2P9VA

Structure of ampc beta-lactamase with cross-linked active site after exposure to small molecule inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
358
structure length
354
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINNKIALAARPVKAITPPTPAVRASWVHTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title O-Aryloxycarbonyl Hydroxamates: New beta-Lactamase Inhibitors That Cross-Link the Active Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 119
structure length 354
sequence length 358
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p9vA00
4E6WA 3GRJA 1JVJA 1FQGA 3Q7VA 3FV7A 1PI5A 1EWZA 3GMWA 1L2SA 2Y2IA 2V2FF 2WKHA 1JWZA 3VOZA 3WRZA 1KDWA 2RL3A 4P0MA 1BSGA 1RGYA 3NY4A 1FCOA 1LLBA 2HPBA 3DW0A 3G2YA 3IXBA 3OZHA 1E3UD 3HLEA 4LCLA 5KMWA 2I72A 2XK1A 3LO7A 1TEMA 4ZTKA 4OPQA 3IF5A 1FOFA 3C4OA 2PU2A 1W8QA 3Q81A 1FR6A 1PI4A 2ZLYA 5GLAA 1L0GA 4DE1A 4E3NA 1PIOA 3FKWA 5D3OA 5M19A 3P98A 1FR1A 1BLPA 4E3MA 5CTNA 4L0LA 2C6WB 1CEGA 5AQ9A 1JWVA 4K91A 3O86A 1NJ4A 1K4FA 3BRMA 4S2NA 5TGFA 3ZG0A 1KGEA 1YLWA 1H8ZA 4PPRA 1KGGA 2QZ6A 3G30A 3ZG7B 5EPHA 4XXRA 1LHYA 1W8YA 5F82A 3UNWA 3QNCA 2XD5A 2EFXA 2Y4AA 1K55C 4KQOA 4C75A 4MBFA 3ZVWA 1BULA 4E3JA 2PU4A 3EQVA 4JXWA 4KQQA 2J8YA 3BFGA 4JKTA 5CRFA 5TFQA 4JF6A 2HP9A 1KDSA 4UAAA 1XKZA 2XGNA 4GZBA 4OOYA 4R1GA 1NYMA 4RA7A 4QU3A 5DVAA 5HAIA 4KZ7A 3CG5A 3CJMA 4N9KA 2EXAA 3UPPA 2C5WB 4FSFA 4FH2A 4BJPA 3SS4A 3OCLA 5AQ7A 4KG6A 1YMXA 2WYXA 2OLVA 4WYYA 3E2KA 3G34A 4JF5A 5HAQA 1ES5A 4EV4A 5CEDA 1QMEA 2Y2LA 1ERMA 3D4FA 4K0XA 3IQAA 4EBLA 4E3OA 3VP0A 1XGJA 3HVFA 5M18A 2DRWA 4R3BA 3G35A 1KE3A 3GV9A 3I7JA 3SH9A 3MKEA 2EX8A 3VP3A 2HDRA 1XGIA 3PBOA 3ITAA 1SKFA 2XQZA 3CMZA 4P85A 1XPBA 4R3JA 2HP5A 3BFDA 5FQJA 1N9BA 2H5SA 5G18A 2WGWB 4OPZA 5CGSA 4BENA 2WUQA 1W7FA 4E6XA 1HVBA 1RGZA 3OCNA 4LV2A 1L0DA 1K56D 2HDQA 3WS4A 4B88A 4X6TA 2WGWA 1DY6A 3MFDA 4WZ5C 4DDYA 4OVDA 2QPNA 5A92A 5JYOA 4KZ5A 3VMAA 1Y54A 2JBFA 2WGIA 1VQQA 4S2NC 4OOLA 5GLBA 3S22A 3BFFA 2GDNA 3NIAA 2HDSA 3LY3A 4U0XA 4JLFA 2FFYA 4IEDA 3RXXA 3IF6B 1MXOA 1MY8A 3GSGA 5DTKA 5CHUA 4OQGA 3RXWA 3PBNA 4FD8A 4DE2A 1E3UA 3HLFA 5J8XA 3UDFA 2XD1A 3OPLA 3IF6A 1J9MA 1XA1A 1HD8A 3PBSA 4NETA 4RVAA 5FASA 4OQHA 4QY5A 4GN2A 4R4SA 3BEBA 1O7EA 3AGEA 1YLTA 4PM7A 3S1YA 4BD1A 1ONHA 4N9LA 3HLWA 3ITBA 1CEFA 1XX2A 1DJCA 2CC1A 4JXGA 5CERA 3HUMA 1GA9A 5F1FA 4ZBEA 1IYOA 5FDHA 4LV1A 3W4PA 4E3KA 4EBPA 5EECA 1HZOA 1K6SA 1IYSA 5EVIB 4DDSA 4ZDXA 5DF9A 3UPOA 4LENA 2DCFA 4JXVA 5E2EA 4CPKA 3Q1FA 1L0FA 3DWKA 4MBKA 4CJNA 3HLCA 2HP6A 3N4IA 5EVIA 2ZMAA 3HLGA 2WADA 3TOIA 1C3BA 1ALQA 1XP4A 3IT9A 2ZJ9A 1IKGA 1K57C 2WKIA 3OC2A 4P87A 1IEMA 3W4QA 2OLUA 3MZDA 3UY6A 2EXBA 2V20A 4X53A 2H0YA 2ZM2A 4Z9QA 1ZG4A 1KE0A 4MBHA 4QY6A 4YFMA 5JYPA 4IBXA 3ZG9B 1WYBA 4IVIA 4QB8A 3BFEA 1PYYA 4LV3A 5GHXA 1BLHA 2WAFA 2XEPA 1PW8A 4JBFA 1NXYA 4YINA 2XFTA 3BFCA 3GQZA 3IWOA 1CK3A 2Y2NA 2Z2LB 1U60A 3N8SA 5DF8A 5EUAA 4Y0TA 1K54C 1JWPA 2VGKA 4PM6A 1Q2PA 3BLSA 3LY4A 1SDEA 3W8KA 4EWFA 3HLBA 3G32A 4QD4A 2BLSA 1Q2QA 3JYIA 1MPLA 1MWUA 3VFFA 3IXHA 3SOIA 3UDIA 3V39A 5F83A 3V3SA 4BD0A 1LI0A 4JPMA 2ZQAA 4WELA 2IWBA 3VSKA 5EOOA 3ZDJA 1IYQA 1GHMA 1G68A 1YMSA 1JTDA 3SS5A 4WMCD 2Y2KA 2ZC7A 4Y0OA 3UDXA 3WS2A 2HDUA 3PBRA 3FKVA 1ZG6A 4OP5A 1XXMA 5CTMA 3NCKA 4HEFA 4WEKA 2JCHA 2ZQ7A 4MNRA 2Y55A 4K0WA 2IWDA 4MLLA 1I2WA 5CHJA 5I94A 3NDGA 4S2KA 5AQAA 3RJUA 1IKIA 1K38A 4R0QA 3A3DA 5FAOA 2Y2QA 3HBRA 3IH8A 1L0EA 3BLMA 1YLPA 1E25A 4PMAA 5HW3A 1YQSA 4XUZA 3LCEA 2ZC3B 1H8YA 3SH8A 3A3JA 1O07A 2EX2A 4WBGA 1FCMA 5FQKA 1EROA 4OONA 4DF6A 2J7VA 1PZPA 5E43A 3G31A 4BLMA 5U47A 2WK0A 5L2FA 5GLCA 1I5QA 4GDNA 1K6RA 1E4DA 3BECA 4Y0UA 5GL9A 3PBQA 4S2PA 4X56A 2B5RA 5FQ9A 4U0TA 5A93A 1NZUA 4S2OA 5GLDA 3V5MA 3ZG8B 1DJAA 5FQMA 4OOMA 1TDLA 4UHUA 4BL2A 4FCFA 3PAEA 3TG9A 5GHZA 1NY0A 5HFOA 1MWRA 1DJBA 5FI6A 2DNSA 2VGJA 2FFFB 3VFHA 5EVLA 2G2WA 3WS0A 2Y2HA 1ES3A 2WKEA 1Z6FA 4KENB 4S2MA 5F1GA 2R9XA 1GHPA 3ZG5A 1GHIA 4Q8IA 4EUZA 3N8LA 5IHVA 2XF3A 3IHAA 4N1HA 2G2UA 4BQMA 1LL5A 4ZJ2A 5FI2A 3WRTA 5FATA 1PWCA 2XH9A 3NDEA 4P6BA 4KQRA 4X55A 4E3LA 4S2IA 3DTMA 3A3IA 1EI5A 4N92A 3ZHHA 3FYZA 3NBLA 1ES4A 3FWLA 3OPRA 1K25A 1BZAA 1H5XA 5AQBA 3QHYA 3QNBA 4IBRA 1WYCA 2XLNA 3M6HA 4UA7A 5GHYA 1FSWA 1PWDA 3ZNTA 3N6IA 3Q82A 3IXDA 1ERQA 1LI9A 5E2FA 1K4EA 3O3VA 3MKFA 4Y7PA 4ZJ3A 1SCWA 2Q9MA 2J9PA 3PTEA 2Y2OA 5CEBA 1K55A 5HX9A 1YLZA 2WAEA 1CI8A 5E2GA 1BT5A 5FA7A 3IHBA 4KZBA 4S2LA 3LEZA 3S4XA 1M6KA 3G4PA 1CI9A 4QJGA 3Q07A 1OMEA 4KZ9A 3GVBA 3N7WA 4H8RA 4OP8A 4WMCA 3MXSA 5A90A 4LV0A 4DRTA 5HAPA 1N4OA 3A3EA 3C4PA 5KSCA 3G2ZA 2PBYA 3WWXA 3UO9A 1IELA 3HUOA 4D2OA 3VP4A 3IWQA 3B3XA 2ZQ9A 5FAPA 4E3IA 2XR0A 3FZCA 3HREA 4KZ4A 1TDGA 3ZCZA 2WZXA 2XFSA 2ZD8A 2Y2MA 1BTLA 2X71A 4M3KA 3UE3A 4FH4A 3NI9A 5CECA 5FAQA 4IVKA 4MEZA 3UN7A 1YT4A 2QMIA 5BOHA 5M1AA 2Y2JA 4HBTA 4KZ8A 2A3UA 3ZVTA 1PZOA 2X02A 4GNUA 1M40A 3PAGA 4O7DA 4OPYA 3C5AA 3SS3A 5FI7A 1GCEA 2J9OA 2EFUA 4X68A 5TR7A 4DXCA 5HL1A 2EX6A 2ZC5B 3VSLA 3IF6C 3M2JA 3C7VA 4WZ5A 3P09A 3W4OA 1K56A 2RCXA 4PM8A 3HUNA 2IWCA 5FQIA 4OLGA 3ZGAB 4OQ0A 4S2JA 3DWZA 3UE0A 1PW1A 2BG1A 4KG2A 5DF7A 2JE5A 1W79A 3MBZA 1FSYA 4OKPA 5DTTA 5EVID 1RP5A 3OPHA 4OH0A 1JTGA 3E2LA 4C3QA 4R23A 3BYDA 1G6AA 5EVIC 4U3TA 3VOYA 4JXSA 2Y2PA 2Y91A 2OV5A 3ZFZA 4X69A 2Y59A 2EX9A 4GD8A 4XUXA 5EOEA 2ZM8A 1SDNA 4OQIA 3A3FA 1HTZA 2A49A 3IXGA 4HBUA 3TSGA 4F94A 2ZQ8A 4WEJA 3VP1A 1MKIA 1MBLA 3C7UA 4EQIA 4DKIA 4PM9A 2P9VB 3VP2A 3O87A 1QMFA 1S6RA 4HESA 3MZFA 1LL9A 1ZKJA 4QHCA 1NZOA 2ZM0A 1KGFA 4KG5A 2P9VA 1YLYA 4BL3A 2JC7A 3NC8A 4UA6A 1RCJA 1BLSA 1K57A 1S0WA 4KZ6A 3V50A 2H10A 4OLDA 3Q7ZA 4B4ZA 3GTCA 2Z2MB 1YLJA 1ONGA 3OPPA 2ZQCA 2XDMA 5A91A 1MWSA 1WE4A 5DTSA 5FSRA 4NK3A 3M6BA 4B4XA 1NRFA 2OSUA 2ZC6B 1NYYA 3GR2A 3O88A 2P74A 1W5DA 3N8RA 4ZAMA 1GA0A 1VM1A 4GDBA 2R9WA 4GKUA 4GOGA 4LCMA 5CHMA 5CXWA 3SH7A 1ESIA 3HL9A 3ISGA 3MXRA 4DE3A 4GD6A 3PBTA 1K54A 1BLCA 2WZZA 2V1ZA 4ZJ1A 1FCNA 4EBNA 5EE8A 3M2KA 5CGWA 2E8IA 3WS1A 1YM1A 3IH9A 4RYEA 3UE1A 4KZ3A 4N1XA 1PWGA 3CZDA 3IWIA 1ZC2A 2ZQDA 2H0TA 4PM5A 4ID4A 3AGFA 1SHVA 2Q9NA 4RX2A 4DXBA 3ZNYA 4GB7A 4UA9A 4DE0A 4WM9A 5HARA 4R4RA 5KSHA 2X01A 2UWXA 2ZC4B 2WGVA 3HLDA 5KZHA 1IYPA 4RX3A 4WZ4A 3V3RA 5E2HA 1ES2A 3BM6A 3WS5A 1MWTA 3EQUA 5CGXA 1TVFA 4KZAA 1AXBA 1I2SA 4C6YA 3MZEA 4OPRA 4A5RA 3UPNA 5FQQA 1KVMA 3Q7VB 3AGDA 1ESUA 2Y2GA 1KE4A 1XA7A 1BUEA 4JF4A 1KVLA
chains in the Genus database with same CATH superfamily
