2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
molecule keywords Actin-like protein 3
molecule tags Structural protein
source organism Bos taurus
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
3UKUG 2P9IG 3RSEG 3DXMG 3DWLG 1TYQG 1U2VG 3DXKG 2P9LG 3UKRG 2P9PG 4JD2G 2P9SG 4XEIG 2P9KG 1K8KG 3ULEG 2P9NG 2P9UG
chains in the Genus database with same CATH superfamily
4W9RA 2AW6A 4YNDA 3GZSA 1UOHA 3IHYA 1WG0A 1E8YA 3ESLA 4HOUA 2L0TB 3QWPA 4JA9A 3CEQA 4UQXA 3J5QB 4XKCA 5AYWD 3HXEA 3ZHEB 2BKGA 4B0ZA 5FJYA 3ISMC 3CVNA 5BV1A 4J7WA 4EQFA 3QDNA 3E33A 4J8SA 1WY6A 4HBDA 2XZTG 4L23A 3IBEA 4ACLA 3U4TA 3CVXA 2KZTA 3TG4A 2OEVA 5T4YA 4I1AA 4JB8P 3FTXA 3MKQB 1H2TC 5ENQD 3FP3A 2JEKA 3CHPA 4O1OA 2AVPA 2RFMA 3IV0A 3OXFA 5B1AE 1AWCB 3ASNE 3PZ4A 3NBNB 3BEEA 2FI7A 2DZNA 2CFUA 3FU0A 5CRUA 1O1RA 1NFIE 1ZB1A 3P2BA 5EYLA 2QY7A 2NYJA 4GZDA 5DIZA 4JA7A 2VSXE 4N2SA 5FINA 4WWNA 3MGBA 3FU3A 3UMVA 3PE4A 4HOTA 1MX2A 3UXGA 3MYVA 2PQNA 3U64A 4AY5A 3LJNA 4YDWA 4X8QA 4DK5A 4GTRA 3CQGB 4K03A 4UUCA 3BU8A 5H7PA 3QK0A 1HXIA 4AIFA 1FPPA 4M3OA 1QNFA 1HFAA 3U66A 3RJVA 4HXIA 4NACA 1D8EA 1YCSB 3BG0B 3CVLA 2ZIRA 3ULEG 4UQYA 1KLXA 2A4ZA 1WM5A 2P9NG 3PZ1A 2JLBA 4JZYA 2C0MA 3MKRA 3LKUA 5AQBA 4LEUA 2F0YA 4DI4A 1U3DA 4YDOA 5D0OD 3DPYA 3AJIA 2WXKA 2X38A 4WNGA 3UI2A 1JCQA 1BPOA 5A7DB 5JJ6A 3DSSA 3J5PA 2KZTB 3JQ1A 3PNTB 3PNLB 4GAAA 4ATZD 3SFYA 4OVUA 3RO3A 5BNWA 1N54A 2KATA 3L22A 1N4PA 3FTVA 2Y1LE 3TWWA 1AP7A 2P9KG 5C1DA 4B93B 4GB9A 3DSVA 1FVHA 1O5MA 4BT8A 1KT1A 4G23A 1ZBPA 3Q75A 2WXMA 1TN8A 5CMYA 1SW6A 1K1BA 4U8YD 3OTNA 3V2OA 2FBNA 4FU3A 1LD8A 2Y4UA 3ZYLA 1BU9A 4ABNA 3ZFWA 5LX8A 4Z68A 5EX3A 1PY1A 1HU3A 4HORA 2EQXA 3KS2A 3CK9A 3HG0D 4ANXA 3MA5A 4TXRA 3HHMA 4O6FA 3VLDA 2IEJA 3ULQA 4BTBA 4PDXA 3SBSA 3MJWA 3DRAA 2V4HC 4KXKB 1MQSA 3SQVA 1TYQG 4EECA 2IF4A 5KNHD 4APFA 3UT8A 3OXGA 4JEHA 5AJDA 3KEZA 3CVYA 2V4LA 3Q73A 3DEOA 4JHJA 4TRQA 3I5PA 2BKKB 2BTDA 3DPDA 4G1TA 4JXTA 2M63A 4WWPA 4HRMB 3UKRG 1HH8A 3ZYMA 2KM4A 2A5UA 1XGWA 4HRLA 3V31A 4EZLA 4HVBA 4FJYA 1UN9A 5JJ7A 4FC8A 2I1JA 5LP0A 4ILGA 2KCKA 4UWFA 3FUJA 2VJ8A 3SFXA 2IO3C 3L54A 5D0QD 4A55A 1HF8A 3ML8A 4C48B 4DX2A 3MCXA 3I4GA 3FULA 1DVPA 3E32A 3T5VA 2XPYA 2FF4A 3SGHA 1A17A 2DYRE 3TL5A 4IULA 5J08A 3FDHA 3GZ2A 2GRLA 4C0EA 3CLJA 2WPVA 5HRYA 3D9HA 4GCOA 3ABLE 5BW8C 2XRZA 2E2EA 1NL4A 3HXBA 3ASFA 1BD8A 2X6FA 5ANRA 2XZDG 3EU5A 4UI9K 4L2LA 4WUYA 2HM8A 4B89A 3CVUA 3UPVA 4OAVB 3DWLG 1TNUA 4KBQA 2LXMA 3B7SA 1U3CA 3G2WA 4JW1A 5AENA 2QYJA 3CVPA 2WXPA 3QC1A 1LTXA 4CDNA 4DX6D 3RRNB 4I9CA 1V55E 4H7XA 2IO2C 4I2ZA 1N4QA 3QOUA 5ENOD 1H6KA 4GMJA 2DCPA 2JABA 4GZCA 2KC7A 3IKOB 4E6HA 4HI9A 3PREA 5BPPA 2L6JA 5JMND 3HXCA 5FTPA 3QKYA 2EIME 1X81A 3AS8A 2F8YA 1HS6A 2Q7FA 4L7TA 4BY6A 3R9MA 1GW6A 3MKQA 1BI8B 1BLXB 4CT4A 3LY7A 3SHFA 1WDYA 4JHKA 2F37A 3UIPC 2I9CA 3T9KA 2KCVA 3LVRE 2MYOA 4UWGA 3ABME 4DLQA 3CSTA 4GPMA 1W3BA 3EHMA 