2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
2P9UG 1U2VG 3DWLG 4JD2G 3ULEG 2P9LG 2P9SG 2P9KG 2P9NG 3RSEG 2P9PG 3DXMG 1K8KG 2P9IG 3DXKG 3UKRG 1TYQG 4XEIG 3UKUG
chains in the Genus database with same CATH superfamily
3AS5A 3FH7A 4O6FA 2R17C 3LKUA 2ONDA 4ACLA 4K5CA 2AXZA 1IXVA 1P5QA 4PS8A 4CZ2D 4G8KA 2DYRE 4XIFA 4UWKA 1X81A 2WXRA 1IHGA 2XCCA 1ZB1A 1UJKA 2IY0C 4HNAD 3LS8A 4UI9K 3SBTB 2XS8A 2NSZA 3FUHA 1JPLA 3DPDA 4JL0A 4UWGA 3RO2A 3RU0A 3UT7A 4GTMA 4LNGA 1AWCB 4KVOA 4HFGA 3BG1B 2PM6A 4GZDA 3ULQA 5AJDA 3PNLB 4U95D 4GCOA 2X6IA 1EDUA 4G24A 2JABA 4KYOB 2BKGA 3G2SA 5C2YA 5B1AE 3CVXA 3UM1A 4OYSA 2WXIA 4RG9A 4N2SA 2CHXA 4JHJA 3RIBA 2X6FA 2RFAA 4ZHBA 4HB5A 3FU0A 5FZRA 1NP7A 2WQ7A 2MOWA 5EIDA 5A7DB 3B95A 4L7TA 4CEMA 1KPSB 3E37A 3BEEA 3U3WA 4GTOA 2JEKA 1H0AA 3EUVA 4I9EA 3V2XA 2H6IA 1H2VC 1N4SA 3HXCA 4XE0A 3CVWA 3CV0A 3TL5A 4FA6A 4PUCA 4BT8A 4I17A 4DI3A 5DBKA 4CT4A 3AG3E 3KS2A 1ELRA 1GW6A 1OT8A 1JCRA 3UMVA 4G11A 4XEIG 2WXPA 1ZU2A 2J9QA 3DPYA 3J5QB 5CMYA 1ELWA 5ENOD 2WQHA 1Q2ZA 3ZGQA 2XGSA 5D0QD 1IQUA 3FTVA 2Y4UA 2QFCA 4FP7A 3MV3B 1G3NB 4CGWA 4GA1A 1K8KG 2V4HC 3MYVA 4TRQA 4I6EA 1OCZE 1NA3A 3HIZA 3LVQE 4BX9A 4XI9A 2EILE 4W9RA 2L9BA 2R03A 2V8SE 3FY4A 3FWVA 5D2MC 3RK6A 3KAEA 2LAIA 2A5EA 2HO1A 4J7WA 2QYUA 4FC8A 3CIAA 1PY1A 2X6HA 4HI9A 1H2UA 4WWPA 4EZJA 3ZYMA 3QWVA 3TWXA 3ZHEA 4YVOA 2ETCA 2P9UG 3AU4A 1OWMA 5CEDB 1BI8B 4TUUA 4IRUA 3CKCA 2WB2A 2Y4TA 3CHOA 2L6BA 2BTDA 3MA5A 1VDYA 3JQ1A 3SFYA 1MQSA 5BNWA 1SA5A 4IULA 3MZLB 5FJYA 3B7TA 4GTRA 2R2LA 5G04C 2XEHA 2P58C 4BSXA 3FUDA 2EINE 3URZA 5DIZA 3ASNE 3DRAA 4IYPA 2LAHA 4J0UA 1H6KA 3PZDA 1OWPA 4A3VA 5E76A 5BV1A 3MJWA 3LYAA 4DUIA 2XQ0A 3Q9NC 1E96B 2YHEA 3FUMA 1V55E 1ZBPA 4FU3A 3UINC 4M3OA 3LY8A 4BSZB 1LTXA 4WNFA 5HS0A 3G2VA 3CVUA 3X2QE 2VSOE 3U66A 3DXMG 1OY3D 4R7LA 3SI5A 1Y8MA 2BF0X 1KZPA 3CVQA 4KT6B 3UKUG 4F3VA 4I1OB 4CDRA 2PM7A 4FLBA 5IY5E 1EPUA 4KZCA 2YNQA 1FVHA 3BG0B 5BXOA 4GMJA 3G2TA 4A63B 5KBAA 2IU1A 4H7XA 4RG6A 3T5VA 2XRYA 3KEZA 4N3BA 4HRNA 2P9KG 3NF1A 3QJZA 4O60A 3UUXA 3C72A 3V31A 4AIFA 4JW1A 2RG8A 4RVBA 4Z68A 3ESLA 3B7BA 3HVEA 3RRUA 3APFA 4LERA 1N0RA 4FHJA 4U0SA 3PNTB 1E7UA 4JD2G 4N3AA 3MCXA 3ESKA 2GGFA 4L9PA 5G05C 5HRYA 3UQ3A 5BT1A 1TNYA 1N0QA 4J8DA 2KC7A 1N11A 4WNEA 2IJGX 2R02A 3FEYA 4C0MA 2XZTG 4Y6WA 1A17A 4IN3B 4OAVB 2XEVA 3IXEA 3Q75A 3Q15A 3HRAA 3L13A 3LJ3A 5T3RA 1HF8A 2DCPA 4PS7A 2YINA 3I4RB 2NC9A 4WUYA 5LCWC 2XEEA 5KWDA 4TXRA 3ENEA 3ZFWA 2P9IG 3V2OA 4GB9A 4HI8A 5EX3A 4AY6A 1YYHA 3FUJA 5HQ8A 3PVLA 2LXLA 2HYZA 1MYOA 2WXFA 4B0ZA 1OWLA 4EBAA 1OCRE 1H6PA 1HZ4A 1Z3XA 4JZYA 3HHMA 4B89A 4X8QA 1TR4A 4BEPA 3FP3A 3R9AB 3PS6A 2QYJA 4N5CA 2DBAA 2KCLA 3UM0A 2IOLA 3CQGB 2M63A 4JB8P 1JUQA 2X38A 3EIJA 5FQ6A 2KCKA 4QFVA 4B8CB 5J08A 2RFMA 4C9BB 5CECB 4DX5D 4TXPA 5AN8A 2B0OE 1OUVA 1QQEA 3LXUX 1EYHA 3S7FA 5JJ7A 2V5QC 2VTBA 3VTYA 4TV3A 2LXMA 4GA2A 1PAQA 