1JVJA 1FQGA 2EA9A 3Q7VA 3H82A 2A24A 2V2FF 3C30A 4LRXC 3LUQA 2JN7A 1LLBA 2HPBA 3IXBA 3HLEA 3RTYA 3LO7A 4ZTKA 2V8CA 1FR6A 1PIOA 5M19A 3BJNA 4ARZA 1CEGA 1JWVA 1NJ4A 1K4FA 3ZG0A 4BMWA 4PPRA 2QZ6A 3ZG7B 4EEUA 1STZA 2GZAA 1K55C 4E3JA 4JKTA 2HP9A 4UAAA 1XKZA 4UQIS 1F5MA 1NYMA 1T1AA 1VHMA 2ZMVA 4N9KA 1TS7A 4LRZE 5AQ7A 1YSQA 4KG6A 1YMXA 3UMEA 2OLVA 5HAQA 4JF5A 3B47A 1P9RA 4EV4A 5CEDA 1DP8A 2Y2LA 3D4FA 4K0XA 3JPUA 4E3OA 2DRWA 4B93A 3T4QA 3I7JA 2EX8A 3PBOA 5A8BA 1S4SA 3FG8A 1N9BA 5G18A 3R7WB 4Y13A 1W7FA 1RGZA 2QHKA 4KQDA 2HDQA 4FUWA 1H8MA 2WGWA 4WZ5C 4OVDA 4YNRA 5A92A 2OAQ1 4KZ5A 2JBFA 2WGIA 1VQQA 5GLBA 3FC7A 3NIAA 5EM1A 4Z1WA 1D1JA 4Y17A 2FFYA 1LSXA 3IF6B 1MXOA 5DTKA 3RXWA 4FD8A 5J8XA 3OPLA 4NETA 1J9MA 3MJQA 5FASA 4OQHA 4GN2A 4R4SA 3AGEA 4PM7A 1YLTA 2Q0OA 1CEFA 1XX2A 2V1BA 4P6ZM 3NJAA 1IYOA 2HZ5A 4E3KA 1HZOA 1IYSA 5DF9A 5E2EA 3H82B 2FH5A 4X1MA 2QKPA 5DJTA 3HLCA 2HP6A 4PKYG 1K57C 2WKIA 2OLUA 3UY6A 2H0YA 2ZM2A 1ZG4A 4QY6A 4QB8A 4ARZB 2XEPA 1PW8A 4YINA 3BFCA 5EV0A 1U60A 5DF8A 1OT6A 4MN5A 3DBAA 2O99A 2PD7A 3W8KA 3G32A 2BLSA 3PYPA 1Q2QA 3JYIA 3IXHA 4BD0A 2K7SA 2ZQAA 1T1CA 3SS5A 5TBMB 2ZC7A 3FKVA 2QYBA 5CTMA 4WEKA 3LFVA 4MLLA 1I2WA 4ESPA 5I94A 3NDGA 4S2KA 4CQHA 5FAOA 2Y2QA 2G7UA 5K5BA 5HW3A 4O8GA 1YQSA 4XUZA 1PFLA 2ACGA 3SH8A 3GDIA 1FCMA 3QP8A 4OONA 4DF6A 2J7VA 3NHQA 5DFYA 4BLMA 5GLCA 4GDNA 1K6RA 4GS9A 4S2PA 4EXOA 3NOPC 5A93A 4U0TA 3UB9A 3LI9A 1XFNA 3B33A 1TDLA 4FCFA 4CLCD 5L8MA 1WA9A 2VGJA 2FFFB 5EVLA 4ME4A 1ES3A 2WKEA 2JKGA 2R9XA 3KSFA 3N8LA 2QWSA 4N1HA 1PWCA 1OTDA 4S2IA 3A3IA 3ZHHA 3NBLA 3OPRA 3D3OA 1N9OA 1WYCA 2XLNA 3F1PB 3M6HA 5GHYA 1FSWA 3ZNTA 3N6IA 3LIAA 1SCWA 2Q9MA 3QP2A 3PTEA 5CEBA 2WAEA 5HDSA 3IBRA 3OBFA 5FA7A 1BYWA 3CPTA 5L10A 1PNEA 3LICA 2P7JA 3Q07A 4H8RA 3MXSA 5A90A 4DRTA 3WWXA 1TS6A 3T4TA 3HUOA 4H6JB 3T4LA 2YKHA 2GJ3A 2WKPA 3B3XA 3K2NA 3HREA 4HP9A 2XFSA 3MSHA 2W1TB 2ZD8A 2Y2MA 1BTLA 2JKFA 4FH4A 2J3WA 2V9AA 1YT4A 5M1AA 4KZ8A 3ZVTA 2PBDP 4GNUA 3PAGA 3C5AA 1GCEA 2W3EA 2W3HA 1TF1A 4LFUA 5HD5A 3C7VA 4B9OA 1K56A 5HPIA 4CLCA 4PM8A 3HUNA 5FQIA 4OQ0A 3LR5A 3P7NA 3DWZA 3LIFA 5CX7A 5AVEA 3UB7A 3DTKA 5L09A 4I39A 3MBZA 5EVID 1JTGA 2UV0E 5MC7A 4GS9B 2Y91A 1ZTUA 4UEYA 4X1LA 2EX9A 1OTBA 5EOEA 4I3JA 1SDNA 4OQIA 3TSGA 1MKIA 2PDRA 1ACFA 2W3GA 3RH8B 3O87A 3QP6A 4MN6A 4HESA 3MZFA 3T4OA 2P9VA 2JC7A 2K31A 1S0WA 3Q7ZA 4B4ZA 2Z2MB 4WLAA 2XDMA 3LEQA 1WE4A 3M6BA 4B4XA 2P08A 1NYYA 2VV7A 3N8RA 1VM1A 5CXWA 2R9WA 4KUKA 3MS6A 3PBTA 2K2NA 2WZZA 4ZJ1A 4EBNA 3TJZC 5EE8A 4Q0IA 3WS1A 3CZDA 4R70A 4PM5A 2Q9NA 1SKOB 3ZNYA 5HARA 2D02A 4R4RA 5KSHA 2UWXA 4RX3A 1D06A 4WZ4A 1GSVA 1ES2A 5E2HA 1MWTA 1S66L 1L3LA 5CGXA 1TVFA 3MZEA 4OPRA 2P04A 4O01A 2PT7A 1KVMA 1KE4A 1BUEA 1S1YA 4G3WA 3FV7A 2Y2IA 4G3VA 3WRZA 4WL9A 1DRMA 1BSGA 1RGYA 3NY4A 3OZHA 1E3UD 1TEMA 3Q81A 4CLCB 1GSXA 3FKWA 3P98A 3BW6A 4KUOA 4L0LA 3O86A 4S2NA 3ICYA 2V8FA 1H8ZA 5KIZA 3G30A 4IUHA 4XXRA 3NOTC 3UNWA 2XD5A 4KQOA 4MBFA 4JXWA 2J8YA 5TFQA 2XA7S 4GZBA 4R1GA 1J3WA 1FIKA 5HAIA 1NLYA 3UPPA 4FH2A 2V1AA 3SS4A 3CLOA 5J3WA 2Z6DA 2WYXA 4WYYA 4EETB 3LIEA 1ERMA 2VK3A 2PR5A 3K3DA 3VP0A 4MN7A 4R3BA 1N9LA 3GV9A 3SH9A 3VP3A 1XGIA 1G5UA 4Q0JA 3CMZA 1XPBA 4R3JA 5FQJA 5HWVA 4JGQA 2H5SA 4MDZA 4BENA 2WUQA 4I3IA 1HVBA 5C5KA 4IJGA 4MCWA 3QP1A 2A2LA 1Y54A 2BTFP 4S2NC 4OOLA 2O9BA 4IEDA 4M4XA 3GSGA 3CAXA 5CHUA 1E3UA 4L9FA 3IF6A 1HD8A 3E0YA 3TE8A 4QY5A 3BEBA 3ITBA 4JXGA 5AJGA 5DJUA 3CUEC 3KYZA 4EBPA 5EVIB 3KO6A 4JXVA 4CPKA 2PAVP 3Q1FA 1L0FA 4CJNA 3HLGA 3TOIA 1C3BA 1IKGA 3VE3A 4GW9A 3MZDA 2EXBA 2V20A 5HWWA 3T4JA 4IBXA 4IVIA 1PYYA 5GHXA 4JBFA 2XFTA 3GQZA 2L0WA 3IWOA 4MMNA 4Y0TA 5EUAA 2L4RA 1H0MA 3LIDA 4PM6A 3KYEA 3LY4A 1SDEA 2B02A 1MPLA 3VFFA 4BBUA 4HI4A 1Y28A 5F83A 3V3SA 2XSSA 4WELA 5J7EA 1G68A 2ZMFA 4WMCD 4Y0OA 4OP5A 3PBRA 1NLZA 3NCKA 4HEFA 2Y55A 5TBMA 5EFWA 5AQAA 1IKIA 1K38A 2J3TC 3IH8A 1YLPA 1E25A 2FZ0A 2ZL1B 2W1RA 3S7PA 1O07A 2EX2A 4WBGA 5FQKA 2PD8A 3G31A 5L2FA 1E4DA 4Y0UA 4GJ4A 3ZG8B 4CLCE 3A0VA 4HOIA 1DP9A 5HFOA 3IBJA 3ULFA 1F2KA 4KENB 5F1GA 1GHPA 1SZVA 4BQMA 1LL5A 1G6OA 2V0UA 4ZJ2A 5FI2A 2XH9A 4P6BA 1EI5A 1K25A 1F98A 2O0YA 1UWNX 3E4QA 3IXDA 4Y7PA 3F1PA 4ZJ3A 2GX5A 1OT9A 1YLZA 1CI8A 2QJ7A 5E2GA 1BT5A 3K3CA 4S2LA 3LGOA 1OTEA 4KZ9A 3BY9A 4OP8A 4WMCA 2AVXA 2W0NA 1N4OA 5KSCA 3G2ZA 4YWZA 2PBYA 4HP4A 3UO9A 3IWQA 5FAPA 4E3IA 3FZCA 4K08A 2ZOIA 4KZ4A 1TDGA 4H6JA 3LYXA 2X71A 4M3KA 3NI9A 2HJ9C 4G3KA 5FAQA 3NECA 2M7UA 4IVKA 4MEZA 2W1TA 2QMIA 4OPYA 2O9AA 1YKDA 2EFUA 4X68A 5TR7A 3RFBA 3S7NA 2OAP1 3M2JA 1OJGA 3P09A 3W4OA 4OLGA 3DTEA 3MQ0A 4S2JA 1PW1A 4EU0A 5DF7A 1LSWA 4PAUA 1XJ3A 4E04A 4OKPA 4LPZA 4R23A 4U3TA 3VOYA 2Y2PA 2OV5A 2VGLS 3A3FA 1HTZA 2A49A 2ZQ8A 4QPRA 1T1BA 1MBLA 4DKIA 2M7VA 4GHIB 1S6RA 1ZKJA 1NZOA 1KGFA 1OTIA 3V50A 4OLDA 3GTCA 3OPPA 5A91A 4NG2A 5DTSA 2OSUA 2XA7M 2P74A 2KX6A 4LCMA 3H9WA 4GDBA 4ZAMA 4GOGA 4IUKA 3SH7A 3HL9A 3ISGA 4GD6A 1K54A 1BLCA 5CGWA 4JGOA 1YM1A 3IH9A 5FL3A 4KZ3A 4N1XA 1PWGA 4ETZA 1ZC2A 2ZQDA 3BQ8A 4GB7A 4WM9A 2X01A 2KDKA 4DN0A 3V3RA 2EWVA 1SKOA 3BM6A 4HJ4A 5FEGA 1AXBA 1I2SA 4A5RA 1XFQA 5FQQA 4QWOA 3MMHA 3GRJA 1XJ6A 1PI5A 2CMNA 2WKHA 1JWZA 3VOZA 1KDWA 3UMDA 2RL3A 5FI7A 3DW0A 4LCLA 5HD3A 5KMWA 5IT5A 3UB5P 4NXFA 3IF5A 1FOFA 3KSHA 3C4OA 2PU2A 1W8QA 2E8JA 5GLAA 2B18A 5HL6A 4EQ1A 4NEED 3D9YA 1FR1A 3SZTA 5CTNA 2C6WB 5AQ9A 2LB9A 3KYQA 5TGFA 1KGEA 1MZUA 5EPHA 4HJ6A 4IHQA 1LL8A 2Y4AA 1YPRA 1TS0A 3ZVWA 1BULA 2PU4A 3EQVA 4DMZA 5CRFA 4OOYA 4RA7A 5DVAA 3V67A 4KZ7A 3CJMA 3KX0X 2H28A 4BJPA 1N9NA 2PYRA 3G34A 3EOIA 3MQQA 1QMEA 3LIBA 2OOLA 1ODVA 1XGJA 3HVFA 5M18A 1LSVA 1X0OA 4I3AA 1VETB 3UE6A 1SKFA 2XQZA 5AVFA 2HP5A 3BFDA 4F3LA 3OCNA 1L0DA 5DKKA 3WS4A 4B88A 4X6TA 1DY6A 5F68A 4DDYA 2QPNA 4CLCC 5JYOA 3VMAA 3S22A 2GDNA 2HDSA 3LY3A 4U0XA 3MF0A 3U4LP 3T1RA 2Z6CA 4OQGA 4DE2A 3HLFA 4RVAA 4BD1A 3HLWA 3HUMA 4LV1A 3W4PA 2BASA 1K6SA 4DDSA 4LENA 3A0RA 3DWKA 4NXBA 5EVIA 3ZQ5A 2WADA 1ALQA 3IT9A 3LR3A 3C38A 2ZJ9A 3OC2A 4P87A 1IEMA 3W4QA 2WKQA 3HJIA 5F6AA 4X53A 4XT2A 1KE0A 4MBHA 3EEHA 5JYPA 2VJWA 3ZG9B 1WYBA 3VE4A 3BFEA 4PHTA 4LV3A 2WAFA 4LRYC 5G4ZA 1D7EA 1CK3A 1VB6A 3CITA 4R3AA 2VGKA 1Q2PA 3BLSA 4DJ3A 3MFXA 3HLBA 4QD4A 1MWUA 4Y2FA 3SOIA 3EEAA 3UDIA 3HCYA 3UB6A 3VSKA 5EOOA 1IYQA 4NXGA 1YMSA 1H3QA 4RQ9A 2PHYA 3WS2A 2HDUA 1ZG6A 2IA2A 4GLQA 4MNRA 2JCHA 2ZQ7A 3CWFA 2O9CA 3D72A 4K0WA 5CHJA 3HBRA 3BLMA 1T18A 2ZC3B 3H7WA 3LCEA 1YSPA 1EROA 2ZL1A 5FEFA 1OPXA 5E43A 5U47A 1S4RA 1P0ZA 5J4EA 4F3LB 3BECA 1JNUA 2B5RA 3BQAA 3F1NB 3V5MA 5FQMA 4OOMA 5DFXA 1IOUA 1MWRA 1DJBA 3C2WA 1VEUB 3WS0A 4S2MA 1GHIA 4WUJA 1S1ZA 2XF3A 3IHAA 1F9IA 1KOUA 4N92A 2VGLM 4HIAA 1BZAA 1H5XA 4R38A 4HH2A 4UA7A 1PWDA 2YKFA 3O3VA 5F5YA 2VX8A 2J9PA 3UB8A 1W63Q 3T4SA 1K55A 1NWZA 2LB5A 3IHBA 3HJKA 4HJ3A 3S4XA 1M6KA 3G4PA 4DJ2A 4XT2B 2J80A 4Y5FA 5L07A 4FOFA 3VP4A 2JKRI 2XR0A 3DAVA 1P9WA 1T19A 2WZXA 4BBVA 4L9EA 4EEPA 5CECA 5I5LA 3UN7A 2VA0A 2WKRA 4HBTA 4HNBA 1AWIA 1CF0A 1M40A 3SS3A 5F69A 2GNXA 4HH3A 3OLOA 3VSLA 3IF6C 3NOUC 4WZ5A 3O5YA 5IU1A 1MC0A 4BBTA 2VKSA 2BG1A 4KG2A 3H7WB 2JE5A 1V9ZA 3KSIA 5HPFA 5DTTA 1RP5A 3NULA 4OH0A 3MQOA 3QP5A 1XJ2A 3EWKA 1G28A 4HBUA 4WEJA 3VP1A 4JGPA 4EQIA 3IS2B 4PM9A 3VP2A 4JGRA 3U2AA 2V0WA 1LL9A 3JVVA 4KG5A 1YLYA 4BL3A 4UA6A 1RCJA 1BLSA 1K57A 4GHIA 2EWWA 2R78A 1YLJA 4WF0A 1FILA 5FSRA 1NRFA 2ZC6B 1GA0A 4GKUA 3QP4A 1ESIA 