2P9UG

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
116
Chain Sequence
b'ARFRKVDVDEYDENKFVDEMTAALQAALKNPPSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 36
structure length 116
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9uG00
2P9UG 3UKUG 3DXMG 1K8KG 3DXKG 3RSEG 2P9PG 1TYQG 2P9SG 3UKRG 3DWLG 2P9NG 4JD2G 3ULEG 1U2VG 2P9IG 4XEIG 2P9KG 2P9LG
chains in the Genus database with same CATH superfamily
4BWRA 4K03A 3KAEA 4AEZC 3UT7A 4U8VD 3IXEA 3DWLG 2DWZA 4PS7A 1OCZE 4JHJA 4L1BA 3ENEA 2ZGDA 5CRUA 4U04A 2A5EA 3EJNA 4C0EA 4UWKA 2IFUA 2FI7A 2L0IA 3ZFWA 4CT0A 4FJYA 3FEXA 3R9AB 2DZNA 3FFLA 1E96B 3Q49B 3ZYLA 3QB2A 4C0MA 1E7VA 4PS3A 3Q5MA 4RG9A 1UG3A 4YVQC 3SZ7A 2EQXA 3T8KA 3UKUG 2J09A 3S7BA 5G2NA 1FVFA 4KBQA 4C48B 3Q7FA 3RKVA 4I6JA 4GAAA 3UM2A 3UPVA 3Q47B 2WM9A 4HB5A 2M63A 4XE0A 1GW6A 3MV2B 4J8SA 2KCKA 5CMYA 3B7SA 3T8MA 3ONLA 2YNQA 3C72A 3RIBA 2BF0X 3UIOC 1MYOA 1H0AA 5ITZF 1V54E 3FU5A 5EDSA 3ASDA 3UX4A 3VTYA 2GRRB 3FUEA 2I6HA 4NACA 4XI9A 4Q69A 3RSEG 3ZYKA 4HI9A 3ASFA 4GZ5A 1SVXA 3HXEA 4LNBA 2ILRA 4GA1A 4YDYA 3S7FA 4N2SA 3QDNA 4N3BA 3IKOB 5G55A 1S70B 3UM3A 1KT1A 4ME2A 3NOCD 4GTVA 5FQ4A 4HQDA 3I4GA 3I4RB 3DSSA 4DPRA 4JA7A 4BSZB 2LXLA 4OYSA 5FQ6A 1LD7A 1XGWA 3UIPC 3FP3A 3PS6A 2ONDA 1IXVA 3TWVA 3CGHA 4N5QA 5EILA 3CVQA 3PUJA 2R17C 3R7QA 3TG4A 3CR3A 1VDYA 2V5QC 2H6GA 4UQZA 1Q2ZA 3DEOA 2C2LA 4KZCA 3NQPA 3EIQC 4M3OA 4ILIA 4TXPA 4D10C 5E75A 2PNNA 4H7YA 1A17A 4DI4A 2MHKA 4OVVA 1IHBA 2WXLA 5CERB 4U96D 2VTBA 3UINC 2Y4TA 4MRUA 5G05C 4J7WA 4G11A 5HKPA 1FT2A 3VLDA 3V2OA 5B3SE 2IO2C 1KLXA 3B7RL 1ELKA 2EINE 5JMND 4GPKA 3LYAA 4RLYA 4AY5A 3L54A 4J6IA 3B95A 4Y6WA 4LSZE 2ZISA 3ISMC 3ULEG 5BV1A 5FZRA 3ASGA 1TNOA 4JW1A 5ENOD 3CKCA 3Q15A 2IF4A 4NURA 2R59A 4L2YA 3D9OA 2PQNA 3HVEB 1N0QA 1JUQA 4I9EA 3SFXA 3PUKA 1TNZA 2WMNA 3FTYA 3SD5A 1JCRA 4MKTA 4JB8P 4BTBA 3FWVA 2MOWA 4GTSA 3FUNA 3GW4A 4XEIG 1K3ZD 4BSXA 3UM1A 5ENNA 2FBNA 4XIFA 5AARA 2BTDA 4UWLA 4E85A 3JUEA 4HRLA 4MS6A 3ZEFA 3LEWA 1YA0A 3FTUA 3Q9UC 2Y3AA 1DCQA 3FH7A 4BX8A 3AU4A 4ABNA 4TRQA 2X3MA 4EHMA 4F7AA 2KZTB 5LCWC 2CFUA 4Q96A 3CV0A 3EU5A 4GYWA 2IEJA 2XEVA 4BESA 1BU9A 4N2QA 1KPSB 1U3CA 3U64A 2E2EA 5DIZA 4N39A 3NAWA 2WXMA 3NF1A 2NYJA 4UI9J 2QZAA 2ZXWE 3CVWA 4FLHA 5B1AE 3ZHEB 2PQRA 4I9CA 1OWPA 4UQYA 3FUDA 3ONKA 1TN8A 4GZCA 4CEMA 2QYUA 5LX8A 5BPPA 2P9NG 4X8QA 5JHBA 5LFAA 2L9BA 3E30A 2NC9A 5FWQA 3R9MA 3ZGQA 4F3VA 4U95D 5AIJA 5HS0A 4JPSA 5EYLA 3L16A 3MKRA 1WG0A 3MGBA 3BG0B 3PNTB 5AAOA 4DLQA 3JYSA 2V8SE 3EHNA 1IQUA 2XPZA 1IQRA 1H2TC 3HXFA 5AQ7A 2ETAA 4U0SA 2H6HA 3NZSA 4OAUC 3QAQA 2E0IA 2GGFA 1KT0A 3RO2A 3L6AA 3QK0A 4I2WA 5KCMA 1V55E 4HLEA 2YHEA 4LERA 4GU5A 4L9PA 1TN7A 3HDXA 3P2BA 1BI7B 1QBQA 4J8EA 3GZSA 3G2VA 2WMOA 4ACLA 1H6PA 4IYPA 4JL0A 3E37A 4PH4B 2WXOA 3ZRHA 4DUIA 4LCTA 3JCKC 1BI8B 3DBSA 4GTPA 3KEAA 1HXIA 1AWCB 3APDA 1E8ZA 4IN3B 3BUAA 3ASNE 2P58C 4KYOB 2VGXA 1OUVA 