2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
2P9LG 1TYQG 2P9SG 3DWLG 3DXKG 4XEIG 4JD2G 1U2VG 3DXMG 3UKRG 3UKUG 3RSEG 1K8KG 2P9UG 2P9IG 2P9KG 2P9PG 3ULEG 2P9NG
chains in the Genus database with same CATH superfamily
3EHRA 3PZ1A 3FFLA 1SW6A 2KBXA 2LSVA 4GTOA 2WXIA 4AM9A 3KS2A 3FU3A 2Y4TA 2WM9A 1OY3D 3ASHA 2H6HA 3RO3A 4UI9J 4K03A 2VQ2A 1H6PA 3RRNB 1UJJA 2OOEA 5LOZA 4GMLA 2XEVA 2XCBA 5D2MC 1ZU2A 1OCOE 4DRXE 4I17A 2FO7A 2H6IA 3CKCA 4N5CA 1KT1A 2DZOA 3E37A 2R17C 4N3AA 3F6QA 1MHQA 3CHMA 3FY4A 5CBNA 2VSXE 5ENTD 4GTMA 2J08A 3B13A 4DX7D 3UI2A 2ETAA 3ABKE 4J8EA 3UQ3A 5FQ8A 5H7PA 1JWGA 4G11A 1YA0A 2ZIRA 1A5EA 3TWSA 3G2TA 4G8KA 2F0YA 3ABME 4RLYA 4V3IA 4U04A 3IHVA 1EF1C 3IXEA 3ESLA 3NZUA 5KJKA 3VLDA 2DIWA 2CFZA 2YNQA 3S7DA 2NC9A 4GB9A 3BQOA 2YQ8A 3ZUVB 3CVVA 1IQRA 5LP0A 3KEZA 3HXEA 1DC2A 4ILHB 3HVEB 2PQRA 3ULYA 4LG6A 2C2LA 5KNGA 3AU5A 5AN8A 1HO8A 2BUGA 4CZ2D 3LY9A 3UIOC 2X6HA 4GA0A 5KBAA 3LCAA 4KXKB 4CRWA 3URZA 4KZ0A 2WXKA 5EYLA 2VGYA 2Y69E 2L6BA 2KCKA 3NAWA 2P9UG 2M63A 2OEWA 2P9LG 3RK6A 1O1TA 2V4HC 2R59A 3FTSA 2A5UA 1RW2A 1E8XA 5T4YA 2OEVA 5BV1A 5LFAA 4U0ZA 1TNYA 3ML8A 4IRUA 5AJLA 2ZGGA 4U95D 2MRIA 1HF8A 5EN5D 1BLXB 1WAO1 4B8AA 3LJ3A 4HI9A 4JD2G 3ZYMA 3CVQA 1OT8A 3LYAA 4DX5D 1QYMA 1DCQA 3TJPA 3AS4A 1N52A 4GTPA 3TL5A 3ZEFA 3G2SA 4UQXA 2PQNA 1H6KA 5A6CA 2JEKA 1SQMA 4GMRA 5AQ9A 3SF4A 3ASOE 1OXJA 4XZ4A 2CHZA 5LCWJ 3BU8A 1Z6TA 4N39A 3LY8A 1HH8A 4ZFHA 2BEDA 4WNDA 2Q7FA 4IYPA 1HU3A 4BETA 4L7TA 3TWTA 4EBAG 4CDNA 2XEEA 4CEMA 1MQSA 4EHMA 2GRPB 2WXGA 3JQ1A 3Q75A 4F7AA 3FH5A 5HRYA 1OUVA 2R2LA 5KCMA 5B3SE 2XS1A 1P5QA 5JHBA 3FTYA 3CVYA 1H19A 4O60A 4QFVA 5JJ7A 2DWZA 2R02A 2JLBA 2E2EA 1Y8MA 3CHPA 3N71A 4GTVA 5G55A 4E6HA 1HS6A 2QYJA 5FQ4A 4UWHA 5ENQD 1N94A 3FP3A 1YYHA 2X6FA 2WXQA 3JUEA 1QZ2A 4MS6A 2AW6A 2J8SD 1NFIE 3MCXA 4MBGA 5CHEE 2GROB 3ZYLA 3RSEG 4J8SA 4FHJA 3Q47B 2GGFA 3HXCA 1NL4A 3WG7E 3QOUA 3BG0B 3FUJA 1LD7A 3PDNA 3E32A 2IQCA 4BWRA 2KC7A 3FDHA 3Q9NC 5CECB 5G04J 4OVVA 3DSWA 2QC9A 2LAIA 4TV3A 3CVXA 4HLLA 3GZ1A 3FU0A 4GCOA 4U8HA 3Q73A 2WXPA 4XKCA 2R03A 5FQ7A 1KPSB 2OVBA 3TXNA 2XQ0A 3ASFA 3ASGA 5LX8A 4HXIA 4DJAA 3QC1A 1UN8A 5T8IA 4P29A 5D66A 4A1SA 3Q15A 3UINC 1TN6A 3FH8A 2WMNA 4FJZA 2CG3A 1L5JA 4BESA 4XX5A 2PNNA 2IFUA 4F3VA 4EQFA 3HVEA 3D9HA 1ELKA 2L0TB 3D9MA 4WWNA 1EDUA 3CQCB 3ISMC 4I2ZA 3D9OA 4K5AB 5C1DA 4GA1A 2ETBA 1E8ZA 3HIZA 1H6OA 2IOLA 1WY6A 5G05C 5M72A 5AIJA 2ONDA 2WXNA 4R7LA 1BI8B 5ENSD 3QARA 4APFA 4AVXA 4FLHA 4L9PA 5AYWD 3CSFA 4WWPA 5ARFA 2MYOA 1V55E 3V2OA 5HQ8A 3QDNA 4JVSA 3EHQA 3IV0A 4RQIA 2BKKB 3DSSA 2NXPA 4ANXA 2VGXA 4I6GA 3FTXA 3D9JA 4X8QA 2V0PA 1TJFA 1QQEA 1UJKA 3TAXA 2X6IA 1KZPA 4DPRA 3CHSA 4BSXA 3EIJA 4CYMD 4WWOA 5EYPF 3AG4E 3W9FA 2WQ6A 2J49A 1IKND 2DZNA 3O4ZA 1LTXA 5FJYA 2X6KA 5FZSA 1N54A 2WXLA 2VTBA 5CRVA 4MLPA 5CEAA 2XPYA 2GRLA 3ZU7B 4FADA 4IN3B 4U8YD 4DLOA 5C2YA 4G26A 2WXOA 