4R6LA 3UE1A 3AGFA 5G4YA 3E4OA 1SHVA 4RX2A 4EW7A 2HJEA 3F1OB 1YAXA 2WGVA 5KZHA 1ZHHB 3EQUA 1UGUA 3R4KA 3BY8A 4NKPA 4EUVA 3Q7VB 3A0SA 3AGDA 2W27A 2A24B 1XA7A 4E6WA 4HQAA 3GMWA 1EWZA 2W3DA 1L2SA 5HDDA 2JKTI 3MXQA 3T4KA 4P0MA 1FCOA 3G2YA 2I72A 2XK1A 4OPQA 3FPWA 1L0GA 1PI4A 2ZLYA 4DE1A 4E3NA 5D3OA 1OTAA 3ZYTA 1BLPA 4E3MA 4K91A 3BRMA 1YLWA 5TJJA 1MKMA 1KGGA 5F82A 1LHYA 1TD5A 1W8YA 3LR4A 3QNCA 4X25A 2EFXA 1W63M 4C75A 4KQQA 2PR6A 3BFGA 4AFIA 4JF6A 1KDSA 2XGNA 4QU3A 3CG5A 2EXAA 1Y4OA 2C5WB 3KSGA 4FSFA 1EW0A 3OCLA 5EVEA 2XROA 2JKRM 3E2KA 3EGDC 4O0PA 1ES5A 1PRQA 3IQAA 4EBLA 2D01A 1XJ4A 3G35A 1KE3A 3MKEA 2HDRA 1LT0A 3ITAA 4P85A 1V9YA 2M1CA 3PR6A 1VETA 2WGWB 4OPZA 5CGSA 4E6XA 4LV2A 5HSQA 3T50A 1K56D 1A0KA 3PHYA 2B95A 4YOFA 3MFDA 1DP6A 3BFFA 4JLFA 3RXXA 4LGWA 4BWIA 5HWTA 1MY8A 3IX4A 3PBNA 3LR0A 3UDFA 2Y8HA 2XD1A 1XA1A 3PBSA 1O7EA 3S1YA 1ONHA 4N9LA 1DJCA 2CC1A 5CERA 1GA9A 5F1FA 4ZBEA 5FDHA 3FPVA 5EECA 2OWHA 4ZDXA 3VV4A 3UPOA 2DCFA 2DMWA 4MBKA 3N4IA 2ZMAA 3GECA 1XP4A 3T1QB 2VV8A 2VV6A 4Z9QA 4ZRRA 4YFMA 1BLHA 1NXYA 2Y2NA 2Z2LB 2ZBBA 3N8SA 1K54C 1JWPA 3LI8A 1UWPX 4EWFA 4WN5A 3V39A 1LI0A 4JPMA 2IWBA 2PRFA 3ZDJA 1GHMA 1JTDA 2Y2KA 3UDXA 1XXMA 3OOVA 2Y79A 2ZOHA 3DTIA 2IWDA 3RJUA 4R0QA 3A3DA 1L0EA 2XRNA 4PMAA 1IFQA 1H8YA 3A3JA 2NUTC 4L9GA 4PKYA 1PZPA 3P01A 2WK0A 1HLUP 2JHEA 1I5QA 2JKTM 4NXEA 5GL9A 3PBQA 4Q0HA 4X56A 5FQ9A 1NZUA 4S2OA 5GLDA 1DJAA 4HHDA 4P6ZS 4UHUA 4BL2A 2HV1A 3F1NA 3PAEA 3TG9A 5GHZA 1NY0A 5DKLA 5FI6A 2DNSA 3VFHA 1NRJA 2G2WA 2Y2HA 1Z6FA 2QJ5A 3BWLA 3ZG5A 4Q8IA 2OWJA 4EUZA 5IHVA 1VEUA 3MR0A 2G2UA 3WRTA 5LBRA 5FATA 3NDEA 4KQRA 4X55A 4E3LA 4UQIM 3B42A 3DTMA 3FYZA 1ES4A 5EM0A 3IX8A 3FWLA 5AQBA 3QHYA 3QNBA 4IBRA 3Q82A 3SW1A 1ERQA 1LI9A 5E2FA 1K4EA 3VOLA 3MKFA 2Y2OA 3CPTB 5HX9A 4I5SA 2W3FA 4KZBA 3LEZA 1CI9A 4QJGA 1OMEA 3GVBA 3N7WA 5FDSA 1CQAA 1TS8A 4LV0A 5HAPA 3A3EA 3C4PA 1IELA 4D2OA 2ZQ9A 3ZCZA 1S67L 1GSWA 3T1XA 3UE3A 3W2ZA 2NUPC 3PXPA 5BOHA 2Y2JA 2A3UA 2VEAA 1PZOA 2X02A 4O7DA 1Z09A 3CI6A 4DXCA 2J9OA 5HL1A 2EX6A 2ZC5B 4D60A 3CHWP 4Y3IA 2RCXA 2IWCA 4ETXA 3ZGAB 2J3TD 3UE0A 1W79A 1FSYA 2L1MA 5HDCA 3OPHA 3E2LA 1P97A 2KLIA 3E4PA 4C3QA 1K0KA 3BYDA 1G6AA 5EVIC 1CJFA 4JXSA 3ZFZA 4X69A 2Y59A 3C8CA 4GD8A 4XUXA 3CUEA 2ZM8A 4GCZA 3IXGA 4F94A 2VZWA 2INWA 3T12B 3C7UA 2HGVA 2P9VB 3TW8A 1QMFA 2PYPA 4QHCA 2ZM0A 3IS2A 2I9VA 3NC8A 3E98A 4KZ6A 2H10A 3S7QA 1ONGA 2ZQCA 1MWSA 3S7OA 4NK3A 3GR2A 3O88A 4EERA 1W5DA 4FTXA 3L7HA 3R7WA 5CHMA 3MXRA 4DE3A 4II7A 4EESA 3JVUA 2V1ZA 3IX3A 1FCNA 3M2KA 3T1SA 2E8IA 4RYEA 3L9KA 2VLGA 1OJ5A 4Y15A 3IWIA 2H0TA 4ID4A 2KOIA 4DXBA 4UA9A 4DE0A 3EGXC 4I38A 4LLOB 4HY8A 3HLDA 2ZC4B 2MJ6A 1IYPA 3WS5A 3F1OA 5HZHA 4KZAA 3G6OA 4C6YA 2HF6A 3UPNA 3TRCA 1ESUA 2Y2GA 5IS1A 4JF4A 1KVLA
chains in the Genus database with same CATH topology
4E6WA 3GRJA 1JVJA 1FQGA 3Q7VA 3FV7A 1PI5A 1EWZA 3GMWA 1L2SA 2Y2IA 2V2FF 2WKHA 1JWZA 3VOZA 3WRZA 1KDWA 2RL3A 4P0MA 1BSGA 1RGYA 3NY4A 1FCOA 1LLBA 2HPBA 3DW0A 3G2YA 3IXBA 3OZHA 1E3UD 3HLEA 4LCLA 5KMWA 2I72A 2XK1A 3LO7A 1TEMA 4ZTKA 4OPQA 3IF5A 1FOFA 3C4OA 2PU2A 1W8QA 3Q81A 1FR6A 1PI4A 2ZLYA 5GLAA 1L0GA 4DE1A 4E3NA 1PIOA 3FKWA 5D3OA 5M19A 3P98A 1FR1A 1BLPA 4E3MA 5CTNA 4L0LA 2C6WB 1CEGA 5AQ9A 1JWVA 4K91A 3O86A 1NJ4A 1K4FA 3BRMA 4S2NA 5TGFA 3ZG0A 1KGEA 1YLWA 1H8ZA 4PPRA 1KGGA 2QZ6A 3G30A 3ZG7B 5EPHA 4XXRA 1LHYA 1W8YA 5F82A 3UNWA 3QNCA 2XD5A 2EFXA 2Y4AA 1K55C 4KQOA 4C75A 4MBFA 3ZVWA 1BULA 4E3JA 2PU4A 3EQVA 4JXWA 4KQQA 2J8YA 3BFGA 4JKTA 5CRFA 5TFQA 4JF6A 2HP9A 1KDSA 4UAAA 1XKZA 2XGNA 4GZBA 4OOYA 4R1GA 1NYMA 4RA7A 4QU3A 5DVAA 5HAIA 4KZ7A 3CG5A 3CJMA 4N9KA 2EXAA 3UPPA 2C5WB 4FSFA 4FH2A 4BJPA 3SS4A 3OCLA 5AQ7A 4KG6A 1YMXA 2WYXA 2OLVA 4WYYA 3E2KA 3G34A 4JF5A 5HAQA 1ES5A 4EV4A 5CEDA 1QMEA 2Y2LA 1ERMA 3D4FA 4K0XA 3IQAA 4EBLA 4E3OA 3VP0A 1XGJA 3HVFA 5M18A 2DRWA 4R3BA 3G35A 1KE3A 3GV9A 3I7JA 3SH9A 3MKEA 2EX8A 3VP3A 2HDRA 1XGIA 3PBOA 3ITAA 1SKFA 2XQZA 3CMZA 4P85A 1XPBA 4R3JA 2HP5A 3BFDA 5FQJA 1N9BA 2H5SA 5G18A 2WGWB 4OPZA 5CGSA 4BENA 2WUQA 1W7FA 4E6XA 1HVBA 1RGZA 3OCNA 4LV2A 1L0DA 1K56D 2HDQA 3WS4A 4B88A 4X6TA 2WGWA 1DY6A 3MFDA 4WZ5C 4DDYA 4OVDA 2QPNA 5A92A 5JYOA 4KZ5A 3VMAA 1Y54A 2JBFA 2WGIA 1VQQA 4S2NC 4OOLA 5GLBA 3S22A 3BFFA 2GDNA 3NIAA 2HDSA 3LY3A 4U0XA 4JLFA 2FFYA 4IEDA 3RXXA 3IF6B 1MXOA 1MY8A 3GSGA 5DTKA 5CHUA 4OQGA 3RXWA 3PBNA 4FD8A 4DE2A 1E3UA 3HLFA 5J8XA 3UDFA 2XD1A 3OPLA 3IF6A 1J9MA 1XA1A 1HD8A 3PBSA 4NETA 4RVAA 5FASA 4OQHA 4QY5A 4GN2A 4R4SA 3BEBA 1O7EA 3AGEA 1YLTA 4PM7A 3S1YA 4BD1A 1ONHA 4N9LA 3HLWA 3ITBA 1CEFA 1XX2A 1DJCA 2CC1A 4JXGA 5CERA 3HUMA 1GA9A 5F1FA 4ZBEA 1IYOA 5FDHA 4LV1A 3W4PA 4E3KA 4EBPA 5EECA 1HZOA 1K6SA 1IYSA 5EVIB 4DDSA 4ZDXA 5DF9A 3UPOA 4LENA 2DCFA 4JXVA 5E2EA 4CPKA 3Q1FA 1L0FA 3DWKA 4MBKA 4CJNA 3HLCA 2HP6A 3N4IA 5EVIA 2ZMAA 3HLGA 2WADA 3TOIA 1C3BA 1ALQA 1XP4A 3IT9A 2ZJ9A 1IKGA 1K57C 2WKIA 3OC2A 4P87A 1IEMA 3W4QA 2OLUA 3MZDA 3UY6A 2EXBA 2V20A 4X53A 2H0YA 2ZM2A 4Z9QA 1ZG4A 1KE0A 4MBHA 4QY6A 4YFMA 5JYPA 4IBXA 3ZG9B 1WYBA 4IVIA 4QB8A 3BFEA 1PYYA 4LV3A 5GHXA 1BLHA 2WAFA 2XEPA 1PW8A 4JBFA 1NXYA 4YINA 2XFTA 3BFCA 3GQZA 3IWOA 1CK3A 2Y2NA 2Z2LB 1U60A 3N8SA 5DF8A 5EUAA 4Y0TA 1K54C 1JWPA 2VGKA 4PM6A 1Q2PA 3BLSA 3LY4A 1SDEA 3W8KA 4EWFA 3HLBA 3G32A 4QD4A 2BLSA 1Q2QA 3JYIA 1MPLA 1MWUA 3VFFA 3IXHA 3SOIA 3UDIA 3V39A 5F83A 3V3SA 4BD0A 1LI0A 4JPMA 2ZQAA 4WELA 2IWBA 3VSKA 5EOOA 3ZDJA 1IYQA 1GHMA 1G68A 1YMSA 1JTDA 3SS5A 4WMCD 2Y2KA 2ZC7A 4Y0OA 3UDXA 3WS2A 2HDUA 3PBRA 3FKVA 1ZG6A 4OP5A 1XXMA 5CTMA 3NCKA 4HEFA 4WEKA 2JCHA 2ZQ7A 4MNRA 2Y55A 4K0WA 2IWDA 4MLLA 1I2WA 5CHJA 5I94A 3NDGA 4S2KA 5AQAA 3RJUA 1IKIA 1K38A 4R0QA 3A3DA 5FAOA 2Y2QA 3HBRA 3IH8A 1L0EA 3BLMA 1YLPA 1E25A 4PMAA 5HW3A 1YQSA 4XUZA 3LCEA 2ZC3B 1H8YA 3SH8A 3A3JA 1O07A 2EX2A 4WBGA 1FCMA 5FQKA 1EROA 4OONA 4DF6A 2J7VA 1PZPA 5E43A 3G31A 4BLMA 5U47A 2WK0A 5L2FA 5GLCA 1I5QA 4GDNA 1K6RA 1E4DA 3BECA 4Y0UA 5GL9A 3PBQA 4S2PA 4X56A 2B5RA 5FQ9A 4U0TA 5A93A 1NZUA 4S2OA 5GLDA 3V5MA 3ZG8B 1DJAA 5FQMA 4OOMA 1TDLA 4UHUA 4BL2A 4FCFA 3PAEA 3TG9A 5GHZA 1NY0A 5HFOA 1MWRA 1DJBA 5FI6A 2DNSA 2VGJA 2FFFB 3VFHA 5EVLA 2G2WA 3WS0A 2Y2HA 1ES3A 2WKEA 1Z6FA 4KENB 4S2MA 5F1GA 2R9XA 1GHPA 3ZG5A 1GHIA 4Q8IA 4EUZA 3N8LA 5IHVA 2XF3A 3IHAA 4N1HA 2G2UA 4BQMA 1LL5A 4ZJ2A 5FI2A 3WRTA 5FATA 1PWCA 2XH9A 3NDEA 4P6BA 4KQRA 4X55A 4E3LA 4S2IA 3DTMA 3A3IA 1EI5A 4N92A 3ZHHA 3FYZA 3NBLA 1ES4A 3FWLA 3OPRA 1K25A 1BZAA 1H5XA 5AQBA 3QHYA 3QNBA 4IBRA 1WYCA 2XLNA 3M6HA 4UA7A 5GHYA 1FSWA 1PWDA 3ZNTA 3N6IA 3Q82A 3IXDA 1ERQA 1LI9A 5E2FA 1K4EA 3O3VA 3MKFA 4Y7PA 4ZJ3A 1SCWA 2Q9MA 2J9PA 3PTEA 2Y2OA 5CEBA 1K55A 5HX9A 1YLZA 2WAEA 1CI8A 5E2GA 1BT5A 5FA7A 3IHBA 4KZBA 4S2LA 3LEZA 3S4XA 1M6KA 3G4PA 1CI9A 4QJGA 3Q07A 1OMEA 4KZ9A 3GVBA 3N7WA 4H8RA 4OP8A 4WMCA 3MXSA 5A90A 4LV0A 4DRTA 5HAPA 1N4OA 3A3EA 3C4PA 5KSCA 3G2ZA 2PBYA 3WWXA 3UO9A 1IELA 3HUOA 4D2OA 3VP4A 3IWQA 3B3XA 2ZQ9A 