 4AX3A 1SUJA 3GBML 3TEWA 5D6CB 2WSPA 1P7KA 1ZSDA 4MAUL 4FG2A 4KTEH 3TFBA 4ANUA 1G9EA 5EOCL 5I1IH 1AGCA 3VI4A 1J9RA 5EU7E 1U8HA 1L9TA 3EJYC 3WTVA 1WH0A 3LKRB 1FH5H 1A9BB 5C2UB 1EFQA 5D96B 1ZXQA 3H42L 2YR3A 2WN2A 4MJJA 4PJCF 4ZOEA 5IFJA 3RDTD 2EDFA 4XC3H 2CU9A 3L48A 3CVHL 4ZPTA 4GSRA 3ESVF 4FFWC 5EF0A 3R8QA 2JB6B 1S4IA 1A2YA 2DQEH 4WWID 3UAFA 5E95B 1XF1A 2XZCH 2RFXB 3NJVA 2EXTA 2GCYA 1C08B 2ZXGA 1E4WH 2JKRM 3O8XA 4RGNB 1IO4C 1T04A 2UYLA 3R7RA 4TQEH 2KHAA 1DJHA 2CNYA 3TBCA 1SYSB 3HEIB 4I3SH 1F1DA 1IEBA 3WN5A 1LL1A 4AVIA 4RZKA 3L3HA 5HD8C 1MFDH 3CFJB 3MAWA 1KEML 3VWJB 3F7RA 4B5ZA 4G8FB 1T0NB 2QTVA 3GMNB 4LLAA 3SOBH 4NBXB 3U83A 1OAUL 1LWHA 4I9WD 4I9XA 3T4AB 4HA1A 2C9SA 1V8HA 3Q43A 3KWWA 1ZDSA 2W88A 1WZ1H 1IGIH 1YYMH 2FJHA 2ZQKA 3OLIA 4JG1H 3ZSTA 4OGYH 5MI0B 3BRDA 1GZHA 4WDIB 4AGLA 2CM5A 3IDXL 1AC0A 1U8NA 2WNGA 2JJWA 4YIQB 4IQHA 1ND0B 3FRPB 4OKDA 3JWNG 4IGBC 3VI3A 3IU4H 4I18A 4X5QA 3VMPA 3U46B 4G1EA 4D2NA 4FZ8L 1YEWA 4KXAA 4L9DA 3TXAA 5F6HJ 2EE6A 5DD5L 2HB0A 3RIFK 3W11C 2W0FB 5FWQA 3ZU8A 1XSJA 4YXHL 1BLIA 5L2KE 2YQ2A 3MCYA 3AWGA 5IR1A 3NCYS 4OSUL 4MD4B 4O2FB 4BCYA 4IDJH 4DAGH 1W72H 3IFPA 2NT0A 1OTUC 1KBGL 3DX0A 5DMIL 1O7DC 1LEGA 4ZXBC 3UO8B 5ESQB 3PP3H 1HEZA 4P57B 3FTWA 3X17A 4X8CA 5HI4C 1J8HE 4YHMH 3PDOA 3F00A 5DD0H 3UZQA 3II2A 4FE9A 3WS3A 2AVFA 4NAJA 4ODTL 4OB5H 3ULUD 5B8CB 2VSMB 2IO5A 1NUFA 3VFSB 4MXQD 1LO0H 5GS0L 3KLKA 4G7VL 2K8QA 2X0UA 3IDMA 4PJAE 5IOKA 1TLMA 4LNRB 5E2VH 5CFAA 4F7EB 3LKOA 1L5GB 2ADGA 2F2HA 2W07B 5I6XC 3DNKA 2XZAL 3TJHC 1ZLVH 3P4OA 1FIEA 1N6QH 1VLXA 4LSTL 4ELMB 3AMLA 3SODB 4DN3L 3WTTA 2GYSA 2L7QA 5CMAA 4N6QA 5GGQL 3WMQA 2W9DL 3CSTA 2GABA 3DX1A 4JM2F 3T6WA 4IK6A 5SV4A 4DQOH 5KVGE 4XAWL 3T65B 5AD0B 5B7FA 5CWSB 1HVXA 5IB3B 4FERA 2O5YL 1XXDC 