4URKA 4CRWA 4BWRA 1EDUA 1BI7B 2J8SD 4GMLA 4J8YA 3FUNA 5JHBA 4RVBA 4L9PA 2X6KA 3D9PA 1FVFA 2ETCA 1ZU2A 5CRVA 5CERB 5FZSA 1TNZA 3FH7A 4EBAA 1IXVA 5D66A 3NAWA 4LSZE 4PS3A 2NC9A 3B7UX 4GZ6A 2QC9A 3UIOC 3AAAC 1OCRE 4I17A 4B94A 3D9IA 3EIJA 1NA0A 5CMWA 2KBXA 3CVQA 1A5EA 5KCMA 3C98A 1X5BA 3GYZA 3TJPA 3CKCA 1OXJA 3PEVB 2I2OA 3VTXA 4HI8A 1SA5A 5EDSA 2XHEA 4ATGA 2P9UG 4FJZA 2WQ7A 3ENEA 4FHKA 4XKBA 3Q15A 4TV3A 3RRUA 4CDRA 2ZGDA 2IY0C 2XEVA 4GYYA 3L08A 3R9AB 1MZCA 3FTWA 3LVQE 3E4BA 5LOZA 2LNIA 4N3BA 2PQRA 4GYOA 4LCTA 5G05C 3RKVA 2QZAA 1K1AA 4B8AA 2QFCA 3NZSA 2CHWA 2H6IA 3AG2E 2LXLA 1B89A 4PS7A 4I43A 1VDYA 5G05J 4HLEA 3U3WA 2FO1E 1TNBA 1KT0A 2XGOA 1TR4A 1V54E 3CKBA 4P29A 1OUVA 2GW1A 4BEPA 4I9EA 2PZIA 3TWXA 1SZ9A 3IHVA 3SNXA 4RLYA 2CFZA 3NB2A 1Y8MA 2X6HA 5CBOA 2VSOE 4CGVA 3Q9UC 2XCBA 5JJTA 3HXFA 3TWQA 3Q5MA 4U0ZA 4FLHA 3O48A 2H6FA 3PEUB 5E76A 3DEPA 4RG6A 2XGSA 3R7RA 1IKND 5HI7A 4APOA 3QNKA 1E8WA 3KAEA 2J07A 3CVWA 5G04C 3CK8A 4JEUA 3WG7E 1HO8A 4AXHA 1ELRA 3FY4A 2J49A 4CEMA 4F3VA 3ML9A 3EU9A 3PZ3A 3ONKA 2GROB 2Y4TA 2V0PA 5EILA 1DCEA 2CG2A 4MS6A 5LCWC 1LD7A 1HG5A 3ZW3A 2XS1A 4U07A 4DX5D 4V3IA 4GPKA 3DXKG 2FO7A 1H0AA 2IQCA 5AIJA 2J4DA 1Z6TA 3KEAA 4NQ0A 3B7BA 2HO1A 1TJFA 4KYOB 3CHSA 4U04A 5LCWJ 2LUHA 3G2UA 5FQ8A 1H19A 2P9IG 2R02A 4I1OB 4NURA 5ENSD 1FCHA 3B95A 2F8XK 4FHJA 5AJLA 2AJAA 3R7QA 3CK7A 3C5RA 4ACKA 2DYSE 4BX8A 4XI0A 2OV8A 2B0OE 4N3AA 1OCZE 4U8VD 3PRZA 3QAQA 5AAOA 3RIBA 2LO6A 3IEGA 3FTSA 1QBQA 4BX9A 3LXUX 2NSZA 1QQEA 1MHQA 4A1SA 3P1UA 2NXPA 2Y3AA 4MBGA 3CHRA 3Q4AB 4ANUA 1IQRA 1YMPA 3GW4A 2HE0A 4Q69A 1L5JA 2VGEA 4DLOA 2AWIA 4ANWA 3JXIA 2WB2A 3LY8A 4L1BA 4WWOA 2H6GA 2LSVA 3AU4A 4GTTA 2DBAA 3LYAA 2WXGA 1FT1A 4RQIA 4N2QA 3TWRA 3TGOA 2AXVA 5AN8A 4XX5A 4K0RA 3TWSA 1EF1C 1JPLA 4BT9A 3E37A 3PE3A 3APCA 4F1SA 5A23A 4XI9A 5ANLA 3B7RL 1K3ZD 4XE0A 3K9IA 4UI9C 3DBSA 1UG3A 3AG3E 2L0IA 4Q94A 3MEKA 2IOSA 1RZ4A 3S7JA 3WXXA 5KWDA 3UM0A 2GRQB 3EDTB 4BETA 3TXNA 3EIQC 4H7YA 4AJWA 2WVIA 3ULYA 1DC2A 1OWLA 3EJNA 4F7AA 3MX3A 2VGXA 5FQ4A 4CGWA 5ENPD 5KBAA 4FULA 2MOWA 3D9MA 4AOFA 1IHBA 1U2VG 3D9OA 1UW4B 5FIOA 1OWNA 5B3SE 2V8SE 3APFA 3D9LA 3UTMA 4YVQC 4FP7A 4LNUD 5HQ8A 5E75A 3SY2A 3CSFA 2P9LG 4JL0A 1D8DA 3FTUA 1TN7A 3AU5A 3ZXSA 2LAIA 1Y6IA 2WXOA 5FT9A 4CYMD 3AG4E 1SQMA 3D3MA 2XEEA 4Y6WA 2XQ0A 3VLFA 3CQCB 1PC2A 2DVWA 5T8IA 3CVVA 3L13A 5ENTD 4CCAA 5BXOA 4EHMA 4L2YA 1OY3D 3ZKJA 3NOGD 3ZVVA 3V79K 3QB2A 3RK6A 2DWZA 2FEZA 2LAHA 1E8ZA 4U7EB 2KXPC 4F6RD 2KCLA 4MRUA 2J08A 2PNNA 5ENRD 2OOEA 4KVOA 2L9BA 3G2TA 5JHAA 1N4RA 1E90A 2R2LA 3LDZA 4AV7A 2EINE 1O1SA 4HB5A 1HX8A 1N11A 4JPSA 4DRXE 2XGMA 4ILHB 3BQOA 3PUJA 3LPZA 3FH5A 5ARGA 3ZGQA 1E96B 2VGXB 4NRHB 1KZPA 1NA3A 3OXLA 4LG6A 2IFUA 3CV0A 2R05A 3FUKA 2DIWA 4J8EA 2P9SG 5ARFA 4I6GA 4J8DA 1SVXA 5EYPF 3TAXA 3ZN3A 2CG3A 1N0RA 4GA2A 1TNOA 4OVVA 2J4BA 3ZPJA 4HRNA 4GA1A 2GRRB 3CR3A 2WXIA 4RG9A 4G8LA 1N0QA 