2P9RA

Human alpha2-macroglogulin is composed of multiple domains, as predicted by homology with complement component c3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
b'DSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-2-macroglobulin
publication title Human alpha2-macroglobulin is composed of multiple domains, as predicted by homology with complement component C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01835 MG2 MG2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p9rA00
4LNVA 3FRPA 4FXGA 3T4AA 3HS0A 2ICEA 2A74A 3L3OA 5FO9A 3KLSA 4KH9A 2A73A 5FO8A 2QKIA 3G6JA 4FXKA 5JPNA 2XWBA 3HRZA 5JPMA 5FOBA 2B39A 5JTWA 2P9RA 3CU7A 2PN5A 2I07A 2WINA 4D94A 2XWJA 3OHXA 2WIIA 5FO7A
chains in the Genus database with same CATH superfamily
5HGDA 1KXQE 4P5TB 2O5XH 3ARDD 2JJWA 3RFRA 3MNWA 3TEZA 2DQIH 5FW8A 1LO5A 3F04A 3BP7A 4JFXA 4OBSA 1R0AL 4X7DC 3VRIA 4LOVA 4PRNA 3HNSH 1JFQL 1SOQA 1JZFA 1RZKC 3MO1A 3MRFA 4RIRA 4IBYA 2EIDA 4G6ML 2XZQH 3SQBB 4M1DH 5HD8D 3IAGC 4MYWB 2XNAA 4R7NB 1HXYB 3KS0H 1GZQA 2EC8A 4NENA 5C0CE 5E9NA 5FGCB 5AFAA 4XN4A 3KXFE 1AGBB 1BHGA 1MJJA 2CR0A 2AKRB 1OAXH 3T0EC 3IETA 1A5FL 4P3DB 4XMLH 4AITA 1SJEB 3WE1A 1SM3L 4X9IA 1GXEA 3V4PH 1G0XA 1NGQH 4YAQB 3VXUD 4NRYA 1FYTE 2B1HH 3QDGE 5FM8A 5B3JE 4OQTL 4H20L 2C4XA 1I1AD 3DO7B 3TO4D 4EQ3A 3DSFL 4I0PA 2XPYA 3SHSA 4Z3TA 5BVJA 1KB3A 1YN6B 2VDML 4HS8L 5CGYD 2YPLD 3SDXF 3ROOB 2B8OT 3S6CA 3ZO9A 2HJKA 2BLFA 2BNRE 5E8EA 4IDJH 4AE1A 4YPJA 4X9BA 1SY6H 3LH9A 4JBSA 3BSZH 1J0HA 5TJWK 2HLAA 4MBRA 4NI6A 3BRGC 3PABA 3QIBC 1CICB 2C3XA 3ABLB 2R2CA 2ZSWA 3EH1A 3AITA 3BPOB 3PQYE 4ICXA 2WLIA 3HPJA 1KZYA 2A9DA 3VXTB 5GXBB 5LLIC 5GRXG 2XWZA 4Y5VB 4XC3L 1QTYT 1CF8L 3C5ZC 3BAJA 3F05A 3ULSB 3D4CA 4AE0A 3UPCA 4ZI8A 3RX7A 1C8PA 1INQB 1HOCB 4JRXA 2OLDA 1KDJA 1A6WL 3VA6A 4PRIB 3CCHA 2WLMA 3JZ7A 5C0BB 1M3JA 3GI9L 4J1UB 4F3FB 1DBKH 4R4FH 3WIIL 2X3CA 4J6RL 4DT2A 4JJ5A 1PPIA 2P80D 2JXMA 1T1XA 2ADIA 1JP5A 2R4SH 1A14L 1MG3C 1HN1A 3IDMA 2D7TL 4XMKH 4XMTA 3TO2B 1KPUA 5ACZA 4ONFL 1JZ7A 1KTLB 2AAVA 3RDTD 2P5ED 2YOAA 5C0AB 4ELDA 2CKBB 4X7SL 2CAKA 1M2VA 5DS2A 5GGVY 4W70A 2EO9A 3OZ9L 1TZAA 1A64A 1X7SA 1SVZA 3FUFA 3S2CA 2F1AA 4Z7OE 5TF0A 2OMUB 4D8OA 3LZOA 3VXRD 1MOEA 1QLEB 1BOGA 2K6YA 1T20A 2WHVA 3ELAT 3QZWG 2V5YA 5SX5K 3NIGE 4KI5E 2E7HA 3BWSA 2QSTA 3B3BA 3GLDA 4UBDC 4FLSA 5F9OL 3X1GA 3QDMD 35C8H 3LZFH 4CA4A 2WXLA 2CR3A 3IFNL 1OCCB 1JZGA 2PABA 4J2QA 2R2EA 1CUOA 3HS0C 1S5HB 3GRWH 5C09A 3CFJB 5GGRB 4LSDA 3VFNA 1SMDA 3MGTA 3OAYH 1CDGA 1HHJA 5GRVL 1T21A 3WGVB 3N44B 2NY4C 3KPOA 4OGXL 3NZHH 32C2B 4QKTA 1QHOA 5FFOA 5KVDH 4HXBH 5K5YA 1EEYB 1E7VA 2XA3A 3I50L 2NW3A 4OZIA 2XYBA 1UKSA 1S7QA 3FFCB 3LS4L 1L6ZA 2GBVA 4DGIL 4KC3B 1WGVA 4F8PA 2QGDA 3HG3A 1Z0MA 4O58L 2HPOA 1VFBB 3O2WH 4Y7MA 1GKEA 1U6AH 4MAYC 1TJHH 4ODVL 5E5MA 3WLWC 1DO5A 4ALAH 3AS2A 3U4BL 4JHZA 5C0BE 5D7EA 1UD3A 1XGRB 1YEHL 1A9VA 2K0RA 4R5XA 5D2LB 1IAII 3ARGB 1M6UA 2XPGB 4NT6A 4IU3B 5DS1A 3WIFB 2CIIA 4I88A 3JV4B 4MDJA 1P4BL 2CRYA 3P30L 3QUZB 4L5FH 4FS0A 4EXPX 5AVZB 5C0AE 4YEEA 2PXYC 5GHWH 3POHA 3FAXA 1VA9A 2EIZA 1NJ9B 4PGBA 3WO4C 4JUTA 4NERA 2V9TA 2RJMA 3BIBX 3EZ8A 3DYMA 3RAJL 4AQEB 1HYSC 4Z5RB 2QQKL 1TJIH 3HI6L 1JGVH 2ZG2A 3RGVC 3V6ZB 1YJDH 4FNQA 2IPUG 5EZLA 4YXLH 3NJKA 5FUCE 3VB8A 4J3VA 2F68X 5DRZB 4QRSA 2DQHH 5EBMA 1G7MB 4NGHH 5FA3A 5J13B 1ZKAA 3TU6A 3MJ9H 4LPXA 5L8JB 2W9LA 4AXWA 3B7SA 3LH8A 4LSSL 1GCYA 2Q3ZA 4I85A 5DD6A 1ZGLA 1QMUA 4PH8A 3W9DB 5HY9B 3FTGA 4OKVB 3ZT6A 4DKFH 1MFDL 3JTSB 3O3DB 4LHUD 3OM3B 3FFCE 4H8UA 1TXKA 3WS3A 5HHQA 2WNKA 2K6WA 5IB4A 5IFHH 2VIRA 4YHZL 5D7IB 4MJ6B 4WLCA 5MEPA 5PAZA 3OQRA 2R29L 3IGKA 4Y88A 2WBJC 4PJAF 4TSCL 4WO4B 1TETL 4F1SA 6PCYA 4UM9B 1WSST 4FL4C 3W9EA 3GS0A 3TBCA 3BUPA 4Z3GA 3A6OA 5B1JA 3WG7B 3S5LA 3W38A 2V3EA 4Y1AD 5SWSD 4PY8I 3I84A 4XPBH 3QO1A 1T22A 5CSBA 4ETQA 1RI8A 2ZTBA 1YEEH 4WHYH 1QI3A 5F7UA 1OTSC 5D2LE 5KYWA 4HUUB 1IM3A 1NGXA 5HVHC 1BG1A 1YY9C 5H37H 3KWXA 5T3ZD 3GSNH 3IDUA 4JJOA 4XPGL 2DZEA 3V8CA 4BQ6A 2PR9A 2OBGA 1UWFA 1DVZA 2JKTM 1BXAA 3GMOA 5B1CA 2ESVD 5EA0L 3K4ZA 3LZPA 3QZMA 5I1EH 3L3IA 4G2AA 2R7EB 4GQZA 4PJ9B 5DTFB 5E8OA 4HS6A 3T2PA 4JG5A 4MXWH 1H6TA 1WCBB 5ERWA 2X6BA 2BP0A 2B1OA 2IGFL 3MRIB 4B96A 2OX5A 4AM0Q 2KMWA 1AG0A 4HFUL 2BSED 1XTMA 1FRGH 4P3CL 1K72A 3Q7JA 4M4RA 1CZ8L 3W0WB 4JQVC 4KKAD 4AL8C 2EEAA 4HF5H 2E6PA 3B2VH 4X80L 3OJVC 4Z7VF 3VTAA 4U1LB 3QUXC 4J8QA 1MELA 3T1FA 3TTYA 5JHBA 4KJPC 3IFPA 1DBBL 3PAVA 1U8MB 4LL4A 1T5XB 3VD7A 4R96A 2H6PB 4GRWB 3B4NA 1UOLA 5DC2A 1RU9H 2FIKA 1DYZA 3HKFA 3HG1B 4LXFA 2DYPD 3ULVL 1OAYL 1RZFH 3P4NA 2IDFA 4NAQA 4S1QH 5CNHA 1TZIA 3BYTA 4CNIB 5KS9A 4NHUA 3VU1A 2G5BB 4IRZA 1AFVL 2NUTB 4X7TB 2R2BB 4LQ1A 2WZ6A 1MWOA 5IJKC 4QNPF 5I9QB 1P2CB 3PP4L 1CDYA 1EVUA 3CBJB 2N59A 3DIFB 3QDJE 4R26H 4QJ4B 1RP8A 4YHYC 2K9FB 1WTLA 3B8SA 1UJ3C 4WIQA 1QACA 2VQUA 1CVRA 2WN2A 3EF4A 1J1PH 3BSHA 3K7UA 5CJ8A 1A66A 3T65B 4EKXA 5LDUA 2LVCA 4PS8A 4A7GA 4JRWA 3T4AB 1KCRL 5SX5H 1V3MA 2A74B 3B34A 4QHNA 4U7MA 3RIAF 5IREA 4JGMA 3CBRA 3WU1A 5H35A 1QBML 1QFWH 4JY6A 4ERSH 4RETB 5KSVB 1K4CB 2Z7UA 4WDIB 5DJ8B 3ZDZE 5TE6L 