2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
4JD2G 3DXKG 1K8KG 1TYQG 2P9UG 3RSEG 2P9SG 3DWLG 3ULEG 3UKRG 2P9LG 2P9PG 4XEIG 1U2VG 2P9IG 2P9NG 2P9KG 3UKUG 3DXMG
chains in the Genus database with same CATH superfamily
1W3BA 2P58C 3FU0A 4BX9A 5JHAA 2XZDG 2X6HA 3I4GA 4APOA 3PZ1A 4CYMD 4FP7A 1H2UA 4W9RA 4XX5A 4KZ0A 2KBXA 3BEEA 3PEUB 2RFMA 4U96D 4N2QA 3TJPA 2J8SD 2V4LA 4YVOA 4WNFA 2BUGA 5FINA 2WB2A 4HOUA 5BNWA 1KPSB 2X6IA 1IYGA 5CBNA 5A7DB 1WDYA 2X38A 5DIZA 1N54A 3MKRA 3ZYLA 4GTOA 4DI3A 4F53A 3AG3E 1E7UA 2ILRA 2QZAA 4JEHA 3ENEA 4G11A 3L54A 4GA0A 3ZRHA 3CEQA 4EZLA 3B13A 1N0QA 2WXJA 3OAWA 5BPPA 3T5VA 2LNIA 3IHVA 4I9EA 4U0SA 1ELRA 5G55A 1B89A 1HX8A 2B6CA 4TV3A 4J8FA 5IY5E 3BUAA 4ILGA 3ISMC 1H6PA 3Q47B 5FIOA 5T8IA 3DSSA 4G8KA 4BETA 2KATA 5EIDA 3O48A 3Q7AA 1H2TC 3ZW3A 4RG9A 4BY6A 4JC8A 4CZ2D 2L0TB 5JJ6A 3V2OA 2YHEA 2Y4UA 1P5QA 2I9CA 3Q15A 3RK6A 5LCWC 4B8AA 4GZ3A 3VLDA 1JCRA 2PM6A 5E76A 1EYHA 2OCCE 2XCCA 3KEAA 3MV2B 1N0RA 2Y1LE 1V54E 1QBQA 5ENSD 4J8YA 3D9PA 3UIPC 3LVQE 2AXVA 3MEKA 3QAQA 4U63A 4ACKA 1KZPA 4N39A 1E96B 5LX8A 4IN3B 2ETAA 1Z3XA 3NZSA 3UTMA 2KZTA 2P9UG 3QARA 2PQRA 1SQMA 2IONA 1QZ2A 5HKPA 4GTVA 2R2LA 3ZNGA 3Q9NC 2WPVA 3CVQA 3B7SA 5AJLA 5AJDA 4GMJA 5EIBE 2AWIA 3PUKA 5FQ4A 4A1SA 3CVVA 4APFA 4B93B 3OTNA 2CHWA 3MCXA 3TG4A 3DWLG 5CECB 3D9LA 3UPVA 3P2BA 2I6HA 2Y3AA 4GZCA 5EILA 1S63A 4ATGA 4K03A 3Q9UC 4X8QA 1KT0A 4PS8A 3NBNB 2VJ8A 3FTYA 1E7VA 4HRNA 5KJMA 2WXQA 5J08A 3DXMG 2F8XK 2R05A 4BT8A 3E33A 5C2YA 4P29A 4QQIA 3E4BA 3D9NA 4F1PA 2LXMA 1D9SA 5KWDA 3DSXA 2IQCA 1SVXA 1UW4B 4JXTA 2PNNA 2J08A 2VYIA 2F37A 3TWQA 3IEGA 4TRQA 4ABNA 3S2AA 3DSTA 5B1AE 3BQOA 3DRAA 1UN9A 4HRLA 4HVBA 1TYQG 1N11A 1TJFA 2UWJG 4RQIA 1O1SA 2E2EA 5LP0A 5KNHD 1HS6A 1PAQA 4A55A 4HORA 1E8YA 2Q7FA 2UY1B 4TUUA 4AY5A 3PZ4A 3L08A 4YDOA 4GCNA 5CCLA 1HO8A 5LCWJ 4WAFA 2RG8A 4PUCA 2H6HA 3RAUA 4DX1A 1N95A 2J4DA 2F0YA 4B0ZA 2FEZA 3FEXA 4LERA 4JA7A 3Q73A 1RW2A 3SNXA 5KCMA 3B7TA 3L6AA 4KBQA 4CRWA 4OAUC 2R59A 3Q4AB 4JL0A 3FH5A 3MYVA 2NYJA 1N4PA 3CKBA 3UXGA 4UWLA 4HS2A 4IYPA 4AY6A 3X2QE 4A63B 3HXBA 2ETCA 3NAWA 3EHQA 1OWPA 5G05J 4CDMA 1RZ4A 3FDHA 3FUFA 4GB9A 4KXKB 5HQ8A 3SBTB 4LG6A 3FEYA 4FLHA 5LOZA 5T3RA 2QY7A 3HYMB 4FHJA 4TXPA 5BUZA 2H6GA 4WUYA 4Y6WA 3ASNE 4GTRA 2DBAA 3T5XA 3TG5A 3U4TA 2EIME 4L23A 4G2VA 1WG0A 3UKRG 4GZDA 4DX2A 4I9CA 4XKBA 3NZUA 3G2TA 2J9QA 3PZDA 3PNTB 1FT2A 4GU5A 3FY4A 1BI7B 4WWPA 3PRZA 5KJLA 3BG1B 5EX3A 3QKYA 4A1GA 3DEOA 2L0IA 3R7RA 2XS8A 2AXZA 3LVRE 3D9JA 1L5JA 2VGYA 3NQPA 4FC8A 5FWQA 3ZFWA 4CCAA 5BXUA 5G04C 3JQ1A 4C9BB 4CDRA 4U0UA 3UM2A 3RSEG 2VSXE 5JA4D 1IQUA 3GZ2A 4AJWA 3L17A 1TN7A 2EIJE 3FUHA 5CEAA 4J8DA 4UWKA 5CBOA 2A5UA 1HH8A 1LD8A 5FZRA 3QWPA 4G25A 1O1RA 3P1UA 3L22A 1E8XA 3FUNA 3MV3B 3LY7A 3UIOC 4ZFHA 3KAEA 3CK9A 2C0MA 2FF4A 4EQFA 2LXLA 3CK8A 1Y8MA 2WMOA 3RIBA 1A5EA 3QNKA 5ANRA 3ULQA 3I3NA 4UQXA 