2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
4JD2G 3ULEG 2P9LG 2P9KG 2P9UG 1U2VG 2P9SG 2P9PG 2P9NG 3DXKG 3DWLG 3RSEG 3UKRG 4XEIG 3DXMG 1K8KG 3UKUG 2P9IG 1TYQG
chains in the Genus database with same CATH superfamily
2J08A 5IY5E 2MHKA 2XCBA 3UT7A 4CGVA 4HLEA 5D2MC 1O1TA 3FEYA 1NA0A 4EZLA 2B6CA 4JA9A 2VGEA 5FZSA 1IQUA 1N94A 4GZCA 1A17A 4U0UA 4DX2A 2IQCA 3B13A 3AG1E 1E7UA 2WMOA 5LCWC 4UWLA 4LNGA 1JUQA 1S64A 5CERB 5T4YA 3LPZA 2AXZA 4DK5A 2LAIA 4E85A 3S7FA 4TXRA 2WXIA 4DJAA 4CDNA 2MRIA 1TNBA 2FBNA 4HI8A 1N54A 4PUCA 2XRZA 3QAQA 4HVBA 3LKUA 3QARA 4APOA 3ABLE 2AVPA 4CZ2D 4GCNA 4OYSA 2C2LA 2B0OE 4WNFA 4GU5A 3HXEA 2WM9A 3I4GA 2ETBA 5B3SE 4YDWA 3PZ3A 4NIKA 5CMYA 1KLXA 3RU0A 3IEGA 2R02A 2WXKA 4J8DA 4K5CA 3HXFA 4ILHB 4YVOA 4Q69A 2XQ0A 5CBNA 4HRLA 3MKQB 3T8MA 2XEHA 4FP7A 2GRMA 2EIKE 4YDEA 1SZAA 3ZXSA 4EHMA 2CFZA 1FVFA 4I6JA 4LNBA 4DLOA 1S63A 1V55E 4AVXA 3APDA 3LEWA 1MQSA 4W9RA 1SW6A 3R7RA 1E7VA 2Y0BG 4DUIA 3V2OA 2R5SA 1TNUA 3W9FA 4LCTA 4ANVA 5FT9A 3QWVA 2OCCE 1MHQA 5BXOA 2V4LA 1PY1A 3KS2A 4WWNA 3HVEB 4KYOB 4WWPA 2KCVA 1OT8A 3J5PA 2LSVA 3S2AA 3AJIA 1AP7A 4BETA 2P58C 2LO6A 3DEPA 2J09A 3QNKA 3MJWA 4K03A 4XKBA 1OWNA 4TXPA 1OCCE 2R17C 3FUIA 5AJDA 3CHMA 2MOWA 2OVFA 1O5MA 4JZYA 5JMND 3CKBA 3C5RA 3PH0C 2P9NG 1KZOA 4FU3A 4AOFA 3PVLA 3Q4AB 3SFYA 1GW6A 4APFA 2X38A 1O1RA 4BT9A 3PRZA 3C3RA 4HOUA 3G2TA 4B8AA 1S0PA 3L16A 1HZ4A 4A63B 1NI1A 4N2QA 1SA5A 2WXQA 1L5JA 1E96B 2XPYA 3CK8A 4GA1A 2NC9A 3UT4A 3ONKA 3QB2A 5KNHD 5KJLA 4FJZA 2AXUA 2XHEA 3CHRA 4JC8A 3DWLG 3QK0A 1OCOE 4N3BA 4I6EA 4K5AB 3GZSA 3ASNE 3TXMA 3FY4A 4EPZA 4C0MA 1INZA 3NOGD 5AN8A 4LEUA 2AXVA 3U9WA 2X6IA 3SY2A 3ZFWA 1W3BA 4MS6A 3FUKA 2QY7A 2KCLA 2DZNA 4J8FA 1SQMA 3TG5A 4FLBA 3P1UA 2R2LA 4BX9A 5KWDA 4DX7D 2WXMA 3PZ4A 3I4RB 3IV0A 1X81A 3K9IA 5LX8A 5EIBE 5B1AE 4FHKA 3T8KA 3APFA 4C9BB 2XS8A 2E2EA 3GYZA 3HXDA 4GZ3A 4XI0A 3AG2E 1N9AA 1DCQA 3BEEA 2CHXA 1WAO1 2BKGA 3BU8A 3UT8A 3C3QA 3MV2B 4MBGA 2J07A 3E32A 1FCHA 5KBAA 1DNPA 4YDYA 1N0RA 1NFIE 3UUXA 4GZ5A 2RD0A 4TXQA 4Y6CA 2VYIA 4A3TA 1LD8A 4L1BA 3CK9A 4NACA 3U64A 4N39A 4HOQA 4O1PA 1XGWA 3NOCD 2BKKB 1WM5A 2WXJA 2DWZA 5M72A 1MYOA 3FUEA 5JJ6A 3T5XA 4B93B 4WNGA 3TGOA 3T5VA 5AQBA 5FQ6A 1ZB1A 3E37A 3OXLA 2MYOA 4ILGA 3HXCA 1NL4A 5BUZA 1JWFA 4B89A 2ZGGA 3V31A 1IKND 4JEHA 2LXLA 3L54A 2P9PG 3ZHEA 3JYSA 5FWQA 4BTBA 3FTUA 4N2SA 3FU0A 3TWUA 4GTPA 2XPIA 3ZKJA 2L9BA 4ACKA 3NAWA 4I6GA 4Q96A 5FINA 3SFZA 2QC9A 5DBKA 1MX6A 5BV0A 4N5QA 4G1TA 5ENOD 2WXPA 1TNYA 4J8YA 5LFAA 3V79K 3Q15A 3Q79A 3SD5A 4PS8A 3ABME 4WAFA 1FVHA 4ME2A 2J9QA 3EJNA 5HRYA 3P2BA 3Q7FA 3HYMB 2H6HA 3LVRE 1QQEA 3FTYA 5ARFA 3NZUA 3RAUA 4K5BA 3AU4A 2VJ8A 4Q94A 5BW8C 3ZW3A 2XPZA 4GZ6A 1S70B 3DXMG 2LXMA 3C98A 3ZXPA 4RG9A 3B7RL 4GYWA 2IONA 5AIJA 4KVMA 4A1SA 3Q73A 3TWWA 4CT0A 2IU1A 3E30A 3LS8A 4WNDA 2V0PA 3QC1A 3TAXA 3Q78A 3ZU7B 4ANUA 5AQ7A 2WQ7A 3UPVA 