1P7QB 1R24B 1JF5A 4NWTH 4ZMVA 3LNGA 4J3TA 5DHVB 1TZHA 2Y5QA 4XVOA 2QQQA 4WHDA 2C1OA 3P9MB 4Z3IA 3MV7A 4G8IB 1KTBA 3V4PB 1E3XA 1YUHA 1NBVL 1CFNA 1X5XA 2KDGA 1EJ8A 3MLZL 3S37L 1MFCH 4HXAL 1VZGA 5GRWA 1CO1A 1FVDA 4GIAA 1C1EH 4LPCA 4JPSA 4KZEL 3J07A 4DP6X 3H42L 5T3XD 1M9SA 1NFDB 3RUGA 5BS0A 5K9JL 1MZZA 5DSCA 5GZNA 1DVFD 3G3LA 3FN9A 2IOIA 3EADA 5EU5B 2RA1A 4PCTA 3UG4A 3QI9A 3HBGA 3RY4A 1WF5A 4WTWA 4OCYL 2CGZA 1YAZA 4ZUUB 2DD8L 3A4EA 4GRWE 3US0A 3WD5H 1AJ7L 4AZUA 1HINH 2IAMD 3TS8A 4HC1H 5M94B 1J05B 1LEGA 2V9UA 1RURH 5IT2H 1Z9NA 1NUGA 1XMWA 2VZ1A 2RMNA 1YEDB 3HB3C 5C70A 3RIFK 2F54E 1TQCB 1GGCH 3HA0A 4MNGA 3T77A 5I0DA 3QIWD 3KPSB 2WZAA 5LB1A 2I24N 1LE5B 4M5YL 1DUZB 4JKKA 3WUWG 3RNKB 4UTBA 1E8YA 1WT5A 5IF0B 1YYMH 5M95B 3QRGH 1SYSB 3PWVA 4XNXH 3RTLA 1UUNA 3PWPB 4Y4HD 4M6NH 1RAMA 4JHAH 5IVZA 1JK9B 4FI8A 2HH0H 4XMXA 1SRDA 4RWHA 4JQIH 5JZ7C 4LE8A 4YBQD 5DEGB 2G3ZA 5BZZA 4OZHA 3I6LD 3IE4A 4MMZA 1AZBA 3G5XA 4Y5YC 5EHFA 4YJZL 3GO1H 4OFKA 1JI1A 2FQDA 2CBTA 1LEKA 4UUJA 5DJCB 4PMFA 2C7UB 2EILB 1F3JA 3WE6B 4E2OA 5DD5H 1G7QA 2HJLB 4PGCA 1QO3A 3R19A 3ZIMA 2P5PA 5FYLH 1JHLH 3LB6D 1PCXA 4AK1A 5BMFL 2BHYA 3HRZC 4A66A 1YN7B 1QSFA 2RHEA 5D7SH 4JKMA 4A63A 3MOAH 3Q01A 2IDQA 4JY4B 2X1QA 3O3EB 3QUYD 4U6HA 2AI0H 1CL7H 3V52L 4HLEA 4ZMQA 1E4JA 4NNXA 5TE7H 1EO8H 3L3GB 2G9HB 5MERA 3WYRA 4AGPA 2XN0A 3KVQA 4ZOBA 1KN4L 2FIRT 2WXFA 3RTQA 2GTWB 3MRRA 4HCFA 4UQ3A 3KPSE 1WD8A 3B9KA 2A2QT 4WUKH 4XP5L 3IS1X 5DLMH 1D5MA 1YEFL 2EKJA 1YPZA 1PL3A 2V7HA 3QCUH 3REWA 5LBVA 4I77L 4OCNC 3BEWB 3X1NA 4PJ7F 1ITBB 3ZRCC 5HJBA 5TDNA 4ONHB 4NQQA 4QAWA 3EFFA 4KKLD 1KG0B 3AU0A 4PJXB 4RZCB 3WLWD 1A6UH 4PJFF 1N0LA 1QFWM 3GPEA 4ELMA 4PJEA 5AW7B 4Z8FH 5T33H 5BVPH 1FSKC 1X7TA 4PB0L 4LLUB 2Y4SA 4G71B 3V4UL 1RLWA 1S46A 4YR6B 3QVAA 2GJPA 5A16A 3MZGB 4CC0A 2QQLH 3CVCA 4ORGA 5FK9A 5EWIH 1CT8A 4P07A 4XCFL 4AM0A 1IE4A 4C4BA 3ULUH 2JCWA 4YZFE 4X6BA 5C0JB 2J5LB 2ILLA 2ZUXA 2E27H 4CGTA 1CE6B 3DIVA 2A6KA 3HAEB 3NK4A 1FF5A 4FRWA 2OFQA 4CC1A 4D7PA 1BLNA 4R9HA 2NR6A 2X7LB 2BVTA 2C3HA 2Y07L 4QUOA 4PVMA 4V1DB 1FFOB 2PWHA 3N43B 3FQXB 4J28A 5GS1A 2DWEB 1ZE3H 2XVLA 5CO1A 5CLYA 3MA7B 2Y7NA 4JPIB 2Z8RA 4A7VA 1CGXA 2Y6SC 5T3ZL 3RVTD 1TFPA 1ZV2A 3D2UB 2XC8A 3H9SD 4C57C 5I18H 5L4JA 3DVNA 2PCFB 1KT2B 4JFVA 4MX7A 3WKYA 3WDJA 5FO8B 2H41A 3SD5A 5T1DH 2P5WD 2D2OA 1XGPA 5EO0B 2A6DB 4E41D 1FZMA 2IPKA 1DQKA 1GZHA 3QHFL 2P8PA 4QXTB 5F70A 1HS6A 3N0PB 5CN2A 2QBWA 4IBZA 4PJXE 4WZ9A 5E8PA 3ZRSA 2VDOB 5JPNA 2RFXA 3GZKA 3LVTA 4M6MH 1RJLB 1Y6NR 1ZT4B 2EDHA 3CFDA 5F88B 5F7EL 1U8HB 4NNPL 2HZHA 4ZOEA 5L88H 3ESVF 5EZPA 2AGJH 4A2FA 1E4WH 3TIEA 3V95A 3VFUB 3EFOB 2R0LH 1CFSB 2IVFC 1JN6B 4IHOB 5CINH 3T6QC 1ZTXL 1CXFA 2IADA 1WFUA 1V7ML 3P9WB 4JFQB 1NIAA 5T1LB 5D9SB 3ZLQC 3KLSA 5JXEC 3PF2A 1ET5A 4KRPC 2ED8A 1YVLA 4WUUD 1JPGB 2A9MH 1KCUH 2FB4H 1IAIH 4PWHA 3RZWA 1IQWL 3AG2B 2ALWA 1IC4H 1QRND 1NDMB 2XZAH 4IMKA 2LLGA 1TZGH 4L3CA 3B6SB 4OFYA 1KC5H 1DEEA 1BMGA 1R3LB 1WHPA 2R8SH 3A6BL 2WLLA 3ARGD 1LNUB 3ZZQA 4DGUA 3TCLB 3VMOA 3ZDYF 2R39A 1UXSB 1PG7H 4NN6C 3TV8A 2P26A 4PS4H 4V1DE 5A2AA 1F4YH 2YKKA 2W65A 2W60A 5HGHA 2C4FT 1UM5H 1J0IA 2B08A 2XICA 3MV9A 3TH4T 2ICWB 1GC1H 2FD6L 4PTUA 3VFSB 2WLNA 4JFEA 3P0YH 3CFNA 3NAAL 1RFDL 3HHSA 4KMQA 4GI8A 3HE6A 3ZE2E 2X88A 3IMRA 2GT9A 4XXWA 3BFOA 3D33A 5EO9A 3ULVF 5CJQH 4MMXA 2F8VA 3D06A 3VACA 2FHCA 1XGQB 3G5YA 4PRBA 4I4WB 1MLBA 3KBHE 5DD0H 2GIMA 3V5DA 1E4HA 4LOUC 4PJCA 5KVEE 4P2OC 2VLKB 2HFGH 5FLVA 1O7DC 3DBSA 1MQKL 3E6HA 2OMZA 2WSKA 4ZYKB 1GYCA 2VABB 3HHMA 3VXOA 3WHXB 5C7XH 3SBQA 3H54A 2X87A 1OGAA 2V8MA 2FEDC 2BSBA 2ODIA 2Q9OA 1IGIL 1PEWA 1B3JA 2YR3A 4APXA 5IR1A 3Q13A 4G43B 2OYLA 5IB1A 1Z5LA 1ADWA 4X4YB 1X5IA 2UXVA 4D9QD 1AS8A 5J9PB 3X11A 2B1AH 4F15C 4UM9D 1QI5A 3PDGA 5E1AA 3GBLA 3MBED 3CZFB 2ZXGA 3HLAA 4FXGA 2CH8A 4XNMB 5DFVD 4HBCL 2FEEI 3ZKMC 2BC4A 5E0QA 2X4TA 3WIHL 1A7QL 2QSVA 3FO2A 4MZ2A 4XP9L 3TOPA 5EEYA 3MRDA 4LLDA 3W39B 3BZ4B 2M1KA 2JB5H 4GQ9H 5GSVA 4ZPVB 3IKCA 1SEQH 4Y16A 5E4AA 1J9SA 2XV3A 5I15H 5DCCA 1EDQA 3FF8A 1KIQB 4JM4H 4GYBA 3H2PA 1CE1L 4FQXA 1G7JA 3QK0A 4B9IA 4P57A 3Q5YA 1ZLDA 3EJSA 4WY7H 4HH9A 3UERA 1T5KA 5C0DA 1OPOA 1QUNB 3MNVA 1Z7JA 5IWLC 4KOCA 4KVCH 3CZJA 3VVVA 1QBAA 4G9DB 1QFPA 5IB2A 1BZ7A 2IDUA 3F65A 1WA0X 2XSKA 3F00A 3Q6GL 2E6JA 4O2EA 4DZBA 1QLRA 2FH6A 2EO1A 3IDNA 1I1RA 3AT9A 3QQXA 3QJTB 2AEQL 1Y0LA 2EEDA 2VLKE 2YBRA 4HUKB 4OIIH 4PBDA 1S3KL 2FLBT 2ZYSA 3DXAD 2X4OB 2H6UA 3ZKXC 5CEZL 1TO5A 4UINL 2OCJA 2WMPB 3SCMC 4TSBH 3CX5J 4ZAKC 3I75A 4FOMA 3DV4A 3LKOB 4NJAL 3VWJC 1D5IL 2AQSA 4NRXB 1N64L 1SYVB 3M86A 1I8MB 4EI6A 4PY7A 4Q52A 1VJSA 4OSUL 1UWEH 3D05A 1JPFB 3QIBB 3OGCA 1FVCA 1IAIM 4NO2A 3T3MF 5T5FH 2NY3B 1ZEAL 5C97A 3RA7L 2Z4QB 5E4IA 5HHNA 3HBZA 5I1CL 3F7YB 4PV9A 5L8LB 2WOBA 2YKLL 1FFQA 4RGND 1J8SA 1BBJB 2DQTH 3LQAC 5DR5L 3WFZA 1ACYL 3P3SA 1CD1A 1GAFL 3GLAA 4M62H 1E6OH 1MJ8H 1FYHB 4ZUSB 2FGWH 4U0RB 2RQEA 3BWUF 1ZPUA 1Q0YH 3HNVL 2F19L 2B7DT 1NCCH 3VRLE 2XY1A 3U2JA 2IAND 1G7IA 4N0RA 5E2VH 3KW8A 1I1YB 3IPEA 5JDSA 4APQA 3K8LA 3BAWA 5CLTA 2QMKA 1VACA 3L81A 3NCMA 5E6RB 5AVUB 3T0EE 4OF8A 1R34A 2D4DA 4X9GA 