2EINE 4OVUA 3BU8A 2B0OE 3CIAA 3GZSA 3HIZA 4O1OA 1HG5A 3JQ0A 1EDUA 2NC9A 1S70B 1KLXA 1YCSB 4HB5A 4UI9K 2HO1A 4KVMA 3ASOE 4FJZA 4ANWA 1UOHA 2OOEA 3UM0A 3J5QB 2CG3A 4XI9A 2WQ7A 5A6CA 4JW1A 3VLFA 2FI7A 2MYOA 4GTMA 4J8EA 1MX4A 4YDYA 3TL5A 4AEZC 2R02A 3CHRA 3MA5A 1OXJA 2DYRE 1GW6A 2QFCA 5FJYA 1TR4A 1H6OA 4ZHBA 1JCQA 1MJ0A 1K1BA 3FUEA 5ENQD 2PZIA 5DBKA 4XKCA 4GA2A 3Q75A 5A23A 3ZPJA 1G3NB 4BSXA 3N71A 1H6KA 3IV0A 5JHBA 3IXEA 4I43A 2OEWA 4MKTA 2XCBA 2YINA 2JABA 4DX7D 4UI9C 3UQ3A 3TWXA 4F1SA 1EF1C 4EPZA 3C3QA 2X6KA 2WXKA 5LFAA 2XEEA 1BI8B 4XZ4A 2GGFA 3LY8A 1QYMA 4U07A 5AQ7A 4GYOA 2IO2C 3DPDA 3NOCD 2VSYA 4LNUD 3L16A 1SZAA 3CQCB 4WNGA 2R17C 2KCKA 2VTBB 1PC2A 1TNYA 3JXIA 3RRUA 3CQGB 2P9SG 4ACLA 1QNFA 3ULEG 2H6IA 1KT1A 3CR3A 4DPRA 3V79K 5J90A 3LS8A 3VLEA 4NURA 4Q96A 3ZVVA 2IF4A 5FZQA 4CT4A 3LJNA 1Y6IA 1EPUA 3FTZA 3CK7A 3C3OA 4Y6CA 2WXLA 3KS2A 2L6BA 4BTBA 4LCTA 1JWFA 2FO7A 4N3CA 2MOWA 4GCOA 1HE8A 4R7LA 3ZYQA 2CFZA 2OEVA 4DI4A 2WXOA 2AXUA 4HBDA 4DJAA 1K3ZD 2GRMA 3RO3A 1Z5SC 2OV8A 2VGXB 4BX8A 2DIWA 5FQ7A 4JHKA 1MX6A 3R7QA 1U2VG 4FADA 1SW6A 5BT1A 5G05C 3W9GA 4DRXE 2E0IA 4UQZA 3U3WA 3S7DA 2WXIA 4I6GA 3B7RL 3FU3A 2WQ6A 2LAHA 1OCOE 1X81A 2WXNA 1JCSA 2V5FA 4HXIA 1Z3YA 5CCMA 3FP3A 4BT9A 3AS8A 3CKCA 3ASDA 4HLLA 4EBAG 2KXPC 2P9LG 4XEIG 1D8DA 1IKND 2XRYA 2ZGDA 4YNDA 1IHBA 4LRZA 3FTXA 1TEZA 4UUCA 4EZKA 5EYLA 2OVBA 3R9MA 3TXNA 4I6EA 1V55E 5BV0A 3DSWA 5AIJA 2PL2A 3SI5A 3JUIA 4GAAA 2F8YA 3VTXA 3AG2E 2QYUA 3TAXA 1LTXA 3ZUVB 2CHZA 3RJVA 5B3SE 3J5PA 4FULA 2XGMA 1YA0A 4U8VD 1YMPA 2DZOA 2MRIA 5C1DA 4DLQA 2XGSA 4PDXA 1NA3A 4RG6A 2WXRA 5CRVA 2XGOA 3ZGQA 2Y4TA 3WXXA 3ONLA 5ENTD 1TNUA 2VGEA 2YHCA 3LJ3A 3PDNA 4TXRA 3PREA 3LY9A 3G2SA 2VSOE 3PZ2A 3DSVA 2P9PG 2ZU6B 3SD5A 3QWVA 3TGOA 4F6RD 1TNOA 3CHOA 4O6FA 1HF8A 3PS6A 1X5BA 5HI7A 3QDNA 5AENA 4ANUA 4EBAA 3CSFA 4WNDA 3GW4A 5JJTA 4CT0A 2I2OA 5ENPD 1TN8A 3IHYA 4HNAD 3G2WA 1DC2A 3GYZA 1OWNA 3SZ7A 5D0OD 2VTBA 3IKOB 3LYAA 1ZU2A 1FVFA 3MKQB 1WM5A 3CSTA 4G1TA 3NF1A 4G23A 5AAOA 1BPOA 2L6JA 3L13A 3UINC 3PE3A 3ABKE 4AXHA 2CHXA 4L1BA 1SZ9A 4I1MA 1NL4A 3ZHEA 2EIKE 4A3TA 4BERA 2HYZA 4DLOA 2AVPA 4F3VA 3MZLB 2IFUA 4K5BA 4CGWA 5G04J 3UT8A 3VTYA 1DVPA 4JPSA 1NA0A 4I2ZA 1FT1A 1IQRA 1AP7A 4G8LA 1ELWA 4DX6D 3WG7E 1O5MA 4A3VA 3ZIMA 1U3CA 4K5AB 1BLXB 2FULA 3CGHA 5FT9A 5CMWA 2CG2A 4JVSA 4GZ6A 2P9IG 4JHJA 4ATZD 1OT8A 1MZCA 1H0AA 2X3MA 3PNLB 3FU6A 4K5CA 4KZCA 1LF8A 4AVXA 3SBSA 2BEDA 4FU3A 1JUQA 2IU1A 2J09A 3UT4A 3FULA 3ZYKA 4N5QA 5E75A 3I5PA 3ML9A 4U0ZA 4FHKA 2XEVA 2R5SA 1S0PA 3IBEA 2LSVA 2X6FA 5B1BE 3DPYA 3HDXA 2IOSA 3JCKC 5EDSA 3FWVA 3NOGD 4IRUA 1FPPA 1JWGA 3HG0D 3EHRA 3TWRA 2IJGX 4GYYA 5AQAA 4EZJA 5CHEE 1ELKA 2WXGA 5EYPF 3ZYMA 3RRMB 4I17A 4ANXA 3SHFA 4H7YA 4U8YD 2GROB 2JLBA 3UM1A 4UWHA 4Q69A 3G2UA 3OXGA 2J4BA 3FUJA 1TNBA 2YNQA 1XGWA 4GPMA 3E30A 5D66A 3HVEA 3FUIA 2A4ZA 4PS7A 4Z68A 4UQYA 4C48B 