1UJKA 2OEVA 4IRUA 2J4DA 1H6PA 2JABA 2WQ6A 2PQRA 3FUNA 2KM4A 3L13A 3PEUB 1U3CA 2ZGDA 1H2VC 2QFCA 4F6RD 4AY6A 3RJVA 4UWFA 1EDUA 4A1GA 5ANLA 3PZ1A 4PS3A 4U63A 2XGSA 3UIOC 4A3VA 3JCKC 3D9JA 3TL5A 3PNLB 1WG0A 3O48A 3I5PA 3PDNA 2JEKA 3B95A 3FUDA 5H7PA 4J8EA 3MYVA 3ENEA 4I1OB 2IOLA 2V4HC 3CHOA 4LRZA 4OVUA 1HF8A 3FTWA 4B94A 3L9TA 1N4SA 1JCSA 3LYAA 3FTSA 4CYMD 2UY1A 3CLJA 4QQIA 3FTVA 3CIAA 5HKPA 2DYSE 3TG4A 2LAHA 5KJKA 3UQ3A 3LCAA 3DXKG 2BTDA 3SGHA 4DLQA 1ELRA 5FQ4A 2IEJA 1WDYA 2A5UA 4UUCA 3MGBA 4BY6A 3NZSA 3CVXA 3QWPA 2BEDA 3E33A 4UWGA 5HQ8A 4TUUA 3S7BA 3Q9UC 3NQPA 4I2WA 5D0QD 5JHBA 3QWWA 5CHEE 4L9PA 3ZRHA 3UINC 4J7WA 2P2CP 4FA6A 2CFUA 2QZAA 1G3NB 3D9IA 1OWMA 3WXXA 2OOEA 5G2NA 2WXGA 1YA0A 3D9LA 3UM2A 3LXUX 4EZJA 2VSNA 3G2SA 4GTSA 3L22A 1MJ0A 2I2OA 4AIFA 2VGYA 4Y6WA 1UN9A 2GRNB 1OWOA 4H7YA 4L2LA 2WQHA 5AQ9A 3ZHEB 4ACLA 5LOZA 1U2VG 4AP2A 2FI7A 2NXPA 4HORA 3ASGA 2KZTA 3FU3A 1WY6A 2PNNA 4HOSA 1Z3YA 5CCMA 1QBQA 4HLLA 4N3AA 2FULA 2CG2A 1SVXA 5EYLA 2X6HA 1TEZA 5KJMA 3FH7A 2YNQA 5ARGA 2Y4UA 1ELKA 4HS2A 3VTYA 5KNGA 4F3VA 5ENRD 3IKOB 4AM9A 2P9SG 4GPKA 2C0MA 2WXHA 4JW1A 3EIQC 3LDZA 3FUJA 3IHYA 1KZPA 3F6QA 1YCSB 4LSZE 5BXUA 4XZ4A 2YHCA 3ZYMA 2CG3A 4UWHA 2HM8A 3O4ZA 5C2YA 3SQVA 1LD7A 4AEZC 3CVQA 3BG1B 3RRUA 2CHZA 3FDHA 3ZUVB 2FEZA 3BG0B 4RVBA 5ENPD 3ML9A 1FPPA 1V54E 4DI3A 4F1PA 3CQCB 1K3ZD 1PC2A 4GYOA 2ILRA 4I9EA 1D8DA 2Y4TA 3E34A 4URKA 1TN8A 2FO7A 3ASOE 3DEOA 1NZNA 5C1DA 3D9OA 5JJTA 2QYUA 2A4ZA 1N4RA 1H2TC 3D9PA 3DSXA 4EQFA 4YNDA 5B1BE 5CEAA 1E8WA 2WVIA 3RK6A 4U8YD 3SFXA 3DSSA 1TJFA 3ISMC 3ZN3A 3LY7A 2KBXA 2HR2A 1N4PA 4CDRA 4KZ0A 4JEUA 3ABKE 4FHJA 5ENTD 3N71A 2J8SD 4GTVA 4RLYA 3PZ2A 3EHRA 3RIBA 3R9MA 5AENA 4MLPA 2L0TB 1MX2A 5ENNA 4DRXE 1NP7A 2GRPB 1K8KG 2WXRA 4ILIA 3IBEA 4GTMA 3PEVB 1FT2A 4BEPA 5FTPA 3MEKA 2F0YA 2I1KA 4GTRA 4KXKB 2VSYA 3D9KA 4G25A 4OAVB 4L23A 1HE8A 5J90A 2OV8A 5FIOA 2H6GA 4I17A 5HI7A 4L2YA 2L6BA 3G2UA 3URZA 5BPPA 3B7UX 4TRQA 4GMJA 4GTQA 1EYHA 2UY1B 5JA4D 2J4BA 1MX4A 4LG6A 2F8YA 3QJZA 3LY8A 2VQ2A 3NB2A 1IQRA 4BFRA 3D3MA 3CK7A 4P29A 3HHMA 3T9KA 3EIJA 5ENQD 3TJPA 1Z5SC 4YDOA 3CHPA 3CV0A 2WPVA 3IXEA 4GPMA 4UI9J 4HQDA 3U3WA 2GROB 4NQ0A 2KCKA 4BWRA 4AY5A 1K1AA 4HB5A 3JQ1A 2C0LA 5D0OD 4GTOA 3Q47B 2AW6A 3FU6A 3R7QA 4IYPA 5AYWD 2XEEA 3KEZA 2P9LG 4ZHBA 4PH4B 3WG7E 4MRUA 4GB9A 4GMLA 4J6IA 3ASHA 2I9CA 3EHMA 3D9HA 1B89A 2XENA 1QZ2A 4JHKA 2X3MA 5BV1A 3OAWA 2KZTB 1H6KA 3JUEA 2RG8A 1EF1C 2RFMA 1D8EA 2KATA 2F37A 3PE4A 5EN5D 3Q75A 2LSUA 5EYPF 1UN8A 2IY0C 3U66A 2I1JA 3HDXA 3APCA 3EHNA 4I9CA 4KZCA 3RRMB 2X6KA 4PS7A 1BPOA 1TR4A 4OAUC 1K1BA 1HFAA 4G8LA 2V5QC 2P9IG 4ATZD 4HI9A 2XS1A 2DIWA 3PZDA 4EECA 2E0IA 4JB8P 3BQOA 4PDXA 4WNEA 2PZIA 3UI2A 1UG3A 3CVUA 4K0RA 4BTAA 4E6HA 3ULQA 4WUYA 3SO8A 3L08A 2WXNA 4UI9C 2YQ8A 1AWCB 3Q5MA 1HXIA 3AAAC 5JHAA 3S7DA 2ETCA 5ANRA 4JPSA 5EILA 1QNFA 3FHEA 2XCCA 4F1SA 