2MTPA 4KMTH 4O9HH 5IVOA 3T2NH 1RLBA 3S98A 1NCTA 4DPCX 2FECI 4HMDA 1Z9SA 2ICCA 1GGUA 1W0VB 3NIDE 3FUNA 4GW5B 3K2UL 2YUVA 5DZPA 3ZR6A 4H8WC 3U2SA 1XGYH 4X6EB 2BSSA 1MXGA 5F7DA 2WO2B 2C34A 1A0QL 5L0QB 4JHWH 1E50A 3M88A 4DVBA 1H3XA 1S5IL 3GK8L 5K39A 1U2CA 1NAKH 1LWHA 3ARDA 3ISYA 1HAWA 5D2NA 2QT6A 4CMHB 4DP0X 5F1SA 2YN3A 3AWFA 1I7TB 4P49A 1GJUA 3TONA 2ADGB 2JI1A 1ZAGA 4FJYA 4YVUA 1FN4A 4B0MM 1J0ZA 5DRNB 1BFSA 5A7EA 4KHTH 2FWOB 2GJ6E 5E8DH 4FFTA 3S7GA 1HL5A 4EDWL 4XVUC 4CRPA 1F45A 4Z7QF 3B2UD 4JM2C 1XB8A 4PJBF 1HH9B 2CKBL 2QJDA 4F9LC 5F1IB 1LTXA 5D7LE 2GK0A 3UO8B 2VUKA 4XCNB 3ZSSA 2XWBA 4K7PX 4PJ5B 2HWZH 3VXUA 4FABH 4JB9H 1OLLA 4K3DL 5DZVA 4M4PA 3BWZA 3NIFE 1OF2A 2HTLD 4NWUH 5CEXB 1I1AA 3TO4A 1P1VA 1IIKA 1CLOL 3HFML 3L3DB 1NANI 3BZFA 4UQIM 3FU6A 1N5YL 1CVSC 2YPLA 4XVJL 3FB7B 1KJ2B 1XCQB 1ZSHA 3NQKA 4LU5L 5HDLA 3Q2WA 2OCFD 4F7TB 2HP4A 5L7XH 1DE4B 1PVHA 1J1OL 1ZA3A 4YHIA 2XQ0A 4Z77B 2OTWB 3H55A 1KGXA 1OAZL 4KPHH 4ZUTA 2EE3A 1HXKA 4OVVA 3GSQA 3DARA 3EYSL 3ZYOA 3TIDA 2F5AH 5F3HA 1X6LA 4L9LA 1BEYL 5FYJE 4F9PC 4E0RA 3RL2B 4P4KD 4R84A 1PJWA 4YK4C 4YE0A 2B0SL 3UADA 1AQKL 4Y19B 4N6RA 1XGZA 3NN8A 2BVOA 3R4DA 4OZGA 3S3SA 2IALB 2L4OA 4JPQA 1GY2A 4ODXB 2BVEA 4K7PH 3S36L 5C07E 1R17A 3W5NA 4BH8A 3QC6X 4YBHA 3ZTJH 4CVZB 3OXRA 3HNTH 5D4JA 3MUHL 1K4DB 1MRDH 4HW6A 1HKLL 1URIA 1M71A 4FZ8L 4YO0B 3F58L 3ZPDA 3NPZB 4N0YL 2V37A 4NZTH 2VC2B 2P80A 4YSPA 4ZS6C 4LL9A 3W2DL 5AYTA 1MY5A 3G6JF 1WDAA 1A3RH 3O41B 2KQNA 3PREA 2HA1A 3GZPA 1I85C 1DQDH 4QHPA 3RDTA 2P5EA 1EEZA 3BJLA 3D1MC 1ZLWK 1FHNA 3H7BA 3SDDC 4NQDB 4XCCL 4U1MB 1B3IA 3RVWC 4PJ5E 4ODWB 1T7XA 2O5ZL 2DDQL 3GINA 3HZKA 4PJHA 5CCGE 3TBVA 4OZFB 4Q9RH 3FHEA 3L9RA 4JREC 2V17L 3VXRA 3LIZH 3TCTA 2Z92A 2X1WL 2Y7QA 3WAKA 1B4JH 4HJJL 2IXQA 2KLRA 2X5PA 3WXWH 4GG6F 2KL6A 4XP6H 3IBOA 5HVHB 4O2FA 1PX4A 3PGFH 3QDMA 5F21B 3F84A 1FFTB 4U6YA 5ETUA 3FOLA 1XIWC 2WCSA 4DGWC 4KQ3H 4L1TA 3PWNA 1RJZA 1HI6B 4UT9H 3U0PB 5FGBA 4YQXL 3VFVA 4NOFA 1Q9OA 5D1QB 3WN5A 3LTVA 4XXCC 1BM3H 3REVA 2EDKA 4KY1L 4G6FB 4PN6A 4UIMB 1Y7VA 4MGXA 1U8KA 3PIQA 4Z95L 3SGKC 1CFVL 3QORC 2QVTA 4JFWA 4D9RE 1N8ZB 3RJQB 5KSUB 5CFAA 3U4KA 5EF1A 4U3XA 1FZOB 4HV8B 4WNJA 1NINA 4MJHA 3MZTA 3RWCA 4G8FA 2WWKT 2ZCKL 4CBZA 3U9UB 1P84J 4NZRL 1DN0A 5IQ7L 2XFGB 2W07B 2GITB 3UTPE 3IGLA 1NCOA 2YWYA 3C9NA 3IDYC 4FFYH 5D4IA 3CSYA 2BOLA 1GVIA 4QHLA 5TE4H 1E8WA 3VXSB 4ZNEA 3IRPX 4X0KA 1A1OB 3T09A 3L4UA 5F7NC 4CC4C 3QUXB 1EXUA 4U1KA 3K2IA 4DEWA 1A1MA 1J0KA 2MCPH 3DJZA 4HWZA 3BH9A 1DVUA 3NRQA 4KAQL 4PGZA 5HHOE 4NOBA 4EEEA 4HULB 1MREH 4Q9QH 3DMMB 5C08B 2WLHA 3NFPA 4NUJB 1DN2A 1WAAE 4NLAA 1DSWA 3EYFB 3NDYE 3U4AA 5CD3A 4NKQB 1IGCH 2FK9A 4XMPL 1N6QH 4PJIB 2XXMB 3SJVE 4IRSD 1TUPA 1KBGL 4R2GB 4NQEB 3V9CA 3APCA 1J11A 4X2UA 3ZTJG 3BUIA 5IBTL 3WTTA 4G5ZH 2ADFL 3VI4A 1PDKB 4KJQD 1H3PH 4HIQA 2XUWA 2LU4A 2OSWA 2O6FA 3DGGB 4OV5B 1KB5B 4G6KL 4ZFQA 1CXKA 1UCBH 3L7EB 5L2JA 2IFFL 4M1GH 1S9XA 4RESB 4YSOA 3BDYH 2I07A 4WKZB 2P4AB 1V3JA 4NPJA 1AZRA 4L3ED 2DLIA 3MV11 2FSEA 4LHUA 3VD0A 2ITDB 2VN4A 1CFQA 5FHBL 2WXGA 1PCSA 3OLIA 1MG2C 3DURA 3SN6N 1NCBL 2HX7A 4Q2ZA 1B6UA 1QR1A 5IFJA 4LFHG 5KN5A 2J55A 2XACC 2YFOA 3C60B 2DWYA 3FB6A 3GIVB 2YA0A 5IGXL 5D1XB 5HJ3A 2BS71 4M5ZL 5HYJB 5DUBB 3SDAD 3VDCA 2HVJA 1NUFA 4Y1AA 5SWSA 1G4MA 4Y89A 2O5NA 2AK4D 4XXDA 3VXSE 3BW9B 3L95A 4XO3A 4R90H 3DLQR 3FU0A 3UJJH 3QPQD 1C12B 4X8XA 2DQIL 1IGJA 4AGLA 4LCVA 4G82A 1D6EA 4OM1H 5DMIH 4F7KA 2WTOA 3HW7A 4HKJB 3HNSL 4A7SA 3UTQA 1MWAH 4QIRA 4FC3E 2ESVA 3FNKA 1T1YB 5DVOA 4AQ8A 4M1DL 2C1PA 2PW2A 1I8LC 1KEMH 1TTRA 2FHFA 3FTUA 2FATL 2XTLA 2A1WH 1N4XH 3MN8A 2H0FA 2ZX9A 1U0QA 5HGAB 1QTPA 4Z7WB 5KYXB 1OAXL 3F12B 1JF1B 4DCQA 1LLAA 3T04D 5I8EB 1OAJA 2DQDL 3BJ91 2WO3B 3NJVA 3LZLA 4N9GB 3V4PL 3LRSA 3JVFC 3N41B 3BVNB 4I2XA 4AENA 4ZPTA 4YXHH 1XMEB 1N9PA 2BSEA 3FBQA 4JVUA 2ICEC 3T3PB 3V4VH 4BFKA 4M9PA 4GOSA 4Y5YB 3ECUA 2UV3A 4PRDB 3EYUH 1Q72L 1ZT1A 2JQAA 3E0GA 3WXVH 4IDJL 5INCA 1FLRH 2FWLB 4LCCB 4IEFB 5DT1H 4U1HA 3NTCL 1SY6L 2PF6A 3EUDA 4JKWA 3BSZL 3LX9A 5GIRB 3HRZB 4CMMA 1AIFA 2DYPA 5KYYB 4YL4A 1FGNH 3DX8B 5HYJE 4LEBA 4BFIA 4BFFA 1ZDSA 1XF5B 2ZYIA 3NA4A 2X4SA 1ETZA 3OHXB 4BZYA 4CU8A 4EIUA 4N68A 5EU4A 3W3BA 3IXAA 4N0FA 4FQJL 2N3JA 3CVBA 1ZLWH 3VFOB 4K5MA 2QKIC 4ZUWB 4BZ1H 4HUCA 3LHAA 5I71C 2NSMA 1G0DA 4I9WE 4R4FL 4RQQB 3NYKA 2EYSB 2BIHA 2WLYA 4GAGH 5E6ZA 5EU3A 1WK0A 2R4SL 3R4RA 1CTMA 4PB9H 3T0BA 5JPMB 3DV6A 1M7IA 4XZ4A 4LASL 1IQDB 3ABGA 2ICES 1ZANL 4LEXL 5CS7A 4YWGL 2YD5A 1J10A 5I1AB 2WZPD 3EGXA 3HMXL 3T0VA 3OWRA 1HXMA 2ZXCA 3LDBB 2BY3A 3N1QC 3I85A 4MVBD 2NXZC 5G5DB 4TPRH 1CTNA 1KCKA 1EJ6A 3KJ4C 1WBYA 4P59L 3CVIH 4Y4FB 3SY0A 2PW1A 5JLZA 1XL4A 5TQ2H 4ODTH 3FQNB 5C86A 3UMTA 2Z35A 4GRLC 3KH4A 4OGAC 3MDJA 4X4XB 3ZMEA 3SKJH 1FFNB 1ICTA 1Q90A 3EOAA 3O0RL 5CXPA 35C8L 4MKTA 1SMOA 1GYAA 2JKXA 2C4FU 3L3JB 1DVFA 4FE9A 1FNAA 3ZR5A 4AZ8B 3MRGB 2DJSA 2IMMA 2WXMA 4WU5B 1DQQB 2VE6A 5DJ2A 2OJZL 1MIMH 3TH3T 5D70H 1T7VA 4FI6A 2NY3D 4WI0A 1BEXA 2WUCH 1MCPL 3N44F 4I87A 1J9RA 2IAMA 5KVDL 4G1MA 2Z6FA 4EI5C 1HL8A 3GHPA 1L0PA 5FYLD 3WIHA 2O1AA 3MJ7A 1HSBB 5EZIL 1D2PA 3EJJX 5IQNA 