4UWFA 3EHNA 4N3AA 2YQ8A 2HR2A 3EHMA 2WXFA 4RSYA 5HS0A 1QQEA 3B7BA 3ML8A 2RFAA 2VQ2A 3W9FA 5T4YA 4YDEA 4KYOB 2XEHA 4IULA 2KC7A 2PQNA 1MQSA 3UI2A 2XPIA 3QWWA 3CVXA 3QK0A 2P2CP 5ENNA 2UY1A 2WVIA 2XQ0A 3F6QA 5M72A 3EJNA 4I6JA 3ASGA 3QB2A 3ZU7B 4GMRA 3CV0A 1OWOA 3EDTB 3QJZA 2NSZA 3AS5A 1E90A 4URKA 3HRAA 4GTQA 2GW1A 3CVPA 3UX4A 5BXOA 4C0MA 4GTPA 4BWRA 3I4RB 4KVOA 3ZKJA 2H6FA 2HE0A 1K1AA 1NFIE 4GA1A 3D3MA 3NB2A 2M63A 3EIQC 2IEJA 4WWNA 3MKQA 3PVLA 3JUEA 1K8KG 5CEDB 4V3IA 2C2LA 4PS3A 4TUMA 3URZA 3E37A 2A5EA 1WAO1 3APCA 5ARFA 4EECA 2DYSE 4YVQC 4HI8A 3SF4A 4JD2G 3FTSA 5BW8C 2BKGA 4I2WA 4L9PA 3ZHEB 3DBSA 3ULYA 2GRLA 5EKQD 3HVEB 1OCZE 1PY1A 4DX5D 4OVVA 1IHGA 3TWTA 1O1TA 4JHRA 4M7CA 2IY0C 4MBGA 2EQXA 5FQ6A 4HRMB 3RO2A 4XE0A 2WQHA 3ABME 1DCQA 2KCLA 3ASHA 4U95D 3V31A 3TWSA 1ZB1A 4N2SA 1E8ZA 2XRZA 2C0LA 2V4HC 2WM9A 3FTVA 2AJAA 4JZYA 4F7AA 4AM9A 1TN6A 5CMYA 3R9AB 4J0UA 1UJJA 1HFAA 3AG4E 5AQ9A 1HXIA 3UKUG 2PM7A 3LCAA 2KZTB 1HZ4A 4FJYA 3CVYA 4DUIA 3CHPA 2MHKA 4HOQA 4GMLA 3FH8A 2P9NG 1FCHA 2LUHA 4CGVA 1A17A 1KZOA 2NXPA 4RVBA 3ESLA 3FTUA 4BFRA 1FVHA 3GZ1A 4AOFA 1Z6TA 3PH0C 4CDNA 3SFYA 1TJCA 3JYSA 3T8KA 5CRUA 2AW6A 2KM4A 1H2VC 2DWZA 3LDZA 4HFGA 2GRQB 5FZSA 5H7PA 1S64A 3Q7FA 3ZEFA 1E8WA 3C3RA 4N5CA 3FUMA 3ZXPA 4L2LA 3TWVA 3AS4A 2DVWA 3LXUX 3AJIA 4XIFA 3HXEA 4AIFA 2BKKB 1IXVA 4LUNU 1NI1A 3OXLA 4AV7A 5KJKA 3C5RA 3CVUA 2J07A 3KD7A 1OCCE 4N3BA 5D0QD 4EHMA 3T9KA 4HOSA 3MJWA 3EU9A 4I1AA 3DSUA 3SY2A 3D9KA 3D9OA 4B8CB 4L7TA 1OWLA 2ZIRA 1TNZA 2ETBA 3Q79A 3MX3A 1AWCB 3ONKA 3LPZA 4J8SA 1OY3D 5AYWD 3TXMA 4BSZB 2XZTG 4WWOA 2WXPA 2IO3C 4U7EB 4FA6A 2X6JA 1N4QA 4ILIA 3U9WA 4BTAA 4I1OB 3B95A 2JEKA 2DZNA 2WXHA 4NIKA 2ZGGA 3OXFA 1NZNA 5HRYA 3UUXA 2CFUA 2R03A 3FHEA 2GRPB 2OVFA 5BV1A 4XI0A 2ZISA 3HXDA 1SA4A 5CERB 4CEMA 2LSUA 3CVLA 3AG1E 4C0EA 3TWUA 4HLEA 3FUKA 5KBAA 4YDWA 3RKVA 2FO1E 3JXJA 2RD0A 3EU5A 4ANVA 2BF0X 3S7BA 4QFVA 3HHMA 3UM3A 1NP7A 3D9HA 2ONDA 4OYSA 3RRNB 4U04A 4BEPA 2Y0BG 4WNEA 1UG3A 2ZXWE 1BD8A 4E85A 3EUVA 2WMNA 4LNBA 4LNGA 2V0PA 4HOTA 3Q49B 3QC1A 3KSLA 1OUVA 3ABLE 2VSNA 5ENOD 4GTTA 4UI9J 4UWGA 3FU5A 5ARGA 4D10C 3Q5MA 3DXKG 4HQDA 4J7WA 4KMOA 3CLJA 3FH7A 3SO8A 3ASFA 2XENA 5JMND 1MX2A 3L82A 4NQ0A 2XHEA 4ILHB 4PH4B 2XS1A 3MGBA 4E6HA 2VGXA 3CHQA 4TXQA 1VDYA 3EIJA 2I1JA 4GYWA 4O1PA 1JPLA 3KEZA 2J49A 4AP2A 3AU4A 4FLBA 1HU3A 1OCRE 4M3OA 3TWWA 2BTDA 3O4ZA 3SQVA 4JEUA 3E34A 1N52A 5JJ7A 2FBNA 4NRHB 4B89A 2P9KG 4L2YA 5ENRD 3UT7A 3L9TA 3QOUA 3FUDA 4ME2A 4RLYA 1ZBPA 2DCPA 2XPZA 3E32A 2I1KA 3T8MA 1UJKA 1HG2A 1Q2ZA 3CVNA 5AN8A 5FTPA 5AARA 2GRRB 3RU0A 1DNPA 1XNFA 1N4RA 4MLPA 5EN5D 4BESA 3AU5A 4K0RA 4HI9A 3ZN3A 3APDA 3U66A 2XPYA 4MRUA 5ITZF 4G24A 3V2XA 5FQ8A 3CHMA 2LO6A 3Q78A 2IOLA 1LD7A 4JB8P 3SFZA 3G2VA 2WXMA 4KT6B 4J6IA 2LAIA 2HM8A 1N4SA 3KSQA 2EILE 4GZ5A 1BU9A 3S7JA 1SA5A 3SFXA 4DK5A 1N94A 3LEWA 1D8EA 3UMVA 3AAAC 3D9IA 2QC9A 2GRNB 4G26A 3B7UX 3PE4A 4OAVB 1YYHA 5KNGA 3CVWA 1H19A 1DCEA 5AQBA 2QYJA 3APFA 2L9BA 3LKUA 3S7FA 4LEUA 1INZA 4O60A 2KCVA 4B94A 2RKKA 1N9AA 2V8SE 4NACA 3SGHA 4U8HA 3ESKA 1MHQA 3C72A 2Y69E 5D2MC 1WY6A 2V5QC 3PEVB 3C98A 3U64A 4MS6A 3ZXSA 4GPKA 4Q94A 1U3DA 3FTWA 3K9IA 4GTSA 3CHSA 3HXCA 3PZ3A 1MYOA 1OWMA 3D9MA 3BG0B 3HXFA 3FFLA 3DEPA 1UN8A 4JA9A 3V30A 3PUJA 4H7XA 5KJNA 4LSZE 5EX0A 5G2NA 5ANLA