3EHNA 3QAQA 4DUIA 1BPOA 1FVHA 3U4TA 3CR3A 1TN8A 2H6FA 3TWWA 4M7CA 2WVIA 5JMND 3ZXPA 3UMVA 4JXTA 1S70B 1ZB1A 3SQVA 3FH7A 3FTWA 5BXUA 2P9IG 4GZCA 1Q2ZA 4ILIA 5EX0A 2XPZA 1OWNA 2V5QC 3PNLB 3U66A 2OV8A 4MRUA 4C0EA 3JYSA 3AJIA 4ACKA 3R9MA 1TNZA 3TWRA 3J5PA 3UTMA 3X2QE 2XZDG 3NOGD 1O1RA 4FA6A 2KATA 2V5FA 4EECA 3W9GA 1ELRA 1K3ZD 4IULA 1YMPA 2PM6A 4JB8P 3LJNA 1SZAA 3L22A 2QZAA 4JHKA 4GMJA 3KSQA 3O48A 5FZRA 4U7EB 2CG2A 3C3QA 2RFAA 4HS2A 4NIKA 4BX8A 2ZU6B 4L1BA 3PZ2A 2F8YA 1N4QA 4BSZB 4GA2A 2B6CA 3UXGA 1H2UA 5G2NA 4OYSA 5EDSA 1U3CA 1IHGA 5G04C 3J5QB 1BI7B 4AP2A 4B0ZA 4AY6A 3G2WA 3QB2A 1ELWA 1MX6A 4LNUD 3CVPA 3ZKJA 4G24A 4J0UA 4DX6D 3ML9A 3SNXA 2IOSA 4JA7A 4KT6B 3L17A 3SFXA 3DBSA 3CQGB 2YHCA 3SBTB 3B7BA 1AWCB 4B94A 3DSTA 1EPUA 2DYRE 4OVUA 3I4GA 3FTVA 4H7XA 3HG0D 1SA5A 4HRMB 1NA3A 2MOWA 4O1OA 3V31A 1E7VA 4D10C 1MZCA 1KLXA 4AXHA 4Z68A 3MGBA 4L23A 4ANWA 5KWDA 3L82A 1N4RA 1JUQA 3NF1A 3Q78A 2HE0A 3L08A 3SFYA 3EJNA 3R7QA 5J90A 3AAAC 3ENEA 3UM0A 1DNPA 3CHQA 1E96B 3CSTA 4JL0A 2FO1E 4Q94A 2KZTB 2VGEA 5CEDB 4I2WA 5BW8C 3OAWA 4FJYA 3ULEG 1OCRE 3RAUA 4K5BA 2P58C 5CRUA 1GW6A 3FULA 3ONKA 4B93B 3BUAA 5JA4D 5E75A 3S2AA 2PM7A 1PY1A 3P1UA 5J08A 2LUHA 4YDYA 3C3RA 4ATZD 4RG6A 1TNOA 4DX2A 2VYIA 1U2VG 3CVUA 3PZ3A 3PEVB 1XNFA 2KCVA 5JJ6A 3UIPC 3FUNA 3T8MA 1LF8A 4UI9K 1B89A 5AQAA 1N11A 3QK0A 3B7TA 1U3DA 2AWIA 4EBAA 2IJGX 5HKPA 2KM4A 4HOUA 3MKQB 4U63A 1V54E 2IY0C 3ONLA 4KVOA 4YDEA 5A7DB 3QNKA 3RU0A 3UUXA 5ENOD 1S64A 5B1AE 3GW4A 2LO6A 3QWVA 3MKQA 3U9WA 4LSZE 5KJMA 4Q96A 3ZYKA 5CMWA 2AXVA 5BNWA 5IY5E 5CCMA 2V4LA 3ZW3A 3GZ2A 3DWLG 2OVFA 4JPSA 5A23A 3FUKA 3TWVA 4HLEA 4PDXA 4GCNA 1E8WA 4A63B 1OCZE 3E33A 2LNIA 2Y1LE 4APOA 5KJLA 3RJVA 2AVPA 1LD8A 1JCSA 5T3RA 4EZKA 4LNGA 3HYMB 3G2UA 3UKUG 4AEZC 1K1AA 3AS8A 1INZA 4A3TA 1N95A 1TR4A 2OCCE 3D9KA 2I6HA 1WDYA 1WM5A 4XIFA 5D0QD 4I6JA 5AQ7A 4UQZA 4ANUA 2LSUA 3TXMA 4BT9A 3SD5A 3Q5MA 3TG4A 1RZ4A 3TWQA 3UM1A 4JA9A 4GPMA 4UWKA 2P9PG 3Q49B 2RG8A 4G8LA 4I9EA 1NP7A 2LXMA 3AG1E 1MYOA 1E8YA 5FT9A 3Q7FA 4GYWA 2XGOA 5JJTA 2IO3C 3BG1B 4KBQA 2QY7A 4DI4A 3MKRA 1NA0A 1X5BA 4JZYA 1IHBA 4PS3A 1N4SA 2GRNB 4Q69A 4UI9C 3FUIA 4RG9A 4ACLA 1XGWA 1OCCE 2AXZA 3MV3B 2GRRB 5ENNA 4PUCA 3ABLE 2EINE 3HXFA 2X6JA 1MX2A 4ANVA 1IXVA 3EU9A 1E90A 3ZN3A 1H0AA 1S0PA 3PS6A 4BTAA 2AXUA 4LRZA 2YHEA 3NQPA 2I9CA 3KD7A 4FHKA 5ENRD 2J4BA 2WMOA 3I4RB 3SFZA 3MEKA 3TWXA 2XS8A 1FT1A 4ZHBA 2I1KA 3Q4AB 1KT0A 1K8KG 3LKUA 3SHFA 3L54A 3KAEA 4U0UA 3DEPA 3KEAA 4GTQA 3G2VA 4U0SA 5CCLA 4ME2A 3UX4A 2J09A 1IQUA 3FUMA 1EYHA 3APCA 3PE4A 2J07A 3ZFWA 1HE8A 2L0IA 3QJZA 2GW1A 2HYZA 3ZYQA 2JABA 3FUHA 4CGWA 5JHAA 1UG3A 2UWJG 1HX8A 3T8KA 5B1BE 2PZIA 3NOCD 4F6RD 4AIFA 2L9BA 5E76A 1N0RA 2WPVA 4TXRA 4C0MA 4GU5A 2I2OA 1X81A 1S63A 1TNUA 3EDTB 5ARGA 4DX1A 3OXFA 3PZ4A 4B8CB 2ETCA 3PE3A 3ASNE 4MKTA 4G23A 2J9QA 5CERB 3PRZA 1NI1A 3DPYA 1DCEA 4EPZA 3RKVA 