5FAPA 4E3IA 2XR0A 3FZCA 3HREA 4KZ4A 1TDGA 3ZCZA 2WZXA 2XFSA 2ZD8A 2Y2MA 1BTLA 2X71A 4M3KA 3UE3A 4FH4A 3NI9A 5CECA 5FAQA 4IVKA 4MEZA 3UN7A 1YT4A 2QMIA 5BOHA 5M1AA 2Y2JA 4HBTA 4KZ8A 2A3UA 3ZVTA 1PZOA 2X02A 4GNUA 1M40A 3PAGA 4O7DA 4OPYA 3C5AA 3SS3A 5FI7A 1GCEA 2J9OA 2EFUA 4X68A 5TR7A 4DXCA 5HL1A 2EX6A 2ZC5B 3VSLA 3IF6C 3M2JA 3C7VA 4WZ5A 3P09A 3W4OA 1K56A 2RCXA 4PM8A 3HUNA 2IWCA 5FQIA 4OLGA 3ZGAB 4OQ0A 4S2JA 3DWZA 3UE0A 1PW1A 2BG1A 4KG2A 5DF7A 2JE5A 1W79A 3MBZA 1FSYA 4OKPA 5DTTA 5EVID 1RP5A 3OPHA 4OH0A 1JTGA 3E2LA 4C3QA 4R23A 3BYDA 1G6AA 5EVIC 4U3TA 3VOYA 4JXSA 2Y2PA 2Y91A 2OV5A 3ZFZA 4X69A 2Y59A 2EX9A 4GD8A 4XUXA 5EOEA 2ZM8A 1SDNA 4OQIA 3A3FA 1HTZA 2A49A 3IXGA 4HBUA 3TSGA 4F94A 2ZQ8A 4WEJA 3VP1A 1MKIA 1MBLA 3C7UA 4EQIA 4DKIA 4PM9A 2P9VB 3VP2A 3O87A 1QMFA 1S6RA 4HESA 3MZFA 1LL9A 1ZKJA 4QHCA 1NZOA 2ZM0A 1KGFA 4KG5A 2P9VA 1YLYA 4BL3A 2JC7A 3NC8A 4UA6A 1RCJA 1BLSA 1K57A 1S0WA 4KZ6A 3V50A 2H10A 4OLDA 3Q7ZA 4B4ZA 3GTCA 2Z2MB 1YLJA 1ONGA 3OPPA 2ZQCA 2XDMA 5A91A 1MWSA 1WE4A 5DTSA 5FSRA 4NK3A 3M6BA 4B4XA 1NRFA 2OSUA 2ZC6B 1NYYA 3GR2A 3O88A 2P74A 1W5DA 3N8RA 4ZAMA 1GA0A 1VM1A 4GDBA 2R9WA 4GKUA 4GOGA 4LCMA 5CHMA 5CXWA 3SH7A 1ESIA 3HL9A 3ISGA 3MXRA 4DE3A 4GD6A 3PBTA 1K54A 1BLCA 2WZZA 2V1ZA 4ZJ1A 1FCNA 4EBNA 5EE8A 3M2KA 5CGWA 2E8IA 3WS1A 1YM1A 3IH9A 4RYEA 3UE1A 4KZ3A 4N1XA 1PWGA 3CZDA 3IWIA 1ZC2A 2ZQDA 2H0TA 4PM5A 4ID4A 3AGFA 1SHVA 2Q9NA 4RX2A 4DXBA 3ZNYA 4GB7A 4UA9A 4DE0A 4WM9A 5HARA 4R4RA 5KSHA 2X01A 2UWXA 2ZC4B 2WGVA 3HLDA 5KZHA 1IYPA 4RX3A 4WZ4A 3V3RA 5E2HA 1ES2A 3BM6A 3WS5A 1MWTA 3EQUA 5CGXA 1TVFA 4KZAA 1AXBA 1I2SA 4C6YA 3MZEA 4OPRA 4A5RA 3UPNA 5FQQA 1KVMA 3Q7VB 3AGDA 1ESUA 2Y2GA 1KE4A 1XA7A 1BUEA 4JF4A 1KVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6W A;  3GRJ A;  1JVJ A;  1FQG A;  3Q7V A;  3FV7 A;  1PI5 A;  1EWZ A;  3GMW A;  1L2S A;  2Y2I A;  2V2F F;  2WKH A;  1JWZ A;  3VOZ A;  3WRZ A;  1KDW A;  2RL3 A;  4P0M A;  1BSG A;  1RGY A;  3NY4 A;  1FCO A;  1LLB A;  2HPB A;  3DW0 A;  3G2Y A;  3IXB A;  3OZH A;  1E3U D;  3HLE A;  4LCL A;  5KMW A;  2I72 A;  2XK1 A;  3LO7 A;  1TEM A;  4ZTK A;  4OPQ A;  3IF5 A;  1FOF A;  3C4O A;  2PU2 A;  1W8Q A;  3Q81 A;  1FR6 A;  1PI4 A;  2ZLY A;  5GLA A;  1L0G A;  4DE1 A;  4E3N A;  1PIO A;  3FKW A;  5D3O A;  5M19 A;  3P98 A;  1FR1 A;  1BLP A;  4E3M A;  5CTN A;  4L0L A;  2C6W B;  1CEG A;  5AQ9 A;  1JWV A;  4K91 A;  3O86 A;  1NJ4 A;  1K4F A;  3BRM A;  4S2N A;  5TGF A;  3ZG0 A;  1KGE A;  1YLW A;  1H8Z A;  4PPR A;  1KGG A;  2QZ6 A;  3G30 A;  3ZG7 B;  5EPH A;  4XXR A;  1LHY A;  1W8Y A;  5F82 A;  3UNW A;  3QNC A;  2XD5 A;  2EFX A;  2Y4A A;  1K55 C;  4KQO A;  4C75 A;  4MBF A;  3ZVW A;  1BUL A;  4E3J A;  2PU4 A;  3EQV A;  4JXW A;  4KQQ A;  2J8Y A;  3BFG A;  4JKT A;  5CRF A;  5TFQ A;  4JF6 A;  2HP9 A;  1KDS A;  4UAA A;  1XKZ A;  2XGN A;  4GZB A;  4OOY A;  4R1G A;  1NYM A;  4RA7 A;  4QU3 A;  5DVA A;  5HAI A;  4KZ7 A;  3CG5 A;  3CJM A;  4N9K A;  2EXA A;  3UPP A;  2C5W B;  4FSF A;  4FH2 A;  4BJP A;  3SS4 A;  3OCL A;  5AQ7 A;  4KG6 A;  1YMX A;  2WYX A;  2OLV A;  4WYY A;  3E2K A;  3G34 A;  4JF5 A;  5HAQ A;  1ES5 A;  4EV4 A;  5CED A;  1QME A;  2Y2L A;  1ERM A;  3D4F A;  4K0X A;  3IQA A;  4EBL A;  4E3O A;  3VP0 A;  1XGJ A;  3HVF A;  5M18 A;  2DRW A;  4R3B A;  3G35 A;  1KE3 A;  3GV9 A;  3I7J A;  3SH9 A;  3MKE A;  2EX8 A;  3VP3 A;  2HDR A;  1XGI A;  3PBO A;  3ITA A;  1SKF A;  2XQZ A;  3CMZ A;  4P85 A;  1XPB A;  4R3J A;  2HP5 A;  3BFD A;  5FQJ A;  1N9B A;  2H5S A;  5G18 A;  2WGW B;  4OPZ A;  5CGS A;  4BEN A;  2WUQ A;  1W7F A;  4E6X A;  1HVB A;  1RGZ A;  3OCN A;  4LV2 A;  1L0D A;  1K56 D;  2HDQ A;  3WS4 A;  4B88 A;  4X6T A;  2WGW A;  1DY6 A;  3MFD A;  4WZ5 C;  4DDY A;  4OVD A;  2QPN A;  5A92 A;  5JYO A;  4KZ5 A;  3VMA A;  1Y54 A;  2JBF A;  2WGI A;  1VQQ A;  4S2N C;  4OOL A;  5GLB A;  3S22 A;  3BFF A;  2GDN A;  3NIA A;  2HDS A;  3LY3 A;  4U0X A;  4JLF A;  2FFY A;  4IED A;  3RXX A;  3IF6 B;  1MXO A;  1MY8 A;  3GSG A;  5DTK A;  5CHU A;  4OQG A;  3RXW A;  3PBN A;  4FD8 A;  4DE2 A;  1E3U A;  3HLF A;  5J8X A;  3UDF A;  2XD1 A;  3OPL A;  3IF6 A;  1J9M A;  1XA1 A;  1HD8 A;  3PBS A;  4NET A;  4RVA A;  5FAS A;  4OQH A;  4QY5 A;  4GN2 A;  4R4S A;  3BEB A;  1O7E A;  3AGE A;  1YLT A;  4PM7 A;  3S1Y A;  4BD1 A;  1ONH A;  4N9L A;  3HLW A;  3ITB A;  1CEF A;  1XX2 A;  1DJC A;  2CC1 A;  4JXG A;  5CER A;  3HUM A;  1GA9 A;  5F1F A;  4ZBE A;  1IYO A;  5FDH A;  4LV1 A;  3W4P A;  4E3K A;  4EBP A;  5EEC A;  1HZO A;  1K6S A;  1IYS A;  5EVI B;  4DDS A;  4ZDX A;  5DF9 A;  3UPO A;  4LEN A;  2DCF A;  4JXV A;  5E2E A;  4CPK A;  3Q1F A;  1L0F A;  3DWK A;  4MBK A;  4CJN A;  3HLC A;  2HP6 A;  3N4I A;  5EVI A;  2ZMA A;  3HLG A;  2WAD A;  3TOI A;  1C3B A;  1ALQ A;  1XP4 A;  3IT9 A;  2ZJ9 A;  1IKG A;  1K57 C;  2WKI A;  3OC2 A;  4P87 A;  1IEM A;  3W4Q A;  2OLU A;  3MZD A;  3UY6 A;  2EXB A;  2V20 A;  4X53 A;  2H0Y A;  2ZM2 A;  4Z9Q A;  1ZG4 A;  1KE0 A;  4MBH A;  4QY6 A;  4YFM A;  5JYP A;  4IBX A;  3ZG9 B;  1WYB A;  4IVI A;  4QB8 A;  3BFE A;  1PYY A;  4LV3 A;  5GHX A;  1BLH A;  2WAF A;  2XEP A;  1PW8 A;  4JBF A;  1NXY A;  4YIN A;  2XFT A;  3BFC A;  3GQZ A;  3IWO A;  1CK3 A;  2Y2N A;  2Z2L B;  1U60 A;  3N8S A;  5DF8 A;  5EUA A;  4Y0T A;  1K54 C;  1JWP A;  2VGK A;  4PM6 A;  1Q2P A;  3BLS A;  3LY4 A;  1SDE A;  3W8K A;  4EWF A;  3HLB A;  3G32 A;  4QD4 A;  2BLS A;  1Q2Q A;  3JYI A;  1MPL A;  1MWU A;  3VFF A;  3IXH A;  3SOI A;  3UDI A;  3V39 A;  5F83 A;  3V3S A;  4BD0 A;  1LI0 A;  4JPM A;  2ZQA A;  4WEL A;  2IWB A;  3VSK A;  5EOO A;  3ZDJ A;  1IYQ A;  1GHM A;  1G68 A;  1YMS A;  1JTD A;  3SS5 A;  4WMC D;  2Y2K A;  2ZC7 A;  4Y0O A;  3UDX A;  3WS2 A;  2HDU A;  3PBR A;  3FKV A;  1ZG6 A;  4OP5 A;  1XXM A;  5CTM A;  3NCK A;  4HEF A;  4WEK A;  2JCH A;  2ZQ7 A;  4MNR A;  2Y55 A;  4K0W A;  2IWD A;  4MLL A;  1I2W A;  5CHJ A;  5I94 A;  3NDG A;  4S2K A;  5AQA A;  3RJU A;  1IKI A;  1K38 A;  4R0Q A;  3A3D A;  5FAO A;  2Y2Q A;  3HBR A;  3IH8 A;  1L0E A;  3BLM A;  1YLP A;  1E25 A;  4PMA A;  5HW3 A;  1YQS A;  4XUZ A;  3LCE A;  2ZC3 B;  1H8Y A;  3SH8 A;  3A3J A;  1O07 A;  2EX2 A;  4WBG A;  1FCM A;  5FQK A;  1ERO A;  4OON A;  4DF6 A;  2J7V A;  1PZP A;  5E43 A;  3G31 A;  4BLM A;  5U47 A;  2WK0 A;  5L2F A;  5GLC A;  1I5Q A;  4GDN A;  1K6R A;  1E4D A;  3BEC A;  4Y0U A;  5GL9 A;  3PBQ A;  4S2P A;  4X56 A;  2B5R A;  5FQ9 A;  4U0T A;  5A93 A;  1NZU A;  4S2O A;  5GLD A;  3V5M A;  3ZG8 B;  1DJA A;  5FQM A;  4OOM A;  1TDL A;  4UHU A;  4BL2 A;  4FCF A;  3PAE A;  3TG9 A;  5GHZ A;  1NY0 A;  5HFO A;  1MWR A;  1DJB A;  5FI6 A;  2DNS A;  2VGJ A;  2FFF B;  3VFH A;  5EVL A;  2G2W A;  3WS0 A;  2Y2H A;  1ES3 A;  2WKE A;  1Z6F A;  4KEN B;  4S2M A;  5F1G A;  2R9X A;  1GHP A;  3ZG5 A;  1GHI A;  4Q8I A;  4EUZ A;  3N8L A;  5IHV A;  2XF3 A;  3IHA A;  4N1H