chains in the Genus database with same CATH topology
4JD2G 3DXKG 1K8KG 1TYQG 2P9UG 3RSEG 2P9SG 3DWLG 3ULEG 3UKRG 2P9LG 2P9PG 4XEIG 1U2VG 2P9IG 2P9NG 2P9KG 3UKUG 3DXMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 G;  3DXK G;  1K8K G;  1TYQ G;  2P9U G;  3RSE G;  2P9S G;  3DWL G;  3ULE G;  3UKR G;  2P9L G;  2P9P G;  4XEI G;  1U2V G;  2P9I G;  2P9N G;  2P9K G;  3UKU G;  3DXM G; 
#chains in the Genus database with same CATH topology
 1W3B A;  2P58 C;  3FU0 A;  4BX9 A;  5JHA A;  2XZD G;  2X6H A;  3I4G A;  4APO A;  3PZ1 A;  4CYM D;  4FP7 A;  1H2U A;  4W9R A;  4XX5 A;  4KZ0 A;  2KBX A;  3BEE A;  3PEU B;  2RFM A;  4U96 D;  4N2Q A;  3TJP A;  2J8S D;  2V4L A;  4YVO A;  4WNF A;  2BUG A;  5FIN A;  2WB2 A;  4HOU A;  5BNW A;  1KPS B;  2X6I A;  1IYG A;  5CBN A;  5A7D B;  1WDY A;  2X38 A;  5DIZ A;  1N54 A;  3MKR A;  3ZYL A;  4GTO A;  4DI3 A;  4F53 A;  3AG3 E;  1E7U A;  2ILR A;  2QZA A;  4JEH A;  3ENE A;  4G11 A;  3L54 A;  4GA0 A;  3ZRH A;  3CEQ A;  4EZL A;  3B13 A;  1N0Q A;  2WXJ A;  3OAW A;  5BPP A;  3T5V A;  2LNI A;  3IHV A;  4I9E A;  4U0S A;  1ELR A;  5G55 A;  1B89 A;  1HX8 A;  2B6C A;  4TV3 A;  4J8F A;  5IY5 E;  3BUA A;  4ILG A;  3ISM C;  1H6P A;  3Q47 B;  5FIO A;  5T8I A;  3DSS A;  4G8K A;  4BET A;  2KAT A;  5EID A;  3O48 A;  3Q7A A;  1H2T C;  3ZW3 A;  4RG9 A;  4BY6 A;  4JC8 A;  4CZ2 D;  2L0T B;  5JJ6 A;  3V2O A;  2YHE A;  2Y4U A;  1P5Q A;  2I9C A;  3Q15 A;  3RK6 A;  5LCW C;  4B8A A;  4GZ3 A;  3VLD A;  1JCR A;  2PM6 A;  5E76 A;  1EYH A;  2OCC E;  2XCC A;  3KEA A;  3MV2 B;  1N0R A;  2Y1L E;  1V54 E;  1QBQ A;  5ENS D;  4J8Y A;  3D9P A;  3UIP C;  3LVQ E;  2AXV A;  3MEK A;  3QAQ A;  4U63 A;  4ACK A;  1KZP A;  4N39 A;  1E96 B;  5LX8 A;  4IN3 B;  2ETA A;  1Z3X A;  3NZS A;  3UTM A;  2KZT A;  2P9U G;  3QAR A;  2PQR A;  1SQM A;  2ION A;  1QZ2 A;  5HKP A;  4GTV A;  2R2L A;  3ZNG A;  3Q9N C;  2WPV A;  3CVQ A;  3B7S A;  5AJL A;  5AJD A;  4GMJ A;  5EIB E;  2AWI A;  3PUK A;  5FQ4 A;  4A1S A;  3CVV A;  4APF A;  4B93 B;  3OTN A;  2CHW A;  3MCX A;  3TG4 A;  3DWL G;  5CEC B;  3D9L A;  3UPV A;  3P2B A;  2I6H A;  2Y3A A;  4GZC A;  5EIL A;  1S63 A;  4ATG A;  4K03 A;  3Q9U C;  4X8Q A;  1KT0 A;  4PS8 A;  3NBN B;  2VJ8 A;  3FTY A;  1E7V A;  4HRN A;  5KJM A;  2WXQ A;  5J08 A;  3DXM G;  2F8X K;  2R05 A;  4BT8 A;  3E33 A;  5C2Y A;  4P29 A;  4QQI A;  3E4B A;  3D9N A;  4F1P A;  2LXM A;  1D9S A;  5KWD A;  3DSX A;  2IQC A;  