2UY1A 1XNFA 3VLFA 1S64A 5EX0A 4GTQA 4GCOA 1HFAA 2WQ7A 3SBTB 4I43A 2FO7A 3J5PA 3QWVA 3ABLE 1N52A 3G2TA 2HO1A 4AXHA 2VSYA 2OVBA 1EPUA 4KZ0A 2V5FA 3BQOA 4P29A 2Y0BG 2R5SA 4WNGA 4I1MA 5M72A 2J4BA 4J8FA 2XEEA 5JA4D 2OVFA 3LS8A 3D9PA 4TV3A 2C0MA 3UUXA 4XX5A 1UJKA 5KJNA 3CVVA 2EILE 4YDOA 5KJKA 1QQEA 3FTXA 4B94A 2WXNA 2LAHA 4WNDA 1K8KG 2P9PG 3I3NA 4IRUA 1E90A 4RQIA 1FT1A 1ZBPA 5AYWD 1U2VG 2F37A 3QC1A 3FHEA 1HG5A 5LP0A 4O60A 5FQ8A 1H2UA 3AS8A 3E34A 3DPDA 4GPMA 3EHMA 3ZVVA 3HIZA 5CECB 4A1GA 2J07A 4JZYA 3OXFA 3S7DA 3CVUA 2WPVA 3E4BA 1UJJA 3DPYA 1Z3XA 4HFGA 1N11A 1HG2A 3PZDA 1HE8A 2X6IA 4WWNA 4JVSA 3TL5A 1UW4B 3MX3A 4XKBA 3UT8A 1N0RA 2B0OE 3CHOA 5EIBE 1D8EA 3C3OA 4U0ZA 5KNHD 3BEEA 4WWPA 2WXPA 3QARA 4TXQA 5DBKA 1Z6TA 2RKKA 3FUKA 2OV8A 3Q9NC 3I5PA 3MV3B 4EQFA 2MRIA 2RFMA 4DX6D 5ARGA 1L5JA 4JHKA 3QKYA 3HXDA 2VSNA 2KATA 3UM0A 2GRLA 4TUMA 2WXKA 1WAO1 2I1JA 1OWMA 2VYIA 5AQ9A 3FULA 2PM7A 4LNGA 4DX2A 2XPYA 3W9FA 3MJWA 1RZ4A 4LRZA 2XQ0A 4DLOA 2HM8A 2YQ8A 3QJZA 2PZIA 3RJVA 1O1SA 3CK9A 3QWWA 1YYHA 2KBXA 2WXGA 5BNWA 2V0PA 3APCA 5D66A 4E6HA 1SA5A 4A3VA 3EHRA 3AS4A 5KBAA 4AP2A 1JPLA 1D8DA 5G04C 3R7RA 2XS1A 3KSQA 2R03A 3SFZA 4IULA 3BU8A 4BETA 2WXQA 1DC2A 2XZTG 2RFAA 3TWQA 1JCQA 2LO6A 3LVQE 3ESLA 3JUIA 3PE3A 4PDXA 2DIWA 4Q94A 4FC8A 4AY6A 3ABME 3ABKE 3FUHA 3AJIA 3CIAA 4LUNU 3LY8A 2AWIA 3FH8A 3CHMA 3HG0D 4I1AA 2CG2A 4O6FA 2R02A 3L13A 2HE0A 2P9IG 3V79K 5JJ7A 2V4LA 3ZUVB 3T5VA 4U8HA 5D2MC 1YCSB 3CSTA 4RVBA 3J5QB 3DSVA 5EKQD 5KWDA 4O1PA 4OVUA 2DZOA 2IQCA 1UOHA 3AG1E 3LVRE 4EZLA 5A6CA 4FA6A 2IO3C 5CRVA 2B6CA 3L08A 3CHPA 1IYGA 4G24A 5D0OD 3FDHA 5BUZA 2FEZA 3EHQA 4A3TA 3HHMA 4CZ2D 3CKBA 3CHSA 4K0RA 2KZTA 4U8YD 1OXJA 5HQ8A 4N5CA 1MX2A 2XENA 1O1RA 1ZB1A 3TXMA 1N54A 5AJLA 1JCSA 4I1OB 1W3BA 3D9HA 1WY6A 2J49A 3RAUA 5JJTA 4N3AA 3LPZA 2FULA 1HZ4A 2XGSA 4JHRA 4RG6A 2XRZA 1EF1C 1HH8A 3LXUX 3SNXA 3EUVA 4U63A 4ANXA 3X2QE 5CHEE 4NRHB 1TJFA 4UWFA 3FTWA 4HOUA 4U0UA 5BV0A 3E32A 5JJ6A 2VTBB 1QNFA 1OCRE 4UWGA 1N4PA 4RSYA 1MX4A 3FTSA 5CCLA 3IHYA 3CK8A 4FHKA 5A23A 2P9UG 4H7XA 2VQ2A 4K5CA 5ARFA 2R05A 4FULA 4HBDA 4CT4A 3ULQA 2J08A 2MYOA 3EU9A 4GTRA 4APFA 3FU6A 3MEKA 3D9NA 4GCNA 3FU0A 3ULYA 3S2AA 2AXUA 3D9LA 3NZUA 2WXFA 4HXIA 5IY5E 5CBNA 4M7CA 1HU3A 1WDYA 3LDZA 2WVIA 4KT6B 3O48A 3DSUA 3UQ3A 4GMRA 4Y6CA 1LF8A 3ZXPA 3TJPA 2GRNB 3APFA 2CG3A 3TAXA 4XZ4A 4YVOA 3JQ1A 4JA9A 2X38A 5FTPA 3ZYMA 4NQ0A 4EBAA 2IY0C 3O4ZA 4J0UA 4CGWA 2ETBA 2FO1E 4B0ZA 1FVHA 4G25A 2DCPA 2JEKA 5AN8A 5G04J 2HR2A 3B13A 4GYYA 2VJ8A 3URZA 3L22A 3RRNB 5E76A 2XRYA 2WXHA 2GRPB 4EZJA 3UMVA 4TXRA 2XEHA 3LY7A 3RO3A 3HYMB 2LAIA 3GYZA 1BPOA 3ZIMA 1ELRA 4BX9A 4YDWA 3CEQA 1YMPA 4WNFA 2CHXA 4CCAA 3NBNB 3BG1B 3OXGA 5KNGA 1TR4A 2AW6A 3TWWA 4K5AB 5FIOA 4GTOA 3TWUA 3RRMB 4UUCA 5ENTD 3L9TA 4I6EA 1EDUA 2BEDA 2IJGX 1OT8A 2LNIA 2HYZA 2L0TB 5G05J 3CK7A 3ZXSA 2XGOA 2BKGA 2C0LA 3ZN3A 1RW2A 5J90A 3TG5A 2AJAA 