2F8XK 2WQHA 3I5PA 3IKOB 2GRQB 4XI0A 2BF0X 2E0IA 3RIBA 1HG5A 3ZHEA 4CDMA 4NRHB 3HXDA 3PVLA 1PC2A 2ZGDA 2J4DA 2XENA 4K5CA 3U64A 3LDZA 4WUYA 3UKRG 3PNTB 1D9SA 1TEZA 1O5MA 1W3BA 2CHWA 2DCPA 3D9NA 4J6IA 2EIJE 4BEPA 2LXLA 3LPZA 1MX4A 3SBSA 1ZBPA 3DXMG 1TN7A 3HRAA 2XEHA 2FI7A 2HO1A 5DIZA 4I43A 1VDYA 3MV2B 4JEUA 4NURA 4HOSA 3TGOA 3HHMA 3JXIA 1E7UA 4FC8A 2FBNA 4XKBA 5BT1A 3GYZA 1UW4B 3CEQA 1JCQA 3SZ7A 2YINA 4UUCA 2V8SE 4E85A 1N4PA 2R05A 3VLFA 1Y6IA 3OXLA 1O1SA 3PZDA 4J8YA 5FTPA 3CVNA 3ULQA 2VGXB 4DK5A 3Q7AA 3R7RA 2AJAA 2WQ7A 3MYVA 4H7YA 2B0OE 2XPIA 3BEEA 5EIBE 3PUKA 3T5VA 4UWFA 4M3OA 1A17A 2ILRA 2IONA 2FULA 3D9PA 3APFA 2CHXA 3U3WA 3KSLA 4AOFA 4I9CA 3OXGA 4C48B 1HG2A 3V79K 3B7SA 4O1PA 2VSYA 4CCAA 5BXOA 4N3BA 1YCSB 4HOQA 2IO2C 2VSOE 3TWUA 3SO8A 3DXKG 3IBEA 1OWLA 4W9RA 3LXUX 2XGMA 5D0OD 5CBOA 2MHKA 3NZSA 3NB2A 1Z3YA 2P2CP 3FEYA 2QYUA 3FU6A 3AU4A 1G3NB 3PUJA 4JHJA 3I3NA 4HORA 2WXFA 4GTTA 3CHOA 4FP7A 1QBQA 4GPKA 3PREA 1D8DA 1TJCA 2CFUA 5EILA 4U96D 3DRAA 4ATGA 2NSZA 3DSUA 4J7WA 4YDOA 3D9LA 2WB2A 3DPDA 4GZ6A 4PS8A 4C9BB 1HFAA 4DLQA 4RVBA 4FU3A 3MJWA 2DBAA 2XZTG 1SA4A 2Y4UA 2Y0BG 5ENPD 2VJ8A 2VSNA 3D9IA 4KMOA 3FTUA 2FEZA 4JC8A 3FU5A 4A1GA 2A4ZA 1UN9A 3CHRA 2QFCA 4EZJA 5BV0A 2IF4A 3E30A 3ZGQA 4GTRA 4JEHA 3UM2A 1FVFA 1IYGA 2X38A 4DI3A 2C0MA 3HXBA 3IEGA 3SY2A 3CV0A 2WXHA 1DVPA 2WXRA 4FULA 3MZLB 4HRLA 4TXQA 2C0LA 2RKKA 4G1TA 3TG5A 3WXXA 3L13A 2HR2A 1K1BA 5CMYA 3CK9A 2ZISA 4I6EA 5BPPA 3EUVA 1OWMA 1WG0A 4KVMA 4J8FA 1PAQA 2H6GA 1D8EA 3CIAA 3CK8A 2I1JA 4YNDA 2A5EA 3ZHEB 1H2TC 3MA5A 5LCWC 3UT4A 3EU5A 4BERA 1JWFA 2Y3AA 3QWPA 2P9NG 5EX3A 4Y6WA 4Y6CA 3C72A 3R9AB 4N3CA 4ABNA 3ZPJA 4WAFA 3CVWA 3JCKC 2UY1A 5ANRA 2XGSA 4RSYA 5ITZF 4GYYA 4G25A 1FCHA 3QWWA 3OTNA 3IHYA 4YVQC 3LS8A 2HM8A 4PS7A 3S7JA 4F53A 5EKQD 4WNFA 3DEOA 4BTBA 1NZNA 2GRMA 2KZTA 4BX9A 3DSVA 3UT7A 3VTYA 3CKBA 2BTDA 3B7UX 2XHEA 3FUDA 2RFMA 1Z5SC 5ANLA 4LNBA 3V30A 4KYOB 5KJNA 3AG3E 3CGHA 3RRMB 2RD0A 2EILE 5BUZA 3PH0C 5AJDA 1BU9A 4I1OB 2P9SG 5FINA 1JCRA 4WNEA 3E34A 4N5QA 5AAOA 5EIDA 3C3OA 2NYJA 4LEUA 1FPPA 4YDWA 4A3VA 3QKYA 4NACA 3Q79A 2XRYA 4GYOA 4GZ5A 1FT2A 4HI8A 3CK7A 4LCTA 3CLJA 4I1MA 4JHRA 4L2YA 2EIME 1AP7A 4CDRA 4JW1A 4OAUC 4UQYA 4BFRA 3Q9UC 3JQ0A 2WXJA 4I1AA 2DYSE 4F1PA 1OWOA 4GZDA 3EIQC 5HI7A 3P2BA 1JPLA 2LAHA 3T5XA 2XCCA 3FWVA 4A55A 3FHEA 1SVXA 4FLBA 4L2LA 2BKGA 4GTSA 3CVLA 3D3MA 4GZ3A 4K0RA 4HRNA 4QQIA 4N2SA 5DBKA 3ZIMA 4N2QA 3UPVA 2P9KG 3JXJA 4YVOA 4XE0A 4U07A 4AV7A 4HB5A 3FTZA 5KNHD 3ZXSA 5FZQA 3ZNGA 3FEXA 3ASDA 2FF4A 3E4BA 3FUEA 5G05J 4NQ0A 4XEIG 3UM3A 4TRQA 1QNFA 3T9KA 1OWPA 4O6FA 2VTBB 3FUFA 1N0QA 3S7FA 3L16A 5AARA 3C5RA 1MJ0A 1TNBA 2R5SA 4UWLA 3GZSA 3JUIA 4WNGA 4TUUA 5FQ6A 4UWGA 3NBNB 3S7BA 5HS0A 4B89A 4HVBA 4CGVA 2X3MA 3VTXA 1Z3XA 2EQXA 4GAAA 4F1SA 2IU1A 3HDXA 2KCLA 3K9IA 4ILGA 4J8DA 4LUNU 4HOTA 3EHMA 5AQBA 3SGHA 2EIKE 1N9AA 4KZCA 5AENA 5FWQA 3LY7A 4U8VD 1KZOA 1SZ9A 3LVRE 4TUMA 2F37A 2WXMA 4OAVB 3B95A 3LEWA 3DSXA 2DVWA 4G2VA 3ZVVA 4XI9A 4CT0A 4HQDA 3V2XA 4URKA 3PEUB 1BD8A 3AG2E 3ESKA 4BT8A 3VLEA 1HZ4A 4AY5A 2XRZA 3LVQE 1TYQG 3AS5A 3MX3A 4TXPA 1UOHA 4PH4B 4AJWA 3UT8A 3APDA 4BY6A 4HNAD 4LERA 3L9TA 3SI5A 2PL2A 3L6AA 4HBDA 3RO2A 4EZLA 3C98A 3B7RL 1H2VC 4CT4A 4HFGA 2IEJA 2UY1B 5FIOA 2L6JA 2ZXWE 3ZRHA 1HXIA 3RRUA 2KXPC