1SVX A;  1UW4 B;  4JXT A;  2PNN A;  2J08 A;  2VYI A;  2F37 A;  3TWQ A;  3IEG A;  4TRQ A;  4ABN A;  3S2A A;  3DST A;  5B1A E;  3BQO A;  3DRA A;  1UN9 A;  4HRL A;  4HVB A;  1TYQ G;  1N11 A;  1TJF A;  2UWJ G;  4RQI A;  1O1S A;  2E2E A;  5LP0 A;  5KNH D;  1HS6 A;  1PAQ A;  4A55 A;  4HOR A;  1E8Y A;  2Q7F A;  2UY1 B;  4TUU A;  4AY5 A;  3PZ4 A;  3L08 A;  4YDO A;  4GCN A;  5CCL A;  1HO8 A;  5LCW J;  4WAF A;  2RG8 A;  4PUC A;  2H6H A;  3RAU A;  4DX1 A;  1N95 A;  2J4D A;  2F0Y A;  4B0Z A;  2FEZ A;  3FEX A;  4LER A;  4JA7 A;  3Q73 A;  1RW2 A;  3SNX A;  5KCM A;  3B7T A;  3L6A A;  4KBQ A;  4CRW A;  4OAU C;  2R59 A;  3Q4A B;  4JL0 A;  3FH5 A;  3MYV A;  2NYJ A;  1N4P A;  3CKB A;  3UXG A;  4UWL A;  4HS2 A;  4IYP A;  4AY6 A;  3X2Q E;  4A63 B;  3HXB A;  2ETC A;  3NAW A;  3EHQ A;  1OWP A;  5G05 J;  4CDM A;  1RZ4 A;  3FDH A;  3FUF A;  4GB9 A;  4KXK B;  5HQ8 A;  3SBT B;  4LG6 A;  3FEY A;  4FLH A;  5LOZ A;  5T3R A;  2QY7 A;  3HYM B;  4FHJ A;  4TXP A;  5BUZ A;  2H6G A;  4WUY A;  4Y6W A;  3ASN E;  4GTR A;  2DBA A;  3T5X A;  3TG5 A;  3U4T A;  2EIM E;  4L23 A;  4G2V A;  1WG0 A;  3UKR G;  4GZD A;  4DX2 A;  4I9C A;  4XKB A;  3NZU A;  3G2T A;  2J9Q A;  3PZD A;  3PNT B;  1FT2 A;  4GU5 A;  3FY4 A;  1BI7 B;  4WWP A;  3PRZ A;  5KJL A;  3BG1 B;  5EX3 A;  3QKY A;  4A1G A;  3DEO A;  2L0I A;  3R7R A;  2XS8 A;  2AXZ A;  3LVR E;  3D9J A;  1L5J A;  2VGY A;  3NQP A;  4FC8 A;  5FWQ A;  3ZFW A;  4CCA A;  5BXU A;  5G04 C;  3JQ1 A;  4C9B B;  4CDR A;  4U0U A;  3UM2 A;  3RSE G;  2VSX E;  5JA4 D;  1IQU A;  3GZ2 A;  4AJW A;  3L17 A;  1TN7 A;  2EIJ E;  3FUH A;  5CEA A;  4J8D A;  4UWK A;  5CBO A;  2A5U A;  1HH8 A;  1LD8 A;  5FZR A;  3QWP A;  4G25 A;  1O1R A;  3P1U A;  3L22 A;  1E8X A;  3FUN A;  3MV3 B;  3LY7 A;  3UIO C;  4ZFH A;  3KAE A;  3CK9 A;  2C0M A;  2FF4 A;  4EQF A;  2LXL A;  3CK8 A;  1Y8M A;  2WMO A;  3RIB A;  1A5E A;  3QNK A;  5ANR A;  3ULQ A;  3I3N A;  4UQX A;  2EIN E;  4OVU A;  3BU8 A;  2B0O E;  3CIA A;  3GZS A;  3HIZ A;  4O1O A;  1HG5 A;  3JQ0 A;  1EDU A;  2NC9 A;  1S70 B;  1KLX A;  1YCS B;  4HB5 A;  4UI9 K;  2HO1 A;  4KVM A;  3ASO E;  4FJZ A;  4ANW A;  1UOH A;  2OOE A;  3UM0 A;  3J5Q B;  2CG3 A;  4XI9 A;  2WQ7 A;  5A6C A;  4JW1 A;  3VLF A;  2FI7 A;  2MYO A;  4GTM A;  4J8E A;  1MX4 A;  4YDY A;  3TL5 A;  4AEZ C;  2R02 A;  3CHR A;  3MA5 A;  1OXJ A;  2DYR E;  1GW6 A;  2QFC A;  5FJY A;  1TR4 A;  1H6O A;  4ZHB A;  1JCQ A;  1MJ0 A;  1K1B A;  3FUE A;  5ENQ D;  2PZI A;  5DBK A;  4XKC A;  4GA2 A;  3Q75 A;  5A23 A;  3ZPJ A;  1G3N B;  4BSX A;  3N71 A;  1H6K A;  3IV0 A;  5JHB A;  3IXE A;  4I43 A;  2OEW A;  4MKT A;  2XCB A;  2YIN A;  2JAB A;  4DX7 D;  4UI9 C;  3UQ3 A;  3TWX A;  4F1S A;  1EF1 C;  4EPZ A;  3C3Q A;  2X6K A;  2WXK A;  5LFA A;  2XEE A;  1BI8 B;  4XZ4 A;  2GGF A;  3LY8 A;  1QYM A;  4U07 A;  5AQ7 A;  4GYO A;  2IO2 