3CHQA 3CVLA 4C48B 2EIJE 5FQ8A 3JQ0A 2P9KG 2GRLA 4BESA 1OCZE 4U8HA 3ML8A 4BX8A 3PUJA 1X5BA 5FJYA 4ANXA 4LUNU 2KXPC 1BI7B 1KPSB 3ZEFA 3SBTB 1DVPA 3UM3A 3DRAA 2PM6A 4CCAA 4FLHA 1PAQA 3FH8A 1IXVA 3ASFA 1KT0A 4MKTA 3LVQE 4BSZB 2BF0X 4G23A 4HFGA 3TWTA 1TN7A 2BUGA 4U8VD 1U3DA 5DIZA 2ZXWE 1OUVA 3CVPA 3DPYA 4N5CA 4UWKA 3DBSA 1HG5A 2IF4A 4FULA 4ATGA 2I6HA 3DSWA 4XEIG 2VSXE 2WB2A 2OVBA 1IYGA 5BNWA 3TWSA 3AG3E 4ZFHA 1LF8A 1HO8A 5AARA 4NRHB 2GRRB 4F7AA 4JHJA 1YYHA 3MX3A 1N4QA 3FFLA 3MZLB 3EUVA 3MV3B 4UQZA 2YINA 3DSVA 3R9AB 4GA0A 4RSYA 2M63A 4F53A 2V5FA 4FADA 1LTXA 3Q9NC 3FUFA 3ONLA 4CGWA 3UX4A 3L6AA 3UKRG 3ZGQA 3FUMA 4DX5D 2WXLA 2GW1A 5HS0A 1O1SA 3CVWA 4J8SA 4JL0A 4GTTA 2WXOA 2IO3C 4BSXA 4G24A 4HRNA 4XI9A 1TJCA 3FUHA 5A6CA 5ENSD 4N3CA 3B7BA 1OWPA 3MKRA 4LNUD 3L82A 2VGXA 3UKUG 1N0QA 5G55A 3PS6A 3SNXA 1ZU2A 1OXJA 5T8IA 3B7SA 3PNTB 2LUHA 2R03A 4AJWA 3SI5A 1Z6TA 2IJGX 5G05J 2H6FA 2XZTG 3GZ2A 4CT4A 1P5QA 4G11A 3ZYQA 4IN3B 3UM0A 1BI8B 3TXNA 4BT8A 3ULYA 3SZ7A 4UQXA 5EDSA 1OY3D 2X6JA 1BLXB 5EX3A 3HG0D 4O6FA 3UMVA 2XGOA 4O60A 3G2WA 2AJAA 2RKKA 3VLDA 3TWVA 3VLEA 4TV3A 3FU5A 3C72A 3ESKA 3RO2A 1FT1A 4JD2G 1JWGA 4XKCA 3BUAA 3W9GA 1H0AA 2RFAA 4UQYA 4FC8A 3KSQA 5EX0A 3U4TA 4HXIA 5CMWA 2FO1E 2XRYA 4Z68A 4DI4A 1TYQG 2PM7A 4QFVA 4M3OA 2ZISA 1E8YA 3KSLA 5BT1A 1JCRA 2IO2C 1H6OA 3D9MA 3FEXA 1XNFA 5LP0A 2R05A 4KBQA 4LERA 3PE3A 3AU5A 1UJJA 3D9NA 2VTBB 2DZOA 2DYRE 2Y3AA 3V2XA 2DBAA 4TUMA 1IHBA 2ONDA 4I1AA 3RKVA 4U07A 4ANWA 4R7LA 3KEAA 3PUKA 4FJYA 3RSEG 5T3RA 3NF1A 5G04J 3ESLA 2VSOE 2X6FA 3SBSA 5J08A 4D10C 1D9SA 4DX6D 4GYYA 3VLFA 3E4BA 4RQIA 3FP3A 1N52A 3CEQA 3B7TA 5G05C 3CGHA 1ELWA 3UXGA 4J0UA 3EDTB 4UI9K 3JXJA 2Y1LE 3EHQA 4C0EA 3CQGB 5CRVA 2V8SE 3JUIA 4U04A 3ZYLA 4EBAG 3EU5A 2ZU6B 3CVVA 4DPRA 3KD7A 4A55A 4B8CB 1OCRE 1E8ZA 3DPDA 4HOTA 3ZVVA 1DCEA 4AV7A 2WXFA 3I3NA 5FZRA 2YHEA 3ZPJA 1N11A 3FH5A 1DC2A 4U0ZA 1HG2A 3SF4A 1HH8A 5AAOA 1HS6A 4AXHA 3RRNB 3LJ3A 3OTNA 3UTMA 4L7TA 1RW2A 2XZDG 3J5QB 3ZYKA 5FQ7A 3QKYA 3G2VA 2F8XK 1QYMA 2L6JA 2EQXA 4U0SA 3V30A 2P9UG 1NA3A 4B0ZA 3FULA 2IOSA 1Y6IA 4NURA 2JLBA 2OEWA 4XX5A 4I2ZA 4V3IA 3OXGA 3ULEG 3FTZA 3LJNA 3GW4A 4ABNA 3FTXA 3ZNGA 1TNZA 2NYJA 4XE0A 1OWLA 3CHSA 5G04C 1Q2ZA 3IHVA 1TN6A 1VDYA 4X8QA 5AJLA 4KT6B 4EBAA 3TWXA 4O1OA 1E8XA 4WWOA 3Q49B 1H19A 3C3OA 4U95D 4XIFA 1SA4A 3MKQA 4HBDA 2Y69E 5A23A 5E75A 1UW4B 4JA7A 3EU9A 2VGXB 3ZIMA 3QDNA 4G8KA 4GMRA 5KCMA 2PQNA 1JPLA 4HNAD 3DSTA 2KC7A 2DVWA 5FZQA 2XEVA 4CRWA 4JHRA 3CSTA 1TNOA 5AQAA 2NSZA 4I43A 3CR3A 4H7XA 4I1MA 1N95A 1JCQA 4CDMA 2L0IA 5CECB 4U96D 3PREA 2XGMA 4JVSA 4RG6A 4HRMB 2CHWA 3GZ1A 4IULA 2FF4A 5CEDB 1YMPA 5CBOA 2GRQB 5KJNA 2H6IA 4EZKA 2A5EA 3JXIA 3L17A 2EILE 3HVEA 3CKCA 2LNIA 3DSUA 2DCPA 3X2QE 1HX8A 3UM1A 5D66A 1EPUA 3UIPC 5CRUA 1Y8MA 1UOHA 4GZDA 3S7JA 2IFUA 5LCWJ 2AWIA 1KT1A 2HO1A 2UWJG 2ZIRA 3FWVA 2HE0A 3Q7AA 3SHFA 2VTBA 3AS8A 4KMOA 3CVYA 1H2UA 3QOUA 2Q7FA 3MA5A 2J49A 3VTXA 3HXBA 2QYJA 4M7CA 4CEMA 3LY9A 2HYZA 4BERA 3TWRA 3CVNA 4GCOA 5E76A 4KVOA 4GA2A 4YVQC 4G2VA 1BD8A 2R59A 3AS4A 3TWQA 3AG4E 3NBNB 5A7DB 2EINE 2PL2A 3OXFA 2EIME 5EKQD 3CSFA 5CCLA 1ZBPA 4U7EB 1Z3XA 4OVVA 1HU3A 4DX1A 5ITZF 3HRAA 1IHGA 4JXTA 5EIDA 3MCXA 2ETAA 3HIZA 1SZ9A 3KAEA 2WMNA 3ASDA 4G26A 1E90A 1RZ4A 1BU9A 3AS5A 1A5EA 3RO3A 2GGFA 4GAAA 1MZCA 5JJ7A