3EH3B 3QIWA 1FDLH 3DSNA 2B2XL 2OMBA 1VIWA 4XBGB 1LP9A 2NY1D 3CZLA 1GY1A 3STZB 5C6WH 1U6AL 1BIIA 1CLZH 1O7SA 1S9VB 1XZ0B 1TJHL 2CXKA 2EDBA 1AQ8A 4ALAL 5EPMA 4XBPA 4HJ0D 1ULVA 2GTZB 4G1EA 5B1KA 4BEIA 5F3BB 4Y4HA 4X4MA 3NZ8B 1TKWA 2I9LB 1WS7A 3UJIH 2DLHA 5MEOA 3HE7B 4OLUH 3CZEA 2O6PA 4EN2A 5D2LF 1PZDA 1B0GB 3O9WC 4MD0B 2ZG3A 2GG1A 7TAAA 4GB9A 5E7FA 5J6HB 5E70A 4EKJA 3S3DB 3WNPA 3N1PC 4W6YB 1MNNA 5GHWL 3RB7A 1J87A 2KH2B 3Q44A 5F6HJ 2ED7A 2HG0A 4KQ4H 1IB5A 1XAUA 1OW0C 2YAOA 1ETB1 4TXVB 4B9ZA 4ABWA 2BRRL 2N7BA 2Z0BA 3BT2L 3OKNB 1GOFA 3M6DA 4HIXH 4XCYA 5E51A 3SD2A 3PL6C 4K71B 2D0HA 1J48A 2FX9H 3GTNA 3MLVL 5FHAH 1TJIL 2FO4A 1CFMA 4AJWA 3L6FB 1JGVL 3CPLA 4DP4X 3D09A 1YJDL 4I48A 4YXLL 1W72H 1XH2A 3D39E 2NX5B 4YIQA 1NGYA 4POYA 3V4LA 1N10A 4N8CL 3S3PA 4MCNA 1CGUA 2DQHL 4AC2A 4UU9A 3JTTA 5SWZB 3SQBA 2C9QA 3ZDXB 5BJTA 3W5MA 1QSEB 3CE1A 4F92B 1V27A 4GPVA 2OSLA 4UV4H 4AIEA 1SF3A 3BUDA 4KRPB 1B0RB 3GMQA 2Q86B 5TTRA 4P3DA 3WEMA 1V55B 2DIEA 1NEZA 3GLEA 3ULUD 2BOCB 4IGBC 1NANH 2NNRA 3N85H 4YAQA 4HIJA 2JKSA 2J8OA 5DEFB 3MA9H 1EXHA 1GA2A 2Z65C 3SKNA 3TN0D 1QQDA 1RVFL 2MWCA 3PAZA 3DO7A 5TF1H 4QXGH 2H32B 4LPUA 4OJFH 4NN6B 3L5HA 2FZ3B 1EA9C 2EH8L 2VN5A 5TPWL 1GHFL 2X10A 4KX9A 1I3UA 1X5YA 3QDAA 2DWXA 1YEEL 1INDH 1OT2A 5E2WH 2VDOL 1C16A 1AHWA 3U1SH 4NN7C 4ZFOB 2VWEC 3ZTDC 2WXNA 2YUZA 4N8UA 4H2AA 5DFAA 3A4DA 4MXQC 4K15A 3TBSA 2FLRT 2VW7A 3VW3H 5AYUL 2Y3AA 3BD5A 4LLQA 1A4KB 3VXTA 3MR9A 5I1EL 1I9RH 2NY6B 5C8JA 3ZE0E 1ZV5A 4M7JH 4HBQA 2DLFH 4Q58C 3K46A 1RK0B 4GMSH 4MXWL 4P2OB 3O3UN 5ICZB 1D3CA 3H9HA 5FIEA 2J21A 1Q9WB 2VDKH 3Q2NA 4PRIA 3TBWB 1RJYB 1Q0EA 4NRZA 1H3TA 2XQYG 3EOBA 4J8RB 5GPRA 1GOHA 3HZ3A 4MJ5B 3Q5TA 5E9DB 4ADJA 1FRGL 4YL9A 3ILDA 1J5CA 3QEQB 2VDLH 5K9OB 1AMYA 1AH1A 4U7KA 5IHZA 1M56B 1KTLA 3OGOE 3E8VA 1JNHB 2WVTA 4X8GA 3B2VL 3MLYL 2X53A 3CLEL 3OVUB 4G7VL 4NQDD 2VITA 2VXTH 3P9LB 3OMIB 4KK5C 1R75A 4KH9A 4RAHA 3S88L 3O3AA 5JMRA 3GXFA 2UWEB 3H9SA 4ZODA 1LO0H 4GRWF 5DQ9A 3GKWL 4EVNA 2A9NH 1RU9L 3KHOA 4WFGD 5F93C 4JFZH 4NXSA 4N2CA 2P5WA 2NPLX 5TQ0L 5ACMA 4JFFB 1JNLL 3P69A 3RPBA 4MQTB 2C9PA 1EZVY 1F8TH 1RV6X 4X83A 1NWOA 2YS4A 2Z8WC 4MTMA 5KBLA 4ZZFA 4I7ZC 4PRPB 1R5WA 5D1QD 5JIQA 1NMBH 1U95A 3WNMA 4G6FD 4LCWB 3FPYA 1I7ZB 4RRPG 2CDEA 1EEYA 2YZ8A 3H6JA 2DLTA 3OZLA 2DBJA 5GS0H 1YEIH 5AL0A 3EGDB 3MKKA 3US1A 4YBLB 4D8PB 4BHUA 3TNMA 2LABA 2YAEA 3EO9H 1QFWL 1G9MC 3FZUD 4QGYA 1VFBA 4ERSL 2BERA 4FQIH 1I7UA 1BAWA 5ID0B 2E0PA 4NWTL 4NQXA 4WUUA 1O7DE 4X50A 1OEZW 1QFOA 2ZUQC 3WENA 3NJJA 4P23C 1QZNA 4HS3A 1QRNA 3UTSB 3ARSA 1VADA 2FL5B 4Y4KD 1TCMA 1EBPA 2GUOA 2Q6WA 3TNNA 3ARGA 1C1EL 4GKOA 4IU3A 5EIIA 4JDTL 5AW3B 3U83A 3LEYH 3QEQE 4JK0D 1JZ5A 4RRPM 1I9EA 1NFDF 4C55A 1YRKA 2WVVA 1CFTB 4X7FC 1J5OL 4OD1H 5DJXB 5KSAB 4XMZA 2D31B 3HI1B 3HKZA 2G75B 2O30A 2YD2A 4MJ2A 3P0GB 2EE9A 1G6RH 3EBGA 4R97C 2UWEE 1G4RA 1E4XI 2FVNA 1U36A 4WNQA 1IV8A 4LCUA 4HUXB 1BJ1J 2CBMA 1T2XA 3AS1A 4HC1L 3CFCH 4HHAB 4M93C 4AQEA 4M7LH 1RURL 4WI9A 5IT2L 4NQED 1EBAA 4JFFE 4XNDA 1GGCL 4AH2B 3TA3B 3LPWA 3RKPA 1UTDA 3SDYL 2XG4B 3LXCA 1AYRA 1URLA 5KJ4A 3T6XA 4V11A 3D3VB 4NQCD 5FOJA 1O9VA 1F13A 4UCFA 4DKEH 1U8PB 1YYML 3C08H 4PRPE 4ODUA 4TQIA 4HWEH 2VXVL 4E9TA 2XX0A 2DEYX 4AMKL 4ABQA 2EUVA 3FUMA 4LCWE 2QPDB 4S1RL 5C0ND 5HY9A 2OP4H 4UQ2B 3CFQA 4NZFA 4ZXBD 4TVPE 5D6DA 3E8UH 5D7IA 3D08A 3GMRA 3Q2CA 1GS6X 1QA9B 1D9KB 1E6JH 2GJZB 4OLXH 2HT4C 1PSKL 4KKNA 3B9VA 4KVNH 4GXVH 1BAFL 3GO1L 3QNZB 1UB6A 4PYHA 2JQMA 4UM9A 5H2BA 5CBAA 5KVEH 2XY2A 3MBEA 5AAPA 25C8H 3FU8A 5JIHA 1OF0A 5IJBC 2J1YA 1KCSH 3FKUS 4S11A 3TYFA 1JWUB 3OAWA 2QPUA 3KGTA 1P7KB 3RY6C 5DO8A 1AXIB 2ZX5A 5CN1A 5D7SL 1XAKA 5F89B 3MOAL 4PWJA 5HI5C 5I74B 3VD5A 3P2BA 1C08A 4WRLA 1ZLSL 4OAWA 1DJXA 1EIBA 4CUCA 2AI0L 1PYWB 2J6WA 1CL7L 3HZVB 4Z3FA 5DTFA 5TE7L 2NZ1A 2BO0A 4PM1A 1NFAA 3LVEA 1FBIH 4YHKH 2JJUA 2I7OA 3TJHC 2AQTA 4TQHA 3CH1B 4EDXA 1WCBA 3T6WA 2YUWA 2JMRA 1E4KA 2XYCA 4O00A 4N90E 1Z5YD 1L6PA 4Z6AT 5DLML 2YZ1A 3FB8A 3D3VE 5GRUH 1BGXH 2NXYC 3KPRD 4FYQA 1CJYA 5F1NB 1JZJA 2VR5A 4HD9A 3W0WA 2J12B 3FQ2A 4HPOH 4RZKA 4HGMA 4HUWB 4WHTA 4S1DC 4U1LA 1UUSA 3SKOA 4PJXF 1A6UL 4Y8AA 1U8MA 2VH5H 4Z8FL 1U92B 2H6PA 3KWWA 3WMSA 2IPTH 1YMHA 2KC0A 1UATA 1KV7A 3ARED 3KYOB 4PW3A 3WNNA 3QUGA 4D94A 1BVZA 1JTPA 2LOEA 3MV01 4B41A 5DDHB 4HPYH 1YMMB 4CNIA 1JCVA 1PG7W 4E9XA 2O26U 2QQLL 3PXHA 2YBGA 4LKCB 4Q8BA 2OMWB 2R2BA 2QL1A 3CDZB 2WXPA 1P2CA 1CI5A 4Z76B 3ULUL 3O11B 3OLDA 5ESQB 1LD9B 4LOFA 3AXLB 3IMTA 4KROC 5D5MB 1BQRA 4FN0A 3SKMA 1DLHB 5D7HA 5MI0C 1I75A 2X12A 1HEZB 4Z3HA 2BVQA 5KVGE 4QXUH 4KNTA 3FONB 1G6VK 3ARTA 2NYZA 3OMAB 4FNUA 3T8VA 4AG4H 3HG0A 4XI5D 4H4NA 3P4MB 3QCVL 4L4TD 4S0SD 2H45A 4H25A 5GZNC 4B27A 1CG9A 4R5TA 3GSOB 5E6IB 3R18A 3EJZC 1ZSDA 3EOTH 5B39G 4H8HA 2BNQD 1B2WL 5EF3A 2JI2A 3N43F 3PHOA 4MB1A 4XCEB 3NGBB 3P9MA 4OCWH 4G8IA 1UOWA 4FFVC 3V4PA 2NYYC 3ZYIA 5I18L 5IM7B 1E5BA 2X4QA 3UL4A 1RZKH 3MV8E 3QISA 4IRJB 1ILSA 2HT3D 2DJ4A 4ZMAT 4FNPA 5B7EA 2XWXA 4PJ8B 1LILA 1ZHKB 1HT6A 2FH8A 3QIUD 5IVXB 3KYAA 1T3FA 1BLIA 4MWFB 3IFOB 3ZKQD 2AJVH 4MLIA 5B3NA 3TC9A 2IH8A 3WJLC 1CU4H 1GOGA 3L4ZA 4M7KL 