2L6BA 2X6JA 4BEPA 1WM5A 3U9WA 4AOFA 2VGEA 4HRNA 3CVPA 3NB2A 4GZ6A 4G26A 1IKND 3DXKG 4UWHA 1OY3D 3QWPA 2V4HC 3IEGA 3LCAA 3ZKJA 1Y8MA 5EIDA 5BT1A 3QOUA 4ILHB 1OWNA 1TNBA 2QYJA 4FP7A 2OOEA 3QNKA 2FF4A 1E8YA 1JWFA 2BUGA 5AQAA 3C3RA 1LD8A 3UKRG 4B8AA 4B8CB 2EIME 3RU0A 4WAFA 1JWGA 1N9AA 3L82A 3PZ2A 2WB2A 4ANWA 1QYMA 4HS2A 1D9SA 4C9BB 3MCXA 1K1BA 5FT9A 3DSWA 3C5RA 5ENQD 1X5BA 1U3DA 1TYQG 3TWXA 3ML9A 4L23A 3FUMA 2IU1A 3KEZA 1TNYA 5BXOA 2XZDG 3C3QA 2F0YA 2GW1A 4MBGA 4BT8A 4PS8A 5LCWJ 2YHCA 1N94A 4XKCA 4HOSA 2Y4UA 4B93B 4JEUA 2H6FA 4HOTA 1DVPA 1H6KA 5ANRA 2QFCA 4YNDA 3IV0A 2YINA 2P9LG 4I2ZA 4V3IA 3RK6A 2XCBA 3G2WA 5CBOA 4GMJA 4HRMB 3D9MA 1TNUA 4GA2A 4HNAD 3SFYA 1H2VC 4JC8A 1TJCA 4JXTA 2DVWA 2KCLA 4HI8A 2BKKB 3PZ3A 4W9RA 1KZOA 4F53A 3SI5A 2VSOE 1IHGA 3PZ4A 2WXRA 3MKQB 3DSXA 4JEHA 5AQBA 3LJ3A 3TWTA 2WXIA 1NL4A 5CMWA 2I9CA 4FJZA 5C2YA 1Y6IA 4QQIA 4YDEA 3UI2A 2PM6A 3SY2A 3VLEA 4HOQA 3V30A 4ANUA 4URKA 3FTZA 1HO8A 1BLXB 5T8IA 4CDMA 3T9KA 1E7UA 4ILGA 4UI9K 4G2VA 1SA4A 1PC2A 2OCCE 3PRZA 4AM9A 4AVXA 4AIFA 1SZAA 3S7JA 4UI9C 1OWOA 1G3NB 2F8YA 3RRUA 3PNLB 3FTVA 2CHZA 4CGVA 2VSXE 1NA3A 5C1DA 5ENRD 3TWSA 3D9JA 4KXKB 2CHWA 2J9QA 1SW6A 3PREA 4DK5A 3MA5A 2NXPA 2GRMA 2L6JA 2XS8A 1NP7A 4I6GA 1UN8A 4BFRA 3IBEA 1MQSA 3UXGA 2LXMA 3B7BA 3ZU7B 4OAVB 3CVXA 4BTAA 4DX7D 4CDNA 4FHJA 1N95A 4NIKA 4GYOA 4F1PA 3Q4AB 4GTTA 4HVBA 3OAWA 1S0PA 3PEVB 3CHQA 3HRAA 3VTXA 3AG4E 3JXIA 3KD7A 2H6IA 2X6FA 4ACKA 4DRXE 4DX1A 1HS6A 3SF4A 4TUUA 2LSUA 1TN6A 5ANLA 3PDNA 4L7TA 3PH0C 5BXUA 4WWOA 5J08A 3HXCA 2DBAA 3ZPJA 3U4TA 5FZQA 3HVEA 1X81A 2DYRE 3SBSA 4U07A 4A55A 1NA0A 3CQCB 4FLBA 4F6RD 1FPPA 2ZGGA 2AXVA 1PAQA 2KCVA 1P5QA 3Q78A 4LNUD 3OXLA 1OCOE 3MZLB 2ZIRA 4ATGA 2LSVA 5FJYA 3TGOA 1Z5SC 5A7DB 4WUYA 5AJDA 1OWLA 3ZW3A 2P2CP 3SO8A 2QC9A 2J4DA 4U7EB 3Q7AA 1EYHA 2XGMA 2EIJE 1FCHA 4KVOA 3SGHA 1E8WA 1NZNA 3DEPA 4BERA 5BW8C 3W9GA 3UTMA 4APOA 4ZHBA 3K9IA 1O1TA 2Y1LE 4J8DA 1HX8A 4K5BA 3LJNA 4CDRA 1A5EA 4R7LA 2XCCA 5H7PA 4B89A 3JQ0A 5ENSD 5FQ7A 3PVLA 3Q73A 3Q79A 3AU5A 5EN5D 3DSTA 3EDTB 5LOZA 4AJWA 2JABA 4G1TA 1ELWA 1DCEA 1NFIE 4A1SA 2WQ6A 4ANVA 1SZ9A 3AAAC 2IOLA 4N3CA 3ESKA 4EPZA 3ZHEA 2Q7FA 2X6KA 3FH5A 3TXNA 3N71A 3V31A 2WXJA 2ZU6B 5D0QD 3L17A 2GROB 5AENA 2ETCA 3CVYA 2XPIA 5FZSA 4BY6A 2I1KA 4PUCA 4JD2G 1H19A 3OTNA 4BT9A 3FUFA 4HORA 1H6OA 4GTMA 2DYSE 3CVNA 3CLJA 1B89A 5ENPD 2JLBA 3FUJA 3HXBA 1DNPA 4J8YA 2EIKE 1NI1A 2P9KG 4GB9A 3ZNGA 2KC7A 3ASOE 1E8XA 2WQHA 4L2LA 3G2SA 5KJLA 4A63B 4GZDA 1MHQA 3GZ1A 4KVMA 2R2LA 3AG2E 4O1OA 3AG3E 1INZA 1S63A 3G2UA 2XHEA 2LUHA 2P9SG 1ZU2A 4G8KA 4CYMD 3WG7E 2GRQB 2AXZA 5FINA 2I2OA 3F6QA 2A5UA 3D3MA 4G23A 2RD0A 3DXMG 2F8XK 3Q75A 3E33A 3UT4A 2J8SD 4FU3A 3SHFA 3C98A 4GZ3A 4QFVA 3FY4A 4CRWA 2KXPC 3PE4A 4Z68A 5CCMA 1SQMA 4EBAG 4GMLA 2CFZA 4LEUA 3CVLA 3AS5A 5T4YA 5EYPF 1KZPA 5HI7A 3EIJA 5T3RA 4AV7A 3JXJA 3FEYA 1UN9A 3TWRA 1PY1A 3LY9A 2QY7A 4ZFHA 