chains in the Genus database with same CATH topology
4JD2G 3ULEG 2P9LG 2P9KG 2P9UG 1U2VG 2P9SG 2P9PG 2P9NG 3DXKG 3DWLG 3RSEG 3UKRG 4XEIG 3DXMG 1K8KG 3UKUG 2P9IG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 G;  3ULE G;  2P9L G;  2P9K G;  2P9U G;  1U2V G;  2P9S G;  2P9P G;  2P9N G;  3DXK G;  3DWL G;  3RSE G;  3UKR G;  4XEI G;  3DXM G;  1K8K G;  3UKU G;  2P9I G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 2J08 A;  5IY5 E;  2MHK A;  2XCB A;  3UT7 A;  4CGV A;  4HLE A;  5D2M C;  1O1T A;  3FEY A;  1NA0 A;  4EZL A;  2B6C A;  4JA9 A;  2VGE A;  5FZS A;  1IQU A;  1N94 A;  4GZC A;  1A17 A;  4U0U A;  4DX2 A;  2IQC A;  3B13 A;  3AG1 E;  1E7U A;  2WMO A;  5LCW C;  4UWL A;  4LNG A;  1JUQ A;  1S64 A;  5CER B;  5T4Y A;  3LPZ A;  2AXZ A;  4DK5 A;  2LAI A;  4E85 A;  3S7F A;  4TXR A;  2WXI A;  4DJA A;  4CDN A;  2MRI A;  1TNB A;  2FBN A;  4HI8 A;  1N54 A;  4PUC A;  2XRZ A;  3QAQ A;  4HVB A;  3LKU A;  3QAR A;  4APO A;  3ABL E;  2AVP A;  4CZ2 D;  4GCN A;  4OYS A;  2C2L A;  2B0O E;  4WNF A;  4GU5 A;  3HXE A;  2WM9 A;  3I4G A;  2ETB A;  5B3S E;  4YDW A;  3PZ3 A;  4NIK A;  5CMY A;  1KLX A;  3RU0 A;  3IEG A;  2R02 A;  2WXK A;  4J8D A;  4K5C A;  3HXF A;  4ILH B;  4YVO A;  4Q69 A;  2XQ0 A;  5CBN A;  4HRL A;  3MKQ B;  3T8M A;  2XEH A;  4FP7 A;  2GRM A;  2EIK E;  4YDE A;  1SZA A;  3ZXS A;  4EHM A;  2CFZ A;  1FVF A;  4I6J A;  4LNB A;  4DLO A;  1S63 A;  1V55 E;  4AVX A;  3APD A;  3LEW A;  1MQS A;  4W9R A;  1SW6 A;  3R7R A;  1E7V A;  2Y0B G;  4DUI A;  3V2O A;  2R5S A;  1TNU A;  3W9F A;  4LCT A;  4ANV A;  5FT9 A;  3QWV A;  2OCC E;  1MHQ A;  5BXO A;  2V4L A;  1PY1 A;  3KS2 A;  4WWN A;  3HVE B;  4KYO B;  4WWP A;  2KCV A;  1OT8 A;  3J5P A;  2LSV A;  3S2A A;  3AJI A;  1AP7 A;  4BET A;  2P58 C;  2LO6 A;  3DEP A;  2J09 A;  3QNK A;  3MJW A;  4K03 A;  4XKB A;  1OWN A;  4TXP A;  1OCC E;  2R17 C;  3FUI A;  5AJD A;  3CHM A;  2MOW A;  2OVF A;  1O5M A;  4JZY A;  5JMN D;  3CKB A;  3C5R A;  3PH0 C;  2P9N G;  1KZO A;  4FU3 A;  4AOF A;  3PVL A;  3Q4A B;  3SFY A;  1GW6 A;  4APF A;  2X38 A;  1O1R A;  4BT9 A;  3PRZ A;  3C3R A;  4HOU A;  3G2T A;  4B8A A;  1S0P A;  3L16 A;  1HZ4 A;  4A63 B;  1NI1 A;  4N2Q A;  1SA5 A;  2WXQ A;  1L5J A;  1E96 B;  2XPY A;  3CK8 A;  4GA1 A;  2NC9 A;  3UT4 A;  3ONK A;  3QB2 A;  5KNH D;  5KJL A;  4FJZ A;  2AXU A;  2XHE A;  3CHR A;  4JC8 A;  3DWL G;  3QK0 A;  1OCO E;  4N3B A;  4I6E A;  4K5A