4A55A 1WM5A 3IHYA 1E8XA 2CFUA 3FTSA 2HM8A 4D10C 1O1RA 4HRLA 3TWTA 4DK5A 1IKND 3Q78A 3CHRA 3U9WA 1HFAA 4HOTA 5HKPA 1HXIA 3C3OA 3ZYQA 4DLOA 1QNFA 3UIPC 4JPSA 4UI9J 2ZU6B 5CBOA 3EU5A 3OXFA 2ETAA 3ULEG 3QB2A 3QWPA 3TAXA 3VLFA 3PZ3A 3L08A 4ILGA 1AP7A 5ANRA 2WXJA 5A6CA 1ELKA 1XNFA 3JYSA 2OV8A 4U8VD 2ZISA 3DEPA 4I9CA 3B7RL 2WQ6A 4O1PA 1Z6TA 4APFA 2XENA 2J4BA 1K1AA 3ZXSA 4O1OA 3JXIA 2KZTB 2GROB 3V30A 2I2OA 3FTUA 3U64A 2CG2A 2PQRA 2BUGA 4B94A 3ZRHA 4PS3A 4J8YA 4BERA 3Q47B 2VTBB 3CK7A 3EHMA 1BU9A 3SGHA 2V0PA 2X6JA 5KNHD 4ATGA 4MKTA 4GPMA 3FUFA 3FEXA 4AM9A 3CVLA 3U4TA 5FQ7A 4HLLA 4KBQA 3ASOE 3D9KA 4ZFHA 3PUKA 1RW2A 3WXXA 5BW8C 1SQMA 4CT0A 3NZSA 4MS6A 5ANLA 2XS1A 5FQ4A 3UM2A 3B7UX 2J8SD 1MX6A 5LFAA 1Z5SC 3PZ1A 3ZKJA 3SF4A 3SZ7A 3KSQA 3HDXA 3UT4A 1O1TA 4B93B 3CHQA 3ZU7B 5ARGA 2IEJA 1E90A 1S0PA 2LUHA 3R7RA 3LPZA 3MKQB 3UTMA 1UG3A 4N5QA 3CHSA 2FF4A 4DPRA 2WVIA 4WNGA 4U07A 3PREA 3OXGA 4GTPA 2WXGA 1HE8A 4L2YA 3KEAA 3SHFA 3KD7A 2J4DA 3TG4A 1HH8A 5D0OD 2OCCE 5CRUA 4U7EB 1S70B 4AOFA 3PRZA 4JVSA 1YA0A 3ZIMA 4E6HA 4KVMA 1DC2A 5E75A 5BV0A 4LG6A 3CEQA 1BPOA 1TNUA 5G2NA 2EIJE 5FWQA 3FUKA 4I6JA 2L6JA 4BETA 1B89A 1SZ9A 3GZ2A 5AYWD 3EJNA 4HOUA 3D9LA 2PL2A 4BT9A 2IQCA 1TYQG 2VJ8A 2DVWA 5T8IA 3MKQA 3RRNB 1TN7A 3SQVA 4GTQA 4EZKA 2WXQA 3CVNA 3G2WA 3CSTA 5B1BE 3J5PA 1NL4A 4HORA 2VSXE 3RAUA 4JA9A 3EHNA 3I3NA 3PEVB 4JHKA 4LUNU 3ZW3A 3BQOA 2BKKB 1UOHA 1D8DA 1TNBA 3DSSA 3WG7E 2XRZA 2XPYA 1U3CA 2IF4A 1E8WA 2UWJG 3T5XA 2P9NG 4HQDA 3UI2A 2AJAA 3VTXA 2CFZA 4EHMA 3QKYA 5G04J 1D8EA 5A23A 2P2CP 5JMND 1SVXA 4AY5A 3V79K 2CG3A 2GRLA 1WY6A 4UI9C 4K5AB 4LNBA 3AG2E 3D9OA 3ABME 4TXQA 3QK0A 3DEOA 1MHQA 1FVFA 4LSZE 3MV2B 4C48B 1NZNA 1OXJA 5AQ9A 2GRQB 2IFUA 4LCTA 3SO8A 4F7AA 1IHBA 1N52A 4ILIA 1TNOA 3GYZA 1E7VA 1RZ4A 2P9LG 3TXNA 3L9TA 2H6GA 2OEWA 4GU5A 5AAOA 3O4ZA 4CRWA 4JC8A 3HG0D 3IV0A 1N95A 5EKQD 4F53A 3IEGA 2PNNA 2C0LA 3P2BA 4I2WA 3FTWA 4BX8A 3S7DA 3T8KA 5BUZA 3FH8A 4YDWA 3TGOA 4HVBA 2ZGDA 4FADA 2Y0BG 4NURA 3B7SA 2ZIRA 4GCNA 3FU6A 4WAFA 3SD5A 3L82A 3ISMC 2WXKA 3APDA 3JXJA 5AJLA 1HO8A 4BTAA 2XGOA 4GTVA 3BUAA 3QDNA 3UKRG 3UPVA 1BLXB 1JWGA 3E34A 4APOA 4GYWA 4CDMA 1KLXA 3NQPA 2ZGGA 3VLEA 2UY1B 5BPPA 4XZ4A 5D66A 4MLPA 5CEAA 1TEZA 4DI4A 3K9IA 4OVUA 3RJVA 2XGMA 3HVEB 1DVPA 4A1GA 3UXGA 4WWOA 4YDEA 1L5JA 2AWIA 4U63A 4YNDA 2ETBA 3D9HA 4I1AA 5EN5D 4ABNA 1MX4A 1KT1A 2R59A 1WDYA 1DCEA 3CHPA 3TWUA 1N54A 5LP0A 3ZXPA 2FULA 4U04A 1MJ0A 1HS6A 2HR2A 1N4RA 4NQ0A 4HRMB 2PQNA 1TN6A 2XZDG 3AAAC 4G26A 1DCQA 2WMOA 4BY6A 1Y6IA 1QZ2A 2IOSA 5ENPD 3T9KA 2R05A 4F1SA 3CVVA 4GZCA 2QY7A 5KCMA 4G8LA 4I6GA 5FIOA 2H6FA 3TWVA 2I9CA 3JUIA 3FDHA 4FJYA 4XKBA 1UN8A 4K0RA 2VGXA 1H6OA 4F1PA 3LJNA 5LX8A 1INZA 3PDNA 4EECA 1K1BA 4K5BA 1UN9A 5JHBA 4AVXA 1SZAA 2RKKA 1LD7A 2MHKA 2A5UA 1HG2A 4UQZA 3S7JA 5AQAA 1N94A 4UWFA 4YDYA 2E0IA 4GYYA 2IO3C 3E4BA 3QOUA 3Q4AB 2DIWA 3D9IA 