chains in the Genus database with same CATH topology
2P9LG 1TYQG 2P9SG 3DWLG 3DXKG 4XEIG 4JD2G 1U2VG 3DXMG 3UKRG 3UKUG 3RSEG 1K8KG 2P9UG 2P9IG 2P9KG 2P9PG 3ULEG 2P9NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L G;  1TYQ G;  2P9S G;  3DWL G;  3DXK G;  4XEI G;  4JD2 G;  1U2V G;  3DXM G;  3UKR G;  3UKU G;  3RSE G;  1K8K G;  2P9U G;  2P9I G;  2P9K G;  2P9P G;  3ULE G;  2P9N G; 
#chains in the Genus database with same CATH topology
 3EHR A;  3PZ1 A;  3FFL A;  1SW6 A;  2KBX A;  2LSV A;  4GTO A;  2WXI A;  4AM9 A;  3KS2 A;  3FU3 A;  2Y4T A;  2WM9 A;  1OY3 D;  3ASH A;  2H6H A;  3RO3 A;  4UI9 J;  4K03 A;  2VQ2 A;  1H6P A;  3RRN B;  1UJJ A;  2OOE A;  5LOZ A;  4GML A;  2XEV A;  2XCB A;  5D2M C;  1ZU2 A;  1OCO E;  4DRX E;  4I17 A;  2FO7 A;  2H6I A;  3CKC A;  4N5C A;  1KT1 A;  2DZO A;  3E37 A;  2R17 C;  4N3A A;  3F6Q A;  1MHQ A;  3CHM A;  3FY4 A;  5CBN A;  2VSX E;  5ENT D;  4GTM A;  2J08 A;  3B13 A;  4DX7 D;  3UI2 A;  2ETA A;  3ABK E;  4J8E A;  3UQ3 A;  5FQ8 A;  5H7P A;  1JWG A;  4G11 A;  1YA0 A;  2ZIR A;  1A5E A;  3TWS A;  3G2T A;  4G8K A;  2F0Y A;  3ABM E;  4RLY A;  4V3I A;  4U04 A;  3IHV A;  1EF1 C;  3IXE A;  3ESL A;  3NZU A;  5KJK A;  3VLD A;  2DIW A;  2CFZ A;  2YNQ A;  3S7D A;  2NC9 A;  4GB9 A;  3BQO A;  2YQ8 A;  3ZUV B;  3CVV A;  1IQR A;  5LP0 A;  3KEZ A;  3HXE A;  1DC2 A;  4ILH B;  3HVE B;  2PQR A;  3ULY A;  4LG6 A;  2C2L A;  5KNG A;  3AU5 A;  5AN8 A;  1HO8 A;  2BUG A;  4CZ2 D;  3LY9 A;  3UIO C;  2X6H A;  4GA0 A;  5KBA A;  3LCA A;  4KXK B;  4CRW A;  3URZ A;  4KZ0 A;  2WXK A;  5EYL A;  2VGY A;  2Y69 E;  2L6B A;  2KCK A;  3NAW A;  2P9U G;  2M63 A;  2OEW A;  2P9L G;  3RK6 A;  1O1T A;  2V4H C;  2R59 A;  3FTS A;  2A5U A;  1RW2 A;  1E8X A;  5T4Y A;  2OEV A;  5BV1 A;  5LFA A;  4U0Z A;  1TNY A;  3ML8 A;  4IRU A;  5AJL A;  2ZGG A;  4U95 D;  2MRI A;  1HF8 A;  5EN5 D;  1BLX B;  1WAO 1;  4B8A A;  3LJ3 A;  4HI9 A;  4JD2 G;  3ZYM A;  3CVQ A;  1OT8 A;  3LYA A;  4DX5 D;  1QYM A;  1DCQ A;  3TJP A;  3AS4 A;  1N52 A;  4GTP A;  3TL5 A;  3ZEF A;  3G2S A;  4UQX A;  2PQN A;  1H6K A;  5A6C A;  2JEK A;  1SQM A;  4GMR A;  5AQ9 A;  3SF4 A;  3ASO E;  1OXJ A;  4XZ4 A;  2CHZ A;  5LCW J;  3BU8 A;  1Z6T A;  4N39 A;  3LY8 A;  1HH8 A;  4ZFH A;  2BED A;  4WND A;  2Q7F A;  4IYP A;  1HU3 A;  4BET A;  4L7T A;  3TWT A;  4EBA G;  4CDN A;  2XEE A;  4CEM A;  1MQS A;  4EHM A;  2GRP B;  2WXG A;  3JQ1 A;  3Q75 A;  4F7A A;  3FH5 A;  