5AARA 4TXQA 5G2NA 2X6JA 5T3RA 1E7UA 5LFAA 4U96D 2IONA 4UWKA 3ZIMA 3UM1A 3L16A 1XNFA 3ZYKA 4TUUA 2QYUA 3ASGA 5C2YA 2Y69E 2VSYA 2Y0BG 3Q79A 4LNGA 2MHKA 2X3MA 4FLBA 2YINA 4ANVA 4CDMA 2J09A 4I1MA 3FFLA 3DXMG 2VTBA 3S7BA 3EHRA 4YDYA 1O1TA 3KD7A 2VQ2A 2E0IA 5FQ7A 2XS8A 1MX6A 3LJ3A 1N9AA 4DJAA 5J90A 3FEXA 3C72A 2WXJA 2ETBA 5CECB 5CCMA 3DSXA 3V30A 5AQ9A 3Q47B 1ELKA 3AS5A 4GTOA 5BXUA 3HIZA 5CBNA 4IRUA 4Y6CA 2P58C 3AS4A 3L17A 3ZYQA 2YQ8A 4KMOA 3RAUA 3E34A 4JC8A 5CEAA 1OWOA 1Q2ZA 4KT6B 3EUVA 4PS8A 4UQZA 3MV3B 3MZLB 2R03A 1SZAA 3F6QA 5KJMA 1K8KG 3ZRHA 4DPRA 1YYHA 4TUMA 4RSYA 3SF4A 1MYOA 4BERA 3RO2A 3PZ2A 4JHRA 4MLPA 4DUIA 3PUKA 3JUEA 5HKPA 1TN6A 4OYSA 3PDNA 3UQ3A 2R17C 3ESKA 3X2QE 4BFRA 2ETAA 1INZA 3ZNGA 3TXMA 4BESA 3RRMB 3C3QA 3Q9NC 3I4RB 2EIJE 2WXLA 4G24A 4EBAG 4J8FA 4U63A 3C3OA 4WNEA 4N39A 1IHGA 2BF0X 2ZGGA 4CZ2D 2ZU6B 1JCSA 3APDA 2MRIA 2I1KA 3JUIA 3TG5A 3ZXPA 2XEHA 3JXJA 1FT2A 2VGYA 1S63A 2WXNA 3Q7FA 4A63B 3QWVA 2GRPB 2IU1A 3W9GA 2VTBB 2XRYA 3D9NA 1OCCE 3LCAA 3UINC 4GA0A 5EKQD 3VLEA 2IJGX 5EX0A 3MV2B 3FEYA 4C9BB 2LSUA 2J9QA 4UWHA 3FTYA 3E30A 4WNDA 3LY9A 3UKUG 4HOQA 4U0SA 4GTPA 4BSZB 3CIAA 2WMNA 4AEZC 1N4SA 3UUXA 3U9WA 4K5AB 2X6IA 2BEDA 5G04J 4XEIG 4G26A 5A6CA 2PL2A 5EN5D 3QARA 4ZFHA 4AY6A 5KJKA 4HQDA 4GTQA 1Z5SC 2VSNA 3D9JA 4LUNU 4JD2G 4PUCA 2XPIA 3PZDA 4I2WA 1KPSB 4KZCA 4UWLA 1JWFA 4BTAA 2R5SA 4J0UA 1KZOA 4R7LA 3FUEA 5ENNA 4D10C 2WQHA 1S0PA 1H2UA 3TWVA 2A5EA 2FULA 1YA0A 3LEWA 2WMOA 5CCLA 4ILIA 3HVEA 2UY1A 2V5QC 2WXFA 3ASOE 4C0MA 4A3TA 1IYGA 3V2XA 4GU5A 5AQ7A 5BV0A 4FA6A 2GRMA 3URZA 2RG8A 3IXEA 3FUMA 4AVXA 3NOCD 3SO8A 5FZQA 1QZ2A 4GMRA 4JVSA 4CT0A 4G25A 2C0LA 3BUAA 5CHEE 5KJNA 1QYMA 1TNYA 1NP7A 4WNFA 2EIKE 2OVBA 3T5XA 3JYSA 2DZOA 2AXZA 3QJZA 1P5QA 4U0UA 1SA4A 4WAFA 1IQUA 1N94A 3SI5A 4J6IA 3CHMA 3ASHA 5B1BE 3UT7A 4I6JA 1Z3YA 3ONLA 2GRNB 4HOSA 3T8KA 4EPZA 2V5FA 5FWQA 1N95A 3RU0A 5EIDA 3AG1E 5CEDB 1WAO1 4Q96A 3HYMB 3UT4A 3VTYA 3ASDA 4MKTA 1JWGA 3DSWA 3S7DA 2YHCA 1UJJA 4AP2A 3T8MA 2YHEA 3EHQA 3L6AA 2WM9A 4GYWA 2XENA 1TEZA 2CHXA 2YNQA 4UI9J 2WXHA 5G55A 2L6BA 4I6EA 1E8XA 1RW2A 4HLLA 4DX1A 4YVOA 1LF8A 3N71A 4GZ5A 4KZ0A 1H6OA 1NZNA 3NQPA 3FU6A 2ONDA 3HVEB 2RD0A 4HNAD 2UY1B 4NIKA 5EIBE 3B7TA 2HYZA 3FU5A 3Q78A 2EILE 4BSXA 3UX4A 2WQ6A 4EZKA 4KVMA 4G2VA 3NF1A 1S64A 4U95D 2RFAA 2R59A 1TJCA 3CHQA 2RKKA 1OT8A 3C3RA 5KJLA 1D9SA 3DSUA 3FUDA 3KSLA 4XZ4A 1UN8A 5AQAA 5FZRA 4PH4B 5JA4D 1G3NB 3PH0C 3FUFA 1ELWA 5FQ6A 5ITZF 4OAUC 3FUHA 5HS0A 2PM6A 1NI1A 1EPUA 4DI3A 4DX7D 5DBKA 3KSQA 1HG2A 2PM7A 2P2CP 4IN3B 4ZHBA 4F1PA 3ZUVB 4K5BA 1DCQA 4TXPA 4ME2A 3LS8A 2ILRA 4GTVA 4XIFA 5BT1A 3FWVA 3OAWA 3HRAA 3FHEA 3GZ1A 4G8KA 3ABKE 3W9FA 1EYHA 3I3NA 3G2VA 4GTSA 3SZ7A 3S7FA 3Q7AA 4LRZA 4LNBA 1OCOE 2OEWA 4QFVA 4LERA 4IYPA 2XPZA 1PAQA 3UM2A 3FTZA 4B8CB 5BUZA 2I6HA 4A3VA 3D9KA 4QQIA 3S2AA 3DSTA 3PVLA 1HZ4A 3ZHEA 1E7VA 4YDEA 4EZJA 2OVFA 2HR2A 3FH8A 