1LTXA 3B7TA 3U3WA 3FUIA 1K1AA 4GA0A 2UWJG 1MX6A 3CSFA 4MLPA 1BD8A 2IOSA 3V2XA 1MJ0A 1MZCA 4EECA 2A4ZA 3U66A 3NOGD 5HRYA 1TEZA 2PL2A 2AVPA 5CEAA 3P1UA 4XI0A 4UQXA 1QZ2A 3FU3A 4DJAA 2KM4A 3D9IA 1N4RA 5B1BE 4F1SA 3PZ1A 3D9KA 4I17A 4G8LA 2RG8A 3CQGB 3WXXA 1HF8A 2Y69E 3SQVA 3B7UX 4FADA 2X6HA 3KS2A 3KSLA 2OEVA 3ML8A 3ASHA 1AP7A 3PEUB 5EX3A 4HLLA 4DX5D 3CHRA 4ATZD 3MYVA 4WNEA 1N4SA 4DI3A 1N4QA 3DRAA 2VGYA 3T5XA 3IHVA 3LKUA 4KMOA 1OCCE 4EZKA 5CEDB 2IONA 3ZYQA 2VGXB 3MKQA 2UY1B 3GZ2A 5KJMA 4LG6A 2NSZA 2OEWA 1Z3YA 1O5MA 5JHAA
chains in the Genus database with same CATH topology
2P9UG 3UKUG 3DXMG 1K8KG 3DXKG 3RSEG 2P9PG 1TYQG 2P9SG 3UKRG 3DWLG 2P9NG 4JD2G 3ULEG 1U2VG 2P9IG 4XEIG 2P9KG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9U G;  3UKU G;  3DXM G;  1K8K G;  3DXK G;  3RSE G;  2P9P G;  1TYQ G;  2P9S G;  3UKR G;  3DWL G;  2P9N G;  4JD2 G;  3ULE G;  1U2V G;  2P9I G;  4XEI G;  2P9K G;  2P9L G; 
#chains in the Genus database with same CATH topology
 4BWR A;  4K03 A;  3KAE A;  4AEZ C;  3UT7 A;  4U8V D;  3IXE A;  3DWL G;  2DWZ A;  4PS7 A;  1OCZ E;  4JHJ A;  4L1B A;  3ENE A;  2ZGD A;  5CRU A;  4U04 A;  2A5E A;  3EJN A;  4C0E A;  4UWK A;  2IFU A;  2FI7 A;  2L0I A;  3ZFW A;  4CT0 A;  4FJY A;  3FEX A;  3R9A B;  2DZN A;  3FFL A;  1E96 B;  3Q49 B;  3ZYL A;  3QB2 A;  4C0M A;  1E7V A;  4PS3 A;  3Q5M A;  4RG9 A;  1UG3 A;  4YVQ C;  3SZ7 A;  2EQX A;  3T8K A;  3UKU G;  2J09 A;  3S7B A;  5G2N A;  1FVF A;  4KBQ A;  4C48 B;  3Q7F A;  3RKV A;  4I6J A;  4GAA A;  3UM2 A;  3UPV A;  3Q47 B;  2WM9 A;  4HB5 A;  2M63 A;  4XE0 A;  1GW6 A;  3MV2 B;  4J8S A;  2KCK A;  5CMY A;  3B7S A;  3T8M A;  3ONL A;  2YNQ A;  3C72 A;  3RIB A;  2BF0 X;  3UIO C;  1MYO A;  1H0A A;  5ITZ F;  1V54 E;  3FU5 A;  5EDS A;  3ASD A;  3UX4 A;  3VTY A;  2GRR B;  3FUE A;  2I6H A;  4NAC A;  4XI9 A;  4Q69 A;  3RSE G;  3ZYK A;  4HI9 A;  3ASF A;  4GZ5 A;  1SVX A;  3HXE A;  4LNB A;  2ILR A;  4GA1 A;  4YDY A;  3S7F A;  4N2S A;  3QDN A;  4N3B A;  3IKO B;  5G55 A;  1S70 B;  3UM3 A;  1KT1 A;  4ME2 A;  3NOC D;  4GTV A;  5FQ4 A;  4HQD A;  3I4G A;  3I4R B;  3DSS A;  4DPR A;  4JA7 A;  4BSZ B;  2LXL A;  4OYS A;  5FQ6 A;  1LD7 A;  1XGW A;  3UIP C;  3FP3 A;  3PS6 A;  2OND A;  1IXV A;  3TWV A;  3CGH A;  4N5Q A;  5EIL A;  3CVQ A;  3PUJ A;  2R17 C;  3R7Q A;  3TG4 A;  3CR3 A;  1VDY A;  2V5Q C;  2H6G A;  4UQZ A;  1Q2Z A;  3DEO A;  2C2L A;  4KZC A;  3NQP A;  3EIQ C;  4M3O A;  4ILI A;  4TXP A;  4D10 C;  5E75 A;  2PNN A;  4H7Y A;  1A17 A;  4DI4 A;  2MHK A;  4OVV A;  1IHB A;  2WXL A;  5CER B;  4U96 D;  2VTB A;  3UIN C;  2Y4T A;  4MRU A;  5G05 C;  4J7W A;  4G11 A;  5HKP A;  1FT2 A;  3VLD A;  3V2O A;  5B3S E;  2IO2 C;  1KLX A;  3B7R L;  1ELK A;  2EIN E;  5JMN D;  4GPK A;  3LYA A;  4RLY A;  4AY5 A;  3L54 A;  4J6I A;  3B95 A;  4Y6W A;  4LSZ E;  2ZIS A;  3ISM C;  3ULE G;  5BV1 A;  5FZR A;  