5HRY A;  1OUV A;  2R2L A;  5KCM A;  5B3S E;  2XS1 A;  1P5Q A;  5JHB A;  3FTY A;  3CVY A;  1H19 A;  4O60 A;  4QFV A;  5JJ7 A;  2DWZ A;  2R02 A;  2JLB A;  2E2E A;  1Y8M A;  3CHP A;  3N71 A;  4GTV A;  5G55 A;  4E6H A;  1HS6 A;  2QYJ A;  5FQ4 A;  4UWH A;  5ENQ D;  1N94 A;  3FP3 A;  1YYH A;  2X6F A;  2WXQ A;  3JUE A;  1QZ2 A;  4MS6 A;  2AW6 A;  2J8S D;  1NFI E;  3MCX A;  4MBG A;  5CHE E;  2GRO B;  3ZYL A;  3RSE G;  4J8S A;  4FHJ A;  3Q47 B;  2GGF A;  3HXC A;  1NL4 A;  3WG7 E;  3QOU A;  3BG0 B;  3FUJ A;  1LD7 A;  3PDN A;  3E32 A;  2IQC A;  4BWR A;  2KC7 A;  3FDH A;  3Q9N C;  5CEC B;  5G04 J;  4OVV A;  3DSW A;  2QC9 A;  2LAI A;  4TV3 A;  3CVX A;  4HLL A;  3GZ1 A;  3FU0 A;  4GCO A;  4U8H A;  3Q73 A;  2WXP A;  4XKC A;  2R03 A;  5FQ7 A;  1KPS B;  2OVB A;  3TXN A;  2XQ0 A;  3ASF A;  3ASG A;  5LX8 A;  4HXI A;  4DJA A;  3QC1 A;  1UN8 A;  5T8I A;  4P29 A;  5D66 A;  4A1S A;  3Q15 A;  3UIN C;  1TN6 A;  3FH8 A;  2WMN A;  4FJZ A;  2CG3 A;  1L5J A;  4BES A;  4XX5 A;  2PNN A;  2IFU A;  4F3V A;  4EQF A;  3HVE A;  3D9H A;  1ELK A;  2L0T B;  3D9M A;  4WWN A;  1EDU A;  3CQC B;  3ISM C;  4I2Z A;  3D9O A;  4K5A B;  5C1D A;  4GA1 A;  2ETB A;  1E8Z A;  3HIZ A;  1H6O A;  2IOL A;  1WY6 A;  5G05 C;  5M72 A;  5AIJ A;  2OND A;  2WXN A;  4R7L A;  1BI8 B;  5ENS D;  3QAR A;  4APF A;  4AVX A;  4FLH A;  4L9P A;  5AYW D;  3CSF A;  4WWP A;  5ARF A;  2MYO A;  1V55 E;  3V2O A;  5HQ8 A;  3QDN A;  4JVS A;  3EHQ A;  3IV0 A;  4RQI A;  2BKK B;  3DSS A;  2NXP A;  4ANX A;  2VGX A;  4I6G A;  3FTX A;  3D9J A;  4X8Q A;  2V0P A;  1TJF A;  1QQE A;  1UJK A;  3TAX A;  2X6I A;  1KZP A;  4DPR A;  3CHS A;  4BSX A;  3EIJ A;  4CYM D;  4WWO A;  5EYP F;  3AG4 E;  3W9F A;  2WQ6 A;  2J49 A;  1IKN D;  2DZN A;  3O4Z A;  1LTX A;  5FJY A;  2X6K A;  5FZS A;  1N54 A;  2WXL A;  2VTB A;  5CRV A;  4MLP A;  5CEA A;  2XPY A;  2GRL A;  3ZU7 B;  4FAD A;  4IN3 B;  4U8Y D;  4DLO A;  5C2Y A;  4G26 A;  2WXO A;  3EHN A;  3QAQ A;  4DUI A;  1BPO A;  1FVH A;  3U4T A;  3CR3 A;  1TN8 A;  2H6F A;  3TWW A;  4M7C A;  2WVI A;  5JMN D;  3ZXP A;  3UMV A;  4JXT A;  1S70 B;  1ZB1 A;  3SQV A;  3FH7 A;  3FTW A;  5BXU A;  2P9I G;  4GZC A;  1Q2Z A;  4ILI A;  5EX0 A;  2XPZ A;  1OWN A;  2V5Q C;  3PNL B;  3U66 A;  2OV8 A;  4MRU A;  4C0E A;  3JYS A;  3AJI A;  4ACK A;  3R9M A;  1TNZ A;  3TWR A;  3J5P A;  3UTM A;  3X2Q E;  2XZD G;  3NOG D;  1O1R A;  4FA6 A;  2KAT A;  2V5F A;  4EEC A;  3W9G A;  1ELR A;  1K3Z D;  4IUL A;  1YMP A;  2PM6 A;  4JB8 P;  3LJN A;  1SZA A;  3L22 A;  2QZA A;  4JHK A;  4GMJ A;  3KSQ A;  3O48 A;  5FZR A;  4U7E B;  2CG2 A;  3C3Q A;  2RFA A;  4HS2 A;  4NIK A;  4BX8 A;  2ZU6 B;  4L1B A;  3PZ2 A;  2F8Y A;  1N4Q A;  4BSZ B;  4GA2 A;  2B6C A;  3UXG A;  1H2U A;  5G2N A;  4OYS A;  5EDS A;  1U3C A;  1IHG A;  5G04 C;  3J5Q B;  1BI7 B;  4AP2 A;  4B0Z A;  4AY6 A;  3G2W