A;  2G2U A;  4BQM A;  1LL5 A;  4ZJ2 A;  5FI2 A;  3WRT A;  5FAT A;  1PWC A;  2XH9 A;  3NDE A;  4P6B A;  4KQR A;  4X55 A;  4E3L A;  4S2I A;  3DTM A;  3A3I A;  1EI5 A;  4N92 A;  3ZHH A;  3FYZ A;  3NBL A;  1ES4 A;  3FWL A;  3OPR A;  1K25 A;  1BZA A;  1H5X A;  5AQB A;  3QHY A;  3QNB A;  4IBR A;  1WYC A;  2XLN A;  3M6H A;  4UA7 A;  5GHY A;  1FSW A;  1PWD A;  3ZNT A;  3N6I A;  3Q82 A;  3IXD A;  1ERQ A;  1LI9 A;  5E2F A;  1K4E A;  3O3V A;  3MKF A;  4Y7P A;  4ZJ3 A;  1SCW A;  2Q9M A;  2J9P A;  3PTE A;  2Y2O A;  5CEB A;  1K55 A;  5HX9 A;  1YLZ A;  2WAE A;  1CI8 A;  5E2G A;  1BT5 A;  5FA7 A;  3IHB A;  4KZB A;  4S2L A;  3LEZ A;  3S4X A;  1M6K A;  3G4P A;  1CI9 A;  4QJG A;  3Q07 A;  1OME A;  4KZ9 A;  3GVB A;  3N7W A;  4H8R A;  4OP8 A;  4WMC A;  3MXS A;  5A90 A;  4LV0 A;  4DRT A;  5HAP A;  1N4O A;  3A3E A;  3C4P A;  5KSC A;  3G2Z A;  2PBY A;  3WWX A;  3UO9 A;  1IEL A;  3HUO A;  4D2O A;  3VP4 A;  3IWQ A;  3B3X A;  2ZQ9 A;  5FAP A;  4E3I A;  2XR0 A;  3FZC A;  3HRE A;  4KZ4 A;  1TDG A;  3ZCZ A;  2WZX A;  2XFS A;  2ZD8 A;  2Y2M A;  1BTL A;  2X71 A;  4M3K A;  3UE3 A;  4FH4 A;  3NI9 A;  5CEC A;  5FAQ A;  4IVK A;  4MEZ A;  3UN7 A;  1YT4 A;  2QMI A;  5BOH A;  5M1A A;  2Y2J A;  4HBT A;  4KZ8 A;  2A3U A;  3ZVT A;  1PZO A;  2X02 A;  4GNU A;  1M40 A;  3PAG A;  4O7D A;  4OPY A;  3C5A A;  3SS3 A;  5FI7 A;  1GCE A;  2J9O A;  2EFU A;  4X68 A;  5TR7 A;  4DXC A;  5HL1 A;  2EX6 A;  2ZC5 B;  3VSL A;  3IF6 C;  3M2J A;  3C7V A;  4WZ5 A;  3P09 A;  3W4O A;  1K56 A;  2RCX A;  4PM8 A;  3HUN A;  2IWC A;  5FQI A;  4OLG A;  3ZGA B;  4OQ0 A;  4S2J A;  3DWZ A;  3UE0 A;  1PW1 A;  2BG1 A;  4KG2 A;  5DF7 A;  2JE5 A;  1W79 A;  3MBZ A;  1FSY A;  4OKP A;  5DTT A;  5EVI D;  1RP5 A;  3OPH A;  4OH0 A;  1JTG A;  3E2L A;  4C3Q A;  4R23 A;  3BYD A;  1G6A A;  5EVI C;  4U3T A;  3VOY A;  4JXS A;  2Y2P A;  2Y91 A;  2OV5 A;  3ZFZ A;  4X69 A;  2Y59 A;  2EX9 A;  4GD8 A;  4XUX A;  5EOE A;  2ZM8 A;  1SDN A;  4OQI A;  3A3F A;  1HTZ A;  2A49 A;  3IXG A;  4HBU A;  3TSG A;  4F94 A;  2ZQ8 A;  4WEJ A;  3VP1 A;  1MKI A;  1MBL A;  3C7U A;  4EQI A;  4DKI A;  4PM9 A;  2P9V B;  3VP2 A;  3O87 A;  1QMF A;  1S6R A;  4HES A;  3MZF A;  1LL9 A;  1ZKJ A;  4QHC A;  1NZO A;  2ZM0 A;  1KGF A;  4KG5 A;  2P9V A;  1YLY A;  4BL3 A;  2JC7 A;  3NC8 A;  4UA6 A;  1RCJ A;  1BLS A;  1K57 A;  1S0W A;  4KZ6 A;  3V50 A;  2H10 A;  4OLD A;  3Q7Z A;  4B4Z A;  3GTC A;  2Z2M B;  1YLJ A;  1ONG A;  3OPP A;  2ZQC A;  2XDM A;  5A91 A;  1MWS A;  1WE4 A;  5DTS A;  5FSR A;  4NK3 A;  3M6B A;  4B4X A;  1NRF A;  2OSU A;  2ZC6 B;  1NYY A;  3GR2 A;  3O88 A;  2P74 A;  1W5D A;  3N8R A;  4ZAM A;  1GA0 A;  1VM1 A;  4GDB A;  2R9W A;  4GKU A;  4GOG A;  4LCM A;  5CHM A;  5CXW A;  3SH7 A;  1ESI A;  3HL9 A;  3ISG A;  3MXR A;  4DE3 A;  4GD6 A;  3PBT A;  1K54 A;  1BLC A;  2WZZ A;  2V1Z A;  4ZJ1 A;  1FCN A;  4EBN A;  5EE8 A;  3M2K A;  5CGW A;  2E8I A;  3WS1 A;  1YM1 A;  3IH9 A;  4RYE A;  3UE1 A;  4KZ3 A;  4N1X A;  1PWG A;  3CZD A;  3IWI A;  1ZC2 A;  2ZQD A;  2H0T A;  4PM5 A;  4ID4 A;  3AGF A;  1SHV A;  2Q9N A;  4RX2 A;  4DXB A;  3ZNY A;  4GB7 A;  4UA9 A;  4DE0 A;  4WM9 A;  5HAR A;  4R4R A;  5KSH A;  2X01 A;  2UWX A;  2ZC4 B;  2WGV A;  3HLD A;  5KZH A;  1IYP A;  4RX3 A;  4WZ4 A;  3V3R A;  5E2H A;  1ES2 A;  3BM6 A;  3WS5 A;  1MWT A;  3EQU A;  5CGX A;  1TVF A;  4KZA A;  1AXB A;  1I2S A;  4C6Y A;  3MZE A;  4OPR A;  4A5R A;  3UPN A;  5FQQ A;  1KVM A;  3Q7V B;  3AGD A;  1ESU A;  2Y2G A;  1KE4 A;  1XA7 A;  1BUE A;  4JF4 A;  1KVL A; 
#chains in the Genus database with same CATH topology
 1JVJ A;  1FQG A;  2EA9 A;  3Q7V A;  3H82 A;  2A24 A;  2V2F F;  3C30 A;  4LRX C;  3LUQ A;  2JN7 A;  1LLB A;  2HPB A;  3IXB A;  3HLE A;  3RTY A;  3LO7 A;  4ZTK A;  2V8C A;  1FR6 A;  1PIO A;  5M19 A;  3BJN A;  4ARZ A;  1CEG A;  1JWV A;  1NJ4 A;  1K4F A;  3ZG0 A;  4BMW A;  4PPR A;  2QZ6 A;  3ZG7 B;  4EEU A;  1STZ A;  2GZA A;  1K55 C;  4E3J A;  4JKT A;  2HP9 A;  4UAA A;  1XKZ A;  4UQI S;  1F5M A;  1NYM A;  1T1A A;  1VHM A;  2ZMV A;  4N9K A;  1TS7 A;  4LRZ E;  5AQ7 A;  1YSQ A;  4KG6 A;  1YMX A;  3UME A;  2OLV A;  5HAQ A;  4JF5 A;  3B47 A;  1P9R A;  4EV4 A;  5CED A;  1DP8 A;  2Y2L A;  3D4F A;  4K0X A;  3JPU A;  4E3O A;  2DRW A;  4B93 A;  3T4Q A;  3I7J A;  2EX8 A;  3PBO A;  5A8B A;  1S4S A;  3FG8 A;  1N9B A;  5G18 A;  3R7W B;  4Y13 A;  1W7F A;  1RGZ A;  2QHK A;  4KQD A;  2HDQ A;  4FUW A;  1H8M A;  2WGW A;  4WZ5 C;  4OVD A;  4YNR A;  5A92 A;  2OAQ 1;  4KZ5 A;  2JBF A;  2WGI A;  1VQQ A;  5GLB A;  3FC7 A;  3NIA A;  5EM1 A;  4Z1W A;  1D1J A;  4Y17 A;  2FFY A;  1LSX A;  3IF6 B;  1MXO A;  5DTK A;  3RXW A;  4FD8 A;  5J8X A;  3OPL A;  4NET A;  1J9M A;  3MJQ A;  5FAS A;  4OQH A;  4GN2 A;  4R4S A;  3AGE A;  4PM7 A;  1YLT A;  2Q0O A;  1CEF A;  1XX2 A;  2V1B A;  4P6Z M;  3NJA A;  1IYO A;  2HZ5 A;  4E3K A;  1HZO A;  1IYS A;  5DF9 A;  5E2E A;  3H82 B;  2FH5 A;  4X1M A;  2QKP A;  5DJT A;  3HLC A;  2HP6 A;  4PKY G;  1K57 C;  2WKI A;  2OLU A;  3UY6 A;  2H0Y A;  2ZM2 A;  1ZG4 A;  4QY6 A;  4QB8 A;  4ARZ B;  2XEP A;  1PW8 A;  4YIN A;  3BFC A;  5EV0 A;  1U60 A;  5DF8 A;  1OT6 A;  4MN5 A;  3DBA A;  2O99 A;  2PD7 A;  3W8K A;  3G32 A;  2BLS A;  3PYP A;  1Q2Q A;  3JYI A;  3IXH A;  4BD0 A;  2K7S A;  2ZQA A;  1T1C A;  3SS5 A;  5TBM B;  2ZC7 A;  3FKV A;  2QYB A;  5CTM A;  4WEK A;  3LFV A;  4MLL A;  1I2W A;  4ESP A;  5I94 A;  3NDG A;  4S2K A;  4CQH A;  5FAO A;  2Y2Q A;  2G7U A;  5K5B A;  5HW3 A;  4O8G A;  1YQS A;  4XUZ A;  1PFL A;  2ACG A;  3SH8 A;  3GDI A;  1FCM A;  3QP8 A;  4OON A;  4DF6 A;  2J7V A;  3NHQ A;  5DFY A;  4BLM A;  5GLC A;  4GDN A;  1K6R A;  4GS9 A;  4S2P A;  4EXO A;  3NOP C;  5A93 A;  4U0T A;  3UB9 A;  3LI9 A;  1XFN A;  3B33 A;  1TDL A;  4FCF A;  4CLC D;  5L8M A;  1WA9 A;  2VGJ A;  2FFF B;  5EVL A;  4ME4 A;  1ES3 A;  2WKE A;  2JKG A;  2R9X A;  3KSF A;  3N8L A;  2QWS A;  4N1H A;  1PWC A;  1OTD A;  4S2I A;  3A3I A;  3ZHH A;  3NBL A;  3OPR A;  3D3O A;  1N9O A;  1WYC A;  2XLN A;  3F1P B;  3M6H A;  5GHY A;  1FSW A;  3ZNT A;  3N6I A;  3LIA A;  1SCW A;  2Q9M A;  3QP2 A;  3PTE A;  5CEB A;  2WAE A;  5HDS A;  3IBR A;  3OBF A;  5FA7 A;  1BYW A;  3CPT A;  5L10 A;  1PNE A;  3LIC A;  2P7J A;  3Q07 A;  4H8R A;  3MXS A;  5A90 A;  4DRT A;  3WWX A;  1TS6 A;  3T4T A;  3HUO A;  4H6J B;  3T4L A;  2YKH A;  2GJ3 A;  2WKP A;  3B3X A;  3K2N A;  3HRE A;  4HP9 A;  2XFS A;  3MSH A;  2W1T B;  2ZD8 A;  2Y2M A;  1BTL A;  2JKF A;  4FH4 A;  2J3W A;  2V9A A;  1YT4 A;  5M1A A;  4KZ8 A;  3ZVT A;  2PBD P;  4GNU A;  3PAG A;  3C5A A;  1GCE A;  2W3E A;  2W3H A;  1TF1 A;  4LFU A;  5HD5 A;  3C7V A;  4B9O A;  1K56 A;  5HPI A;  4CLC A;  4PM8 A;  3HUN A;  5FQI A;  4OQ0 A;  3LR5 A;  3P7N A;  3DWZ A;  3LIF A;  5CX7 A;  5AVE A;  3UB7 A;  3DTK A;  5L09 A;  4I39 A;  3MBZ A;  5EVI D;  1JTG