3TWUA 3PS6A 2H6HA 2ZXWE 4N5QA 3G2SA 5IY5E 3SFZA 4O1PA 3SBTB 1UJKA 1N52A 1MJ0A 3FUIA 1H2VC 4A1GA 3TWTA 4N5CA 4E85A 3RSEG 3B13A 4AM9A 3ZEFA 1OWPA 4U8HA 2CHZA 3JQ0A 3EHNA 2OCCE 3L9TA 1Z3XA 5KNGA 1MX4A 2IOLA 1H6PA 3CHOA 2ZISA 2WXRA 4M7CA 2B6CA 3ZU7B 3Q49B 1DNPA 2BUGA 4GCNA 3JCKC 3SD5A 2GGFA 3NZUA 3QWWA 2P9PG 1S70B 5D2MC 3CGHA 1JUQA 3HXDA 2AXUA 4G11A 4GTMA 1HE8A 4K5CA 3UM3A 1OWMA 2UWJG 4O60A 1JCRA 3L82A 2VYIA 4N3CA 5M72A 4FADA 3O4ZA 4F53A 3HDXA 2C2LA 4HFGA 2WXQA 4HS2A 2XCCA 3BG1B 4GZ3A
chains in the Genus database with same CATH topology
3UKUG 2P9IG 3RSEG 3DXMG 3DWLG 1TYQG 1U2VG 3DXKG 2P9LG 3UKRG 2P9PG 4JD2G 2P9SG 4XEIG 2P9KG 1K8KG 3ULEG 2P9NG 2P9UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKU G;  2P9I G;  3RSE G;  3DXM G;  3DWL G;  1TYQ G;  1U2V G;  3DXK G;  2P9L G;  3UKR G;  2P9P G;  4JD2 G;  2P9S G;  4XEI G;  2P9K G;  1K8K G;  3ULE G;  2P9N G;  2P9U G; 
#chains in the Genus database with same CATH topology
 4W9R A;  2AW6 A;  4YND A;  3GZS A;  1UOH A;  3IHY A;  1WG0 A;  1E8Y A;  3ESL A;  4HOU A;  2L0T B;  3QWP A;  4JA9 A;  3CEQ A;  4UQX A;  3J5Q B;  4XKC A;  5AYW D;  3HXE A;  3ZHE B;  2BKG A;  4B0Z A;  5FJY A;  3ISM C;  3CVN A;  5BV1 A;  4J7W A;  4EQF A;  3QDN A;  3E33 A;  4J8S A;  1WY6 A;  4HBD A;  2XZT G;  4L23 A;  3IBE A;  4ACL A;  3U4T A;  3CVX A;  2KZT A;  3TG4 A;  2OEV A;  5T4Y A;  4I1A A;  4JB8 P;  3FTX A;  3MKQ B;  1H2T C;  5ENQ D;  3FP3 A;  2JEK A;  3CHP A;  4O1O A;  2AVP A;  2RFM A;  3IV0 A;  3OXF A;  5B1A E;  1AWC B;  3ASN E;  3PZ4 A;  3NBN B;  3BEE A;  2FI7 A;  2DZN A;  2CFU A;  3FU0 A;  5CRU A;  1O1R A;  1NFI E;  1ZB1 A;  3P2B A;  5EYL A;  2QY7 A;  2NYJ A;  4GZD A;  5DIZ A;  4JA7 A;  2VSX E;  4N2S A;  5FIN A;  4WWN A;  3MGB A;  3FU3 A;  3UMV A;  3PE4 A;  4HOT A;  1MX2 A;  3UXG A;  3MYV A;  2PQN A;  3U64 A;  4AY5 A;  3LJN A;  4YDW A;  4X8Q A;  4DK5 A;  4GTR A;  3CQG B;  4K03 A;  4UUC A;  3BU8 A;  5H7P A;  3QK0 A;  1HXI A;  4AIF A;  1FPP A;  4M3O A;  1QNF A;  1HFA A;  3U66 A;  3RJV A;  4HXI A;  4NAC A;  1D8E A;  1YCS B;  3BG0 B;  3CVL A;  2ZIR A;  3ULE G;  4UQY A;  1KLX A;  2A4Z A;  1WM5 A;  2P9N G;  3PZ1 A;  2JLB A;  4JZY A;  2C0M A;  3MKR A;  3LKU A;  5AQB A;  4LEU A;  2F0Y A;  4DI4 A;  1U3D A;  4YDO A;  5D0O D;  3DPY A;  3AJI A;  2WXK A;  2X38 A;  4WNG A;  3UI2 A;  1JCQ A;  1BPO A;  5A7D B;  5JJ6 A;  3DSS A;  3J5P A;  2KZT B;  3JQ1 A;  3PNT B;  3PNL B;  4GAA A;  4ATZ D;  3SFY A;  4OVU A;  3RO3 A;  5BNW A;  1N54 A;  2KAT A;  3L22 A;  1N4P A;  3FTV A;  2Y1L E;  3TWW A;  1AP7 A;  2P9K G;  5C1D A;  4B93 B;  4GB9 A;  3DSV A;  1FVH A;  1O5M A;  4BT8 A;  1KT1 A;  4G23 A;  1ZBP A;  3Q75 A;  2WXM A;  1TN8 A;  5CMY A;  1SW6 A;  1K1B A;  4U8Y D;  3OTN A;  3V2O A;  2FBN A;  4FU3 A;  1LD8 A;  2Y4U A;  3ZYL A;  1BU9 A;  4ABN A;  3ZFW A;  5LX8 A;  4Z68 A;  5EX3 A;  1PY1 A;  1HU3 A;  4HOR