C;  3DPD A;  3NOC D;  2VSY A;  4LNU D;  3L16 A;  1SZA A;  3CQC B;  4WNG A;  2R17 C;  2KCK A;  2VTB B;  1PC2 A;  1TNY A;  3JXI A;  3RRU A;  3CQG B;  2P9S G;  4ACL A;  1QNF A;  3ULE G;  2H6I A;  1KT1 A;  3CR3 A;  4DPR A;  3V79 K;  5J90 A;  3LS8 A;  3VLE A;  4NUR A;  4Q96 A;  3ZVV A;  2IF4 A;  5FZQ A;  4CT4 A;  3LJN A;  1Y6I A;  1EPU A;  3FTZ A;  3CK7 A;  3C3O A;  4Y6C A;  2WXL A;  3KS2 A;  2L6B A;  4BTB A;  4LCT A;  1JWF A;  2FO7 A;  4N3C A;  2MOW A;  4GCO A;  1HE8 A;  4R7L A;  3ZYQ A;  2CFZ A;  2OEV A;  4DI4 A;  2WXO A;  2AXU A;  4HBD A;  4DJA A;  1K3Z D;  2GRM A;  3RO3 A;  1Z5S C;  2OV8 A;  2VGX B;  4BX8 A;  2DIW A;  5FQ7 A;  4JHK A;  1MX6 A;  3R7Q A;  1U2V G;  4FAD A;  1SW6 A;  5BT1 A;  5G05 C;  3W9G A;  4DRX E;  2E0I A;  4UQZ A;  3U3W A;  3S7D A;  2WXI A;  4I6G A;  3B7R L;  3FU3 A;  2WQ6 A;  2LAH A;  1OCO E;  1X81 A;  2WXN A;  1JCS A;  2V5F A;  4HXI A;  1Z3Y A;  5CCM A;  3FP3 A;  4BT9 A;  3AS8 A;  3CKC A;  3ASD A;  4HLL A;  4EBA G;  2KXP C;  2P9L G;  4XEI G;  1D8D A;  1IKN D;  2XRY A;  2ZGD A;  4YND A;  1IHB A;  4LRZ A;  3FTX A;  1TEZ A;  4UUC A;  4EZK A;  5EYL A;  2OVB A;  3R9M A;  3TXN A;  4I6E A;  1V55 E;  5BV0 A;  3DSW A;  5AIJ A;  2PL2 A;  3SI5 A;  3JUI A;  4GAA A;  2F8Y A;  3VTX A;  3AG2 E;  2QYU A;  3TAX A;  1LTX A;  3ZUV B;  2CHZ A;  3RJV A;  5B3S E;  3J5P A;  4FUL A;  2XGM A;  1YA0 A;  4U8V D;  1YMP A;  2DZO A;  2MRI A;  5C1D A;  4DLQ A;  2XGS A;  4PDX A;  1NA3 A;  4RG6 A;  2WXR A;  5CRV A;  2XGO A;  3ZGQ A;  2Y4T A;  3WXX A;  3ONL A;  5ENT D;  1TNU A;  2VGE A;  2YHC A;  3LJ3 A;  3PDN A;  4TXR A;  3PRE A;  3LY9 A;  3G2S A;  2VSO E;  3PZ2 A;  3DSV A;  2P9P G;  2ZU6 B;  3SD5 A;  3QWV A;  3TGO A;  4F6R D;  1TNO A;  3CHO A;  4O6F A;  1HF8 A;  3PS6 A;  1X5B A;  5HI7 A;  3QDN A;  5AEN A;  4ANU A;  4EBA A;  3CSF A;  4WND A;  3GW4 A;  5JJT A;  4CT0 A;  2I2O A;  5ENP D;  1TN8 A;  3IHY A;  4HNA D;  3G2W A;  1DC2 A;  3GYZ A;  1OWN A;  3SZ7 A;  5D0O D;  2VTB A;  3IKO B;  3LYA A;  1ZU2 A;  1FVF A;  3MKQ B;  1WM5 A;  3CST A;  4G1T A;  3NF1 A;  4G23 A;  5AAO A;  1BPO A;  2L6J A;  3L13 A;  3UIN C;  3PE3 A;  3ABK E;  4AXH A;  2CHX A;  4L1B A;  1SZ9 A;  4I1M A;  1NL4 A;  3ZHE A;  2EIK E;  4A3T A;  4BER A;  2HYZ A;  4DLO A;  2AVP A;  4F3V A;  3MZL B;  2IFU A;  4K5B A;  4CGW A;  5G04 J;  3UT8 A;  3VTY A;  1DVP A;  4JPS A;  1NA0 A;  4I2Z A;  1FT1 A;  1IQR A;  1AP7 A;  4G8L A;  1ELW A;  4DX6 D;  3WG7 E;  1O5M A;  4A3V A;  3ZIM A;  1U3C A;  4K5A B;  1BLX B;  2FUL A;  3CGH A;  5FT9 A;  5CMW A;  2CG2 A;  4JVS A;  4GZ6 A;  2P9I G;  4JHJ A;  4ATZ D;  1OT8 A;  1MZC A;  1H0A A;  2X3M A;  3PNL B;  3FU6 A;  4K5C A;  4KZC A;  1LF8 A;  4AVX A;  3SBS A;  2BED A;  4FU3 A;  1JUQ A;  2IU1 A;  2J09 A;  3UT4 A;  3FUL A;  3ZYK A;  4N5Q A;  5E75 A;  3I5P A;  3ML9 A;  4U0Z A;  4FHK A;  2XEV A;  2R5S A;  1S0P