A;  2UV0 E;  5MC7 A;  4GS9 B;  2Y91 A;  1ZTU A;  4UEY A;  4X1L A;  2EX9 A;  1OTB A;  5EOE A;  4I3J A;  1SDN A;  4OQI A;  3TSG A;  1MKI A;  2PDR A;  1ACF A;  2W3G A;  3RH8 B;  3O87 A;  3QP6 A;  4MN6 A;  4HES A;  3MZF A;  3T4O A;  2P9V A;  2JC7 A;  2K31 A;  1S0W A;  3Q7Z A;  4B4Z A;  2Z2M B;  4WLA A;  2XDM A;  3LEQ A;  1WE4 A;  3M6B A;  4B4X A;  2P08 A;  1NYY A;  2VV7 A;  3N8R A;  1VM1 A;  5CXW A;  2R9W A;  4KUK A;  3MS6 A;  3PBT A;  2K2N A;  2WZZ A;  4ZJ1 A;  4EBN A;  3TJZ C;  5EE8 A;  4Q0I A;  3WS1 A;  3CZD A;  4R70 A;  4PM5 A;  2Q9N A;  1SKO B;  3ZNY A;  5HAR A;  2D02 A;  4R4R A;  5KSH A;  2UWX A;  4RX3 A;  1D06 A;  4WZ4 A;  1GSV A;  1ES2 A;  5E2H A;  1MWT A;  1S66 L;  1L3L A;  5CGX A;  1TVF A;  3MZE A;  4OPR A;  2P04 A;  4O01 A;  2PT7 A;  1KVM A;  1KE4 A;  1BUE A;  1S1Y A;  4G3W A;  3FV7 A;  2Y2I A;  4G3V A;  3WRZ A;  4WL9 A;  1DRM A;  1BSG A;  1RGY A;  3NY4 A;  3OZH A;  1E3U D;  1TEM A;  3Q81 A;  4CLC B;  1GSX A;  3FKW A;  3P98 A;  3BW6 A;  4KUO A;  4L0L A;  3O86 A;  4S2N A;  3ICY A;  2V8F A;  1H8Z A;  5KIZ A;  3G30 A;  4IUH A;  4XXR A;  3NOT C;  3UNW A;  2XD5 A;  4KQO A;  4MBF A;  4JXW A;  2J8Y A;  5TFQ A;  2XA7 S;  4GZB A;  4R1G A;  1J3W A;  1FIK A;  5HAI A;  1NLY A;  3UPP A;  4FH2 A;  2V1A A;  3SS4 A;  3CLO A;  5J3W A;  2Z6D A;  2WYX A;  4WYY A;  4EET B;  3LIE A;  1ERM A;  2VK3 A;  2PR5 A;  3K3D A;  3VP0 A;  4MN7 A;  4R3B A;  1N9L A;  3GV9 A;  3SH9 A;  3VP3 A;  1XGI A;  1G5U A;  4Q0J A;  3CMZ A;  1XPB A;  4R3J A;  5FQJ A;  5HWV A;  4JGQ A;  2H5S A;  4MDZ A;  4BEN A;  2WUQ A;  4I3I A;  1HVB A;  5C5K A;  4IJG A;  4MCW A;  3QP1 A;  2A2L A;  1Y54 A;  2BTF P;  4S2N C;  4OOL A;  2O9B A;  4IED A;  4M4X A;  3GSG A;  3CAX A;  5CHU A;  1E3U A;  4L9F A;  3IF6 A;  1HD8 A;  3E0Y A;  3TE8 A;  4QY5 A;  3BEB A;  3ITB A;  4JXG A;  5AJG A;  5DJU A;  3CUE C;  3KYZ A;  4EBP A;  5EVI B;  3KO6 A;  4JXV A;  4CPK A;  2PAV P;  3Q1F A;  1L0F A;  4CJN A;  3HLG A;  3TOI A;  1C3B A;  1IKG A;  3VE3 A;  4GW9 A;  3MZD A;  2EXB A;  2V20 A;  5HWW A;  3T4J A;  4IBX A;  4IVI A;  1PYY A;  5GHX A;  4JBF A;  2XFT A;  3GQZ A;  2L0W A;  3IWO A;  4MMN A;  4Y0T A;  5EUA A;  2L4R A;  1H0M A;  3LID A;  4PM6 A;  3KYE A;  3LY4 A;  1SDE A;  2B02 A;  1MPL A;  3VFF A;  4BBU A;  4HI4 A;  1Y28 A;  5F83 A;  3V3S A;  2XSS A;  4WEL A;  5J7E A;  1G68 A;  2ZMF A;  4WMC D;  4Y0O A;  4OP5 A;  3PBR A;  1NLZ A;  3NCK A;  4HEF A;  2Y55 A;  5TBM A;  5EFW A;  5AQA A;  1IKI A;  1K38 A;  2J3T C;  3IH8 A;  1YLP A;  1E25 A;  2FZ0 A;  2ZL1 B;  2W1R A;  3S7P A;  1O07 A;  2EX2 A;  4WBG A;  5FQK A;  2PD8 A;  3G31 A;  5L2F A;  1E4D A;  4Y0U A;  4GJ4 A;  3ZG8 B;  4CLC E;  3A0V A;  4HOI A;  1DP9 A;  5HFO A;  3IBJ A;  3ULF A;  1F2K A;  4KEN B;  5F1G A;  1GHP A;  1SZV A;  4BQM A;  1LL5 A;  1G6O A;  2V0U A;  4ZJ2 A;  5FI2 A;  2XH9 A;  4P6B A;  1EI5 A;  1K25 A;  1F98 A;  2O0Y A;  1UWN X;  3E4Q A;  3IXD A;  4Y7P A;  3F1P A;  4ZJ3 A;  2GX5 A;  1OT9 A;  1YLZ A;  1CI8 A;  2QJ7 A;  5E2G A;  1BT5 A;  3K3C A;  4S2L A;  3LGO A;  1OTE A;  4KZ9 A;  3BY9 A;  4OP8 A;  4WMC A;  2AVX A;  2W0N A;  1N4O A;  5KSC A;  3G2Z A;  4YWZ A;  2PBY A;  4HP4 A;  3UO9 A;  3IWQ A;  5FAP A;  4E3I A;  3FZC A;  4K08 A;  2ZOI A;  4KZ4 A;  1TDG A;  4H6J A;  3LYX A;  2X71 A;  4M3K A;  3NI9 A;  2HJ9 C;  4G3K A;  5FAQ A;  3NEC A;  2M7U A;  4IVK A;  4MEZ A;  2W1T A;  2QMI A;  4OPY A;  2O9A A;  1YKD A;  2EFU A;  4X68 A;  5TR7 A;  3RFB A;  3S7N A;  2OAP 1;  3M2J A;  1OJG A;  3P09 A;  3W4O A;  4OLG A;  3DTE A;  3MQ0 A;  4S2J A;  1PW1 A;  4EU0 A;  5DF7 A;  1LSW A;  4PAU A;  1XJ3 A;  4E04 A;  4OKP A;  4LPZ A;  4R23 A;  4U3T A;  3VOY A;  2Y2P A;  2OV5 A;  2VGL S;  3A3F A;  1HTZ A;  2A49 A;  2ZQ8 A;  4QPR A;  1T1B A;  1MBL A;  4DKI A;  2M7V A;  4GHI B;  1S6R A;  1ZKJ A;  1NZO A;  1KGF A;  1OTI A;  3V50 A;  4OLD A;  3GTC A;  3OPP A;  5A91 A;  4NG2 A;  5DTS A;  2OSU A;  2XA7 M;  2P74 A;  2KX6 A;  4LCM A;  3H9W A;  4GDB A;  4ZAM A;  4GOG A;  4IUK A;  3SH7 A;  3HL9 A;  3ISG A;  4GD6 A;  1K54 A;  1BLC A;  5CGW A;  4JGO A;  1YM1 A;  3IH9 A;  5FL3 A;  4KZ3 A;  4N1X A;  1PWG A;  4ETZ A;  1ZC2 A;  2ZQD A;  3BQ8 A;  4GB7 A;  4WM9 A;  2X01 A;  2KDK A;  4DN0 A;  3V3R A;  2EWV A;  1SKO A;  3BM6 A;  4HJ4 A;  5FEG A;  1AXB A;  1I2S A;  4A5R A;  1XFQ A;  5FQQ A;  4QWO A;  3MMH A;  3GRJ A;  1XJ6 A;  1PI5 A;  2CMN A;  2WKH A;  1JWZ A;  3VOZ A;  1KDW A;  3UMD A;  2RL3 A;  5FI7 A;  3DW0 A;  4LCL A;  5HD3 A;  5KMW A;  5IT5 A;  3UB5 P;  4NXF A;  3IF5 A;  1FOF A;  3KSH A;  3C4O A;  2PU2 A;  1W8Q A;  2E8J A;  5GLA A;  2B18 A;  5HL6 A;  4EQ1 A;  4NEE D;  3D9Y A;  1FR1 A;  3SZT A;  5CTN A;  2C6W B;  5AQ9 A;  2LB9 A;  3KYQ A;  5TGF A;  1KGE A;  1MZU A;  5EPH A;  4HJ6 A;  4IHQ A;  1LL8 A;  2Y4A A;  1YPR A;  1TS0 A;  3ZVW A;  1BUL A;  2PU4 A;  3EQV A;  4DMZ A;  5CRF A;  4OOY A;  4RA7 A;  5DVA A;  3V67 A;  4KZ7 A;  3CJM A;  3KX0 X;  2H28 A;  4BJP A;  1N9N A;  2PYR A;  3G34 A;  3EOI A;  3MQQ A;  1QME A;  3LIB A;  2OOL A;  1ODV A;  1XGJ A;  3HVF A;  5M18 A;  1LSV A;  1X0O A;  4I3A A;  1VET B;  3UE6 A;  1SKF A;  2XQZ A;  5AVF A;  2HP5 A;  3BFD A;  4F3L A;  3OCN A;  1L0D A;  5DKK A;  3WS4 A;  4B88 A;  4X6T A;  1DY6 A;  5F68 A;  4DDY A;  2QPN A;  4CLC C;  5JYO A;  3VMA A;  3S22 A;  2GDN A;  2HDS A;  3LY3 A;  4U0X A;  3MF0 A;  3U4L P;  3T1R A;  2Z6C A;  4OQG A;  4DE2 A;  3HLF A;  4RVA A;  4BD1 A;  3HLW A;  3HUM A;  4LV1 A;  3W4P A;  2BAS A;  1K6S A;  4DDS A;  4LEN A;  3A0R A;  3DWK A;  4NXB A;  5EVI A;  3ZQ5 A;  2WAD A;  1ALQ A;  3IT9 A;  3LR3 A;  3C38 A;  2ZJ9 A;  3OC2 A;  4P87 A;  1IEM A;  3W4Q A;  2WKQ A;  3HJI A;  5F6A A;  4X53 A;  4XT2 A;  1KE0 A;  4MBH A;  3EEH A;  5JYP A;  2VJW A;  3ZG9 B;  1WYB A;  3VE4 A;  3BFE A;  4PHT A;  4LV3 A;  2WAF A;  4LRY C;  5G4Z A;  1D7E A;  1CK3 A;  1VB6 A;  3CIT A;  4R3A A;  2VGK A;  1Q2P A;  3BLS A;  4DJ3 A;  3MFX A;  3HLB A;  4QD4 A;  1MWU A;  4Y2F A;  3SOI A;  3EEA A;  3UDI A;  3HCY A;  3UB6 A;  3VSK A;  5EOO A;  1IYQ A;  4NXG A;  1YMS A;  1H3Q A;  4RQ9 A;  2PHY A;  3WS2 A;  2HDU A;  1ZG6 A;  2IA2 A;  4GLQ A;  4MNR A;  2JCH A;  2ZQ7 A;  3CWF A;  2O9C A;  3D72 A;  4K0W A;  5CHJ A;  3HBR A;  3BLM A;  1T18 A;  2ZC3 B;  3H7W A;  3LCE A;  1YSP A;  1ERO A;  2ZL1 A;  5FEF A;  1OPX A;  5E43 A;  5U47 A;  1S4R A;  1P0Z A;  5J4E A;  4F3L B;  3BEC A;  1JNU A;  2B5R A;  3BQA A;  3F1N B;  3V5M A;  5FQM A;  4OOM A;  5DFX A;  1IOU A;  1MWR A;  1DJB A;  3C2W A;  1VEU B;  3WS0 A;  4S2M A;  1GHI A;  4WUJ A;  1S1Z A;  2XF3 A;  3IHA A;  1F9I A;  1KOU A;  4N92 A;  2VGL M;  4HIA A;  1BZA A;  1H5X A;  4R38 A;  4HH2 A;  4UA7 A;  1PWD A;  2YKF A;  3O3V A;  5F5Y A;  2VX8 A;  2J9P A;  3UB8 A;  1W63 Q;  3T4S A;  1K55 A;  1NWZ A;  2LB5 A;  3IHB A;  3HJK A;  4HJ3 A;  3S4X A;  1M6K A;  3G4P A;  4DJ2 A;  4XT2 B;  