A;  2EQX A;  3KS2 A;  3CK9 A;  3HG0 D;  4ANX A;  3MA5 A;  4TXR A;  3HHM A;  4O6F A;  3VLD A;  2IEJ A;  3ULQ A;  4BTB A;  4PDX A;  3SBS A;  3MJW A;  3DRA A;  2V4H C;  4KXK B;  1MQS A;  3SQV A;  1TYQ G;  4EEC A;  2IF4 A;  5KNH D;  4APF A;  3UT8 A;  3OXG A;  4JEH A;  5AJD A;  3KEZ A;  3CVY A;  2V4L A;  3Q73 A;  3DEO A;  4JHJ A;  4TRQ A;  3I5P A;  2BKK B;  2BTD A;  3DPD A;  4G1T A;  4JXT A;  2M63 A;  4WWP A;  4HRM B;  3UKR G;  1HH8 A;  3ZYM A;  2KM4 A;  2A5U A;  1XGW A;  4HRL A;  3V31 A;  4EZL A;  4HVB A;  4FJY A;  1UN9 A;  5JJ7 A;  4FC8 A;  2I1J A;  5LP0 A;  4ILG A;  2KCK A;  4UWF A;  3FUJ A;  2VJ8 A;  3SFX A;  2IO3 C;  3L54 A;  5D0Q D;  4A55 A;  1HF8 A;  3ML8 A;  4C48 B;  4DX2 A;  3MCX A;  3I4G A;  3FUL A;  1DVP A;  3E32 A;  3T5V A;  2XPY A;  2FF4 A;  3SGH A;  1A17 A;  2DYR E;  3TL5 A;  4IUL A;  5J08 A;  3FDH A;  3GZ2 A;  2GRL A;  4C0E A;  3CLJ A;  2WPV A;  5HRY A;  3D9H A;  4GCO A;  3ABL E;  5BW8 C;  2XRZ A;  2E2E A;  1NL4 A;  3HXB A;  3ASF A;  1BD8 A;  2X6F A;  5ANR A;  2XZD G;  3EU5 A;  4UI9 K;  4L2L A;  4WUY A;  2HM8 A;  4B89 A;  3CVU A;  3UPV A;  4OAV B;  3DWL G;  1TNU A;  4KBQ A;  2LXM A;  3B7S A;  1U3C A;  3G2W A;  4JW1 A;  5AEN A;  2QYJ A;  3CVP A;  2WXP A;  3QC1 A;  1LTX A;  4CDN A;  4DX6 D;  3RRN B;  4I9C A;  1V55 E;  4H7X A;  2IO2 C;  4I2Z A;  1N4Q A;  3QOU A;  5ENO D;  1H6K A;  4GMJ A;  2DCP A;  2JAB A;  4GZC A;  2KC7 A;  3IKO B;  4E6H A;  4HI9 A;  3PRE A;  5BPP A;  2L6J A;  5JMN D;  3HXC A;  5FTP A;  3QKY A;  2EIM E;  1X81 A;  3AS8 A;  2F8Y A;  1HS6 A;  2Q7F A;  4L7T A;  4BY6 A;  3R9M A;  1GW6 A;  3MKQ A;  1BI8 B;  1BLX B;  4CT4 A;  3LY7 A;  3SHF A;  1WDY A;  4JHK A;  2F37 A;  3UIP C;  2I9C A;  3T9K A;  2KCV A;  3LVR E;  2MYO A;  4UWG A;  3ABM E;  4DLQ A;  3CST A;  4GPM A;  1W3B A;  3EHM A;  4URK A;  4CRW A;  4BWR A;  1EDU A;  1BI7 B;  2J8S D;  4GML A;  4J8Y A;  3FUN A;  5JHB A;  4RVB A;  4L9P A;  2X6K A;  3D9P A;  1FVF A;  2ETC A;  1ZU2 A;  5CRV A;  5CER B;  5FZS A;  1TNZ A;  3FH7 A;  4EBA A;  1IXV A;  5D66 A;  3NAW A;  4LSZ E;  4PS3 A;  2NC9 A;  3B7U X;  4GZ6 A;  2QC9 A;  3UIO C;  3AAA C;  1OCR E;  4I17 A;  4B94 A;  3D9I A;  3EIJ A;  1NA0 A;  5CMW A;  2KBX A;  3CVQ A;  1A5E A;  5KCM A;  3C98 A;  1X5B A;  3GYZ A;  3TJP A;  3CKC A;  1OXJ A;  3PEV B;  2I2O A;  3VTX A;  4HI8 A;  1SA5 A;  5EDS A;  2XHE A;  4ATG A;  2P9U G;  4FJZ A;  2WQ7 A;  3ENE A;  4FHK A;  4XKB A;  3Q15 A;  4TV3 A;  3RRU A;  4CDR A;  2ZGD A;  2IY0 C;  2XEV A;  4GYY A;  3L08 A;  3R9A B;  1MZC A;  3FTW A;  3LVQ E;  3E4B A;  5LOZ A;  2LNI A;  4N3B A;  2PQR A;  4GYO A;  4LCT A;  5G05 C;  3RKV A;  2QZA A;  1K1A A;  4B8A A;  2QFC A;  3NZS A;  2CHW A;  2H6I A;  3AG2 E;  2LXL A;  1B89 A;  4PS7 A;  4I43 A;  1VDY A;  5G05 J;  4HLE A;  3U3W A;  2FO1 E;  1TNB A;  1KT0 A;  2XGO A;  1TR4 A;  1V54 E;  3CKB A;  4P29 A;  1OUV A;  2GW1 