3U36B 1U91A 4DPAX 3BP5A 5EZJB 4ZUUA 1SY6A 4QLWA 4JL1A 4CVXB 1G1OA 2VDPH 2VC2L 2VT0A 3BSZA 2VDNH 3KCPB 2IOMA 4YZWA 5IEKB 1E4WL 1U8LB 4B60A 3QC5X 1IE5A 4L9DA 1X44A 1RH8A 4EIGB 4B9JA 1S8DB 4L05A 4L29A 2OV0A 1JVOA 1KJ3H 2CO7A 5CINL 3B37A 4LB8A 3R0NA 4HSQA 2C5DC 1L3NA 1RP9A 5GGSB 5ICYB 5IFAH 3RNKA 4C56E 4CSZA 5F72S 1CQYA 3JVGA 3QG7L 4IBTA 3VFPB 5IF0A 4RX4D 1KCUL 5TGBA 4JZNA 1I1FB 1WZLA 2OZ4H 1F00I 3HC4H 5CILH 3TTSA 1IC4L 4ZMLA 2XZAL 2ZT9C 1LEIB 1TTBA 2R8SL 1N70A 1CGSH 2CRZA 4HEPA 5AQ0A 4YNYB 43CAB 2HFEB 5SX4H 1ZLEA 3PQYD 3I6GB 4JCLA 4NP4H 1MFEH 4HWUA 1PG7L 3CPUA 4XPHL 4TSAL 5I17B 3OMNB 1JHTB 1F4YL 2NRDA 4HD5A 4UQEA 3O6LH 4MQSB 3ZT7A 2XN2A 3H3PH 4BXSV 5HJGA 4IOFD 2C7UA 4Y5XB 3ASWA 3BISA 2DQEH 3PGCA 5I16B 4YHOL 2Q7YB 3L5WA 4K3JH 3TT1H 1T04A 4WI2A 3FL7A 4HOMA 5D7JD 4BXVA 5EUOB 1EHLL 1ROWA 5FGRA 1ZXQA 4FFZL 1AHMA 2VDQB 4N5ED 1J8KA 3H8NA 3PUUA 1YEGL 3WTYA 4G6AC 5CJQL 5A2BA 2H2PD 3EO0A 4JY5H 1DHKA 4N0CD 2A7BA 1OXYA 4K8RC 1FNFA 2CRMA 2GCYB 2HYMA 4ZTPH 3RWDB 5DD0L 1U3HB 1N5AB 4IOSD 2VLJB 1F0LA 4XE0A 3O3EA 3VWKD 2HG5A 3GRWA 4NZ8A 4FD0A 1IGMH 5G55A 4RH4A 2ZCHH 1AMXA 4UQBA 1YNTB 5C7XL 2VQ1B 1UADC 1TJMA 4QHUB 3FYIB 4JRYD 3UJTH 4QRRE 3X14B 2AV1A 4KI5D 5GS2H 4GP8B 3EXJA 1BQHB 2GTWA 1N2RB 4CKQA 5DUJA 2NY0D 1UG9A 43C9B 3VFWB 2NY5C 5ID1A 5DUMH 4DF9A 3EH5B 5EOQH 2B1AL 1A7OH 5JHMA 3O81A 4LEEA 4JO8A 4Y2DB 1UA3A 3BEWA 4L4VB 1FNLA 5F96L 5LHDA 2V2WA 2HFTA 4UT6H 4FTVB 2BJMH 1ZJBA 1KG0A 4ZK8A 3PHQA 5LN8A 4BCYA 4I0KA 4BUGA 3CX2A 2ZOOA 4N0UE 2W9EH 1BD2B 2OI9B 2NR6C 4GQ9L 1UACH 5LNEA 4QJ5B 3BAYA 3LQZA 4LHJB 3GJEB 4FJZA 3GMLA 1SFDA 3L3OB 4JM4L 3PS6A 5IMKA 1EFXB 2APSA 1CCZA 1R19A 3RWGA 3VRLF 5AKVA 1GGBL 1ILUA 4WY7L 1XGUB 5GRZA 1JPST 1HILB 5GS1C 3U46B 4P46C 2WGNB 5E1QA 3WO3B 3VQ1C 1DBML 1RJCA 4KVCL 4EIZC 1HIMH 4MA3B 4A2DA 3ECBA 4EXKA 1XWVA 2XHNA 1WWWX 2OMXB 3HAEA 1BZOA 5E6SB 2V33A 2X6MA 3ILQC 2FT6A 2GJRA 3INUH 4J4PA 3NSXA 4G9FB 4HMCA 1QW9A 2WBKA 4X6CE 4OIIL 5F9WB 1MAML 1BBDH 2WB1A 3SPCA 1RIVH 3DX0A 1A3ZA 2P8LB 3OV6A 4A6YB 5F1OB 5JPNC 3K6SA 2IGLA 2FJFB 2WCPA 4TSBL 3VGEA 4NM4L 4LGSB 3V6OC 4JVPA 4L1HA 4O5LL 5D8JH 3RZCB 3UPRA 2H1PH 5C0IB 3KM2A 1NC4D 3JQOB 3SYPA 3ARBB 2PCFA 1KT2A 1UWEL 2AK1H 4HT1L 4AIOA 5CSZA 4ZSOA 1X3DA 4HK3J 2C3VB 5EO0A 4DVRH 5BW7A 4HUVB 3OJDB 3GUTA 4QRPE 1XH1A 4NKOB 1UOVA 4TNWF 1UZGA 5IROD 4PGEA 5D4QA 1ZHLB 4FTVE 4IRSA 1WA2X 5IW6B 5TDPB 3VU2A 4F2FA 1SOKA 5JHDE 1IC1A 2QKIB 4IMKC 4TQEL 4UYQA 2EKSB 2CJSA 3BLPX 5KAQG 2HN7B 1P4IH 2MIZA 1MJ8L 3NIFF 5H37A 1OSPH 3MNZA 1U8HA 3GSNA 3JWNC 2QZ5A 5IG7B 4A39A 3BQUD 3VFUA 1NCCL 2AMUA 1IBZA 3PV6A 5E2VL 4IMLB 2JIXB 2DWSA 4JFQA 4YE4L 5E4EB 4MNQD 4WFEE 2BXZA 3FSWA 1E5UI 1M1XA 4R7VA 1AS6A 4KMTL 4O9HL 2EXWC 3EYVB 4S1SH 3WFEL 1ID5I 1T1ZB 3QS3A 1FL5B 1KXVA 2CGYA 5KAQF 3HE6C 3S4SA 3TPUB 5DFTA 4M6OH 1AR1D 1TIUA 1XF1A 4MMXC 4LIQE 2P45B 2EZ0D 5E0FA 4G9FE 5IBUB 1LNUA 5DGQA 3O8XD 3DETC 3SDAA 2A83A 3FOMB 1P4LB 1RK1A 2WXHA 1KTCA 1TVBB 1E4XH 1KYUA 2AK4A 3RWIB 5EDSA 5JO5B 5KSAD 3R7RA 1NAKL 1NH6A 5C6TL 1NTDA 2X0WA 4U1IA 4GT0A 3X1BA 4WEUD 2L3BA 4LKXB 2PYED 3S34H 3ZDWA 2E7CA 1QD0A 3SPJA 3GBNH 5I1LB 2NTFA 2ICWA 1TYEB 2E9GA 3OWEA 2CUAA 1U93B 2CGRH 1PNCA 4LSUH 5E00B 1VKXB 3N04A 5J6GB 1L9MA 5K9QI 4B53A 3U7WL 2JCCB 1ND0B 4JO5A 5E8DL 3LHPL 2Q3XA 3FUHA 1JXJA 1MCWM 2EDDA 4AL8H 3I2CH 5F7MC 1NL0H 3WAJA 4P2QB 4LP5A 4OH2A 4I4WA 1NA8A 1NCHA 1NEUA 2Y5TB 4X5XB 4AVHA 4FXGC 5G2NA 3MRNA 3ALXA 2ENPA 4UDUB 3D7PA 5HGDB 2H9GA 4FABL 4JB9L 5JOFA 3MNWB 2VABA 3WHXA 3RPKA 1CLYH 4NWUL 3BP7B 4JFXB 1KZQA 3K2MC 4YDIL 5IB5A 3VRIB 1PGRB 2GBAA 1V5JA 2XN9D 3IK2A 4K23H 1LDPH 4PRNB 5LO7A 4Y16C 1IEBA 4G43A 3MRFB 1FWXA 3MO1B 4RIRB 4HUNB 1ZV9A 2CZNA 2FJHA 1T7WA 4I1RA 2XNAB 3RY5A 3U9WA 1KELL 2K70A 3MVSA 4Y9BA 3VXQA 4NENB 1J0YA 2FX7H 5I8OH 3TF4A 1MJJB 4KKCD 3QDJD 4B5EA 4TL5A 3MRMA 3CHOA 3DX4A 4LRIA 2XV0A 4UNIA 5DRWA 5HPOA 4OJAA 4NRYB 4RGOH 4OFPA 3DUUA 4LZKA 4BRVA 1Q0XH 3W39A 1FG9C 3F6LA 4XODA 4DQOH 1PW3A 4I0PB 4DUXA 1R46A 4YUEH 5BVJB 5L2KB 2XETA 3O6ML 4HHWA 5B7MA 1K6QL 2VLRE 5GS3A 1YZZA 5E8EB 3HNTL 4Q9BA 5EOCJ 1JZ4A 3GNML 4U4IA 4OZFG 3TP4A 4HYTB 1XO8A 1BW8A 5DJYA 4WCYL 5BCAA 5HYSG 2ENSA 2AXWA 2HLAB 2JELH 3D4YA 4HC1A 2WXIA 2JCCE 3MXVL 4M61B 1D7CA 1XBDA 5GZOC 1SQMA 3HPJB 4RFNC 1P9MA 2WZPA 1XEUA 2KZKA 2NY2D 2BZCA 3RLSA 3TFKC 2W8CA 4UMSA 1S6NA 1RIUH 4K2UH 4Q9RL 4I1NB 2GK2A 1UWXK 4JRXB 1QKZL 3CCHB 4PTTA 5AAMC 4C4KO 3SDCC 2FGZA 1B4JL 5J0BA 5HI4C 3WXWL 3U1PA 4JJ5B 4JQIA 4K07A 4AI7A 2ZAHA 2YEZA 2JXMB 2X70A 3W37A 1T1XB 2ADIB 2F54D 4KQ3L 3IDMB 4UZUA 3I3BA 3CHSA 3V0DA 3GSWA 3RIFF 1WC7B 1VESA 2YRPA 4APQC 3BPNC 1NAMH 1BM3L 3N1MC 1D5RA 5J1SC 4OGYH 1URZA 3EOYG 4J3SA 4B9GA 1S7XB 4KNQA 1KFAH 2AQ3A 4PCSA 5ABDE 4KJWC 4E5XG 2ZWSA 4P5RA 4FDWA 1WV7T 2Q2LA 5J3HC 4CJ0A 5JW4N 4KX8A 1BOGB 3DTXA 3V5KA 2IDSA 3P4OA 3MJWA 3FUJA 4GKZB 1MCBA 4PVNA 3IDJA 5C8JB 5LCVH 4ZW8A 4HG4K 5I0WA 3QEUA 4BV1A 2N7SA 2AXHA 3D69B 2R2EB 1GGIH 2YSSA 3THML 5C09B 5ALBL 3VFNB 2NW2A 4FFYL 2A4ZA 1F6AA 3ARDC 4GKSA 4E9RA 4ZO9A 5JW5B 1HHJB 2P7TB 3QPXL 1T21B 4WGVB 5TE4L 4DNLA 3KPOB 1BPVA 3AZUA 4MD4B 4ENEC 3C6LD 3EF7A 4PG2A 4JHVA 4AQ1C 4BK5A 