3GZSA 1HU3A 2FBNA 3E32A 4LNUD 3HXDA 5ARFA 2WM9A 4GTSA 2NYJA 4AV7A 4Q96A 2FEZA 4K03A 1BD8A 3D9NA 3Q7FA 5JA4D 5EIBE 3E30A 1IYGA 2YHCA 2WXLA 4ACKA 3D9JA 4KZ0A 3FU3A 4HBDA 5AQ7A 3DBSA 3EIQC 1KT0A 2R5SA 4DJAA 1S63A 2DZOA 3FH5A 1OCOE 3ZHEB 3LY7A 4GZ6A 2MRIA 3OTNA 2QZAA 1FPPA 2CHWA 3FTXA 4KXKB 4CDNA 3LVRE 3MKRA 3Q9UC 5ENSD 3SY2A 3GW4A 5J90A 2VGXB 2I6HA 2Y69E 3C98A 2VGYA 4U8HA 1PC2A 5FTPA 3EU9A 2E2EA 3W9FA 3AS8A 2UY1A 3IBEA 3L6AA 3CGHA 3VLDA 4XI0A 4FHKA 3LY9A 2IO2C 4J8FA 1HG5A 4B8AA 1YMPA 1LF8A 4JEUA 1TN8A 4FJZA 2C2LA 3DXKG 4FLHA 4CGVA 4I1MA 1N4PA 4UWLA 5KJLA 4N2QA 5ITZF 4M7CA 2NXPA 4DX1A 4JXTA 5CCMA 2F0YA 3CQCB 3D3MA 3NOGD 1S64A 4L23A 1LD8A 3ASFA 1N9AA 3DSVA 4G23A 2XHEA 5JJ6A 3EHRA 5M72A 2VYIA 3GZ1A 2OOEA 3SFZA 5FINA 3QAQA 5FZSA 3ZYKA 3PEUB 3P1UA 2WXOA 3FUIA 4AXHA 4JEHA 1XGWA 4U96D 4BTBA 3RKVA 3AU5A 4HXIA 3ONKA 4LRZA 2KBXA 4UQYA 2F8YA 3ZYLA 5CHEE 4URKA 3JCKC 4P29A 3SFXA 4OVVA 1KZOA 5LOZA 1N4QA 1QBQA 3CVPA 3ZPJA 3APCA 5AIJA 5C1DA 5HI7A 4DX6D 2AXVA 4BFRA 1MZCA 3EDTB 4EPZA 3UT8A 4QQIA 4AJWA 3ULYA 3EHQA 4UWHA 4V3IA 1IQRA 4EBAG 3E33A 1JWFA 3W9GA 3FHEA 4Y6CA 2LSUA 3ASDA 5H7PA 3ASGA 4RQIA 3D9PA 4C0EA 3MGBA 3TWQA 3NB2A 2CHZA 4GMRA 3L22A 4YDOA 4DX2A 4GZ5A 5G05J 1E8ZA 4PDXA 1Z3YA 3ZEFA 2EIME 1WG0A 5FQ8A 3PUJA 3TWWA 3R7QA 5EX0A 3KSLA 1V54E 3CKBA 2WMNA 3HXBA 4H7YA 5CBNA 3FFLA 2P9SG 4N39A 2QC9A 2WXNA 5AENA 1NA0A 4GZ3A 4L1BA 5EILA 3IHVA 3IKOB 4E85A 4F6RD 4BESA 4ANWA 2V5FA 3FU5A 4U0ZA 2V4LA 4J6IA 3PZ4A 3G2UA 2OVFA 1SA4A 3Q7AA 5KJMA 1QYMA 2AXUA 4OAUC 4ILHB 4MBGA 3NOCD 4N3CA 3FTYA 3I5PA 4JHRA 4U8YD 4A1SA 3PH0C 4EZLA 2B6CA 4NIKA 3I4GA 3DWLG 3CHMA 3C3RA 4XX5A 5EYPF 3CVYA 2J49A 3LCAA 3TG5A 2DWZA 2GRMA 3NAWA 3B13A 4ANVA 1EF1C 2X3MA 3L54A 1YCSB 5EDSA 5B3SE 5FT9A 3C3QA 3FUEA 1H2TC 1TJCA 4GTTA 2ZXWE 1UW4B 3DSUA 3L16A 4GAAA 5FZQA 4HS2A 5KJNA 1NFIE 2LO6A 3N71A 1U3DA 1TNZA 3NBNB 1HX8A 2OEVA 2DZNA 4WNDA 4AP2A 2I1JA 3FUNA 2KZTA 2J09A 2EIKE 1OWNA 2GRRB 4HOQA 3AJIA 3RRMB 3TWSA 3CSFA 3TWRA 4GMLA 5BXUA 3TJPA 1FT1A 3ONLA 4WWNA 2XPZA 2KM4A 4BWRA 4G25A 3S2AA 5G55A 2AW6A 3S7BA 1JCSA 2A4ZA 2H6HA 5ENNA 2VSNA 4J8EA 4DX7D 3MX3A 2VGEA 2GRNB 4HLEA 3ABKE 5CCLA 1W3BA 4TUMA 5CRVA 3Q5MA 5CERB 2J08A 3DSTA 2I1KA 3ZVVA 4UUCA 2Y1LE 2VQ2A 3BU8A 5KJKA 4DLQA 3Q73A 2GRPB 4JA7A 4ATZD 1O1SA 4AEZC 2HE0A 3CK8A 4G1TA 2WXMA 5T4YA 2J07A 4LEUA 2GW1A 3Q79A 3RO3A 1A5EA 5KNGA 3QC1A 2KCVA 4J8SA 2KXPC 1OWOA 2FO7A 3FULA 3OAWA 5ENQD 4Q94A 1MX2A 3C5RA 4Q69A 3D9MA 2LSVA 5CMWA 3L17A 3O48A 3ABLE 1E8YA 2ILRA 3DSWA 2FI7A 3ZN3A 1O5MA 2BEDA 2LNIA 3R9MA 4UQXA 2DYSE 1WAO1 3PE4A 3JQ0A 4I43A 4EQFA 3LEWA 4ANUA 4DRXE 5ENTD 3QARA 2Y3AA 3DSXA 4A3TA 3JUEA 3AS4A 3ML9A 2P9PG 1H19A 2L0TB 2EQXA 1X5BA 1SW6A 4U0UA 3AG4E 2Q7FA 2L0IA 2YQ8A 3ASHA 4ANXA 2IONA 4CYMD 1FT2A 3ZNGA 4RLYA 2F37A 3CR3A 5EYLA 5JJTA 2RD0A 3QWWA 4XKCA 4GPKA 2FO1E 2JLBA 4MRUA 3LDZA 2F8XK 3PZ2A 5LCWJ 4I2ZA 1TJFA 2VSYA 2AVPA 4G2VA 2PZIA 1JCQA 4HOSA 3OXLA 3UIOC 3ZUVB 3UM3A 5JHAA 2XPIA 3RSEG 4KMOA 3CLJA 4YVQC 3TXMA 1U2VG 2X6KA 3CK9A 3UX4A 4L2LA 2KATA 5AARA 3Q49B 3HYMB 5AQBA 2OVBA 5ENRD 4GYOA 4FULA 1K3ZD 4GA0A 1FCHA 2WPVA 4CCAA 1BI7B 3SNXA 3FTZA 3MEKA 1DNPA 3F6QA 4NACA 2WXHA 1D9SA 1NI1A 2C0MA 4PH4B 4NRHB 3NZUA 2XCBA 4RSYA 3HXFA 3T8MA 3PE3A 4ME2A 1UJJA 3AG1E 3SBSA 2MYOA 1OCCE 3ML8A 3HXEA 3QNKA