3ASG A;  1TNO A;  4JW1 A;  5ENO D;  3CKC A;  3Q15 A;  2IF4 A;  4NUR A;  2R59 A;  4L2Y A;  3D9O A;  2PQN A;  3HVE B;  1N0Q A;  1JUQ A;  4I9E A;  3SFX A;  3PUK A;  1TNZ A;  2WMN A;  3FTY A;  3SD5 A;  1JCR A;  4MKT A;  4JB8 P;  4BTB A;  3FWV A;  2MOW A;  4GTS A;  3FUN A;  3GW4 A;  4XEI G;  1K3Z D;  4BSX A;  3UM1 A;  5ENN A;  2FBN A;  4XIF A;  5AAR A;  2BTD A;  4UWL A;  4E85 A;  3JUE A;  4HRL A;  4MS6 A;  3ZEF A;  3LEW A;  1YA0 A;  3FTU A;  3Q9U C;  2Y3A A;  1DCQ A;  3FH7 A;  4BX8 A;  3AU4 A;  4ABN A;  4TRQ A;  2X3M A;  4EHM A;  4F7A A;  2KZT B;  5LCW C;  2CFU A;  4Q96 A;  3CV0 A;  3EU5 A;  4GYW A;  2IEJ A;  2XEV A;  4BES A;  1BU9 A;  4N2Q A;  1KPS B;  1U3C A;  3U64 A;  2E2E A;  5DIZ A;  4N39 A;  3NAW A;  2WXM A;  3NF1 A;  2NYJ A;  4UI9 J;  2QZA A;  2ZXW E;  3CVW A;  4FLH A;  5B1A E;  3ZHE B;  2PQR A;  4I9C A;  1OWP A;  4UQY A;  3FUD A;  3ONK A;  1TN8 A;  4GZC A;  4CEM A;  2QYU A;  5LX8 A;  5BPP A;  2P9N G;  4X8Q A;  5JHB A;  5LFA A;  2L9B A;  3E30 A;  2NC9 A;  5FWQ A;  3R9M A;  3ZGQ A;  4F3V A;  4U95 D;  5AIJ A;  5HS0 A;  4JPS A;  5EYL A;  3L16 A;  3MKR A;  1WG0 A;  3MGB A;  3BG0 B;  3PNT B;  5AAO A;  4DLQ A;  3JYS A;  2V8S E;  3EHN A;  1IQU A;  2XPZ A;  1IQR A;  1H2T C;  3HXF A;  5AQ7 A;  2ETA A;  4U0S A;  2H6H A;  3NZS A;  4OAU C;  3QAQ A;  2E0I A;  2GGF A;  1KT0 A;  3RO2 A;  3L6A A;  3QK0 A;  4I2W A;  5KCM A;  1V55 E;  4HLE A;  2YHE A;  4LER A;  4GU5 A;  4L9P A;  1TN7 A;  3HDX A;  3P2B A;  1BI7 B;  1QBQ A;  4J8E A;  3GZS A;  3G2V A;  2WMO A;  4ACL A;  1H6P A;  4IYP A;  4JL0 A;  3E37 A;  4PH4 B;  2WXO A;  3ZRH A;  4DUI A;  4LCT A;  3JCK C;  1BI8 B;  3DBS A;  4GTP A;  3KEA A;  1HXI A;  1AWC B;  3APD A;  1E8Z A;  4IN3 B;  3BUA A;  3ASN E;  2P58 C;  4KYO B;  2VGX A;  1OUV A;  2UY1 A;  1XNF A;  3VLF A;  1S64 A;  5EX0 A;  4GTQ A;  4GCO A;  1HFA A;  2WQ7 A;  3SBT B;  4I43 A;  2FO7 A;  3J5P A;  3QWV A;  3ABL E;  1N52 A;  3G2T A;  2HO1 A;  4AXH A;  2VSY A;  2OVB A;  1EPU A;  4KZ0 A;  2V5F A;  3BQO A;  4P29 A;  2Y0B G;  2R5S A;  4WNG A;  4I1M A;  5M72 A;  2J4B A;  4J8F A;  2XEE A;  5JA4 D;  2OVF A;  3LS8 A;  3D9P A;  4TV3 A;  2C0M A;  3UUX A;  4XX5 A;  1UJK A;  5KJN A;  3CVV A;  2EIL E;  4YDO A;  5KJK A;  1QQE A;  3FTX A;  4B94 A;  2WXN A;  2LAH A;  4WND A;  1K8K G;  2P9P G;  3I3N A;  4IRU A;  1E90 A;  4RQI A;  1FT1 A;  1ZBP A;  5AYW D;  1U2V G;  2F37 A;  3QC1 A;  3FHE A;  1HG5 A;  5LP0 A;  4O60 A;  5FQ8 A;  1H2U A;  3AS8 A;  3E34 A;  3DPD A;  4GPM A;  3EHM A;  3ZVV A;  3HIZ A;  5CEC B;  4A1G A;  2J07 A;  4JZY A;  3OXF A;  3S7D A;  3CVU A;  2WPV A;  3E4B A;  1UJJ A;  3DPY A;  1Z3X A;  4HFG A;  1N11 A;  1HG2 A;  3PZD A;  1HE8 A;  2X6I A;  4WWN A;  4JVS A;  3TL5 A;  1UW4 B;  3MX3 A;  4XKB A;  3UT8 A;  1N0R A;  2B0O E;  3CHO A;  5EIB E;  1D8E A;  3C3O A;  4U0Z A;  5KNH D;  3BEE A;  4WWP A;  2WXP A;  3QAR A;  