3NJNA 5AVQB 1MCJA 5B22A 5KOVC 2NW3B 4OZIB 2MCPL 1S7QB 4OM0H 2Q8AH 4Q9QL 3U0WH 1QFUH 2KPWA 3V7AE 3ULVC 2EH7L 3ETBJ 5L8KB 1JPEA 3KNBB 4IRJD 2YPVH 1DP0A 1VRSA 2VR8A 4ANUA 4N2KA 1XCXA 2BY0A 1SXBA 3AT8A 3L2NA 3OAZH 5I26A 1IGCL 5E5MB 5DC0A 2OL3H 3M46A 3G04B 1W0WA 4PJIF 5IESH 3C12A 2RACA 3WKMH 2ZYRA 3C8KA 2GIXA 2Z31C 1TVHA 2GBTA 3FMGH 4G5ZL 4NT6B 1HCZA 2OM5A 3EHBD 5CR1A 1NSNH 3X1EA 4GSDH 4GMTL 5CUSH 2CIIB 3DJRA 3TWCH 5AKTA 4MDJB 1SVCP 4I13B 3PFUA 2ARJQ 3BN3B 1AHKA 4M1GL 4F1ZA 5AL8A 1GPOH 4KXAA 1L7TL 2EIZB 4PGBB 3TA4D 1A6TA 4ESKA 3ME0A 4DH2A 3BKMH 4YVNA 1CXEA 3VYOA 3EO1B 4LRNH 1GH7A 2KZBA 4FQ2H 1MSPA 1KXTA 5C3TA 5JIIA 3N9GH 4L9LC 1KXHA 1DBAH 3TX4A 3DGDA 2VN7A 5DD1H 2PP9A 3ATFA 3TN0A 1CDBA 5CEXA 5EZLB 2CHXA 4EUPH 3O4OB 3IU4H 4L8BA 3L3DA 2YMTA 1OB0A 3PCYA 1DJGA 4POUB 4G42A 5C09E 5EBMB 1XF2A 3FB7A 5FA3B 1MCHA 4AXWB 3WS6A 1SZNA 1ZGLB 4R90L 4KXBA 3FTGB 4OZIE 3WS3B 2AVFA 5HHQB 1NPNA 5IB4B 4PRHE 3HLKA 3R1GH 2VIRB 4BFGA 3TVMB 4IS6B 4HWBH 5D1ZC 4CU7A 5MEPB 1MWAL 3L48A 3JT0A 3RDTC 5E23A 5EBGA 1A1NA 3LN4A 1QSZA 3W9EB 3HJEA 2IALA 1N4XL 1EV2E 4U31A 4PSPA 4ODXA 1RUML 3AB0C 2JJSA 5CD5D 3UC2A 4Z7WF 5A3IC 1MZYA 3QO1B 1T22B 2EEFA 4ETQB 5LVEA 1RCYA 5BOJA 5DYOA 3UBXI 2ITCB 3UTOA 5KYWB 1CBVH 1X9QA 1IM3B 3N41F 4M00A 1NGXB 4YXHL 1J8HE 3D9AL 5E9AA 2ZWKA 3QWOA 4WW2B 1BXVA 1M4KA 3SB3A 3EJQA 2DH3A 3O41A 4QY8A 3FO1B 3GMOB 5GS0D 3V4VL 3EJRA 1OHQA 1W8EA 3L5XH 3WN5C 4PHXA 4B9FA 2V5SA 5E8OB 3EYUL 4C83B 1OT1A 2A0LD 4HS6B 3E1ZA 1FLRL 4NQDA 4XN9A 5DT1L 2Y22A 1SJVA 4OU3A 3ATAA 5HTSA 3QEGL 1FNHA 2MEJB 4F58L 5ERWB 2WINA 2D4FA 2BP0B 2MQ0A 2OX5B 3TV3L 3S5YA 4B50A 2V3DA 2ZIDA 5DI8A 3CFUA 1AS7A 3MHZA 4NQUA 3BWUC 2X3BA 3IM1A 2UXTA 4M4RB 3BPCA 2YA1A 5ENWA 3HMWH 4IKNA 4UB0L 5I0VA 4R6UA 5D1QA 4BSJA 5I6NA 5AVWB 4BZ1L 1QPKA 4XR8C 3ZL2A 1GZPA 1IC7H 2XWTA 2FX8L 3T6ZA 2YMOA 4R96B 5IUSA 4FG6D 1NMCC 3GHBH 4FFZA 4PB9L 3V0WH 4NNYA 3P4NB 1PS3A 4HV8A 3NA9H 1TZIB 1GW6A 5KS9B 4NHUB 4V2CB 4UTAH 5BZWA 3K91A 3V0AC 1CYGA 1HQ4A 4MDIA 2PWFA 4TPRL 2GITA 3CXHJ 3O2DH 1YAIA 4G8EA 1F4WH 1PZAA 2OSXA 3CVIL 3GS7A 1PY0A 2WBWB 2K3HA 4ODTL 4Y4KA 3L1OH 5L9DH 2C9VA 4ZMXA 1NQBA 3P3RA 1TSRA 2OR7A 4ICWA 4W68A 4F7MA 4UT7L 1XD0A 2HFFA 3O6FC 1UWYA 1YQVL 2WBXA 3QUMH 2DI7A 4JN1H 4QHNB 1GS8A 1YDPB 1A21A 1MIML 3R8BB 5GJSH 2XTJC 3BFQG 1TU2A 1VEPA 2H5UA 1W8OA 4G7YH 4XNZC 1UH4A 1Z1WA 2VM4A 2C1OB 2WANA 1HL4A 3MV7B 4LQFH 2Y0SA 5KZCD 1YUHB 2OR9H 4NQEA 2CPUA 3AACA 2P9RA 1AAJA 1KB9J 1ZXKA 4YPGA 4ZFZA 1FVDB 1AZUA 4DP5X 1XSKA 1JFHA 4A55A 4HHGA 3KPNA 5BS0B 3RUGB 4KO9A 4NQCA 5DSCB 5IHUH 2YGQA 1ZHNA 5DVKA 1DQLH 2P46B 1TF4A 1Z3GH 3EDEA 3QI9B 2PNDA 4LT7A 4A2HA 3WDIA 1BVLB 4Z7NB 1P7HL 2AQPA 3WEAA 3X1FA 2X3AA 1KEGH 3UJIL 3VFGL 4A67A 4OLUL 4ZXBA 1DDHB 2FAUA 1LEGB 1UYWH 5I6OA 3MFFA 2JWYA 2X6UA 4AQ8C 3GBMH 2WQWA 4MNGB 3T77B 5GGQH 1HHHA 1XSIA 2IQ9H 4MJJA 1QZ1A 3PFQA 4KQ4L 3ZX1A 4BUQA 3ZE0F 3PWVB 4X8JA 2F8XC 3QAZC 4M56A 1IEHA 3EXLA 4NUQA 1L4IA 2FX9L 2BS9A 2ARJA 4TVPH 1BMWA 5HDBB 1QHPA 1W72L 1KYDA 3KZ8A 3MLWH 2QPSA 4OZHB 4XNQA 2NOYA 3UROR 2F0CA 4MMZB 3BZ5A 4N3UA 1T83A 1IARB 3ZDXF 1LEKB 1PAMA 4NBYB 1IKFH 4UUJB 5DO2D 3VG9B 3VGGA 2NZ9D 4UV4L 4HIHA 4JO4H 5DQJA 4GKNA 2I60L 5MEND 2Y36H 3L3HA 3RVXD 4KKQA 1G7QB 3MV7E 1X9LA 4PGCB 1LO3H 1B0WA 4JO1H 4PJGA 2R0WL 1SJMA 3KLLA 3N85L 3G5VA 3PWUA 5DXWA 1ZY9A 1U8OA 2J20A 4JG1H 3RUGE 1QSFB 2OMYB 3OKOA 3T71A 3KPRA 4QXGL 4LAQL 3CDYA 1HEHC 2CRIA 4OJFL 2A6IA 3G5ZA 4U6HB 4DKAA 4FA8A 1PMYA 4HALA 4GW4A 2PPEA 2D7PA 3DC0A 2IG2H 4G6JL 3GQFA 3LQAH 5MERB 1RIHH 2IF7A 4K7FA 5E2WL 3TEUA 6FABH 5EEUA 5EORH 2BIQA 1HFUA 3RL1A 5I23A 3AREA 1IC0A 3RTQB 3MRRB 3ZL4L 4MNGE 3BZDA 4AQZA 4D3CH 4UQ3B 3VW3L 3B9KB 1UOKA 3K6OA 2YC1A 5D4HA 5HHME 1D5MB 2H3NA 2XA8H 1YPZB 4GBXD 3KHQA 2V7HB 3C5SA 3REWB 1I9RL 1JRHI 2F53D 4PQXA 1H6EA 2Q76A 2BVYA 2DLFL 4J3OH 4ZJ9A 3FQWA 4ZUVA 5TDNB 1P6FA 2UZPA 3T0ED 3IN0A 3EFFB 1S7SB 2VDKL 5BRZB 1OPGH 3ZHKA 4I0CC 3BP4A 3OKKA 1N0LB 2W0FA 1AO7E 3CSFA 4DESA 4ELMB 2O93L 4PJEB 4RQQA 3E80A 2PO6C 4PJAE 2EYSA 4H8WH 3AVEA 4X5RA 1WTGT 3NEXA 1DFBH 1OSZA 2HVKA 5AG8A 4L4TA 1YECL 4R5VA 1DVFC 2E86A 1A4AA 5JPMA 4KK8C 1IJ9A 1OK0A 4PV8A 1QABA 1AOZA 1ZDQA 3C87A 5A16B 3RHWK 1OM9A 4P99A 2BNQA 3L9BA 4ORGB 2J4WL 5FK9B 4BRJA 1CT8B 1KXQA 1YEJL 4C4KT 2CA3A 4AM0B 3BIKA 2IAMC 2VXTL 3O45A 4I1PA 4X6BB 3EJYD 4Y4FA 1PY9A 5KVGH 1IGYB 2UWEF 3QFDA 3SYAA 1LO0L 3SQOL 3WY2A 4JFPA 3A4AA 1QSFE 3FTWA 4JFZL 3WFDH 4LESA 3PXLA 5K9QG 1BLNB 5H4YA 5GGUA 2VERA 2DI9A 4BZ2L 1F8TL 3Q1SH 3L3JA 1E5ZA 4ANKA 5F0PB 3NCCB 3C5ZD 3KAAA 2X2HA 2MNJB 1MH5A 4XVTH 1DQQA 3UFIA 5D7LD 1NIEA 2L7EA 2AANA 1H0DA 5ABZA 1NMBL 1RD6A 1JHKH 4WK4B 5TK4A 4YBQC 3K71B 1S9KC 5IOPA 1TT6A 2IOOA 1UT2A 5EOCH 3CN0A 4LEOB 4TUKH 5EFIA 1YEIL 5GS0L 3DVNB 5IHWA 4MX7B 1KYAA 3SO3C 2Y7LA 2DRUA 1WZAA 3FT1A 2BNUA 1XGPB 3EO9L 1FZMB 1PX8A 2WWOA 4XBEH 2WCGA 4FQIL 2XKUA 1MQ8A 4DO5A 4ZD3H 2XWCA 1XZ0A 5K9KA 3MROA 2BP8A 4RX4A 5HYFA 1I3VA 4P5TC 1ZCRA 1TLKA 5ESAA 4ELME 1BF8A 4PJEE 3LEVH 5JPNB 4CGUB 2WXKA 3HE7A 3ZMNA 1F1DA 3MSPA 2ZWLT 2NSQA 2FHBA 3LEYL 2P52A 3PQYA 3RBSA 4ZS7H 3TIEB 4L2YA 5GS2D 1G1YA 5CP3H 1DVSA 5EN2B 2WZ5A 4K7PY 