chains in the Genus database with same CATH topology
2P9UG 1U2VG 3DWLG 4JD2G 3ULEG 2P9LG 2P9SG 2P9KG 2P9NG 3RSEG 2P9PG 3DXMG 1K8KG 2P9IG 3DXKG 3UKRG 1TYQG 4XEIG 3UKUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9U G;  1U2V G;  3DWL G;  4JD2 G;  3ULE G;  2P9L G;  2P9S G;  2P9K G;  2P9N G;  3RSE G;  2P9P G;  3DXM G;  1K8K G;  2P9I G;  3DXK G;  3UKR G;  1TYQ G;  4XEI G;  3UKU G; 
#chains in the Genus database with same CATH topology
 3AS5 A;  3FH7 A;  4O6F A;  2R17 C;  3LKU A;  2OND A;  4ACL A;  4K5C A;  2AXZ A;  1IXV A;  1P5Q A;  4PS8 A;  4CZ2 D;  4G8K A;  2DYR E;  4XIF A;  4UWK A;  1X81 A;  2WXR A;  1IHG A;  2XCC A;  1ZB1 A;  1UJK A;  2IY0 C;  4HNA D;  3LS8 A;  4UI9 K;  3SBT B;  2XS8 A;  2NSZ A;  3FUH A;  1JPL A;  3DPD A;  4JL0 A;  4UWG A;  3RO2 A;  3RU0 A;  3UT7 A;  4GTM A;  4LNG A;  1AWC B;  4KVO A;  4HFG A;  3BG1 B;  2PM6 A;  4GZD A;  3ULQ A;  5AJD A;  3PNL B;  4U95 D;  4GCO A;  2X6I A;  1EDU A;  4G24 A;  2JAB A;  4KYO B;  2BKG A;  3G2S A;  5C2Y A;  5B1A E;  3CVX A;  3UM1 A;  4OYS A;  2WXI A;  4RG9 A;  4N2S A;  2CHX A;  4JHJ A;  3RIB A;  2X6F A;  2RFA A;  4ZHB A;  4HB5 A;  3FU0 A;  5FZR A;  1NP7 A;  2WQ7 A;  2MOW A;  5EID A;  5A7D B;  3B95 A;  4L7T A;  4CEM A;  1KPS B;  3E37 A;  3BEE A;  3U3W A;  4GTO A;  2JEK A;  1H0A A;  3EUV A;  4I9E A;  3V2X A;  2H6I A;  1H2V C;  1N4S A;  3HXC A;  4XE0 A;  3CVW A;  3CV0 A;  3TL5 A;  4FA6 A;  4PUC A;  4BT8 A;  4I17 A;  4DI3 A;  5DBK A;  4CT4 A;  3AG3 E;  3KS2 A;  1ELR A;  1GW6 A;  1OT8 A;  1JCR A;  3UMV A;  4G11 A;  4XEI G;  2WXP A;  1ZU2 A;  2J9Q A;  3DPY A;  3J5Q B;  5CMY A;  1ELW A;  5ENO D;  2WQH A;  1Q2Z A;  3ZGQ A;  2XGS A;  5D0Q D;  1IQU A;  3FTV A;  2Y4U A;  2QFC A;  4FP7 A;  3MV3 B;  1G3N B;  4CGW A;  4GA1 A;  1K8K G;  2V4H C;  3MYV A;  4TRQ A;  4I6E A;  1OCZ E;  1NA3 A;  3HIZ A;  3LVQ E;  4BX9 A;  4XI9 A;  2EIL E;  4W9R A;  2L9B A;  2R03 A;  2V8S E;  3FY4 A;  3FWV A;  5D2M C;  3RK6 A;  3KAE A;  2LAI A;  2A5E A;  2HO1 A;  4J7W A;  2QYU A;  4FC8 A;  3CIA A;  1PY1 A;  2X6H A;  4HI9 A;  1H2U A;  4WWP A;  4EZJ A;  3ZYM A;  3QWV A;  3TWX A;  3ZHE A;  4YVO A;  2ETC A;  2P9U G;  3AU4 A;  1OWM A;  5CED B;  1BI8 B;  4TUU A;  4IRU A;  3CKC A;  2WB2 A;  2Y4T A;  3CHO A;  2L6B A;  2BTD A;  3MA5 A;  1VDY A;  3JQ1 A;  3SFY A;  1MQS A;  5BNW A;  1SA5 A;  4IUL A;  3MZL B;  5FJY A;  3B7T A;  4GTR A;  2R2L A;  5G04 C;  2XEH A;  2P58 C;  4BSX A;  3FUD A;  