A;  3QB2 A;  1ELW A;  1MX6 A;  4LNU D;  3CVP A;  3ZKJ A;  4G24 A;  4J0U A;  4DX6 D;  3ML9 A;  3SNX A;  2IOS A;  4JA7 A;  4KT6 B;  3L17 A;  3SFX A;  3DBS A;  3CQG B;  2YHC A;  3SBT B;  3B7B A;  1AWC B;  4B94 A;  3DST A;  1EPU A;  2DYR E;  4OVU A;  3I4G A;  3FTV A;  4H7X A;  3HG0 D;  1SA5 A;  4HRM B;  1NA3 A;  2MOW A;  4O1O A;  3V31 A;  1E7V A;  4D10 C;  1MZC A;  1KLX A;  4AXH A;  4Z68 A;  3MGB A;  4L23 A;  4ANW A;  5KWD A;  3L82 A;  1N4R A;  1JUQ A;  3NF1 A;  3Q78 A;  2HE0 A;  3L08 A;  3SFY A;  3EJN A;  3R7Q A;  5J90 A;  3AAA C;  3ENE A;  3UM0 A;  1DNP A;  3CHQ A;  1E96 B;  3CST A;  4JL0 A;  2FO1 E;  4Q94 A;  2KZT B;  2VGE A;  5CED B;  4I2W A;  5BW8 C;  3OAW A;  4FJY A;  3ULE G;  1OCR E;  3RAU A;  4K5B A;  2P58 C;  5CRU A;  1GW6 A;  3FUL A;  3ONK A;  4B93 B;  3BUA A;  5JA4 D;  5E75 A;  3S2A A;  2PM7 A;  1PY1 A;  3P1U A;  5J08 A;  2LUH A;  4YDY A;  3C3R A;  4ATZ D;  4RG6 A;  1TNO A;  4DX2 A;  2VYI A;  1U2V G;  3CVU A;  3PZ3 A;  3PEV B;  1XNF A;  2KCV A;  5JJ6 A;  3UIP C;  3FUN A;  3T8M A;  1LF8 A;  4UI9 K;  1B89 A;  5AQA A;  1N11 A;  3QK0 A;  3B7T A;  1U3D A;  2AWI A;  4EBA A;  2IJG X;  5HKP A;  2KM4 A;  4HOU A;  3MKQ B;  4U63 A;  1V54 E;  2IY0 C;  3ONL A;  4KVO A;  4YDE A;  5A7D B;  3QNK A;  3RU0 A;  3UUX A;  5ENO D;  1S64 A;  5B1A E;  3GW4 A;  2LO6 A;  3QWV A;  3MKQ A;  3U9W A;  4LSZ E;  5KJM A;  4Q96 A;  3ZYK A;  5CMW A;  2AXV A;  5BNW A;  5IY5 E;  5CCM A;  2V4L A;  3ZW3 A;  3GZ2 A;  3DWL G;  2OVF A;  4JPS A;  5A23 A;  3FUK A;  3TWV A;  4HLE A;  4PDX A;  4GCN A;  1E8W A;  4A63 B;  1OCZ E;  3E33 A;  2LNI A;  2Y1L E;  4APO A;  5KJL A;  3RJV A;  2AVP A;  1LD8 A;  1JCS A;  5T3R A;  4EZK A;  4LNG A;  3HYM B;  3G2U A;  3UKU G;  4AEZ C;  1K1A A;  3AS8 A;  1INZ A;  4A3T A;  1N95 A;  1TR4 A;  2OCC E;  3D9K A;  2I6H A;  1WDY A;  1WM5 A;  4XIF A;  5D0Q D;  4I6J A;  5AQ7 A;  4UQZ A;  4ANU A;  2LSU A;  3TXM A;  4BT9 A;  3SD5 A;  3Q5M A;  3TG4 A;  1RZ4 A;  3TWQ A;  3UM1 A;  4JA9 A;  4GPM A;  4UWK A;  2P9P G;  3Q49 B;  2RG8 A;  4G8L A;  4I9E A;  1NP7 A;  2LXM A;  3AG1 E;  1MYO A;  1E8Y A;  5FT9 A;  3Q7F A;  4GYW A;  2XGO A;  5JJT A;  2IO3 C;  3BG1 B;  4KBQ A;  2QY7 A;  4DI4 A;  3MKR A;  1NA0 A;  1X5B A;  4JZY A;  1IHB A;  4PS3 A;  1N4S A;  2GRN B;  4Q69 A;  4UI9 C;  3FUI A;  4RG9 A;  4ACL A;  1XGW A;  1OCC E;  2AXZ A;  3MV3 B;  2GRR B;  5ENN A;  4PUC A;  3ABL E;  2EIN E;  3HXF A;  2X6J A;  1MX2 A;  4ANV A;  1IXV A;  3EU9 A;  1E90 A;  3ZN3 A;  1H0A A;  1S0P A;  3PS6 A;  4BTA A;  2AXU A;  4LRZ A;  2YHE A;  3NQP A;  2I9C A;  3KD7 A;  4FHK A;  5ENR D;  2J4B A;  2WMO A;  3I4R B;  3SFZ A;  3MEK A;  3TWX A;  2XS8 A;  1FT1 A;  4ZHB A;  2I1K A;  3Q4A B;  1KT0 A;  1K8K G;  3LKU A;  3SHF A;  3L54 A;  3KAE A;  4U0U A;  3DEP A;  3KEA A;  4GTQ A;  3G2V A;  4U0S A;  5CCL A;  4ME2 A;  3UX4 A;  2J09 A;  1IQU