A;  4BEP A;  4I9E A;  2PZI A;  3TWX A;  1SZ9 A;  3IHV A;  3SNX A;  4RLY A;  2CFZ A;  3NB2 A;  1Y8M A;  2X6H A;  5CBO A;  2VSO E;  4CGV A;  3Q9U C;  2XCB A;  5JJT A;  3HXF A;  3TWQ A;  3Q5M A;  4U0Z A;  4FLH A;  3O48 A;  2H6F A;  3PEU B;  5E76 A;  3DEP A;  4RG6 A;  2XGS A;  3R7R A;  1IKN D;  5HI7 A;  4APO A;  3QNK A;  1E8W A;  3KAE A;  2J07 A;  3CVW A;  5G04 C;  3CK8 A;  4JEU A;  3WG7 E;  1HO8 A;  4AXH A;  1ELR A;  3FY4 A;  2J49 A;  4CEM A;  4F3V A;  3ML9 A;  3EU9 A;  3PZ3 A;  3ONK A;  2GRO B;  2Y4T A;  2V0P A;  5EIL A;  1DCE A;  2CG2 A;  4MS6 A;  5LCW C;  1LD7 A;  1HG5 A;  3ZW3 A;  2XS1 A;  4U07 A;  4DX5 D;  4V3I A;  4GPK A;  3DXK G;  2FO7 A;  1H0A A;  2IQC A;  5AIJ A;  2J4D A;  1Z6T A;  3KEA A;  4NQ0 A;  3B7B A;  2HO1 A;  1TJF A;  4KYO B;  3CHS A;  4U04 A;  5LCW J;  2LUH A;  3G2U A;  5FQ8 A;  1H19 A;  2P9I G;  2R02 A;  4I1O B;  4NUR A;  5ENS D;  1FCH A;  3B95 A;  2F8X K;  4FHJ A;  5AJL A;  2AJA A;  3R7Q A;  3CK7 A;  3C5R A;  4ACK A;  2DYS E;  4BX8 A;  4XI0 A;  2OV8 A;  2B0O E;  4N3A A;  1OCZ E;  4U8V D;  3PRZ A;  3QAQ A;  5AAO A;  3RIB A;  2LO6 A;  3IEG A;  3FTS A;  1QBQ A;  4BX9 A;  3LXU X;  2NSZ A;  1QQE A;  1MHQ A;  4A1S A;  3P1U A;  2NXP A;  2Y3A A;  4MBG A;  3CHR A;  3Q4A B;  4ANU A;  1IQR A;  1YMP A;  3GW4 A;  2HE0 A;  4Q69 A;  1L5J A;  2VGE A;  4DLO A;  2AWI A;  4ANW A;  3JXI A;  2WB2 A;  3LY8 A;  4L1B A;  4WWO A;  2H6G A;  2LSV A;  3AU4 A;  4GTT A;  2DBA A;  3LYA A;  2WXG A;  1FT1 A;  4RQI A;  4N2Q A;  3TWR A;  3TGO A;  2AXV A;  5AN8 A;  4XX5 A;  4K0R A;  3TWS A;  1EF1 C;  1JPL A;  4BT9 A;  3E37 A;  3PE3 A;  3APC A;  4F1S A;  5A23 A;  4XI9 A;  5ANL A;  3B7R L;  1K3Z D;  4XE0 A;  3K9I A;  4UI9 C;  3DBS A;  1UG3 A;  3AG3 E;  2L0I A;  4Q94 A;  3MEK A;  2IOS A;  1RZ4 A;  3S7J A;  3WXX A;  5KWD A;  3UM0 A;  2GRQ B;  3EDT B;  4BET A;  3TXN A;  3EIQ C;  4H7Y A;  4AJW A;  2WVI A;  3ULY A;  1DC2 A;  1OWL A;  3EJN A;  4F7A A;  3MX3 A;  2VGX A;  5FQ4 A;  4CGW A;  5ENP D;  5KBA A;  4FUL A;  2MOW A;  3D9M A;  4AOF A;  1IHB A;  1U2V G;  3D9O A;  1UW4 B;  5FIO A;  1OWN A;  5B3S E;  2V8S E;  3APF A;  3D9L A;  3UTM A;  4YVQ C;  4FP7 A;  4LNU D;  5HQ8 A;  5E75 A;  3SY2 A;  3CSF A;  2P9L G;  4JL0 A;  1D8D A;  3FTU A;  1TN7 A;  3AU5 A;  3ZXS A;  2LAI A;  1Y6I A;  2WXO A;  5FT9 A;  4CYM D;  3AG4 E;  1SQM A;  3D3M A;  2XEE A;  4Y6W A;  2XQ0 A;  3VLF A;  3CQC B;  1PC2 A;  2DVW A;  5T8I A;  3CVV A;  3L13 A;  5ENT D;  4CCA A;  5BXO A;  4EHM A;  4L2Y A;  1OY3 D;  3ZKJ A;  3NOG D;  3ZVV A;  3V79 K;  3QB2 A;  3RK6 A;  2DWZ A;  2FEZ A;  2LAH A;  1E8Z A;  4U7E B;  2KXP C;  4F6R D;  2KCL A;  4MRU A;  2J08 A;  2PNN A;  5ENR D;  2OOE A;  4KVO A;  2L9B A;  3G2T A;  5JHA A;  1N4R A;  1E90 A;  2R2L A;  3LDZ A;  4AV7 A;  2EIN E;  1O1S A;  4HB5 A;  1HX8 A;  1N11 A;  4JPS A;  4DRX E;  2XGM A;  4ILH B;  3BQO A;  3PUJ A;  