2EIN E;  3URZ A;  5DIZ A;  3ASN E;  3DRA A;  4IYP A;  2LAH A;  4J0U A;  1H6K A;  3PZD A;  1OWP A;  4A3V A;  5E76 A;  5BV1 A;  3MJW A;  3LYA A;  4DUI A;  2XQ0 A;  3Q9N C;  1E96 B;  2YHE A;  3FUM A;  1V55 E;  1ZBP A;  4FU3 A;  3UIN C;  4M3O A;  3LY8 A;  4BSZ B;  1LTX A;  4WNF A;  5HS0 A;  3G2V A;  3CVU A;  3X2Q E;  2VSO E;  3U66 A;  3DXM G;  1OY3 D;  4R7L A;  3SI5 A;  1Y8M A;  2BF0 X;  1KZP A;  3CVQ A;  4KT6 B;  3UKU G;  4F3V A;  4I1O B;  4CDR A;  2PM7 A;  4FLB A;  5IY5 E;  1EPU A;  4KZC A;  2YNQ A;  1FVH A;  3BG0 B;  5BXO A;  4GMJ A;  3G2T A;  4A63 B;  5KBA A;  2IU1 A;  4H7X A;  4RG6 A;  3T5V A;  2XRY A;  3KEZ A;  4N3B A;  4HRN A;  2P9K G;  3NF1 A;  3QJZ A;  4O60 A;  3UUX A;  3C72 A;  3V31 A;  4AIF A;  4JW1 A;  2RG8 A;  4RVB A;  4Z68 A;  3ESL A;  3B7B A;  3HVE A;  3RRU A;  3APF A;  4LER A;  1N0R A;  4FHJ A;  4U0S A;  3PNT B;  1E7U A;  4JD2 G;  4N3A A;  3MCX A;  3ESK A;  2GGF A;  4L9P A;  5G05 C;  5HRY A;  3UQ3 A;  5BT1 A;  1TNY A;  1N0Q A;  4J8D A;  2KC7 A;  1N11 A;  4WNE A;  2IJG X;  2R02 A;  3FEY A;  4C0M A;  2XZT G;  4Y6W A;  1A17 A;  4IN3 B;  4OAV B;  2XEV A;  3IXE A;  3Q75 A;  3Q15 A;  3HRA A;  3L13 A;  3LJ3 A;  5T3R A;  1HF8 A;  2DCP A;  4PS7 A;  2YIN A;  3I4R B;  2NC9 A;  4WUY A;  5LCW C;  2XEE A;  5KWD A;  4TXR A;  3ENE A;  3ZFW A;  2P9I G;  3V2O A;  4GB9 A;  4HI8 A;  5EX3 A;  4AY6 A;  1YYH A;  3FUJ A;  5HQ8 A;  3PVL A;  2LXL A;  2HYZ A;  1MYO A;  2WXF A;  4B0Z A;  1OWL A;  4EBA A;  1OCR E;  1H6P A;  1HZ4 A;  1Z3X A;  4JZY A;  3HHM A;  4B89 A;  4X8Q A;  1TR4 A;  4BEP A;  3FP3 A;  3R9A B;  3PS6 A;  2QYJ A;  4N5C A;  2DBA A;  2KCL A;  3UM0 A;  2IOL A;  3CQG B;  2M63 A;  4JB8 P;  1JUQ A;  2X38 A;  3EIJ A;  5FQ6 A;  2KCK A;  4QFV A;  4B8C B;  5J08 A;  2RFM A;  4C9B B;  5CEC B;  4DX5 D;  4TXP A;  5AN8 A;  2B0O E;  1OUV A;  1QQE A;  3LXU X;  1EYH A;  3S7F A;  5JJ7 A;  2V5Q C;  2VTB A;  3VTY A;  4TV3 A;  2LXM A;  4GA2 A;  1PAQ A;  4A55 A;  1WM5 A;  3IHY A;  1E8X A;  2CFU A;  3FTS A;  2HM8 A;  4D10 C;  1O1R A;  4HRL A;  3TWT A;  4DK5 A;  1IKN D;  3Q78 A;  3CHR A;  3U9W A;  1HFA A;  4HOT A;  5HKP A;  1HXI A;  3C3O A;  3ZYQ A;  4DLO A;  1QNF A;  3UIP C;  4JPS A;  4UI9 J;  2ZU6 B;  5CBO A;  3EU5 A;  3OXF A;  2ETA A;  3ULE G;  3QB2 A;  3QWP A;  3TAX A;  3VLF A;  3PZ3 A;  3L08 A;  4ILG A;  1AP7 A;  5ANR A;  2WXJ A;  5A6C A;  1ELK A;  1XNF A;  3JYS A;  2OV8 A;  4U8V D;  2ZIS A;  3DEP A;  4I9C A;  3B7R L;  2WQ6 A;  4O1P A;  1Z6T A;  4APF A;  2XEN A;  2J4B A;  1K1A A;  3ZXS A;  4O1O A;  3JXI A;  2KZT B;  2GRO B;  3V30 A;  2I2O A;  3FTU A;  3U64 A;  2CG2 A;  2PQR A;  2BUG A;  4B94 A;  3ZRH A;  4PS3 A;  4J8Y A;  4BER A;  3Q47 B;  2VTB B;  3CK7 A;  3EHM A;  1BU9 A;  3SGH A;  2V0P A;  2X6J A;  5KNH D;  4ATG A;  4MKT A;  4GPM A;  3FUF A;  3FEX A;  4AM9 A;  3CVL A;  3U4T A;  5FQ7 A;  4HLL