A;  3FUM A;  1EYH A;  3APC A;  3PE4 A;  2J07 A;  3ZFW A;  1HE8 A;  2L0I A;  3QJZ A;  2GW1 A;  2HYZ A;  3ZYQ A;  2JAB A;  3FUH A;  4CGW A;  5JHA A;  1UG3 A;  2UWJ G;  1HX8 A;  3T8K A;  5B1B E;  2PZI A;  3NOC D;  4F6R D;  4AIF A;  2L9B A;  5E76 A;  1N0R A;  2WPV A;  4TXR A;  4C0M A;  4GU5 A;  2I2O A;  1X81 A;  1S63 A;  1TNU A;  3EDT B;  5ARG A;  4DX1 A;  3OXF A;  3PZ4 A;  4B8C B;  2ETC A;  3PE3 A;  3ASN E;  4MKT A;  4G23 A;  2J9Q A;  5CER B;  3PRZ A;  1NI1 A;  3DPY A;  1DCE A;  4EPZ A;  3RKV A;  2F8X K;  2WQH A;  3I5P A;  3IKO B;  2GRQ B;  4XI0 A;  2BF0 X;  2E0I A;  3RIB A;  1HG5 A;  3ZHE A;  4CDM A;  4NRH B;  3HXD A;  3PVL A;  1PC2 A;  2ZGD A;  2J4D A;  2XEN A;  4K5C A;  3U64 A;  3LDZ A;  4WUY A;  3UKR G;  3PNT B;  1D9S A;  1TEZ A;  1O5M A;  1W3B A;  2CHW A;  2DCP A;  3D9N A;  4J6I A;  2EIJ E;  4BEP A;  2LXL A;  3LPZ A;  1MX4 A;  3SBS A;  1ZBP A;  3DXM G;  1TN7 A;  3HRA A;  2XEH A;  2FI7 A;  2HO1 A;  5DIZ A;  4I43 A;  1VDY A;  3MV2 B;  4JEU A;  4NUR A;  4HOS A;  3TGO A;  3HHM A;  3JXI A;  1E7U A;  4FC8 A;  2FBN A;  4XKB A;  5BT1 A;  3GYZ A;  1UW4 B;  3CEQ A;  1JCQ A;  3SZ7 A;  2YIN A;  4UUC A;  2V8S E;  4E85 A;  1N4P A;  2R05 A;  3VLF A;  1Y6I A;  3OXL A;  1O1S A;  3PZD A;  4J8Y A;  5FTP A;  3CVN A;  3ULQ A;  2VGX B;  4DK5 A;  3Q7A A;  3R7R A;  2AJA A;  2WQ7 A;  3MYV A;  4H7Y A;  2B0O E;  2XPI A;  3BEE A;  5EIB E;  3PUK A;  3T5V A;  4UWF A;  4M3O A;  1A17 A;  2ILR A;  2ION A;  2FUL A;  3D9P A;  3APF A;  2CHX A;  3U3W A;  3KSL A;  4AOF A;  4I9C A;  3OXG A;  4C48 B;  1HG2 A;  3V79 K;  3B7S A;  4O1P A;  2VSY A;  4CCA A;  5BXO A;  4N3B A;  1YCS B;  4HOQ A;  2IO2 C;  2VSO E;  3TWU A;  3SO8 A;  3DXK G;  3IBE A;  1OWL A;  4W9R A;  3LXU X;  2XGM A;  5D0O D;  5CBO A;  2MHK A;  3NZS A;  3NB2 A;  1Z3Y A;  2P2C P;  3FEY A;  2QYU A;  3FU6 A;  3AU4 A;  1G3N B;  3PUJ A;  4JHJ A;  3I3N A;  4HOR A;  2WXF A;  4GTT A;  3CHO A;  4FP7 A;  1QBQ A;  4GPK A;  3PRE A;  1D8D A;  1TJC A;  2CFU A;  5EIL A;  4U96 D;  3DRA A;  4ATG A;  2NSZ A;  3DSU A;  4J7W A;  4YDO A;  3D9L A;  2WB2 A;  3DPD A;  4GZ6 A;  4PS8 A;  4C9B B;  1HFA A;  4DLQ A;  4RVB A;  4FU3 A;  3MJW A;  2DBA A;  2XZT G;  1SA4 A;  2Y4U A;  2Y0B G;  5ENP D;  2VJ8 A;  2VSN A;  3D9I A;  4KMO A;  3FTU A;  2FEZ A;  4JC8 A;  3FU5 A;  4A1G A;  2A4Z A;  1UN9 A;  3CHR A;  2QFC A;  4EZJ A;  5BV0 A;  2IF4 A;  3E30 A;  3ZGQ A;  4GTR A;  4JEH A;  3UM2 A;  1FVF A;  1IYG A;  2X38 A;  4DI3 A;  2C0M A;  3HXB A;  3IEG A;  3SY2 A;  3CV0 A;  2WXH A;  1DVP A;  2WXR A;  4FUL A;  3MZL B;  4HRL A;  4TXQ A;  2C0L A;  2RKK A;  4G1T A;  3TG5 A;  3WXX A;  3L13 A;  2HR2 A;  1K1B A;  5CMY A;  3CK9 A;  2ZIS A;  4I6E A;  5BPP A;  3EUV A;  1OWM A;  1WG0 A;  4KVM A;  4J8F A;  1PAQ A;  2H6G A;  1D8E A;  3CIA A;  3CK8 A;  2I1J A;  4YND A;  2A5E A;  3ZHE B;  1H2T C;  3MA5 A;  