3GSRA 2IADB 4QNPE 1D2OA 4JPKH 5C07D 1IC5H 1OP4A 4HLZH 1A6VL 2ORBL 5CZRA 1G6RL 2LW3A 2NY4D 4HFWA 5ICUA 3OKNA 2Q20A 5D7JA 4MKMA 3CFCL 5LGJA 2CBQA 4M7LL 1A47A 3KWVA 2VSKB 1DEEB 2G0KA 4GAYA 1TFHA 4WTQA 2WLLB 4DK6A 1PKQB 1NGWA 3I74A 5HDRA 1HJCA 4IOSA 1DVXA 4UT9A 4EOWL 3VWKA 1A2YA 5E2TL 1HK6A 3ZE1E 2WIIB 4DKEL 4MAYD 3C08L 1T2QH 1QSEA 4XPTH 1FH2A 1A9EB 2W60B 2W65B 5HGHB 1EK3A 4BH7B 3ZQXA 3WL9B 3MV9B 3QZPA 3ZL1A 1AHWC 1CURA 2Q86A 1LYQA 1HE7A 1NCAH 4JRYA 5CJXA 2YD1A 4LSPH 2QADB 3HHSB 2IH3A 2CR6A 1KB9K 1CICC 3HE6B 2XKNA 1E6JL 2GT9B 5DEFA 5EO9B 3BPOC 2QSCH 8CGTA 4GXVL 3UBFA 2YA2A 4N2LA 2V5MA 2PXYD 3G5YB 1E65A 4PRBB 4Y5VC 1MLBB 2HRPH 1XGTA 4F33A 1GIGL 3CVHH 5A2KH 4PJCB 4N4YB 3IJHA 4A7TA 4H5SB 3VXME 25C8L 1G87A 3E6HB 2DN7A 1L0YA 4FFYA 2OMZB 5F6HI 1NCGA 3OB8A 4EBQH 3VXOB 3PAUA 1KGYE 1KCSL 4D9RD 4PJDA 1TDQA 3BAEL 4OLYH 4GUOA 1OGAB 3F3HA 3QE5A 3RGVD 4APXB 5IR1B 1QP1A 5AUMB 5IB1B 1Z5LB 3P0VH 4WSGA 2ARWA 1J18A 1KIRA 3EBHA 4LGPB 4WW1A 1F90L 1HJBC 3KD4A 3X11B 1A4KA 4FADA 3UTPD 3HLAB 1BZQK 4FXGB 4IHBA 1FBIL 4YHKL 3RVTC 1UQSA 3UC0H 4LLAA 3ESUF 5ICZA 2BC4B 4F37K 3BGFB 1PEZA 4Q4IA 5ISZB 2X4TB 4KWUA 3TBWA 3FO2B 3MRDB 4LLDB 2QGEA 2WBJD 3JWNE 5HHOD 1OANA 1ZT7A 5GSVB 4HCRH 3IKCB 5E9DA 1LO2H 3AXHA 3HOGA 2DTMH 4QRQB 1MHCA 5K9OA 4HQQH 4FQXB 1G7JB 4P57B 4HPOL 3QXDA 4ODSL 3ZN6A 1XVSA 3ARYA 2AV7A 3HFFA 2Z8VC 3FDWA 4HH9B 5C0DB 3TH2T 3N6YA 2HPTA 5JW4R 3MNVB 3OXSB 1XFPA 4JPVL 4JFEE 4GS7B 3N42B 3PWJA 1D5XA 4B9PA 2CM6A 3GXUB 3CMOL 2YWZA 1BZ7B 1BSIA 4MA8H 1MUJA 2IPTL 4S10A 4P05A 3VTMA 5DHEA 4DHLA 2WGXA 2FBRA 4KI1A 4O2EB 3GIZH 4WTXA 4DZBB 1QLRB 3NESA 5I1IH 2D3VA 3MLUH 5EOTB 4DKDC 1LK2A 1S7VA 2FYYA 1Y0LB 5IROA 3WUZA 2YBRB 3LNEA 1BX2A 5FV2A 4HIIA 1D5ZA 5D5MF 3EH4B 5C0RL 1OGAE 1UHVA 2O61B 3PE9A 3DV4B 3EDKA 3FU5A 3ARGC 1TJGH 4QXUL 4Z3JA 4LSQH 3BRFA 2DIBA 3BQUA 4PY7B 5GGRY 1XH0A 4AG4L 3QUZC 1MWAA 3OGCB 4D8PA 1FVCB 3AQXA 1HZLA 1FIGH 3EOTL 4PJ7E 1YYLH 4MNQA 1RUQH 4HJTA 5HHNB 3K0YA 4PV9B 3LH2H 1JZ8A 4XMWA 4MA1B 1G5GA 3O2VL 4NCC1 2BOBA 1T4WA 5AW4B 4F8LA 3WY4A 3UTSA 1MRCH 1CD1B 4H0LC 1MW1A 4NZDA 4YDNA 5AWNL 4JFOB 3NACH 2DMCA 2E9JA 1HTYA 3O8XA 2J5WA 4LSVH 3VGFA 4A1RA 8FABA 3AM8A 4KGJA 2Y72A 3KS0J 1ES0A 3UTSD 4A2EA 5E08H 4PVBA 4H88L 5IVXF 3V4VA 4A7UA 2J1XA 3FRPA 1G7IB 4QRTA 3UTZA 4WFHE 5KSAA 5KUKA 5C9JA 3IBEA 5JDSB 3QXVA 5B8CB 2PYEA 3L54A 1CU4L 2WVUA 2I9TA 5E8NB 2FCBA 2MJWA 1MCWW 4MFHA 1NC2D 4TUJA 3UBXG 2VDPL 2XWRA 3TFBA 2CKNA 3W81A 3ZZSA 1Z9SB 3G08B 2VDNL 4XOCA 4ZW3A 3B5HA 3AY2A 4LCIH 4WO4C 2Q8BH 3VCLA 3U2SB 1KJ3L 2BSSB 5JIDA 5F7DB 2XG4A 1BQLL 3CJJA 5CHNA 3OBAA 1OE1A 3AG4B 1RHHA 5IFAL 4FKKA 1ZK5A 5K39B 5C2BH 2F7IA 4G7SB 3WSQH 5EU7E 3MRBA 2OZ4L 5D2NB 4BZ1A 1TJXA 5CILL 3ISRA 5GGVL 2OMNA 3WTSA 1G7LB 5BQDA 4PLKC 1BZ9A 5IOKA 3H3BC 2XN9A 4UQ2A 1CGSL 1FN4B 4QCIA 3UZEC 1EHKB 4ATTA 1THCA 2PTVA 3IJYA 4FLRA 4NP4L 1MFEL 4WQOA 2G5UA 2YGNA 4ZRGA 2ZUTA 1MLCA 2X0VA 2Z34A 1WJ3A 3CU7A 1ZS8A 4PJ9C 1YY8A 3FUDA 3H3PL 5HI3C 5JMOC 3R06A 3WFBL 3QDJA 3U30B 2O72A 3SGEI 1WA1X 2EXTA 3OKEA 3V79C 1H6FA 3MU3A 2XWBB 4K3JL 1XL6A 3KG5A 3TT1L 4B7IA 2QGCA 3VXUB 1E4KC 5IV2A 4D0DA 3BCDA 3MGAA 5EUOF 1I1AB 1MJ7H 4BGLA 3HB3D 3TO4B 2F5BH 2GSIA 1M7XA 2C9SA 1BQHG 1OSYA 5F9JA 3ZW3A 4JY5L 3BZFB 2LT9A 2E75C 1MVUA 2D7QA 5F89A 4ZTPL 1E67A 4OCRH 3VM5A 3VMNA 3JXAA 5IEHB 3DUHA 1A7PH 1QBBA 2WJ5A 5CZVL 3ARUA 1PYWA 4PCKA 1ZA3B 1X5LA 1ZOXA 4IJ3B 4YHIB 3CIAA 5JW3H 4J7RA 3K1KC 2FNWA 2PTUA 4ZUTB 1YNTF 2C9UA 4OLWH 4F24A 3UJTL 5I0YA 4K3HA 2VRAA 2AJXH 2E74C 3M7FB 5F3HB 1T6VN 3TIDB 1UD5A 2CLRA 3BXNA 1H9DA 4E0RB 1ACZA 2E6QA 1BJMA 2JE8A 5BO1H 1BJ8A 4R83A 3QB7C 3ZDYE 1O6SA 2WNXA 3NN8B 4NUGH 2BVOB 5EOQL 4YHML 5CLWA 1YHPA 2J2ZA 4OZGB 4ZMOA 1A7OL 2N4IA 1RULL 3U2IA 2EVJA 2XIDA 3GXNA 4RGNC 3MOBH 5IQ9A 5I9QC 4RVBA 2Q3AA 1I3GH 1L3WA 4BH8B 4HUWA 3OXRB 3WY1A 2BJML 3S35X 2Q5BA 1HWGB 1M71B 1UJTA 4KNSA 2BY2A 4YGVA 4A7QA 5AZ2H 3QRLA 1CR9H 1REIA 2CPCA 2W9EL 2IH1A 4A37A 5CM1A 3ULVE 1UACL 1HX0A 3STLB 3KYOA 1JRHH 1EERB 3T4AC 1S7TB 3NPSC 4RBPK 3SOBH 1C5BL 2CIKB 3RDTB 2P5EB 1EEZB 1W15A 3MLTA 1IZJA 2BDNH 3H7BB 2B39A 3F7RA 4Q6IA 2YO3A 3HZKB 3OMZA 2QV2A 4PJHB 3AB0B 3LKQB 4KBPA 3TBVB 5DHYA 3L9RB 3VXRB 1ESOA 1LD9A 3H53A 1WICA 3P2TA 1HIML 1F2XK 3IJ7A 2Y7QB 1WP6A 2IXQB 3OR6A 4FQ1H 3J7HA 3QDMB 1H3WM 1JSYA 1W72A 2AEWA 3FONA 3M17A 4JDZA 1FZKA 2YPLE 3FOLB 4L8DA 1XQ4A 2WAQA 4U6YB 5ETUB 5EU6E 3PWNB 2AABH 1RJZB 2YD0A 1UA7A 3GSOA 2OXGB 5E6IA 6CGTA 1B4RA 1BBDL 1Q9OB 1RK7A 5HGBA 2WPGA 1RIVL 4I89A 3REVB 2J1WA 3C6LA 3PIQB 1MCLA 3Q9PA 2N7AA 2AXFA 1AACA 5ECGA 1ROCA 2DF3A 5D8JL 1DVTA 4NKIH 3KCWA 3KLQA 5KJRH 3L17A 3QR2A 5IM7A 1JXGA 2AK1L 5CKAA 1TQCC 3D39D 4IRJA 3QGVA 2N56A 2DICA 1PLCA 1AR2A 4DVRL 1AOHA 2W9DH 3RWCB 4G8FB 2CNZA 5GGTH 5E7BA 3F7VA 2VOTA 2ZCLH 2X1PA 4WO0A 5HJDA 3JVGC 1DN0B 1CI3M 2MH4A 3MACL 4X99B 3C9NB 5IJCC 1GYWA 4LO9A 4GEJA 3SQRA 3CSYB 2YIHA 4QHLB 4P9HH 4X0KB 5TFSH 4BFOA 4WWKD 3O4LD 4U1KB 5EZJA 3RJDA 2GI7A 1A1MB 2VSMB 1QPPA 3U6XS 3BH9B 3M07A 1GL4B 1OSPL 4JHUA 2WNWA 2KDYA 2RQ8A 4XAWH 2GI0A 4RFOH 3KCPA 5IEKA 1GRWA 2P5EE 1M05A 5IBUG 2BZDA 3NFPB 4AOFA 4K9EL 4A2MA 3OHMB 2ZSVA 1QEXA 