A;  4KBQ A;  3ASO E;  3D9K A;  4ZFH A;  3PUK A;  1RW2 A;  3WXX A;  5BW8 C;  1SQM A;  4CT0 A;  3NZS A;  4MS6 A;  5ANL A;  2XS1 A;  5FQ4 A;  3UM2 A;  3B7U X;  2J8S D;  1MX6 A;  5LFA A;  1Z5S C;  3PZ1 A;  3ZKJ A;  3SF4 A;  3SZ7 A;  3KSQ A;  3HDX A;  3UT4 A;  1O1T A;  4B93 B;  3CHQ A;  3ZU7 B;  5ARG A;  2IEJ A;  1E90 A;  1S0P A;  2LUH A;  3R7R A;  3LPZ A;  3MKQ B;  3UTM A;  1UG3 A;  4N5Q A;  3CHS A;  2FF4 A;  4DPR A;  2WVI A;  4WNG A;  4U07 A;  3PRE A;  3OXG A;  4GTP A;  2WXG A;  1HE8 A;  4L2Y A;  3KEA A;  3SHF A;  3KD7 A;  2J4D A;  3TG4 A;  1HH8 A;  5D0O D;  2OCC E;  5CRU A;  4U7E B;  1S70 B;  4AOF A;  3PRZ A;  4JVS A;  1YA0 A;  3ZIM A;  4E6H A;  4KVM A;  1DC2 A;  5E75 A;  5BV0 A;  4LG6 A;  3CEQ A;  1BPO A;  1TNU A;  5G2N A;  2EIJ E;  5FWQ A;  3FUK A;  4I6J A;  2L6J A;  4BET A;  1B89 A;  1SZ9 A;  3GZ2 A;  5AYW D;  3EJN A;  4HOU A;  3D9L A;  2PL2 A;  4BT9 A;  2IQC A;  1TYQ G;  2VJ8 A;  2DVW A;  5T8I A;  3MKQ A;  3RRN B;  1TN7 A;  3SQV A;  4GTQ A;  4EZK A;  2WXQ A;  3CVN A;  3G2W A;  3CST A;  5B1B E;  3J5P A;  1NL4 A;  4HOR A;  2VSX E;  3RAU A;  4JA9 A;  3EHN A;  3I3N A;  3PEV B;  4JHK A;  4LUN U;  3ZW3 A;  3BQO A;  2BKK B;  1UOH A;  1D8D A;  1TNB A;  3DSS A;  3WG7 E;  2XRZ A;  2XPY A;  1U3C A;  2IF4 A;  1E8W A;  2UWJ G;  3T5X A;  2P9N G;  4HQD A;  3UI2 A;  2AJA A;  3VTX A;  2CFZ A;  4EHM A;  3QKY A;  5G04 J;  1D8E A;  5A23 A;  2P2C P;  5JMN D;  1SVX A;  4AY5 A;  3V79 K;  2CG3 A;  2GRL A;  1WY6 A;  4UI9 C;  4K5A B;  4LNB A;  3AG2 E;  3D9O A;  3ABM E;  4TXQ A;  3QK0 A;  3DEO A;  1MHQ A;  1FVF A;  4LSZ E;  3MV2 B;  4C48 B;  1NZN A;  1OXJ A;  5AQ9 A;  2GRQ B;  2IFU A;  4LCT A;  3SO8 A;  4F7A A;  1IHB A;  1N52 A;  4ILI A;  1TNO A;  3GYZ A;  1E7V A;  1RZ4 A;  2P9L G;  3TXN A;  3L9T A;  2H6G A;  2OEW A;  4GU5 A;  5AAO A;  3O4Z A;  4CRW A;  4JC8 A;  3HG0 D;  3IV0 A;  1N95 A;  5EKQ D;  4F53 A;  3IEG A;  2PNN A;  2C0L A;  3P2B A;  4I2W A;  3FTW A;  4BX8 A;  3S7D A;  3T8K A;  5BUZ A;  3FH8 A;  4YDW A;  3TGO A;  4HVB A;  2ZGD A;  4FAD A;  2Y0B G;  4NUR A;  3B7S A;  2ZIR A;  4GCN A;  3FU6 A;  4WAF A;  3SD5 A;  3L82 A;  3ISM C;  2WXK A;  3APD A;  3JXJ A;  5AJL A;  1HO8 A;  4BTA A;  2XGO A;  4GTV A;  3BUA A;  3QDN A;  3UKR G;  3UPV A;  1BLX B;  1JWG A;  3E34 A;  4APO A;  4GYW A;  4CDM A;  1KLX A;  3NQP A;  2ZGG A;  3VLE A;  2UY1 B;  5BPP A;  4XZ4 A;  5D66 A;  4MLP A;  5CEA A;  1TEZ A;  4DI4 A;  3K9I A;  4OVU A;  3RJV A;  2XGM A;  3HVE B;  1DVP A;  4A1G A;  3UXG A;  4WWO A;  4YDE A;  1L5J A;  2AWI A;  4U63 A;  4YND A;  2ETB A;  3D9H A;  4I1A A;  5EN5 D;  4ABN A;  1MX4 A;  1KT1 A;  2R59 A;  1WDY A;  1DCE A;  3CHP A;  3TWU A;  1N54 A;  5LP0 A;  3ZXP A;  2FUL A;  4U04 A;  1MJ0 A;  1HS6 A;  2HR2 A;  1N4R A;  4NQ0 A;  4HRM B;  2PQN A;  1TN6 A;  2XZD G;  3AAA C;  4G26 A;  1DCQ A;  2WMO A;  4BY6 A;  1Y6I