4TXQ A;  5DBK A;  1Z6T A;  2RKK A;  3FUK A;  2OV8 A;  3Q9N C;  3I5P A;  3MV3 B;  4EQF A;  2MRI A;  2RFM A;  4DX6 D;  5ARG A;  1L5J A;  4JHK A;  3QKY A;  3HXD A;  2VSN A;  2KAT A;  3UM0 A;  2GRL A;  4TUM A;  2WXK A;  1WAO 1;  2I1J A;  1OWM A;  2VYI A;  5AQ9 A;  3FUL A;  2PM7 A;  4LNG A;  4DX2 A;  2XPY A;  3W9F A;  3MJW A;  1RZ4 A;  4LRZ A;  2XQ0 A;  4DLO A;  2HM8 A;  2YQ8 A;  3QJZ A;  2PZI A;  3RJV A;  1O1S A;  3CK9 A;  3QWW A;  1YYH A;  2KBX A;  2WXG A;  5BNW A;  2V0P A;  3APC A;  5D66 A;  4E6H A;  1SA5 A;  4A3V A;  3EHR A;  3AS4 A;  5KBA A;  4AP2 A;  1JPL A;  1D8D A;  5G04 C;  3R7R A;  2XS1 A;  3KSQ A;  2R03 A;  3SFZ A;  4IUL A;  3BU8 A;  4BET A;  2WXQ A;  1DC2 A;  2XZT G;  2RFA A;  3TWQ A;  1JCQ A;  2LO6 A;  3LVQ E;  3ESL A;  3JUI A;  3PE3 A;  4PDX A;  2DIW A;  4Q94 A;  4FC8 A;  4AY6 A;  3ABM E;  3ABK E;  3FUH A;  3AJI A;  3CIA A;  4LUN U;  3LY8 A;  2AWI A;  3FH8 A;  3CHM A;  3HG0 D;  4I1A A;  2CG2 A;  4O6F A;  2R02 A;  3L13 A;  2HE0 A;  2P9I G;  3V79 K;  5JJ7 A;  2V4L A;  3ZUV B;  3T5V A;  4U8H A;  5D2M C;  1YCS B;  3CST A;  4RVB A;  3J5Q B;  3DSV A;  5EKQ D;  5KWD A;  4O1P A;  4OVU A;  2DZO A;  2IQC A;  1UOH A;  3AG1 E;  3LVR E;  4EZL A;  5A6C A;  4FA6 A;  2IO3 C;  5CRV A;  2B6C A;  3L08 A;  3CHP A;  1IYG A;  4G24 A;  5D0O D;  3FDH A;  5BUZ A;  2FEZ A;  3EHQ A;  4A3T A;  3HHM A;  4CZ2 D;  3CKB A;  3CHS A;  4K0R A;  2KZT A;  4U8Y D;  1OXJ A;  5HQ8 A;  4N5C A;  1MX2 A;  2XEN A;  1O1R A;  1ZB1 A;  3TXM A;  1N54 A;  5AJL A;  1JCS A;  4I1O B;  1W3B A;  3D9H A;  1WY6 A;  2J49 A;  3RAU A;  5JJT A;  4N3A A;  3LPZ A;  2FUL A;  1HZ4 A;  2XGS A;  4JHR A;  4RG6 A;  2XRZ A;  1EF1 C;  1HH8 A;  3LXU X;  3SNX A;  3EUV A;  4U63 A;  4ANX A;  3X2Q E;  5CHE E;  4NRH B;  1TJF A;  4UWF A;  3FTW A;  4HOU A;  4U0U A;  5BV0 A;  3E32 A;  5JJ6 A;  2VTB B;  1QNF A;  1OCR E;  4UWG A;  1N4P A;  4RSY A;  1MX4 A;  3FTS A;  5CCL A;  3IHY A;  3CK8 A;  4FHK A;  5A23 A;  2P9U G;  4H7X A;  2VQ2 A;  4K5C A;  5ARF A;  2R05 A;  4FUL A;  4HBD A;  4CT4 A;  3ULQ A;  2J08 A;  2MYO A;  3EU9 A;  4GTR A;  4APF A;  3FU6 A;  3MEK A;  3D9N A;  4GCN A;  3FU0 A;  3ULY A;  3S2A A;  2AXU A;  3D9L A;  3NZU A;  2WXF A;  4HXI A;  5IY5 E;  5CBN A;  4M7C A;  1HU3 A;  1WDY A;  3LDZ A;  2WVI A;  4KT6 B;  3O48 A;  3DSU A;  3UQ3 A;  4GMR A;  4Y6C A;  1LF8 A;  3ZXP A;  3TJP A;  2GRN B;  3APF A;  2CG3 A;  3TAX A;  4XZ4 A;  4YVO A;  3JQ1 A;  4JA9 A;  2X38 A;  5FTP A;  3ZYM A;  4NQ0 A;  4EBA A;  2IY0 C;  3O4Z A;  4J0U A;  4CGW A;  2ETB A;  2FO1 E;  4B0Z A;  1FVH A;  4G25 A;  2DCP A;  2JEK A;  5AN8 A;  5G04 J;  2HR2 A;  3B13 A;  4GYY A;  2VJ8 A;  3URZ A;  3L22 A;  3RRN B;  5E76 A;  2XRY A;  2WXH A;  2GRP B;  4EZJ A;  3UMV A;  4TXR A;  2XEH A;  3LY7 A;  3RO3 A;  3HYM B;  2LAI A;  3GYZ A;  1BPO A;  3ZIM A;  1ELR A;  4BX9 A;  4YDW A;  3CEQ A;  1YMP A;  4WNF A;  2CHX