B;  3GZS A;  3ASN E;  3TXM A;  3FY4 A;  4EPZ A;  4C0M A;  1INZ A;  3NOG D;  5AN8 A;  4LEU A;  2AXV A;  3U9W A;  2X6I A;  3SY2 A;  3ZFW A;  1W3B A;  4MS6 A;  3FUK A;  2QY7 A;  2KCL A;  2DZN A;  4J8F A;  1SQM A;  3TG5 A;  4FLB A;  3P1U A;  2R2L A;  4BX9 A;  5KWD A;  4DX7 D;  2WXM A;  3PZ4 A;  3I4R B;  3IV0 A;  1X81 A;  3K9I A;  5LX8 A;  5EIB E;  5B1A E;  4FHK A;  3T8K A;  3APF A;  4C9B B;  2XS8 A;  2E2E A;  3GYZ A;  3HXD A;  4GZ3 A;  4XI0 A;  3AG2 E;  1N9A A;  1DCQ A;  3BEE A;  2CHX A;  1WAO 1;  2BKG A;  3BU8 A;  3UT8 A;  3C3Q A;  3MV2 B;  4MBG A;  2J07 A;  3E32 A;  1FCH A;  5KBA A;  1DNP A;  4YDY A;  1N0R A;  1NFI E;  3UUX A;  4GZ5 A;  2RD0 A;  4TXQ A;  4Y6C A;  2VYI A;  4A3T A;  1LD8 A;  4L1B A;  3CK9 A;  4NAC A;  3U64 A;  4N39 A;  4HOQ A;  4O1P A;  1XGW A;  3NOC D;  2BKK B;  1WM5 A;  2WXJ A;  2DWZ A;  5M72 A;  1MYO A;  3FUE A;  5JJ6 A;  3T5X A;  4B93 B;  4WNG A;  3TGO A;  3T5V A;  5AQB A;  5FQ6 A;  1ZB1 A;  3E37 A;  3OXL A;  2MYO A;  4ILG A;  3HXC A;  1NL4 A;  5BUZ A;  1JWF A;  4B89 A;  2ZGG A;  3V31 A;  1IKN D;  4JEH A;  2LXL A;  3L54 A;  2P9P G;  3ZHE A;  3JYS A;  5FWQ A;  4BTB A;  3FTU A;  4N2S A;  3FU0 A;  3TWU A;  4GTP A;  2XPI A;  3ZKJ A;  2L9B A;  4ACK A;  3NAW A;  4I6G A;  4Q96 A;  5FIN A;  3SFZ A;  2QC9 A;  5DBK A;  1MX6 A;  5BV0 A;  4N5Q A;  4G1T A;  5ENO D;  2WXP A;  1TNY A;  4J8Y A;  5LFA A;  3V79 K;  3Q15 A;  3Q79 A;  3SD5 A;  4PS8 A;  3ABM E;  4WAF A;  1FVH A;  4ME2 A;  2J9Q A;  3EJN A;  5HRY A;  3P2B A;  3Q7F A;  3HYM B;  2H6H A;  3LVR E;  1QQE A;  3FTY A;  5ARF A;  3NZU A;  3RAU A;  4K5B A;  3AU4 A;  2VJ8 A;  4Q94 A;  5BW8 C;  3ZW3 A;  2XPZ A;  4GZ6 A;  1S70 B;  3DXM G;  2LXM A;  3C98 A;  3ZXP A;  4RG9 A;  3B7R L;  4GYW A;  2ION A;  5AIJ A;  4KVM A;  4A1S A;  3Q73 A;  3TWW A;  4CT0 A;  2IU1 A;  3E30 A;  3LS8 A;  4WND A;  2V0P A;  3QC1 A;  3TAX A;  3Q78 A;  3ZU7 B;  4ANU A;  5AQ7 A;  2WQ7 A;  3UPV A;  1UJK A;  2OEV A;  4IRU A;  2J4D A;  1H6P A;  2JAB A;  2WQ6 A;  2PQR A;  3FUN A;  2KM4 A;  3L13 A;  3PEU B;  1U3C A;  2ZGD A;  1H2V C;  2QFC A;  4F6R D;  4AY6 A;  3RJV A;  4UWF A;  1EDU A;  4A1G A;  5ANL A;  3PZ1 A;  4PS3 A;  4U63 A;  2XGS A;  3UIO C;  4A3V A;  3JCK C;  3D9J A;  3TL5 A;  3PNL B;  1WG0 A;  3O48 A;  3I5P A;  3PDN A;  2JEK A;  3B95 A;  3FUD A;  5H7P A;  4J8E A;  3MYV A;  3ENE A;  4I1O B;  2IOL A;  2V4H C;  3CHO A;  4LRZ A;  4OVU A;  1HF8 A;  3FTW A;  4B94 A;  3L9T A;  1N4S A;  1JCS A;  3LYA A;  3FTS A;  4CYM D;  2UY1 A;  3CLJ A;  4QQI A;  3FTV A;  3CIA A;  5HKP A;  2DYS E;  3TG4 A;  2LAH A;  5KJK A;  3UQ3 A;  3LCA A;  3DXK G;  2BTD A;  3SGH A;  4DLQ A;  1ELR A;  5FQ4 A;  2IEJ A;  1WDY A;  2A5U A;  4UUC A;  3MGB A;  4BY6 A;  3NZS A;  3CVX A;  3QWP A;  2BED A;  3E33 A;  4UWG A;  5HQ8 A;  4TUU A;  3S7B A;  3Q9U C;  3NQP A;  4I2W A;  5D0Q D;  5JHB A;  