2J80 A;  4Y5F A;  5L07 A;  4FOF A;  3VP4 A;  2JKR I;  2XR0 A;  3DAV A;  1P9W A;  1T19 A;  2WZX A;  4BBV A;  4L9E A;  4EEP A;  5CEC A;  5I5L A;  3UN7 A;  2VA0 A;  2WKR A;  4HBT A;  4HNB A;  1AWI A;  1CF0 A;  1M40 A;  3SS3 A;  5F69 A;  2GNX A;  4HH3 A;  3OLO A;  3VSL A;  3IF6 C;  3NOU C;  4WZ5 A;  3O5Y A;  5IU1 A;  1MC0 A;  4BBT A;  2VKS A;  2BG1 A;  4KG2 A;  3H7W B;  2JE5 A;  1V9Z A;  3KSI A;  5HPF A;  5DTT A;  1RP5 A;  3NUL A;  4OH0 A;  3MQO A;  3QP5 A;  1XJ2 A;  3EWK A;  1G28 A;  4HBU A;  4WEJ A;  3VP1 A;  4JGP A;  4EQI A;  3IS2 B;  4PM9 A;  3VP2 A;  4JGR A;  3U2A A;  2V0W A;  1LL9 A;  3JVV A;  4KG5 A;  1YLY A;  4BL3 A;  4UA6 A;  1RCJ A;  1BLS A;  1K57 A;  4GHI A;  2EWW A;  2R78 A;  1YLJ A;  4WF0 A;  1FIL A;  5FSR A;  1NRF A;  2ZC6 B;  1GA0 A;  4GKU A;  3QP4 A;  1ESI A;  4R6L A;  3UE1 A;  3AGF A;  5G4Y A;  3E4O A;  1SHV A;  4RX2 A;  4EW7 A;  2HJE A;  3F1O B;  1YAX A;  2WGV A;  5KZH A;  1ZHH B;  3EQU A;  1UGU A;  3R4K A;  3BY8 A;  4NKP A;  4EUV A;  3Q7V B;  3A0S A;  3AGD A;  2W27 A;  2A24 B;  1XA7 A;  4E6W A;  4HQA A;  3GMW A;  1EWZ A;  2W3D A;  1L2S A;  5HDD A;  2JKT I;  3MXQ A;  3T4K A;  4P0M A;  1FCO A;  3G2Y A;  2I72 A;  2XK1 A;  4OPQ A;  3FPW A;  1L0G A;  1PI4 A;  2ZLY A;  4DE1 A;  4E3N A;  5D3O A;  1OTA A;  3ZYT A;  1BLP A;  4E3M A;  4K91 A;  3BRM A;  1YLW A;  5TJJ A;  1MKM A;  1KGG A;  5F82 A;  1LHY A;  1TD5 A;  1W8Y A;  3LR4 A;  3QNC A;  4X25 A;  2EFX A;  1W63 M;  4C75 A;  4KQQ A;  2PR6 A;  3BFG A;  4AFI A;  4JF6 A;  1KDS A;  2XGN A;  4QU3 A;  3CG5 A;  2EXA A;  1Y4O A;  2C5W B;  3KSG A;  4FSF A;  1EW0 A;  3OCL A;  5EVE A;  2XRO A;  2JKR M;  3E2K A;  3EGD C;  4O0P A;  1ES5 A;  1PRQ A;  3IQA A;  4EBL A;  2D01 A;  1XJ4 A;  3G35 A;  1KE3 A;  3MKE A;  2HDR A;  1LT0 A;  3ITA A;  4P85 A;  1V9Y A;  2M1C A;  3PR6 A;  1VET A;  2WGW B;  4OPZ A;  5CGS A;  4E6X A;  4LV2 A;  5HSQ A;  3T50 A;  1K56 D;  1A0K A;  3PHY A;  2B95 A;  4YOF A;  3MFD A;  1DP6 A;  3BFF A;  4JLF A;  3RXX A;  4LGW A;  4BWI A;  5HWT A;  1MY8 A;  3IX4 A;  3PBN A;  3LR0 A;  3UDF A;  2Y8H A;  2XD1 A;  1XA1 A;  3PBS A;  1O7E A;  3S1Y A;  1ONH A;  4N9L A;  1DJC A;  2CC1 A;  5CER A;  1GA9 A;  5F1F A;  4ZBE A;  5FDH A;  3FPV A;  5EEC A;  2OWH A;  4ZDX A;  3VV4 A;  3UPO A;  2DCF A;  2DMW A;  4MBK A;  3N4I A;  2ZMA A;  3GEC A;  1XP4 A;  3T1Q B;  2VV8 A;  2VV6 A;  4Z9Q A;  4ZRR A;  4YFM A;  1BLH A;  1NXY A;  2Y2N A;  2Z2L B;  2ZBB A;  3N8S A;  1K54 C;  1JWP A;  3LI8 A;  1UWP X;  4EWF A;  4WN5 A;  3V39 A;  1LI0 A;  4JPM A;  2IWB A;  2PRF A;  3ZDJ A;  1GHM A;  1JTD A;  2Y2K A;  3UDX A;  1XXM A;  3OOV A;  2Y79 A;  2ZOH A;  3DTI A;  2IWD A;  3RJU A;  4R0Q A;  3A3D A;  1L0E A;  2XRN A;  4PMA A;  1IFQ A;  1H8Y A;  3A3J A;  2NUT C;  4L9G A;  4PKY A;  1PZP A;  3P01 A;  2WK0 A;  1HLU P;  2JHE A;  1I5Q A;  2JKT M;  4NXE A;  5GL9 A;  3PBQ A;  4Q0H A;  4X56 A;  5FQ9 A;  1NZU A;  4S2O A;  5GLD A;  1DJA A;  4HHD A;  4P6Z S;  4UHU A;  4BL2 A;  2HV1 A;  3F1N A;  3PAE A;  3TG9 A;  5GHZ A;  1NY0 A;  5DKL A;  5FI6 A;  2DNS A;  3VFH A;  1NRJ A;  2G2W A;  2Y2H A;  1Z6F A;  2QJ5 A;  3BWL A;  3ZG5 A;  4Q8I A;  2OWJ A;  4EUZ A;  5IHV A;  1VEU A;  3MR0 A;  2G2U A;  3WRT A;  5LBR A;  5FAT A;  3NDE A;  4KQR A;  4X55 A;  4E3L A;  4UQI M;  3B42 A;  3DTM A;  3FYZ A;  1ES4 A;  5EM0 A;  3IX8 A;  3FWL A;  5AQB A;  3QHY A;  3QNB A;  4IBR A;  3Q82 A;  3SW1 A;  1ERQ A;  1LI9 A;  5E2F A;  1K4E A;  3VOL A;  3MKF A;  2Y2O A;  3CPT B;  5HX9 A;  4I5S A;  2W3F A;  4KZB A;  3LEZ A;  1CI9 A;  4QJG A;  1OME A;  3GVB A;  3N7W A;  5FDS A;  1CQA A;  1TS8 A;  4LV0 A;  5HAP A;  3A3E A;  3C4P A;  1IEL A;  4D2O A;  2ZQ9 A;  3ZCZ A;  1S67 L;  1GSW A;  3T1X A;  3UE3 A;  3W2Z A;  2NUP C;  3PXP A;  5BOH A;  2Y2J A;  2A3U A;  2VEA A;  1PZO A;  2X02 A;  4O7D A;  1Z09 A;  3CI6 A;  4DXC A;  2J9O A;  5HL1 A;  2EX6 A;  2ZC5 B;  4D60 A;  3CHW P;  4Y3I A;  2RCX A;  2IWC A;  4ETX A;  3ZGA B;  2J3T D;  3UE0 A;  1W79 A;  1FSY A;  2L1M A;  5HDC A;  3OPH A;  3E2L A;  1P97 A;  2KLI A;  3E4P A;  4C3Q A;  1K0K A;  3BYD A;  1G6A A;  5EVI C;  1CJF A;  4JXS A;  3ZFZ A;  4X69 A;  2Y59 A;  3C8C A;  4GD8 A;  4XUX A;  3CUE A;  2ZM8 A;  4GCZ A;  3IXG A;  4F94 A;  2VZW A;  2INW A;  3T12 B;  3C7U A;  2HGV A;  2P9V B;  3TW8 A;  1QMF A;  2PYP A;  4QHC A;  2ZM0 A;  3IS2 A;  2I9V A;  3NC8 A;  3E98 A;  4KZ6 A;  2H10 A;  3S7Q A;  1ONG A;  2ZQC A;  1MWS A;  3S7O A;  4NK3 A;  3GR2 A;  3O88 A;  4EER A;  1W5D A;  4FTX A;  3L7H A;  3R7W A;  5CHM A;  3MXR A;  4DE3 A;  4II7 A;  4EES A;  3JVU A;  2V1Z A;  3IX3 A;  1FCN A;  3M2K A;  3T1S A;  2E8I A;  4RYE A;  3L9K A;  2VLG A;  1OJ5 A;  4Y15 A;  3IWI A;  2H0T A;  4ID4 A;  2KOI A;  4DXB A;  4UA9 A;  4DE0 A;  3EGX C;  4I38 A;  4LLO B;  4HY8 A;  3HLD A;  2ZC4 B;  2MJ6 A;  1IYP A;  3WS5 A;  3F1O A;  5HZH A;  4KZA A;  3G6O A;  4C6Y A;  2HF6 A;  3UPN A;  3TRC A;  1ESU A;  2Y2G A;  5IS1 A;  4JF4 A;  1KVL A; 
#chains in the Genus database with same CATH homology
 4E6W A;  3GRJ A;  1JVJ A;  1FQG A;  3Q7V A;  3FV7 A;  1PI5 A;  1EWZ A;  3GMW A;  1L2S A;  2Y2I A;  2V2F F;  2WKH A;  1JWZ A;  3VOZ A;  3WRZ A;  1KDW A;  2RL3 A;  4P0M A;  1BSG A;  1RGY A;  3NY4 A;  1FCO A;  1LLB A;  2HPB A;  3DW0 A;  3G2Y A;  3IXB A;  3OZH A;  1E3U D;  3HLE A;  4LCL A;  5KMW A;  2I72 A;  2XK1 A;  3LO7 A;  1TEM A;  4ZTK A;  4OPQ A;  3IF5 A;  1FOF A;  3C4O A;  2PU2 A;  1W8Q A;  3Q81 A;  1FR6 A;  1PI4 A;  2ZLY A;  5GLA A;  1L0G A;  4DE1 A;  4E3N A;  1PIO A;  3FKW A;  5D3O A;  5M19 A;  3P98 A;  1FR1 A;  1BLP A;  4E3M A;  5CTN A;  4L0L A;  2C6W B;  1CEG A;  5AQ9 A;  1JWV A;  4K91 A;  3O86 A;  1NJ4 A;  1K4F A;  3BRM A;  4S2N A;  5TGF A;  3ZG0 A;  1KGE A;  1YLW A;  1H8Z A;  4PPR A;  1KGG A;  2QZ6 A;  3G30 A;  3ZG7 B;  5EPH A;  4XXR A;  1LHY A;  1W8Y A;  5F82 A;  3UNW A;  3QNC A;  2XD5 A;  2EFX A;  2Y4A A;  1K55 C;  4KQO A;  4C75 A;  4MBF A;  3ZVW A;  1BUL A;  4E3J A;  2PU4 A;  3EQV A;  4JXW A;  4KQQ A;  2J8Y A;  3BFG A;  4JKT A;  5CRF A;  5TFQ A;  4JF6 A;  2HP9 A;  1KDS A;  4UAA A;  1XKZ A;  2XGN A;  4GZB A;  4OOY A;  4R1G A;  1NYM A;  4RA7 A;  4QU3 A;  5DVA A;  5HAI A;  4KZ7 A;  3CG5 A;  3CJM A;  4N9K A;  2EXA A;  3UPP A;  2C5W B;  4FSF A;  4FH2 A;  4BJP A;  3SS4 A;  3OCL A;  5AQ7 A;  4KG6 A;  1YMX A;  2WYX A;  2OLV A;  4WYY A;  3E2K A;  3G34 A;  4JF5 A;  5HAQ A;  1ES5 A;  4EV4 A;  5CED A;  1QME A;  2Y2L A;  1ERM A;  3D4F A;  4K0X A;  3IQA A;  4EBL A;  4E3O A;  3VP0 A;  1XGJ A;  3HVF A;  5M18 A;  2DRW A;  4R3B A;  3G35 A;  1KE3 A;  3GV9 A;  3I7J A;  3SH9 A;  3MKE A;  2EX8 A;  3VP3 A;  2HDR A;  1XGI A;  3PBO A;  3ITA A;  1SKF A;  2XQZ A;  3CMZ A;  4P85 A;  1XPB A;  4R3J A;  2HP5 A;  3BFD A;  5FQJ A;  1N9B A;  2H5S A;  5G18 A;  2WGW B;  4OPZ A;  5CGS A;  4BEN A;  2WUQ A;  1W7F A;  4E6X A;  1HVB A;  