5KYNA 4KO9A 3GS0A 4GEJA 3SDXB 5H4YA 3W5MA 5CLXA 2R0WH 2ADFH 2EEAA 3H3PL 2RGSA 4YFDB 5HTSA 3MLZL 4CDGC 1EANA 4M6NH 1SHMA 3RPKA 3UGXA 3THMH 4YHOH 1XBRA 5L2JB 2A0LC 2YPLE 2FZ3B 4OI9A 4JM4L 4JZOA 4A6YB 3CVDA 2QPDB 4QRTB 3BUIA 1AGFB 4LQ1A 3QIBD 5K9OA 1L9PA 4FNTA 2XN9E 3CQQA 1SFHA 3GSNB 4Z95L 2AERT 2OCCB 2YSSB 1RIHH 5DI8B 5JPMB 1F4XL 4PLKD 3KLHD 1CE1H 1A1MB 4LCYB 4QWWC 3N1PC 4M48L 1LLAA 1LK3L 3S37L 4BWUA 5IQ7L 3LXAA 1L4IA 1KFAL 2V33A 1XF4B 4R96B 2P46B 1XCQB 2R23B 3II1A 3L5JA 3MLVH 1A0QH 3I2CL 1BM3H 1IGYB 2FUTA 4XT1C 1M57B 1VPOL 4UUJB 3ZDYF 3P9MB 5D4IA 3U4BH 4PGBB 3VRJA 3ISYA 3RUGF 3BH4A 3VMOA 2E7LC 5F1NA 1UOWA 1MAMH 3D1MC 3B4NA 2AV7A 2DI8A 5GSRA 4LMQI 3DURB 4CVXB 2C9XA 4JDTL 3PUCA 4N8UA 1CK0L 5C09A 5T3XE 1QRNE 3T08A 3AMKA 2AQQA 5TD4A 4AMKH 4PI2A 3DV4A 1I7TB 4FTVB 1JS4A 3CNKA 5KZCD 2AJXH 2HRPL 4BH8A 2HMIC 1IGCL 1PDKB 1B3IA 2Y24A 1CYXA 2K4WA 1M2VB 1YNTA 2J73A 1PX8A 1UKTA 4B9GA 3QI9A 3MUGA 2FJFA 4M7LT 4LLMA 5SWZB 4IOIB 2F53B 3U7WL 3MO1B 4YK4B 3BZFA 4J3XA 4JRYA 3WTXA 2D2CC 1SRDA 4XCNA 2DWEB 3F64A 4UILL 3OAZH 3D08A 3FPYA 4O58L 1FHGA 4BZ2L 5ITFA 1SGKA 3MJ9H 4D0CB 3BFOA 3BHBA 3TJEH 5E8PA 3RFZC 3O9WD 2WGXA 3BP5A 3K8MA 4PSRA 5FYKE 3WIFB 4N1HB 3IDJA 1D9KC 3OKYA 5IFHL 1QBLL 1BHGA 1HKLL 1G5AA 3QUYC 1H3PL 1INQA 5ANMB 1ZTXE 4HFWB 2AEWA 1JD7A 1OAZH 5J56B 1BQHA 3UCQA 4S10A 2FLRT 1NMAL 2X89A 2Y2WA 1NINA 1JIBA 2D7PA 1X4XA 2GJ6B 5E1AB 1E9QA 1AYRA 3CQPA 2VM4A 2G2PA 4PR5B 4P2CG 2BZDA 4UQ3B 3K2KA 3VE0A 4E41D 2YQ3A 2PW2B 2APXA 3ZPDA 4N8VB 4BYHA 1E9PB 3LOWA 3LS4H 4TNWK 5C0CB 4ZFQA 3UDWC 1XF3B 3HS9A 4NO3A 5GRVL 2Q76B 4EN3C 1PCXA 1GYAA 3QPXH 4YVNA 4OJFL 2VSDA 3TASA 3CZJA 4JDVB 2H6OA 3BQUA 2VDRB 1DJZA 2CDGA 4ZSOB 3SO3C 2QSCL 3UAJD 1HHJB 3RU8H 5GIRA 5GZOD 1CO1A 1AKJB 3TCXA 1CG9B 3INUL