5LCW C;  3UT4 A;  3EU5 A;  4BER A;  1JWF A;  2Y3A A;  3QWP A;  2P9N G;  5EX3 A;  4Y6W A;  4Y6C A;  3C72 A;  3R9A B;  4N3C A;  4ABN A;  3ZPJ A;  4WAF A;  3CVW A;  3JCK C;  2UY1 A;  5ANR A;  2XGS A;  4RSY A;  5ITZ F;  4GYY A;  4G25 A;  1FCH A;  3QWW A;  3OTN A;  3IHY A;  4YVQ C;  3LS8 A;  2HM8 A;  4PS7 A;  3S7J A;  4F53 A;  5EKQ D;  4WNF A;  3DEO A;  4BTB A;  1NZN A;  2GRM A;  2KZT A;  4BX9 A;  3DSV A;  3UT7 A;  3VTY A;  3CKB A;  2BTD A;  3B7U X;  2XHE A;  3FUD A;  2RFM A;  1Z5S C;  5ANL A;  4LNB A;  3V30 A;  4KYO B;  5KJN A;  3AG3 E;  3CGH A;  3RRM B;  2RD0 A;  2EIL E;  5BUZ A;  3PH0 C;  5AJD A;  1BU9 A;  4I1O B;  2P9S G;  5FIN A;  1JCR A;  4WNE A;  3E34 A;  4N5Q A;  5AAO A;  5EID A;  3C3O A;  2NYJ A;  4LEU A;  1FPP A;  4YDW A;  4A3V A;  3QKY A;  4NAC A;  3Q79 A;  2XRY A;  4GYO A;  4GZ5 A;  1FT2 A;  4HI8 A;  3CK7 A;  4LCT A;  3CLJ A;  4I1M A;  4JHR A;  4L2Y A;  2EIM E;  1AP7 A;  4CDR A;  4JW1 A;  4OAU C;  4UQY A;  4BFR A;  3Q9U C;  3JQ0 A;  2WXJ A;  4I1A A;  2DYS E;  4F1P A;  1OWO A;  4GZD A;  3EIQ C;  5HI7 A;  3P2B A;  1JPL A;  2LAH A;  3T5X A;  2XCC A;  3FWV A;  4A55 A;  3FHE A;  1SVX A;  4FLB A;  4L2L A;  2BKG A;  4GTS A;  3CVL A;  3D3M A;  4GZ3 A;  4K0R A;  4HRN A;  4QQI A;  4N2S A;  5DBK A;  3ZIM A;  4N2Q A;  3UPV A;  2P9K G;  3JXJ A;  4YVO A;  4XE0 A;  4U07 A;  4AV7 A;  4HB5 A;  3FTZ A;  5KNH D;  3ZXS A;  5FZQ A;  3ZNG A;  3FEX A;  3ASD A;  2FF4 A;  3E4B A;  3FUE A;  5G05 J;  4NQ0 A;  4XEI G;  3UM3 A;  4TRQ A;  1QNF A;  3T9K A;  1OWP A;  4O6F A;  2VTB B;  3FUF A;  1N0Q A;  3S7F A;  3L16 A;  5AAR A;  3C5R A;  1MJ0 A;  1TNB A;  2R5S A;  4UWL A;  3GZS A;  3JUI A;  4WNG A;  4TUU A;  5FQ6 A;  4UWG A;  3NBN B;  3S7B A;  5HS0 A;  4B89 A;  4HVB A;  4CGV A;  2X3M A;  3VTX A;  1Z3X A;  2EQX A;  4GAA A;  4F1S A;  2IU1 A;  3HDX A;  2KCL A;  3K9I A;  4ILG A;  4J8D A;  4LUN U;  4HOT A;  3EHM A;  5AQB A;  3SGH A;  2EIK E;  1N9A A;  4KZC A;  5AEN A;  5FWQ A;  3LY7 A;  4U8V D;  1KZO A;  1SZ9 A;  3LVR E;  4TUM A;  2F37 A;  2WXM A;  4OAV B;  3B95 A;  3LEW A;  3DSX A;  2DVW A;  4G2V A;  3ZVV A;  4XI9 A;  4CT0 A;  4HQD A;  3V2X A;  4URK A;  3PEU B;  1BD8 A;  3AG2 E;  3ESK A;  4BT8 A;  3VLE A;  1HZ4 A;  4AY5 A;  2XRZ A;  3LVQ E;  1TYQ G;  3AS5 A;  3MX3 A;  4TXP A;  1UOH A;  4PH4 B;  4AJW A;  3UT8 A;  3APD A;  4BY6 A;  4HNA D;  4LER A;  3L9T A;  3SI5 A;  2PL2 A;  3L6A A;  4HBD A;  3RO2 A;  4EZL A;  3C98 A;  3B7R L;  1H2V C;  4CT4 A;  4HFG A;  2IEJ A;  2UY1 B;  5FIO A;  2L6J A;  2ZXW E;  3ZRH A;  1HXI A;  3RRU A;  2KXP C; 
#chains in the Genus database with same CATH homology
 2P9L G;  1TYQ G;  2P9S G;  3DWL G;  3DXK G;  4XEI G;  4JD2 G;  1U2V G;  3DXM G;  3UKR G;  3UKU G;  3RSE G;  1K8K G;  2P9U G;  2P9I G;  2P9K G;  2P9P G;  3ULE G;  2P9N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...