A;  4CCA A;  3NBN B;  3BG1 B;  3OXG A;  5KNG A;  1TR4 A;  2AW6 A;  3TWW A;  4K5A B;  5FIO A;  4GTO A;  3TWU A;  3RRM B;  4UUC A;  5ENT D;  3L9T A;  4I6E A;  1EDU A;  2BED A;  2IJG X;  1OT8 A;  2LNI A;  2HYZ A;  2L0T B;  5G05 J;  3CK7 A;  3ZXS A;  2XGO A;  2BKG A;  2C0L A;  3ZN3 A;  1RW2 A;  5J90 A;  3TG5 A;  2AJA A;  2L6B A;  2X6J A;  4BEP A;  1WM5 A;  3U9W A;  4AOF A;  2VGE A;  4HRN A;  3CVP A;  3NB2 A;  4GZ6 A;  4G26 A;  1IKN D;  3DXK G;  4UWH A;  1OY3 D;  3QWP A;  2V4H C;  3IEG A;  3LCA A;  3ZKJ A;  1Y8M A;  5EID A;  5BT1 A;  3QOU A;  4ILH B;  1OWN A;  1TNB A;  2QYJ A;  4FP7 A;  2OOE A;  3QNK A;  2FF4 A;  1E8Y A;  1JWF A;  2BUG A;  5AQA A;  3C3R A;  1LD8 A;  3UKR G;  4B8A A;  4B8C B;  2EIM E;  3RU0 A;  4WAF A;  1JWG A;  1N9A A;  3L82 A;  3PZ2 A;  2WB2 A;  4ANW A;  1QYM A;  4HS2 A;  1D9S A;  4C9B B;  3MCX A;  1K1B A;  5FT9 A;  3DSW A;  3C5R A;  5ENQ D;  1X5B A;  1U3D A;  1TYQ G;  3TWX A;  3ML9 A;  4L23 A;  3FUM A;  2IU1 A;  3KEZ A;  1TNY A;  5BXO A;  2XZD G;  3C3Q A;  2F0Y A;  2GW1 A;  4MBG A;  4BT8 A;  4PS8 A;  5LCW J;  2YHC A;  1N94 A;  4XKC A;  4HOS A;  2Y4U A;  4B93 B;  4JEU A;  2H6F A;  4HOT A;  1DVP A;  1H6K A;  5ANR A;  2QFC A;  4YND A;  3IV0 A;  2YIN A;  2P9L G;  4I2Z A;  4V3I A;  3RK6 A;  2XCB A;  3G2W A;  5CBO A;  4GMJ A;  4HRM B;  3D9M A;  1TNU A;  4GA2 A;  4HNA D;  3SFY A;  1H2V C;  4JC8 A;  1TJC A;  4JXT A;  2DVW A;  2KCL A;  4HI8 A;  2BKK B;  3PZ3 A;  4W9R A;  1KZO A;  4F53 A;  3SI5 A;  2VSO E;  1IHG A;  3PZ4 A;  2WXR A;  3MKQ B;  3DSX A;  4JEH A;  5AQB A;  3LJ3 A;  3TWT A;  2WXI A;  1NL4 A;  5CMW A;  2I9C A;  4FJZ A;  5C2Y A;  1Y6I A;  4QQI A;  4YDE A;  3UI2 A;  2PM6 A;  3SY2 A;  3VLE A;  4HOQ A;  3V30 A;  4ANU A;  4URK A;  3FTZ A;  1HO8 A;  1BLX B;  5T8I A;  4CDM A;  3T9K A;  1E7U A;  4ILG A;  4UI9 K;  4G2V A;  1SA4 A;  1PC2 A;  2OCC E;  3PRZ A;  4AM9 A;  4AVX A;  4AIF A;  1SZA A;  3S7J A;  4UI9 C;  1OWO A;  1G3N B;  2F8Y A;  3RRU A;  3PNL B;  3FTV A;  2CHZ A;  4CGV A;  2VSX E;  1NA3 A;  5C1D A;  5ENR D;  3TWS A;  3D9J A;  4KXK B;  2CHW A;  2J9Q A;  1SW6 A;  3PRE A;  4DK5 A;  3MA5 A;  2NXP A;  2GRM A;  2L6J A;  2XS8 A;  1NP7 A;  4I6G A;  1UN8 A;  4BFR A;  3IBE A;  1MQS A;  3UXG A;  2LXM A;  3B7B A;  3ZU7 B;  4OAV B;  3CVX A;  4BTA A;  4DX7 D;  4CDN A;  4FHJ A;  1N95 A;  4NIK A;  4GYO A;  4F1P A;  3Q4A B;  4GTT A;  4HVB A;  3OAW A;  1S0P A;  3PEV B;  3CHQ A;  3HRA A;  3VTX A;  3AG4 E;  3JXI A;  3KD7 A;  2H6I A;  2X6F A;  4ACK A;  4DRX E;  4DX1 A;  1HS6 A;  3SF4 A;  4TUU A;  2LSU A;  1TN6 A;  5ANL A;  3PDN A;  4L7T A;  3PH0 C;  5BXU A;  4WWO A;  5J08 A;  3HXC A;  2DBA A;  3ZPJ A;  3U4T A;  5FZQ A;  3HVE A;  1X81 A;  2DYR E;  3SBS A;  4U07 A;  4A55 A;  1NA0 A;  3CQC B;  4FLB A;  4F6R D;  1FPP A;  2ZGG A;  2AXV A;  1PAQ A;  2KCV A;  1P5Q A;  3Q78 A;  4LNU D;  3OXL A;  1OCO E;  3MZL