5CD3B 1JGUH 2R4RH 4BWTA 3VXRE 1IVTA 3VFPA 2V2TA 4UM8A 5JTWA 4S1SL 2Y6SD 2PWGA 3VI4B 3HN5A 4KNUA 1NUNB 2WXOA 4QRUB 4K3EH 3ZK0A 1X5AA 2HFEA 4P5MA 4O02H 1P69B 2Y3NA 3BE1H 3L4TA 3OR7A 3E1F1 4IK7A 4URTB 1S9XB 5I17A 2I07B 2IC2A 1P5VA 4Q0XH 3MRQA 2FSEB 1EAPA 4LHUB 2ZX6A 4XNZB 1CFQB 2EDTA 5J56B 3MRJA 4KRLB 3DURB 3OTTA 3TLRA 4LSUL 2A3TA 5C7ZA 4W9HC 4AMWA 4DSYA 5LDSA 3DECA 3D25A 3FT9A 1QR1B 5IFJB 2JCCF 5KN5B 1SUJA 3JWDL 4IRZL 1NL0L 4TL4A 5HJ3B 2VDRB 1T7ZA 5JXED 4X6DB 2HVJB 4Y1AB 5SWSB 1FVEB 4ALAC 4ANWA 4EZMA 4XXDB 1IBGL 4ZNEE 5IMLB 4UOW1 3L95B 3VJ6A 5INDA 3MX0A 1R3KA 1CLYL 3GSUA 4Z9KB 1EO7A 2C9AA 4KFMA 4K23L 1LDPL 4KK9C 1EO5A 1X5JA 2ESVB 3F85A 1VF5C 3TEYA 1PZ3A 4FCAA 2C1PB 3VFWA 2X28A 3VI3B 1FNSL 2EACA 2EVHA 2KT6A 5EEXA 4N1HB 2FX7L 3F8UB 5I8OL 5JHLH 2VL5A 3FTYA 1NLBH 4PWFA 1MHPH 1NCDH 2VGLM 1WBXA 3RDJA 3VI4E 3LRSB 1F3DH 2MHAA 4RGOL 1A6AA 4KZDH 1KLFA 4I3RH 2Y9RT 4H1LB 4I2XB 1YC7A 1YJDC 4ZPTB 4AENB 2GY7B 1Q0XL 3NZSA 4J4PC 4QDGA 2RD0A 4LLWA 1MCQA 1G9MH 5HPMB 4NO3A 4YUEL 3V7AG 5J1TC 3WTWA 2WWMC 5D6CB 4R0LA 1XH3B 3MCKA 3M1CA 1EDHA 4XB7A 4LOUD 4JLRA 4A2GA 2E56A 4TTGA 2XTJE 1ZT1B 2ZX7A 5INCB 2IPUK 3PNWA 4U1HB 2QZQA 5E56A 4UOW0 1E2ZA 3U46A 3GSVA 1G6RA 4XGZA 2D03L 5LGKA 4JQXA 4RDQF 3WLBB 5AOZA 4QEGA 2JELL 4WK0B 4CMMB 1AIFB 2DYPB 4AT6A 3EH2A 2G0LA 5BW7C 4BFIB 4FQQA 2P44B 3FO0L 3U7YL 2EXYC 2X4SB 1ETZB 2XWJA 3NT0A 5SWSE 1G5AA 4CILA 2AEPL 1ADQH 4RBPH 5EU4B 2P49B 3F64A 3MCLH 5K69A 4N0FB 5KANI 1RIUL 4K2UL 5FO9A 3MLRL 2VUYA 3L5JA 5M7QA 2FBJH 4QLRA 4KTDL 3ZKMD 5T3ZE 5KBMA 4KJQC 3PXJA 1E90A 4N6QA 4BQ8A 1ECYA 2XKSA 3HPLB 2AF2A 2W5PA 5A2JH 3RZCA 4XWGH 4JZOB 5EU3B 1YNLH 3K5RA 5C0IA 3DV6B 1HHGA 3PWLA 4HKZA 4DO6A 2RH0A 1M7IB 3MNMA 2P1YA 1LE9B 3BVWA 1I9IH 4BIKA 1G7PA 1JYXA 1HXMB 3L4YA 2DQCH 1SUHA 3LOWA 4OGYL 3F83A 4NKOA 1A7NH 1NPJA 4OLVH 1NUDA 1BP3B 1WBYB 4MXVF 1KFAL 2PW1B 3VTTA 5JLZB 5EUKA 1WE5A 3AJ7A 4ATWA 3ABMB 2VZ3A 4I2XE 2Z35B 4XVSH 1E9QA 1KV3A 5FUZH 5LQBH 3QHTC 2HN7A 3EOAB 1HOEA 5LG6A 3VX0A 2E76C 1KGCE 1RZJC 1ZA6A 2V9QA 1GGIL 1ZTXE 2A73B 2BK8A 4G8GE 5FYJU 4Z7AA 2XVKA 5CR8A 5D7KD 2VE6B 2EDQA 5DJ2B 3II3A 3A4FA 3QPQC 1NCIA 1EH9A 4WI0B 4K9JA 1EEQA 2BWDA 5LGHH 3SCMD 2XVBA 3MRCA 2IAMB 4ZAKD 4G1MB 1NCWH 4OZIF 3EYVA 3VWJD 1OE3A 4OM0L 3MJ7B 4QOKD 3P2DA 4JKNA 1QFUL 1JMXA 2WN3A 3IMWA 3QIWB 3DSNB 1T5WB 1U3ZA 2YPVL 4MLSA 4WGWB 3HC3L 1LP9B 5ANMA 2CUIA 3RGBA 3AROA 2K4WA 1BIIB 4UV7H 5AB1A 2VR4A 1NIBA 4KK6C 5CCHE 3T5WA 4TUUA 2ZOLA 2W38A 4XBPB 4WAFA 4GSQA 3RRQA 3K6DA 1F18A 1CTOA 4Y4HB 3SBWA 4CSTA 3BKJH 4FNSA 3RBGA 3KL5A 4LKXA 4MJIB 4B7LA 5ECJE 2JK5A 2X1OA 1RUAH 3FMGL 2YQ3A 3TT3H 4GSDL 4OUUA 5CUSL 1U93A 2BIPA 4GH7B 4N90D 4PR5A 4R4BA 4OI7A 2UY6A 5EULV 1OIOA 1YNKL 1GPOL 4KMLB 2EDFA 4FP8H 5MENA 1KIPA 4DP2X 3AUWB 2NSXA 3BKML 2FRGP 1EHXA 4NI3A 3D0LB 2LQRA 4MCZA 2G4EA 4J3OD 1PD1A 4UDUA 4XCYB 2ZKYA 2Y06L 4FHBD 2ZOKA 4S0TD 4M48H 2FO4B 4LK4A 5I1KL 1DBAL 3QA3B 3CPLB 1MY7A 5DD1L 1LO4L 4I48B 4LPYA 3D2TA 1FGVH 3IU4L 4O2CA 4YIQB 1NGYB 4DK3A 4QJ3B 3HR6A 2XBTA 3QUYB 5DVMA 5EDXA 4UU9B 3JTTB 2K4AA 1RUPH 4HAFA 5BJTB 15C8H 3WMPA 3C6SA 4X0NA 3HG2A 2OSLB 3S5LG 2WP3O 3ESMA 4N8VA 2GYSA 3T6VA 3UTTE 2D7NA 3GMQB 5JHAA 3U79A 5DZJA 1NEZB 1E30A 3R1GL 3HG5A 5FWRA 3RPIA 5H4ZA 2WQXA 4HWBL 5E4OA 4HIJB 2WK2A 5CJOH 4MCYA 3MBWA 3SKNB 2V7NB 2G3XA 2AERT 3II2A 3LKRA 4GBXA 1QQDB 5D96B 1SLUA 4YDVA 5F7WC 1F58L 3TZVB 3KYNA 2F53A 5DRXA 4MVBC 4F2MA 5L2KA 4XVUD 4JM2D 4UAOB 5AVTB 3T0EA 2Z93A 1OZTG 3BD4A 3D5OF 3II1A 1CBVL 1C16B 1SOXA 1AHWB 2ZP0T 4LDEB 4OIAA 4M7ZB 4AJ0A 3I6LE 1BOYA 1QW8A 3T2QA 4IBWA 2MQGA 1YO4A 5AVXB 3MV8D 1NBQA 3TBSB 4ABVA 2QPEB 4UTBH 4MHHI 3T4YA 4M61A 3F7KA 1I53A 2ETWA 1TYJA 4LLQB 3L5XL 4O4YH 2VL4A 3CN4A 2NY3C 3MR9B 3DTUB 4K94C 4FFWC 3EW3B 4HX1A 3DPBA 4YLQT 1YCSA 5CEZE 2R0KL 3H9HB 4ZNCD 1IEAA 3QJFA 2OZ4A 1LMKA 3UAJC 1K8IA 1L9NA 4JDEA 3IT8D 4NRZB 3EOBB 2ERJB 4UQ9A 5CIPH 2GHZA 4U0RC 3GM0A 1Q4NX 5BOPA 2IQAA 2AQ1A 4PLJC 4CSPA 3C5ZA 4TRPH 5IHZB 1DQML 1WC7A 1QSVA 1Q38A 5D7LA 5FGCE 2PR4L 4C56D 1SGKA 2QPFA 1Z66A 3N91A 1S7RB 3H6AA 4BK5C 2VITB 1IAOA 2ZAGA 4L23A 1IC7L 5FB8B 4OJYA 3O3AB 3T2OA 1S7XA 2ZUWA 3ABZA 2KYIA 3H9SB 4Q7DA 5DQ9B 1HQRA 1EXGA 2ZP8A 2X09A 4ZS6D 4EVNB 3GHBL 2EP6A 5KYUA 3QZBA 3V0WL 2OK0L 2IWEA 2P5WB 4E41B 3SYCA 2H8PA 4GKZA 2EIKB 1WZ1L 3AGVA 5KS9F 5L0QC 4UTAL 4PI0A 3IMUA 1E9OA 5KUMA 2VAJA 1UM4H 5LWYH 5BV7B 3D69A 1F1GA 4TMPA 5FR3A 3SE3C 4B97A 4WHCA 3O2DL 3RVWD 2QFPA 3OB0K 3ZBMA 1F4WL 4CMHC 5JW5A 1R5WB 2P7TA 1U95B 5K1NA 1JIBA 5L9DL 3L1OL 3HUJA 4MD4A 1FPTL 3CQQA 2D0FA 3IU3A 2CDEB 4PP1D 4FLHA 3OAUH 1Q9KB 3CFKB 5D1ZI 1Y18A 4K8RH 4A7GF 3QS2A 4JN1L 3TNMB 3RILA 1JV5A 4GKLA 1XIWD 4KO6A 3KNBA 3VUAA 1I31A 3CN1A 1ZWIA 2IO5A 1I7UB 1MHEA 4NO0B 5C07A 2QR0A 1M2OA 5L6YH 2Z7WA 4NQXB 4G7YL 4WUUB 3FXIC 3G04A 4PRIE 3FCTB 4HS3B 1QRNB 1FNEA 3QORD 4FYRA 5DJ0A 1VADB 3VYNA 4QRRD 3ASNB 4PS7A 2GUOB 2Q6WB 3TNNB 3MBXH 4DO4A 2NY5H 5EIIB 4UTCA 4PY8J 1NBZA 4OCXH 2D7OA 3RUGF 9PCYA 2WVVB 2F7QA 1XB3A 4RAUA 5IHUL 4N1EA 3G9AB 2B4CL 3PJLA 1CFBA 2X05A 3WS6C 2OKMA 4F57H 4Z7NF 1FQ9C 1OZUA 1ZE3C 2EJ1A 4NJ9L 3H9SE 4X8CA 1KEGL 3UG5A 4WNQB 3EO1A 2ZF9A