A;  1QZ2 A;  2IOS A;  5ENP D;  3T9K A;  2R05 A;  4F1S A;  3CVV A;  4GZC A;  2QY7 A;  5KCM A;  4G8L A;  4I6G A;  5FIO A;  2H6F A;  3TWV A;  2I9C A;  3JUI A;  3FDH A;  4FJY A;  4XKB A;  1UN8 A;  4K0R A;  2VGX A;  1H6O A;  4F1P A;  3LJN A;  5LX8 A;  1INZ A;  3PDN A;  4EEC A;  1K1B A;  4K5B A;  1UN9 A;  5JHB A;  4AVX A;  1SZA A;  2RKK A;  1LD7 A;  2MHK A;  2A5U A;  1HG2 A;  4UQZ A;  3S7J A;  5AQA A;  1N94 A;  4UWF A;  4YDY A;  2E0I A;  4GYY A;  2IO3 C;  3E4B A;  3QOU A;  3Q4A B;  2DIW A;  3D9I A;  3GZS A;  1HU3 A;  2FBN A;  3E32 A;  4LNU D;  3HXD A;  5ARF A;  2WM9 A;  4GTS A;  2NYJ A;  4AV7 A;  4Q96 A;  2FEZ A;  4K03 A;  1BD8 A;  3D9N A;  3Q7F A;  5JA4 D;  5EIB E;  3E30 A;  1IYG A;  2YHC A;  2WXL A;  4ACK A;  3D9J A;  4KZ0 A;  3FU3 A;  4HBD A;  5AQ7 A;  3DBS A;  3EIQ C;  1KT0 A;  2R5S A;  4DJA A;  1S63 A;  2DZO A;  3FH5 A;  1OCO E;  3ZHE B;  3LY7 A;  4GZ6 A;  2MRI A;  3OTN A;  2QZA A;  1FPP A;  2CHW A;  3FTX A;  4KXK B;  4CDN A;  3LVR E;  3MKR A;  3Q9U C;  5ENS D;  3SY2 A;  3GW4 A;  5J90 A;  2VGX B;  2I6H A;  2Y69 E;  3C98 A;  2VGY A;  4U8H A;  1PC2 A;  5FTP A;  3EU9 A;  2E2E A;  3W9F A;  3AS8 A;  2UY1 A;  3IBE A;  3L6A A;  3CGH A;  3VLD A;  4XI0 A;  4FHK A;  3LY9 A;  2IO2 C;  4J8F A;  1HG5 A;  4B8A A;  1YMP A;  1LF8 A;  4JEU A;  1TN8 A;  4FJZ A;  2C2L A;  3DXK G;  4FLH A;  4CGV A;  4I1M A;  1N4P A;  4UWL A;  5KJL A;  4N2Q A;  5ITZ F;  4M7C A;  2NXP A;  4DX1 A;  4JXT A;  5CCM A;  2F0Y A;  3CQC B;  3D3M A;  3NOG D;  1S64 A;  4L23 A;  1LD8 A;  3ASF A;  1N9A A;  3DSV A;  4G23 A;  2XHE A;  5JJ6 A;  3EHR A;  5M72 A;  2VYI A;  3GZ1 A;  2OOE A;  3SFZ A;  5FIN A;  3QAQ A;  5FZS A;  3ZYK A;  3PEU B;  3P1U A;  2WXO A;  3FUI A;  4AXH A;  4JEH A;  1XGW A;  4U96 D;  4BTB A;  3RKV A;  3AU5 A;  4HXI A;  3ONK A;  4LRZ A;  2KBX A;  4UQY A;  2F8Y A;  3ZYL A;  5CHE E;  4URK A;  3JCK C;  4P29 A;  3SFX A;  4OVV A;  1KZO A;  5LOZ A;  1N4Q A;  1QBQ A;  3CVP A;  3ZPJ A;  3APC A;  5AIJ A;  5C1D A;  5HI7 A;  4DX6 D;  2AXV A;  4BFR A;  1MZC A;  3EDT B;  4EPZ A;  3UT8 A;  4QQI A;  4AJW A;  3ULY A;  3EHQ A;  4UWH A;  4V3I A;  1IQR A;  4EBA G;  3E33 A;  1JWF A;  3W9G A;  3FHE A;  4Y6C A;  2LSU A;  3ASD A;  5H7P A;  3ASG A;  4RQI A;  3D9P A;  4C0E A;  3MGB A;  3TWQ A;  3NB2 A;  2CHZ A;  4GMR A;  3L22 A;  4YDO A;  4DX2 A;  4GZ5 A;  5G05 J;  1E8Z A;  4PDX A;  1Z3Y A;  3ZEF A;  2EIM E;  1WG0 A;  5FQ8 A;  3PUJ A;  3TWW A;  3R7Q A;  5EX0 A;  3KSL A;  1V54 E;  3CKB A;  2WMN A;  3HXB A;  4H7Y A;  5CBN A;  3FFL A;  2P9S G;  4N39 A;  2QC9 A;  2WXN A;  5AEN A;  1NA0 A;  4GZ3 A;  4L1B A;  5EIL A;  3IHV A;  3IKO B;  4E85 A;  4F6R D;  4BES A;  4ANW A;  2V5F A;  3FU5 A;  4U0Z A;  2V4L A;  4J6I A;  3PZ4 A;  3G2U A;  2OVF A;  1SA4 A;  3Q7A A;  5KJM A;  1QYM A;  2AXU A;  4OAU C;  4ILH B;  4MBG A;  3NOC D;  4N3C A;  3FTY A;  