1RGZ A;  3OCN A;  4LV2 A;  1L0D A;  1K56 D;  2HDQ A;  3WS4 A;  4B88 A;  4X6T A;  2WGW A;  1DY6 A;  3MFD A;  4WZ5 C;  4DDY A;  4OVD A;  2QPN A;  5A92 A;  5JYO A;  4KZ5 A;  3VMA A;  1Y54 A;  2JBF A;  2WGI A;  1VQQ A;  4S2N C;  4OOL A;  5GLB A;  3S22 A;  3BFF A;  2GDN A;  3NIA A;  2HDS A;  3LY3 A;  4U0X A;  4JLF A;  2FFY A;  4IED A;  3RXX A;  3IF6 B;  1MXO A;  1MY8 A;  3GSG A;  5DTK A;  5CHU A;  4OQG A;  3RXW A;  3PBN A;  4FD8 A;  4DE2 A;  1E3U A;  3HLF A;  5J8X A;  3UDF A;  2XD1 A;  3OPL A;  3IF6 A;  1J9M A;  1XA1 A;  1HD8 A;  3PBS A;  4NET A;  4RVA A;  5FAS A;  4OQH A;  4QY5 A;  4GN2 A;  4R4S A;  3BEB A;  1O7E A;  3AGE A;  1YLT A;  4PM7 A;  3S1Y A;  4BD1 A;  1ONH A;  4N9L A;  3HLW A;  3ITB A;  1CEF A;  1XX2 A;  1DJC A;  2CC1 A;  4JXG A;  5CER A;  3HUM A;  1GA9 A;  5F1F A;  4ZBE A;  1IYO A;  5FDH A;  4LV1 A;  3W4P A;  4E3K A;  4EBP A;  5EEC A;  1HZO A;  1K6S A;  1IYS A;  5EVI B;  4DDS A;  4ZDX A;  5DF9 A;  3UPO A;  4LEN A;  2DCF A;  4JXV A;  5E2E A;  4CPK A;  3Q1F A;  1L0F A;  3DWK A;  4MBK A;  4CJN A;  3HLC A;  2HP6 A;  3N4I A;  5EVI A;  2ZMA A;  3HLG A;  2WAD A;  3TOI A;  1C3B A;  1ALQ A;  1XP4 A;  3IT9 A;  2ZJ9 A;  1IKG A;  1K57 C;  2WKI A;  3OC2 A;  4P87 A;  1IEM A;  3W4Q A;  2OLU A;  3MZD A;  3UY6 A;  2EXB A;  2V20 A;  4X53 A;  2H0Y A;  2ZM2 A;  4Z9Q A;  1ZG4 A;  1KE0 A;  4MBH A;  4QY6 A;  4YFM A;  5JYP A;  4IBX A;  3ZG9 B;  1WYB A;  4IVI A;  4QB8 A;  3BFE A;  1PYY A;  4LV3 A;  5GHX A;  1BLH A;  2WAF A;  2XEP A;  1PW8 A;  4JBF A;  1NXY A;  4YIN A;  2XFT A;  3BFC A;  3GQZ A;  3IWO A;  1CK3 A;  2Y2N A;  2Z2L B;  1U60 A;  3N8S A;  5DF8 A;  5EUA A;  4Y0T A;  1K54 C;  1JWP A;  2VGK A;  4PM6 A;  1Q2P A;  3BLS A;  3LY4 A;  1SDE A;  3W8K A;  4EWF A;  3HLB A;  3G32 A;  4QD4 A;  2BLS A;  1Q2Q A;  3JYI A;  1MPL A;  1MWU A;  3VFF A;  3IXH A;  3SOI A;  3UDI A;  3V39 A;  5F83 A;  3V3S A;  4BD0 A;  1LI0 A;  4JPM A;  2ZQA A;  4WEL A;  2IWB A;  3VSK A;  5EOO A;  3ZDJ A;  1IYQ A;  1GHM A;  1G68 A;  1YMS A;  1JTD A;  3SS5 A;  4WMC D;  2Y2K A;  2ZC7 A;  4Y0O A;  3UDX A;  3WS2 A;  2HDU A;  3PBR A;  3FKV A;  1ZG6 A;  4OP5 A;  1XXM A;  5CTM A;  3NCK A;  4HEF A;  4WEK A;  2JCH A;  2ZQ7 A;  4MNR A;  2Y55 A;  4K0W A;  2IWD A;  4MLL A;  1I2W A;  5CHJ A;  5I94 A;  3NDG A;  4S2K A;  5AQA A;  3RJU A;  1IKI A;  1K38 A;  4R0Q A;  3A3D A;  5FAO A;  2Y2Q A;  3HBR A;  3IH8 A;  1L0E A;  3BLM A;  1YLP A;  1E25 A;  4PMA A;  5HW3 A;  1YQS A;  4XUZ A;  3LCE A;  2ZC3 B;  1H8Y A;  3SH8 A;  3A3J A;  1O07 A;  2EX2 A;  4WBG A;  1FCM A;  5FQK A;  1ERO A;  4OON A;  4DF6 A;  2J7V A;  1PZP A;  5E43 A;  3G31 A;  4BLM A;  5U47 A;  2WK0 A;  5L2F A;  5GLC A;  1I5Q A;  4GDN A;  1K6R A;  1E4D A;  3BEC A;  4Y0U A;  5GL9 A;  3PBQ A;  4S2P A;  4X56 A;  2B5R A;  5FQ9 A;  4U0T A;  5A93 A;  1NZU A;  4S2O A;  5GLD A;  3V5M A;  3ZG8 B;  1DJA A;  5FQM A;  4OOM A;  1TDL A;  4UHU A;  4BL2 A;  4FCF A;  3PAE A;  3TG9 A;  5GHZ A;  1NY0 A;  5HFO A;  1MWR A;  1DJB A;  5FI6 A;  2DNS A;  2VGJ A;  2FFF B;  3VFH A;  5EVL A;  2G2W A;  3WS0 A;  2Y2H A;  1ES3 A;  2WKE A;  1Z6F A;  4KEN B;  4S2M A;  5F1G A;  2R9X A;  1GHP A;  3ZG5 A;  1GHI A;  4Q8I A;  4EUZ A;  3N8L A;  5IHV A;  2XF3 A;  3IHA A;  4N1H A;  2G2U A;  4BQM A;  1LL5 A;  4ZJ2 A;  5FI2 A;  3WRT A;  5FAT A;  1PWC A;  2XH9 A;  3NDE A;  4P6B A;  4KQR A;  4X55 A;  4E3L A;  4S2I A;  3DTM A;  3A3I A;  1EI5 A;  4N92 A;  3ZHH A;  3FYZ A;  3NBL A;  1ES4 A;  3FWL A;  3OPR A;  1K25 A;  1BZA A;  1H5X A;  5AQB A;  3QHY A;  3QNB A;  4IBR A;  1WYC A;  2XLN A;  3M6H A;  4UA7 A;  5GHY A;  1FSW A;  1PWD A;  3ZNT A;  3N6I A;  3Q82 A;  3IXD A;  1ERQ A;  1LI9 A;  5E2F A;  1K4E A;  3O3V A;  3MKF A;  4Y7P A;  4ZJ3 A;  1SCW A;  2Q9M A;  2J9P A;  3PTE A;  2Y2O A;  5CEB A;  1K55 A;  5HX9 A;  1YLZ A;  2WAE A;  1CI8 A;  5E2G A;  1BT5 A;  5FA7 A;  3IHB A;  4KZB A;  4S2L A;  3LEZ A;  3S4X A;  1M6K A;  3G4P A;  1CI9 A;  4QJG A;  3Q07 A;  1OME A;  4KZ9 A;  3GVB A;  3N7W A;  4H8R A;  4OP8 A;  4WMC A;  3MXS A;  5A90 A;  4LV0 A;  4DRT A;  5HAP A;  1N4O A;  3A3E A;  3C4P A;  5KSC A;  3G2Z A;  2PBY A;  3WWX A;  3UO9 A;  1IEL A;  3HUO A;  4D2O A;  3VP4 A;  3IWQ A;  3B3X A;  2ZQ9 A;  5FAP A;  4E3I A;  2XR0 A;  3FZC A;  3HRE A;  4KZ4 A;  1TDG A;  3ZCZ A;  2WZX A;  2XFS A;  2ZD8 A;  2Y2M A;  1BTL A;  2X71 A;  4M3K A;  3UE3 A;  4FH4 A;  3NI9 A;  5CEC A;  5FAQ A;  4IVK A;  4MEZ A;  3UN7 A;  1YT4 A;  2QMI A;  5BOH A;  5M1A A;  2Y2J A;  4HBT A;  4KZ8 A;  2A3U A;  3ZVT A;  1PZO A;  2X02 A;  4GNU A;  1M40 A;  3PAG A;  4O7D A;  4OPY A;  3C5A A;  3SS3 A;  5FI7 A;  1GCE A;  2J9O A;  2EFU A;  4X68 A;  5TR7 A;  4DXC A;  5HL1 A;  2EX6 A;  2ZC5 B;  3VSL A;  3IF6 C;  3M2J A;  3C7V A;  4WZ5 A;  3P09 A;  3W4O A;  1K56 A;  2RCX A;  4PM8 A;  3HUN A;  2IWC A;  5FQI A;  4OLG A;  3ZGA B;  4OQ0 A;  4S2J A;  3DWZ A;  3UE0 A;  1PW1 A;  2BG1 A;  4KG2 A;  5DF7 A;  2JE5 A;  1W79 A;  3MBZ A;  1FSY A;  4OKP A;  5DTT A;  5EVI D;  1RP5 A;  3OPH A;  4OH0 A;  1JTG A;  3E2L A;  4C3Q A;  4R23 A;  3BYD A;  1G6A A;  5EVI C;  4U3T A;  3VOY A;  4JXS A;  2Y2P A;  2Y91 A;  2OV5 A;  3ZFZ A;  4X69 A;  2Y59 A;  2EX9 A;  4GD8 A;  4XUX A;  5EOE A;  2ZM8 A;  1SDN A;  4OQI A;  3A3F A;  1HTZ A;  2A49 A;  3IXG A;  4HBU A;  3TSG A;  4F94 A;  2ZQ8 A;  4WEJ A;  3VP1 A;  1MKI A;  1MBL A;  3C7U A;  4EQI A;  4DKI A;  4PM9 A;  2P9V B;  3VP2 A;  3O87 A;  1QMF A;  1S6R A;  4HES A;  3MZF A;  1LL9 A;  1ZKJ A;  4QHC A;  1NZO A;  2ZM0 A;  1KGF A;  4KG5 A;  2P9V A;  1YLY A;  4BL3 A;  2JC7 A;  3NC8 A;  4UA6 A;  1RCJ A;  1BLS A;  1K57 A;  1S0W A;  4KZ6 A;  3V50 A;  2H10 A;  4OLD A;  3Q7Z A;  4B4Z A;  3GTC A;  2Z2M B;  1YLJ A;  1ONG A;  3OPP A;  2ZQC A;  2XDM A;  5A91 A;  1MWS A;  1WE4 A;  5DTS A;  5FSR A;  4NK3 A;  3M6B A;  4B4X A;  1NRF A;  2OSU A;  2ZC6 B;  1NYY A;  3GR2 A;  3O88 A;  2P74 A;  1W5D A;  3N8R A;  4ZAM A;  1GA0 A;  1VM1 A;  4GDB A;  2R9W A;  4GKU A;  4GOG A;  4LCM A;  5CHM A;  5CXW A;  3SH7 A;  1ESI A;  3HL9 A;  3ISG A;  3MXR A;  4DE3 A;  4GD6 A;  3PBT A;  1K54 A;  1BLC A;  2WZZ A;  2V1Z A;  4ZJ1 A;  1FCN A;  4EBN A;  5EE8 A;  3M2K A;  5CGW A;  2E8I A;  3WS1 A;  1YM1 A;  3IH9 A;  4RYE A;  3UE1 A;  4KZ3 A;  4N1X A;  1PWG A;  3CZD A;  3IWI A;  1ZC2 A;  2ZQD A;  2H0T A;  4PM5 A;  4ID4 A;  3AGF A;  1SHV A;  2Q9N A;  4RX2 A;  4DXB A;  3ZNY A;  4GB7 A;  4UA9 A;  4DE0 A;  4WM9 A;  5HAR A;  4R4R A;  5KSH A;  2X01 A;  2UWX A;  2ZC4 B;  2WGV A;  3HLD A;  5KZH A;  1IYP A;  4RX3 A;  4WZ4 A;  3V3R A;  5E2H A;  1ES2 A;  3BM6 A;  3WS5 A;  1MWT A;  3EQU A;  5CGX A;  1TVF A;  4KZA A;  1AXB A;  1I2S A;  4C6Y A;  3MZE A;  4OPR A;  4A5R A;  3UPN A;  5FQQ A;  1KVM A;  3Q7V B;  3AGD A;  1ESU A;  2Y2G A;  1KE4 A;  1XA7 A;  1BUE A;  4JF4 A;  1KVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...