3QWW A;  5CHE E;  4L9P A;  3ZRH A;  3UIN C;  4J7W A;  2P2C P;  4FA6 A;  2CFU A;  2QZA A;  1G3N B;  3D9I A;  1OWM A;  3WXX A;  2OOE A;  5G2N A;  2WXG A;  1YA0 A;  3D9L A;  3UM2 A;  3LXU X;  4EZJ A;  2VSN A;  3G2S A;  4GTS A;  3L22 A;  1MJ0 A;  2I2O A;  4AIF A;  2VGY A;  4Y6W A;  1UN9 A;  2GRN B;  1OWO A;  4H7Y A;  4L2L A;  2WQH A;  5AQ9 A;  3ZHE B;  4ACL A;  5LOZ A;  1U2V G;  4AP2 A;  2FI7 A;  2NXP A;  4HOR A;  3ASG A;  2KZT A;  3FU3 A;  1WY6 A;  2PNN A;  4HOS A;  1Z3Y A;  5CCM A;  1QBQ A;  4HLL A;  4N3A A;  2FUL A;  2CG2 A;  1SVX A;  5EYL A;  2X6H A;  1TEZ A;  5KJM A;  3FH7 A;  2YNQ A;  5ARG A;  2Y4U A;  1ELK A;  4HS2 A;  3VTY A;  5KNG A;  4F3V A;  5ENR D;  3IKO B;  4AM9 A;  2P9S G;  4GPK A;  2C0M A;  2WXH A;  4JW1 A;  3EIQ C;  3LDZ A;  3FUJ A;  3IHY A;  1KZP A;  3F6Q A;  1YCS B;  4LSZ E;  5BXU A;  4XZ4 A;  2YHC A;  3ZYM A;  2CG3 A;  4UWH A;  2HM8 A;  3O4Z A;  5C2Y A;  3SQV A;  1LD7 A;  4AEZ C;  3CVQ A;  3BG1 B;  3RRU A;  2CHZ A;  3FDH A;  3ZUV B;  2FEZ A;  3BG0 B;  4RVB A;  5ENP D;  3ML9 A;  1FPP A;  1V54 E;  4DI3 A;  4F1P A;  3CQC B;  1K3Z D;  1PC2 A;  4GYO A;  2ILR A;  4I9E A;  1D8D A;  2Y4T A;  3E34 A;  4URK A;  1TN8 A;  2FO7 A;  3ASO E;  3DEO A;  1NZN A;  5C1D A;  3D9O A;  5JJT A;  2QYU A;  2A4Z A;  1N4R A;  1H2T C;  3D9P A;  3DSX A;  4EQF A;  4YND A;  5B1B E;  5CEA A;  1E8W A;  2WVI A;  3RK6 A;  4U8Y D;  3SFX A;  3DSS A;  1TJF A;  3ISM C;  3ZN3 A;  3LY7 A;  2KBX A;  2HR2 A;  1N4P A;  4CDR A;  4KZ0 A;  4JEU A;  3ABK E;  4FHJ A;  5ENT D;  3N71 A;  2J8S D;  4GTV A;  4RLY A;  3PZ2 A;  3EHR A;  3RIB A;  3R9M A;  5AEN A;  4MLP A;  2L0T B;  1MX2 A;  5ENN A;  4DRX E;  1NP7 A;  2GRP B;  1K8K G;  2WXR A;  4ILI A;  3IBE A;  4GTM A;  3PEV B;  1FT2 A;  4BEP A;  5FTP A;  3MEK A;  2F0Y A;  2I1K A;  4GTR A;  4KXK B;  2VSY A;  3D9K A;  4G25 A;  4OAV B;  4L23 A;  1HE8 A;  5J90 A;  2OV8 A;  5FIO A;  2H6G A;  4I17 A;  5HI7 A;  4L2Y A;  2L6B A;  3G2U A;  3URZ A;  5BPP A;  3B7U X;  4TRQ A;  4GMJ A;  4GTQ A;  1EYH A;  2UY1 B;  5JA4 D;  2J4B A;  1MX4 A;  4LG6 A;  2F8Y A;  3QJZ A;  3LY8 A;  2VQ2 A;  3NB2 A;  1IQR A;  4BFR A;  3D3M A;  3CK7 A;  4P29 A;  3HHM A;  3T9K A;  3EIJ A;  5ENQ D;  3TJP A;  1Z5S C;  4YDO A;  3CHP A;  3CV0 A;  2WPV A;  3IXE A;  4GPM A;  4UI9 J;  4HQD A;  3U3W A;  2GRO B;  4NQ0 A;  2KCK A;  4BWR A;  4AY5 A;  1K1A A;  4HB5 A;  3JQ1 A;  2C0L A;  5D0O D;  4GTO A;  3Q47 B;  2AW6 A;  3FU6 A;  3R7Q A;  4IYP A;  5AYW D;  2XEE A;  3KEZ A;  2P9L G;  4ZHB A;  4PH4 B;  3WG7 E;  4MRU A;  4GB9 A;  4GML A;  4J6I A;  3ASH A;  2I9C A;  3EHM A;  3D9H A;  1B89 A;  2XEN A;  1QZ2 A;  4JHK A;  2X3M A;  5BV1 A;  3OAW A;  2KZT B;  1H6K A;  3JUE A;  2RG8 A;  1EF1 C;  2RFM A;  1D8E A;  2KAT A;  2F37 A;  3PE4 A;  5EN5 D;  3Q75 A;  2LSU A;  5EYP F;  1UN8 A;  2IY0 C;  3U66 A;  2I1J A;  3HDX A;  3APC