3LPZ A;  3FH5 A;  5ARG A;  3ZGQ A;  1E96 B;  2VGX B;  4NRH B;  1KZP A;  1NA3 A;  3OXL A;  4LG6 A;  2IFU A;  3CV0 A;  2R05 A;  3FUK A;  2DIW A;  4J8E A;  2P9S G;  5ARF A;  4I6G A;  4J8D A;  1SVX A;  5EYP F;  3TAX A;  3ZN3 A;  2CG3 A;  1N0R A;  4GA2 A;  1TNO A;  4OVV A;  2J4B A;  3ZPJ A;  4HRN A;  4GA1 A;  2GRR B;  3CR3 A;  2WXI A;  4RG9 A;  4G8L A;  1N0Q A;  5AAR A;  4TXQ A;  5G2N A;  2X6J A;  5T3R A;  1E7U A;  5LFA A;  4U96 D;  2ION A;  4UWK A;  3ZIM A;  3UM1 A;  3L16 A;  1XNF A;  3ZYK A;  4TUU A;  2QYU A;  3ASG A;  5C2Y A;  2Y69 E;  2VSY A;  2Y0B G;  3Q79 A;  4LNG A;  2MHK A;  2X3M A;  4FLB A;  2YIN A;  4ANV A;  4CDM A;  2J09 A;  4I1M A;  3FFL A;  3DXM G;  2VTB A;  3S7B A;  3EHR A;  4YDY A;  1O1T A;  3KD7 A;  2VQ2 A;  2E0I A;  5FQ7 A;  2XS8 A;  1MX6 A;  3LJ3 A;  1N9A A;  4DJA A;  5J90 A;  3FEX A;  3C72 A;  2WXJ A;  2ETB A;  5CEC B;  5CCM A;  3DSX A;  3V30 A;  5AQ9 A;  3Q47 B;  1ELK A;  3AS5 A;  4GTO A;  5BXU A;  3HIZ A;  5CBN A;  4IRU A;  4Y6C A;  2P58 C;  3AS4 A;  3L17 A;  3ZYQ A;  2YQ8 A;  4KMO A;  3RAU A;  3E34 A;  4JC8 A;  5CEA A;  1OWO A;  1Q2Z A;  4KT6 B;  3EUV A;  4PS8 A;  4UQZ A;  3MV3 B;  3MZL B;  2R03 A;  1SZA A;  3F6Q A;  5KJM A;  1K8K G;  3ZRH A;  4DPR A;  1YYH A;  4TUM A;  4RSY A;  3SF4 A;  1MYO A;  4BER A;  3RO2 A;  3PZ2 A;  4JHR A;  4MLP A;  4DUI A;  3PUK A;  3JUE A;  5HKP A;  1TN6 A;  4OYS A;  3PDN A;  3UQ3 A;  2R17 C;  3ESK A;  3X2Q E;  4BFR A;  2ETA A;  1INZ A;  3ZNG A;  3TXM A;  4BES A;  3RRM B;  3C3Q A;  3Q9N C;  3I4R B;  2EIJ E;  2WXL A;  4G24 A;  4EBA G;  4J8F A;  4U63 A;  3C3O A;  4WNE A;  4N39 A;  1IHG A;  2BF0 X;  2ZGG A;  4CZ2 D;  2ZU6 B;  1JCS A;  3APD A;  2MRI A;  2I1K A;  3JUI A;  3TG5 A;  3ZXP A;  2XEH A;  3JXJ A;  1FT2 A;  2VGY A;  1S63 A;  2WXN A;  3Q7F A;  4A63 B;  3QWV A;  2GRP B;  2IU1 A;  3W9G A;  2VTB B;  2XRY A;  3D9N A;  1OCC E;  3LCA A;  3UIN C;  4GA0 A;  5EKQ D;  3VLE A;  2IJG X;  5EX0 A;  3MV2 B;  3FEY A;  4C9B B;  2LSU A;  2J9Q A;  4UWH A;  3FTY A;  3E30 A;  4WND A;  3LY9 A;  3UKU G;  4HOQ A;  4U0S A;  4GTP A;  4BSZ B;  3CIA A;  2WMN A;  4AEZ C;  1N4S A;  3UUX A;  3U9W A;  4K5A B;  2X6I A;  2BED A;  5G04 J;  4XEI G;  4G26 A;  5A6C A;  2PL2 A;  5EN5 D;  3QAR A;  4ZFH A;  4AY6 A;  5KJK A;  4HQD A;  4GTQ A;  1Z5S C;  2VSN A;  3D9J A;  4LUN U;  4JD2 G;  4PUC A;  2XPI A;  3PZD A;  4I2W A;  1KPS B;  4KZC A;  4UWL A;  1JWF A;  4BTA A;  2R5S A;  4J0U A;  1KZO A;  4R7L A;  3FUE A;  5ENN A;  4D10 C;  2WQH A;  1S0P A;  1H2U A;  3TWV A;  2A5E A;  2FUL A;  1YA0 A;  3LEW A;  2WMO A;  5CCL A;  4ILI A;  3HVE A;  2UY1 A;  2V5Q C;  2WXF A;  3ASO E;  4C0M A;  4A3T A;  1IYG A;  3V2X A;  4GU5 A;  5AQ7 A;  5BV0 A;  4FA6 A;  2GRM A;  3URZ A;  2RG8 A;  3IXE A;  3FUM A;  4AVX A;  3NOC D;  3SO8 A;  5FZQ A;  1QZ2 A;  4GMR A;  4JVS A;  4CT0 A;  4G25 A;  2C0L A;  3BUA A;  5CHE E;  