A;  3IBE A;  2LSV A;  2X6F A;  5B1B E;  3DPY A;  3HDX A;  2IOS A;  3JCK C;  5EDS A;  3FWV A;  3NOG D;  4IRU A;  1FPP A;  1JWG A;  3HG0 D;  3EHR A;  3TWR A;  2IJG X;  4GYY A;  5AQA A;  4EZJ A;  5CHE E;  1ELK A;  2WXG A;  5EYP F;  3ZYM A;  3RRM B;  4I17 A;  4ANX A;  3SHF A;  4H7Y A;  4U8Y D;  2GRO B;  2JLB A;  3UM1 A;  4UWH A;  4Q69 A;  3G2U A;  3OXG A;  2J4B A;  3FUJ A;  1TNB A;  2YNQ A;  1XGW A;  4GPM A;  3E30 A;  5D66 A;  3HVE A;  3FUI A;  2A4Z A;  4PS7 A;  4Z68 A;  4UQY A;  4C48 B;  4UWF A;  3EHN A;  4N3A A;  2YQ8 A;  2HR2 A;  3EHM A;  2WXF A;  4RSY A;  5HS0 A;  1QQE A;  3B7B A;  3ML8 A;  2RFA A;  2VQ2 A;  3W9F A;  5T4Y A;  4YDE A;  4KYO B;  2XEH A;  4IUL A;  2KC7 A;  2PQN A;  1MQS A;  3UI2 A;  2XPI A;  3QWW A;  3CVX A;  3QK0 A;  2P2C P;  5ENN A;  2UY1 A;  2WVI A;  2XQ0 A;  3F6Q A;  5M72 A;  3EJN A;  4I6J A;  3ASG A;  3QB2 A;  3ZU7 B;  4GMR A;  3CV0 A;  1OWO A;  3EDT B;  3QJZ A;  2NSZ A;  3AS5 A;  1E90 A;  4URK A;  3HRA A;  4GTQ A;  2GW1 A;  3CVP A;  3UX4 A;  5BXO A;  4C0M A;  4GTP A;  4BWR A;  3I4R B;  4KVO A;  3ZKJ A;  2H6F A;  2HE0 A;  1K1A A;  1NFI E;  4GA1 A;  3D3M A;  3NB2 A;  2M63 A;  3EIQ C;  2IEJ A;  4WWN A;  3MKQ A;  3PVL A;  3JUE A;  1K8K G;  5CED B;  4V3I A;  2C2L A;  4PS3 A;  4TUM A;  3URZ A;  3E37 A;  2A5E A;  1WAO 1;  3APC A;  5ARF A;  4EEC A;  2DYS E;  4YVQ C;  4HI8 A;  3SF4 A;  4JD2 G;  3FTS A;  5BW8 C;  2BKG A;  4I2W A;  4L9P A;  3ZHE B;  3DBS A;  3ULY A;  2GRL A;  5EKQ D;  3HVE B;  1OCZ E;  1PY1 A;  4DX5 D;  4OVV A;  1IHG A;  3TWT A;  1O1T A;  4JHR A;  4M7C A;  2IY0 C;  4MBG A;  2EQX A;  5FQ6 A;  4HRM B;  3RO2 A;  4XE0 A;  2WQH A;  3ABM E;  1DCQ A;  2KCL A;  3ASH A;  4U95 D;  3V31 A;  3TWS A;  1ZB1 A;  4N2S A;  1E8Z A;  2XRZ A;  2C0L A;  2V4H C;  2WM9 A;  3FTV A;  2AJA A;  4JZY A;  4F7A A;  4AM9 A;  1TN6 A;  5CMY A;  3R9A B;  4J0U A;  1UJJ A;  1HFA A;  3AG4 E;  5AQ9 A;  1HXI A;  3UKU G;  2PM7 A;  3LCA A;  2KZT B;  1HZ4 A;  4FJY A;  3CVY A;  4DUI A;  3CHP A;  2MHK A;  4HOQ A;  4GML A;  3FH8 A;  2P9N G;  1FCH A;  2LUH A;  4CGV A;  1A17 A;  1KZO A;  2NXP A;  4RVB A;  3ESL A;  3FTU A;  4BFR A;  1FVH A;  3GZ1 A;  4AOF A;  1Z6T A;  3PH0 C;  4CDN A;  3SFY A;  1TJC A;  3JYS A;  3T8K A;  5CRU A;  2AW6 A;  2KM4 A;  1H2V C;  2DWZ A;  3LDZ A;  4HFG A;  2GRQ B;  5FZS A;  5H7P A;  1S64 A;  3Q7F A;  3ZEF A;  1E8W A;  3C3R A;  4N5C A;  3FUM A;  3ZXP A;  4L2L A;  3TWV A;  3AS4 A;  2DVW A;  3LXU X;  3AJI A;  4XIF A;  3HXE A;  4AIF A;  2BKK B;  1IXV A;  4LUN U;  1NI1 A;  3OXL A;  4AV7 A;  5KJK A;  3C5R A;  3CVU A;  2J07 A;  3KD7 A;  1OCC E;  4N3B A;  5D0Q D;  4EHM A;  3T9K A;  4HOS A;  3MJW A;  3EU9 A;  4I1A A;  3DSU A;  3SY2 A;  3D9K A;  3D9O A;  4B8C B;  4L7T A;  1OWL A;  2ZIR A;  1TNZ A;  2ETB A;  3Q79 A;  3MX3 A;  1AWC B;  3ONK A;  3LPZ A;  4J8S A;  1OY3 D;  5AYW D;  