B;  2ZIR A;  4ATG A;  2LSV A;  5FJY A;  3TGO A;  1Z5S C;  5A7D B;  4WUY A;  5AJD A;  1OWL A;  3ZW3 A;  2P2C P;  3SO8 A;  2QC9 A;  2J4D A;  4U7E B;  3Q7A A;  1EYH A;  2XGM A;  2EIJ E;  1FCH A;  4KVO A;  3SGH A;  1E8W A;  1NZN A;  3DEP A;  4BER A;  5BW8 C;  3W9G A;  3UTM A;  4APO A;  4ZHB A;  3K9I A;  1O1T A;  2Y1L E;  4J8D A;  1HX8 A;  4K5B A;  3LJN A;  4CDR A;  1A5E A;  4R7L A;  2XCC A;  5H7P A;  4B89 A;  3JQ0 A;  5ENS D;  5FQ7 A;  3PVL A;  3Q73 A;  3Q79 A;  3AU5 A;  5EN5 D;  3DST A;  3EDT B;  5LOZ A;  4AJW A;  2JAB A;  4G1T A;  1ELW A;  1DCE A;  1NFI E;  4A1S A;  2WQ6 A;  4ANV A;  1SZ9 A;  3AAA C;  2IOL A;  4N3C A;  3ESK A;  4EPZ A;  3ZHE A;  2Q7F A;  2X6K A;  3FH5 A;  3TXN A;  3N71 A;  3V31 A;  2WXJ A;  2ZU6 B;  5D0Q D;  3L17 A;  2GRO B;  5AEN A;  2ETC A;  3CVY A;  2XPI A;  5FZS A;  4BY6 A;  2I1K A;  4PUC A;  4JD2 G;  1H19 A;  3OTN A;  4BT9 A;  3FUF A;  4HOR A;  1H6O A;  4GTM A;  2DYS E;  3CVN A;  3CLJ A;  1B89 A;  5ENP D;  2JLB A;  3FUJ A;  3HXB A;  1DNP A;  4J8Y A;  2EIK E;  1NI1 A;  2P9K G;  4GB9 A;  3ZNG A;  2KC7 A;  3ASO E;  1E8X A;  2WQH A;  4L2L A;  3G2S A;  5KJL A;  4A63 B;  4GZD A;  1MHQ A;  3GZ1 A;  4KVM A;  2R2L A;  3AG2 E;  4O1O A;  3AG3 E;  1INZ A;  1S63 A;  3G2U A;  2XHE A;  2LUH A;  2P9S G;  1ZU2 A;  4G8K A;  4CYM D;  3WG7 E;  2GRQ B;  2AXZ A;  5FIN A;  2I2O A;  3F6Q A;  2A5U A;  3D3M A;  4G23 A;  2RD0 A;  3DXM G;  2F8X K;  3Q75 A;  3E33 A;  3UT4 A;  2J8S D;  4FU3 A;  3SHF A;  3C98 A;  4GZ3 A;  4QFV A;  3FY4 A;  4CRW A;  2KXP C;  3PE4 A;  4Z68 A;  5CCM A;  1SQM A;  4EBA G;  4GML A;  2CFZ A;  4LEU A;  3CVL A;  3AS5 A;  5T4Y A;  5EYP F;  1KZP A;  5HI7 A;  3EIJ A;  5T3R A;  4AV7 A;  3JXJ A;  3FEY A;  1UN9 A;  3TWR A;  1PY1 A;  3LY9 A;  2QY7 A;  4ZFH A;  1LTX A;  3B7T A;  3U3W A;  3FUI A;  1K1A A;  4GA0 A;  2UWJ G;  1MX6 A;  3CSF A;  4MLP A;  1BD8 A;  2IOS A;  3V2X A;  1MJ0 A;  1MZC A;  4EEC A;  2A4Z A;  3U66 A;  3NOG D;  5HRY A;  1TEZ A;  2PL2 A;  2AVP A;  5CEA A;  3P1U A;  4XI0 A;  4UQX A;  1QZ2 A;  3FU3 A;  4DJA A;  2KM4 A;  3D9I A;  1N4R A;  5B1B E;  4F1S A;  3PZ1 A;  3D9K A;  4I17 A;  4G8L A;  2RG8 A;  3CQG B;  3WXX A;  1HF8 A;  2Y69 E;  3SQV A;  3B7U X;  4FAD A;  2X6H A;  3KS2 A;  3KSL A;  2OEV A;  3ML8 A;  3ASH A;  1AP7 A;  3PEU B;  5EX3 A;  4HLL A;  4DX5 D;  3CHR A;  4ATZ D;  3MYV A;  4WNE A;  1N4S A;  4DI3 A;  1N4Q A;  3DRA A;  2VGY A;  3T5X A;  3IHV A;  3LKU A;  4KMO A;  1OCC E;  4EZK A;  5CED B;  2ION A;  3ZYQ A;  2VGX B;  3MKQ A;  2UY1 B;  3GZ2 A;  5KJM A;  4LG6 A;  2NSZ A;  2OEW A;  1Z3Y A;  1O5M A;  5JHA A; 
#chains in the Genus database with same CATH homology
 2P9U G;  3UKU G;  3DXM G;  1K8K G;  3DXK G;  3RSE G;  2P9P G;  1TYQ G;  2P9S G;  3UKR G;  3DWL G;  2P9N G;  4JD2 G;  3ULE G;  1U2V G;  2P9I G;  4XEI G;  2P9K G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...