3I5P A;  4JHR A;  4U8Y D;  4A1S A;  3PH0 C;  4EZL A;  2B6C A;  4NIK A;  3I4G A;  3DWL G;  3CHM A;  3C3R A;  4XX5 A;  5EYP F;  3CVY A;  2J49 A;  3LCA A;  3TG5 A;  2DWZ A;  2GRM A;  3NAW A;  3B13 A;  4ANV A;  1EF1 C;  2X3M A;  3L54 A;  1YCS B;  5EDS A;  5B3S E;  5FT9 A;  3C3Q A;  3FUE A;  1H2T C;  1TJC A;  4GTT A;  2ZXW E;  1UW4 B;  3DSU A;  3L16 A;  4GAA A;  5FZQ A;  4HS2 A;  5KJN A;  1NFI E;  2LO6 A;  3N71 A;  1U3D A;  1TNZ A;  3NBN B;  1HX8 A;  2OEV A;  2DZN A;  4WND A;  4AP2 A;  2I1J A;  3FUN A;  2KZT A;  2J09 A;  2EIK E;  1OWN A;  2GRR B;  4HOQ A;  3AJI A;  3RRM B;  3TWS A;  3CSF A;  3TWR A;  4GML A;  5BXU A;  3TJP A;  1FT1 A;  3ONL A;  4WWN A;  2XPZ A;  2KM4 A;  4BWR A;  4G25 A;  3S2A A;  5G55 A;  2AW6 A;  3S7B A;  1JCS A;  2A4Z A;  2H6H A;  5ENN A;  2VSN A;  4J8E A;  4DX7 D;  3MX3 A;  2VGE A;  2GRN B;  4HLE A;  3ABK E;  5CCL A;  1W3B A;  4TUM A;  5CRV A;  3Q5M A;  5CER B;  2J08 A;  3DST A;  2I1K A;  3ZVV A;  4UUC A;  2Y1L E;  2VQ2 A;  3BU8 A;  5KJK A;  4DLQ A;  3Q73 A;  2GRP B;  4JA7 A;  4ATZ D;  1O1S A;  4AEZ C;  2HE0 A;  3CK8 A;  4G1T A;  2WXM A;  5T4Y A;  2J07 A;  4LEU A;  2GW1 A;  3Q79 A;  3RO3 A;  1A5E A;  5KNG A;  3QC1 A;  2KCV A;  4J8S A;  2KXP C;  1OWO A;  2FO7 A;  3FUL A;  3OAW A;  5ENQ D;  4Q94 A;  1MX2 A;  3C5R A;  4Q69 A;  3D9M A;  2LSV A;  5CMW A;  3L17 A;  3O48 A;  3ABL E;  1E8Y A;  2ILR A;  3DSW A;  2FI7 A;  3ZN3 A;  1O5M A;  2BED A;  2LNI A;  3R9M A;  4UQX A;  2DYS E;  1WAO 1;  3PE4 A;  3JQ0 A;  4I43 A;  4EQF A;  3LEW A;  4ANU A;  4DRX E;  5ENT D;  3QAR A;  2Y3A A;  3DSX A;  4A3T A;  3JUE A;  3AS4 A;  3ML9 A;  2P9P G;  1H19 A;  2L0T B;  2EQX A;  1X5B A;  1SW6 A;  4U0U A;  3AG4 E;  2Q7F A;  2L0I A;  2YQ8 A;  3ASH A;  4ANX A;  2ION A;  4CYM D;  1FT2 A;  3ZNG A;  4RLY A;  2F37 A;  3CR3 A;  5EYL A;  5JJT A;  2RD0 A;  3QWW A;  4XKC A;  4GPK A;  2FO1 E;  2JLB A;  4MRU A;  3LDZ A;  2F8X K;  3PZ2 A;  5LCW J;  4I2Z A;  1TJF A;  2VSY A;  2AVP A;  4G2V A;  2PZI A;  1JCQ A;  4HOS A;  3OXL A;  3UIO C;  3ZUV B;  3UM3 A;  5JHA A;  2XPI A;  3RSE G;  4KMO A;  3CLJ A;  4YVQ C;  3TXM A;  1U2V G;  2X6K A;  3CK9 A;  3UX4 A;  4L2L A;  2KAT A;  5AAR A;  3Q49 B;  3HYM B;  5AQB A;  2OVB A;  5ENR D;  4GYO A;  4FUL A;  1K3Z D;  4GA0 A;  1FCH A;  2WPV A;  4CCA A;  1BI7 B;  3SNX A;  3FTZ A;  3MEK A;  1DNP A;  3F6Q A;  4NAC A;  2WXH A;  1D9S A;  1NI1 A;  2C0M A;  4PH4 B;  4NRH B;  3NZU A;  2XCB A;  4RSY A;  3HXF A;  3T8M A;  3PE3 A;  4ME2 A;  1UJJ A;  3AG1 E;  3SBS A;  2MYO A;  1OCC E;  3ML8 A;  3HXE A;  3QNK A; 
#chains in the Genus database with same CATH homology
 2P9U G;  1U2V G;  3DWL G;  4JD2 G;  3ULE G;  2P9L G;  2P9S G;  2P9K G;  2P9N G;  3RSE G;  2P9P G;  3DXM G;  1K8K G;  2P9I G;  3DXK G;  3UKR G;  1TYQ G;  4XEI G;  3UKU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...