3TXM A;  4BSZ B;  2XZT G;  4WWO A;  2WXP A;  2IO3 C;  4U7E B;  4FA6 A;  2X6J A;  1N4Q A;  4ILI A;  3U9W A;  4BTA A;  4I1O B;  3B95 A;  2JEK A;  2DZN A;  2WXH A;  4NIK A;  2ZGG A;  3OXF A;  1NZN A;  5HRY A;  3UUX A;  2CFU A;  2R03 A;  3FHE A;  2GRP B;  2OVF A;  5BV1 A;  4XI0 A;  2ZIS A;  3HXD A;  1SA4 A;  5CER B;  4CEM A;  2LSU A;  3CVL A;  3AG1 E;  4C0E A;  3TWU A;  4HLE A;  3FUK A;  5KBA A;  4YDW A;  3RKV A;  2FO1 E;  3JXJ A;  2RD0 A;  3EU5 A;  4ANV A;  2BF0 X;  3S7B A;  4QFV A;  3HHM A;  3UM3 A;  1NP7 A;  3D9H A;  2OND A;  4OYS A;  3RRN B;  4U04 A;  4BEP A;  2Y0B G;  4WNE A;  1UG3 A;  2ZXW E;  1BD8 A;  4E85 A;  3EUV A;  2WMN A;  4LNB A;  4LNG A;  2V0P A;  4HOT A;  3Q49 B;  3QC1 A;  3KSL A;  1OUV A;  3ABL E;  2VSN A;  5ENO D;  4GTT A;  4UI9 J;  4UWG A;  3FU5 A;  5ARG A;  4D10 C;  3Q5M A;  3DXK G;  4HQD A;  4J7W A;  4KMO A;  3CLJ A;  3FH7 A;  3SO8 A;  3ASF A;  2XEN A;  5JMN D;  1MX2 A;  3L82 A;  4NQ0 A;  2XHE A;  4ILH B;  4PH4 B;  2XS1 A;  3MGB A;  4E6H A;  2VGX A;  3CHQ A;  4TXQ A;  1VDY A;  3EIJ A;  2I1J A;  4GYW A;  4O1P A;  1JPL A;  3KEZ A;  2J49 A;  4AP2 A;  3AU4 A;  4FLB A;  1HU3 A;  1OCR E;  4M3O A;  3TWW A;  2BTD A;  3O4Z A;  3SQV A;  4JEU A;  3E34 A;  1N52 A;  5JJ7 A;  2FBN A;  4NRH B;  4B89 A;  2P9K G;  4L2Y A;  5ENR D;  3UT7 A;  3L9T A;  3QOU A;  3FUD A;  4ME2 A;  4RLY A;  1ZBP A;  2DCP A;  2XPZ A;  3E32 A;  2I1K A;  3T8M A;  1UJK A;  1HG2 A;  1Q2Z A;  3CVN A;  5AN8 A;  5FTP A;  5AAR A;  2GRR B;  3RU0 A;  1DNP A;  1XNF A;  1N4R A;  4MLP A;  5EN5 D;  4BES A;  3AU5 A;  4K0R A;  4HI9 A;  3ZN3 A;  3APD A;  3U66 A;  2XPY A;  4MRU A;  5ITZ F;  4G24 A;  3V2X A;  5FQ8 A;  3CHM A;  2LO6 A;  3Q78 A;  2IOL A;  1LD7 A;  4JB8 P;  3SFZ A;  3G2V A;  2WXM A;  4KT6 B;  4J6I A;  2LAI A;  2HM8 A;  1N4S A;  3KSQ A;  2EIL E;  4GZ5 A;  1BU9 A;  3S7J A;  1SA5 A;  3SFX A;  4DK5 A;  1N94 A;  3LEW A;  1D8E A;  3UMV A;  3AAA C;  3D9I A;  2QC9 A;  2GRN B;  4G26 A;  3B7U X;  3PE4 A;  4OAV B;  1YYH A;  5KNG A;  3CVW A;  1H19 A;  1DCE A;  5AQB A;  2QYJ A;  3APF A;  2L9B A;  3LKU A;  3S7F A;  4LEU A;  1INZ A;  4O60 A;  2KCV A;  4B94 A;  2RKK A;  1N9A A;  2V8S E;  4NAC A;  3SGH A;  4U8H A;  3ESK A;  1MHQ A;  3C72 A;  2Y69 E;  5D2M C;  1WY6 A;  2V5Q C;  3PEV B;  3C98 A;  3U64 A;  4MS6 A;  3ZXS A;  4GPK A;  4Q94 A;  1U3D A;  3FTW A;  3K9I A;  4GTS A;  3CHS A;  3HXC A;  3PZ3 A;  1MYO A;  1OWM A;  3D9M A;  3BG0 B;  3HXF A;  3FFL A;  3DEP A;  1UN8 A;  4JA9 A;  3V30 A;  3PUJ A;  4H7X A;  5KJN A;  4LSZ E;  5EX0 A;  5G2N A;  5ANL A; 
#chains in the Genus database with same CATH homology
 4JD2 G;  3DXK G;  1K8K G;  1TYQ G;  2P9U G;  3RSE G;  2P9S G;  3DWL G;  3ULE G;  3UKR G;  2P9L G;  2P9P G;  4XEI G;  1U2V G;  2P9I G;  2P9N G;  2P9K G;  3UKU G;  3DXM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...