A;  3EHN A;  4I9C A;  4KZC A;  3RRM B;  2X6K A;  4PS7 A;  1BPO A;  1TR4 A;  4OAU C;  1K1B A;  1HFA A;  4G8L A;  2V5Q C;  2P9I G;  4ATZ D;  4HI9 A;  2XS1 A;  2DIW A;  3PZD A;  4EEC A;  2E0I A;  4JB8 P;  3BQO A;  4PDX A;  4WNE A;  2PZI A;  3UI2 A;  1UG3 A;  3CVU A;  4K0R A;  4BTA A;  4E6H A;  3ULQ A;  4WUY A;  3SO8 A;  3L08 A;  2WXN A;  4UI9 C;  2YQ8 A;  1AWC B;  3Q5M A;  1HXI A;  3AAA C;  5JHA A;  3S7D A;  2ETC A;  5ANR A;  4JPS A;  5EIL A;  1QNF A;  3FHE A;  2XCC A;  4F1S A;  3CHQ A;  3CVL A;  4C48 B;  2EIJ E;  5FQ8 A;  3JQ0 A;  2P9K G;  2GRL A;  4BES A;  1OCZ E;  4U8H A;  3ML8 A;  4BX8 A;  3PUJ A;  1X5B A;  5FJY A;  4ANX A;  4LUN U;  2KXP C;  1BI7 B;  1KPS B;  3ZEF A;  3SBT B;  1DVP A;  3UM3 A;  3DRA A;  2PM6 A;  4CCA A;  4FLH A;  1PAQ A;  3FH8 A;  1IXV A;  3ASF A;  1KT0 A;  4MKT A;  3LVQ E;  4BSZ B;  2BF0 X;  4G23 A;  4HFG A;  3TWT A;  1TN7 A;  2BUG A;  4U8V D;  1U3D A;  5DIZ A;  2ZXW E;  1OUV A;  3CVP A;  3DPY A;  4N5C A;  4UWK A;  3DBS A;  1HG5 A;  2IF4 A;  4FUL A;  4ATG A;  2I6H A;  3DSW A;  4XEI G;  2VSX E;  2WB2 A;  2OVB A;  1IYG A;  5BNW A;  3TWS A;  3AG3 E;  4ZFH A;  1LF8 A;  1HO8 A;  5AAR A;  4NRH B;  2GRR B;  4F7A A;  4JHJ A;  1YYH A;  3MX3 A;  1N4Q A;  3FFL A;  3MZL B;  3EUV A;  3MV3 B;  4UQZ A;  2YIN A;  3DSV A;  3R9A B;  4GA0 A;  4RSY A;  2M63 A;  4F53 A;  2V5F A;  4FAD A;  1LTX A;  3Q9N C;  3FUF A;  3ONL A;  4CGW A;  3UX4 A;  3L6A A;  3UKR G;  3ZGQ A;  3FUM A;  4DX5 D;  2WXL A;  2GW1 A;  5HS0 A;  1O1S A;  3CVW A;  4J8S A;  4JL0 A;  4GTT A;  2WXO A;  2IO3 C;  4BSX A;  4G24 A;  4HRN A;  4XI9 A;  1TJC A;  3FUH A;  5A6C A;  5ENS D;  4N3C A;  3B7B A;  1OWP A;  3MKR A;  4LNU D;  3L82 A;  2VGX A;  3UKU G;  1N0Q A;  5G55 A;  3PS6 A;  3SNX A;  1ZU2 A;  1OXJ A;  5T8I A;  3B7S A;  3PNT B;  2LUH A;  2R03 A;  4AJW A;  3SI5 A;  1Z6T A;  2IJG X;  5G05 J;  2H6F A;  2XZT G;  3GZ2 A;  4CT4 A;  1P5Q A;  4G11 A;  3ZYQ A;  4IN3 B;  3UM0 A;  1BI8 B;  3TXN A;  4BT8 A;  3ULY A;  3SZ7 A;  4UQX A;  5EDS A;  1OY3 D;  2X6J A;  1BLX B;  5EX3 A;  3HG0 D;  4O6F A;  3UMV A;  2XGO A;  4O60 A;  3G2W A;  2AJA A;  2RKK A;  3VLD A;  3TWV A;  3VLE A;  4TV3 A;  3FU5 A;  3C72 A;  3ESK A;  3RO2 A;  1FT1 A;  4JD2 G;  1JWG A;  4XKC A;  3BUA A;  3W9G A;  1H0A A;  2RFA A;  4UQY A;  4FC8 A;  3KSQ A;  5EX0 A;  3U4T A;  4HXI A;  5CMW A;  2FO1 E;  2XRY A;  4Z68 A;  4DI4 A;  1TYQ G;  2PM7 A;  4QFV A;  4M3O A;  2ZIS A;  1E8Y A;  3KSL A;  5BT1 A;  1JCR A;  2IO2 C;  1H6O A;  3D9M A;  3FEX A;  1XNF A;  5LP0 A;  2R05 A;  4KBQ A;  4LER A;  3PE3 A;  3AU5 A;  1UJJ A;  3D9N A;  2VTB B;  2DZO A;  2DYR E;  2Y3A A;  3V2X A;  2DBA A;  4TUM A;  1IHB A;  2OND A;  4I1A A;  3RKV A;  4U07 A;  4ANW A;  4R7L A;  3KEA A;  3PUK A;  4FJY A;  3RSE G;  5T3R A;  3NF1 A;  5G04 J;  3ESL A;  2VSO E;  2X6F A;  3SBS A;  5J08 A;  4D10 