5KJN A;  1QYM A;  1TNY A;  1NP7 A;  4WNF A;  2EIK E;  2OVB A;  3T5X A;  3JYS A;  2DZO A;  2AXZ A;  3QJZ A;  1P5Q A;  4U0U A;  1SA4 A;  4WAF A;  1IQU A;  1N94 A;  3SI5 A;  4J6I A;  3CHM A;  3ASH A;  5B1B E;  3UT7 A;  4I6J A;  1Z3Y A;  3ONL A;  2GRN B;  4HOS A;  3T8K A;  4EPZ A;  2V5F A;  5FWQ A;  1N95 A;  3RU0 A;  5EID A;  3AG1 E;  5CED B;  1WAO 1;  4Q96 A;  3HYM B;  3UT4 A;  3VTY A;  3ASD A;  4MKT A;  1JWG A;  3DSW A;  3S7D A;  2YHC A;  1UJJ A;  4AP2 A;  3T8M A;  2YHE A;  3EHQ A;  3L6A A;  2WM9 A;  4GYW A;  2XEN A;  1TEZ A;  2CHX A;  2YNQ A;  4UI9 J;  2WXH A;  5G55 A;  2L6B A;  4I6E A;  1E8X A;  1RW2 A;  4HLL A;  4DX1 A;  4YVO A;  1LF8 A;  3N71 A;  4GZ5 A;  4KZ0 A;  1H6O A;  1NZN A;  3NQP A;  3FU6 A;  2OND A;  3HVE B;  2RD0 A;  4HNA D;  2UY1 B;  4NIK A;  5EIB E;  3B7T A;  2HYZ A;  3FU5 A;  3Q78 A;  2EIL E;  4BSX A;  3UX4 A;  2WQ6 A;  4EZK A;  4KVM A;  4G2V A;  3NF1 A;  1S64 A;  4U95 D;  2RFA A;  2R59 A;  1TJC A;  3CHQ A;  2RKK A;  1OT8 A;  3C3R A;  5KJL A;  1D9S A;  3DSU A;  3FUD A;  3KSL A;  4XZ4 A;  1UN8 A;  5AQA A;  5FZR A;  4PH4 B;  5JA4 D;  1G3N B;  3PH0 C;  3FUF A;  1ELW A;  5FQ6 A;  5ITZ F;  4OAU C;  3FUH A;  5HS0 A;  2PM6 A;  1NI1 A;  1EPU A;  4DI3 A;  4DX7 D;  5DBK A;  3KSQ A;  1HG2 A;  2PM7 A;  2P2C P;  4IN3 B;  4ZHB A;  4F1P A;  3ZUV B;  4K5B A;  1DCQ A;  4TXP A;  4ME2 A;  3LS8 A;  2ILR A;  4GTV A;  4XIF A;  5BT1 A;  3FWV A;  3OAW A;  3HRA A;  3FHE A;  3GZ1 A;  4G8K A;  3ABK E;  3W9F A;  1EYH A;  3I3N A;  3G2V A;  4GTS A;  3SZ7 A;  3S7F A;  3Q7A A;  4LRZ A;  4LNB A;  1OCO E;  2OEW A;  4QFV A;  4LER A;  4IYP A;  2XPZ A;  1PAQ A;  3UM2 A;  3FTZ A;  4B8C B;  5BUZ A;  2I6H A;  4A3V A;  3D9K A;  4QQI A;  3S2A A;  3DST A;  3PVL A;  1HZ4 A;  3ZHE A;  1E7V A;  4YDE A;  4EZJ A;  2OVF A;  2HR2 A;  3FH8 A;  3TWU A;  3PS6 A;  2H6H A;  2ZXW E;  4N5Q A;  3G2S A;  5IY5 E;  3SFZ A;  4O1P A;  3SBT B;  1UJK A;  1N52 A;  1MJ0 A;  3FUI A;  1H2V C;  4A1G A;  3TWT A;  4N5C A;  4E85 A;  3RSE G;  3B13 A;  4AM9 A;  3ZEF A;  1OWP A;  4U8H A;  2CHZ A;  3JQ0 A;  3EHN A;  2OCC E;  3L9T A;  1Z3X A;  5KNG A;  1MX4 A;  2IOL A;  1H6P A;  3CHO A;  2ZIS A;  2WXR A;  4M7C A;  2B6C A;  3ZU7 B;  3Q49 B;  1DNP A;  2BUG A;  4GCN A;  3JCK C;  3SD5 A;  2GGF A;  3NZU A;  3QWW A;  2P9P G;  1S70 B;  5D2M C;  3CGH A;  1JUQ A;  3HXD A;  2AXU A;  4G11 A;  4GTM A;  1HE8 A;  4K5C A;  3UM3 A;  1OWM A;  2UWJ G;  4O60 A;  1JCR A;  3L82 A;  2VYI A;  4N3C A;  5M72 A;  4FAD A;  3O4Z A;  4F53 A;  3HDX A;  2C2L A;  4HFG A;  2WXQ A;  4HS2 A;  2XCC A;  3BG1 B;  4GZ3 A; 
#chains in the Genus database with same CATH homology
 3UKU G;  2P9I G;  3RSE G;  3DXM G;  3DWL G;  1TYQ G;  1U2V G;  3DXK G;  2P9L G;  3UKR G;  2P9P G;  4JD2 G;  2P9S G;  4XEI G;  2P9K G;  1K8K G;  3ULE G;  2P9N G;  2P9U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...