C;  1D9S A;  4DX6 D;  4GYY A;  3VLF A;  3E4B A;  4RQI A;  3FP3 A;  1N52 A;  3CEQ A;  3B7T A;  5G05 C;  3CGH A;  1ELW A;  3UXG A;  4J0U A;  3EDT B;  4UI9 K;  3JXJ A;  2Y1L E;  3EHQ A;  4C0E A;  3CQG B;  5CRV A;  2V8S E;  3JUI A;  4U04 A;  3ZYL A;  4EBA G;  3EU5 A;  2ZU6 B;  3CVV A;  4DPR A;  3KD7 A;  4A55 A;  4B8C B;  1OCR E;  1E8Z A;  3DPD A;  4HOT A;  3ZVV A;  1DCE A;  4AV7 A;  2WXF A;  3I3N A;  5FZR A;  2YHE A;  3ZPJ A;  1N11 A;  3FH5 A;  1DC2 A;  4U0Z A;  1HG2 A;  3SF4 A;  1HH8 A;  5AAO A;  1HS6 A;  4AXH A;  3RRN B;  3LJ3 A;  3OTN A;  3UTM A;  4L7T A;  1RW2 A;  2XZD G;  3J5Q B;  3ZYK A;  5FQ7 A;  3QKY A;  3G2V A;  2F8X K;  1QYM A;  2L6J A;  2EQX A;  4U0S A;  3V30 A;  2P9U G;  1NA3 A;  4B0Z A;  3FUL A;  2IOS A;  1Y6I A;  4NUR A;  2JLB A;  2OEW A;  4XX5 A;  4I2Z A;  4V3I A;  3OXG A;  3ULE G;  3FTZ A;  3LJN A;  3GW4 A;  4ABN A;  3FTX A;  3ZNG A;  1TNZ A;  2NYJ A;  4XE0 A;  1OWL A;  3CHS A;  5G04 C;  1Q2Z A;  3IHV A;  1TN6 A;  1VDY A;  4X8Q A;  5AJL A;  4KT6 B;  4EBA A;  3TWX A;  4O1O A;  1E8X A;  4WWO A;  3Q49 B;  1H19 A;  3C3O A;  4U95 D;  4XIF A;  1SA4 A;  3MKQ A;  4HBD A;  2Y69 E;  5A23 A;  5E75 A;  1UW4 B;  4JA7 A;  3EU9 A;  2VGX B;  3ZIM A;  3QDN A;  4G8K A;  4GMR A;  5KCM A;  2PQN A;  1JPL A;  4HNA D;  3DST A;  2KC7 A;  2DVW A;  5FZQ A;  2XEV A;  4CRW A;  4JHR A;  3CST A;  1TNO A;  5AQA A;  2NSZ A;  4I43 A;  3CR3 A;  4H7X A;  4I1M A;  1N95 A;  1JCQ A;  4CDM A;  2L0I A;  5CEC B;  4U96 D;  3PRE A;  2XGM A;  4JVS A;  4RG6 A;  4HRM B;  2CHW A;  3GZ1 A;  4IUL A;  2FF4 A;  5CED B;  1YMP A;  5CBO A;  2GRQ B;  5KJN A;  2H6I A;  4EZK A;  2A5E A;  3JXI A;  3L17 A;  2EIL E;  3HVE A;  3CKC A;  2LNI A;  3DSU A;  2DCP A;  3X2Q E;  1HX8 A;  3UM1 A;  5D66 A;  1EPU A;  3UIP C;  5CRU A;  1Y8M A;  1UOH A;  4GZD A;  3S7J A;  2IFU A;  5LCW J;  2AWI A;  1KT1 A;  2HO1 A;  2UWJ G;  2ZIR A;  3FWV A;  2HE0 A;  3Q7A A;  3SHF A;  2VTB A;  3AS8 A;  4KMO A;  3CVY A;  1H2U A;  3QOU A;  2Q7F A;  3MA5 A;  2J49 A;  3VTX A;  3HXB A;  2QYJ A;  4M7C A;  4CEM A;  3LY9 A;  2HYZ A;  4BER A;  3TWR A;  3CVN A;  4GCO A;  5E76 A;  4KVO A;  4GA2 A;  4YVQ C;  4G2V A;  1BD8 A;  2R59 A;  3AS4 A;  3TWQ A;  3AG4 E;  3NBN B;  5A7D B;  2EIN E;  2PL2 A;  3OXF A;  2EIM E;  5EKQ D;  3CSF A;  5CCL A;  1ZBP A;  4U7E B;  1Z3X A;  4OVV A;  1HU3 A;  4DX1 A;  5ITZ F;  3HRA A;  1IHG A;  4JXT A;  5EID A;  3MCX A;  2ETA A;  3HIZ A;  1SZ9 A;  3KAE A;  2WMN A;  3ASD A;  4G26 A;  1E90 A;  1RZ4 A;  1BU9 A;  3AS5 A;  1A5E A;  3RO3 A;  2GGF A;  4GAA A;  1MZC A;  5JJ7 A; 
#chains in the Genus database with same CATH homology
 4JD2 G;  3ULE G;  2P9L G;  2P9K G;  2P9U G;  1U2V G;  2P9S G;  2P9P G;  2P9N G;  3DXK G;  3DWL G;  3RSE G;  3UKR G;  4XEI G;  3DXM G;  1K8K G;  3UKU G;  2P9I G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...