2P9VA

Structure of ampc beta-lactamase with cross-linked active site after exposure to small molecule inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
358
structure length
354
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINNKIALAARPVKAITPPTPAVRASWVHTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title O-Aryloxycarbonyl Hydroxamates: New beta-Lactamase Inhibitors That Cross-Link the Active Site.
pubmed doi rcsb
total genus 119
structure length 354
sequence length 358
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p9vA00
1CI8A 1BLPA 4X6TA 1ZG4A 1YLPA 1XA1A 2PU4A 5FQJA 5KZHA 5DTKA 2X71A 4R3BA 1YMXA 4EBLA 4PPRA 2EFXA 1NRFA 3UPOA 2ZD8A 4IEDA 3OZHA 1SCWA 3RXWA 5EPHA 4H8RA 3VP1A 3G2ZA 4BJPA 5GHXA 1I2WA 4OLDA 5EVID 5JYPA 1K4EA 3IWQA 4MBKA 3UDIA 4DE1A 5U47A 3SOIA 3LY3A 3P98A 4KZ5A 4P87A 3IHBA 3FWLA 5GLDA 4JBFA 3ZDJA 3E2KA 1PI4A 3VP0A 2H5SA 1JWPA 1PZOA 4EV4A 4QY5A 4FCFA 4WEJA 1I2SA 1FCNA 1K55C 3NI9A 1HVBA 1YLYA 3GVBA 5FDHA 3WS4A 1MPLA 2FFYA 3HLGA 1Q2QA 1L2SA 3DW0A 4JF5A 2Y2IA 5HARA 1IELA 4OP5A 4WZ5A 4ZBEA 1KGGA 2WAFA 3SS3A 4R0QA 4DRTA 2ZC7A 4M3KA 1I5QA 2XLNA 1CEFA 5AQBA 5TFQA 3IXHA 3MKFA 3UNWA 1HD8A 1BULA 2J8YA 2UWXA 2XQZA 3OCNA 2G2UA 4JPMA 1IYOA 2WYXA 4JXGA 2HP9A 1LL5A 2JCHA 3HLEA 4EUZA 5E2FA 3GTCA 2Q9NA 1CK3A 2A3UA 3O86A 4K0WA 4K0XA 4KZ6A 5GL9A 3UE1A 5KSCA 5DVAA 1ZKJA 3BFGA 5DF9A 5A92A 3FYZA 5EOOA 2DCFA 3N8SA 1GHMA 1IEMA 1FOFA 3CG5A 1PI5A 1ONHA 4QJGA 3UY6A 5CECA 2V1ZA 3OPLA 3WS5A 4OPZA 2XEPA 1KDSA 2R9XA 1BZAA 4U3TA 1SDEA 5DF7A 3G30A 1H5XA 2X01A 1G68A 1IKIA 1BUEA 5JYOA 4XUXA 2QMIA 1RP5A 4PM8A 1M6KA 2PU2A 5EVIC 5J8XA 2B5RA 1OMEA 4PM6A 4OKPA 4Z9QA 4GNUA 5EVLA 1KDWA 2IWBA 4OQHA 4ZJ3A 5AQ7A 4FH2A 5GLCA 3V3RA 4DE2A 3WS1A 1K54C 4KZ8A 1E3UA 1XXMA 5FQKA 3Q7VA 1BTLA 1SHVA 4DKIA 2Z2MB 4BD1A 1E4DA 2WGVA 3W4QA 3C5AA 4KG5A 1L0FA 4UAAA 3M2JA 4ZDXA 4OP8A 2ZQDA 3NIAA 4KZAA 3C7UA 4OPRA 3VOYA 5CEDA 2WGWA 4OOLA 5FQIA 4EBPA 2X02A 3UO9A 3VP2A 2XFSA 3PTEA 3WS0A 4QY6A 1IYQA 1QMFA 4FSFA 4KG2A 4IVIA 1HTZA 3WRZA 4MLLA 1JWZA 2Q9MA 4QB8A 1EROA 1GHPA 3PBRA 5HW3A 4KZ4A 3GV9A 1K4FA 3CZDA 4WBGA 4PM7A 2Y2HA 3SH7A 4BLMA 1ZG6A 4OPQA 5I94A 3QNCA 1CI9A 4DF6A 1FSWA 1NZOA 3NCKA 5CERA 1IYPA 1NXYA 2FFFB 1GHIA 3TG9A 3ITAA 3O88A 4S2IA 3MFDA 2Z2LB 1FR1A 3Q7ZA 5HAIA 3OPRA 2ZJ9A 3N8LA 1LI0A 3MZEA 1NY0A 3HL9A 3QHYA 1JTGA 4RVAA 3SS5A 3A3EA 2P9VA 4CPKA 3HREA 3VP3A 4OQGA 1W5DA 5FATA 2P74A 3SS4A 1KGFA 1S6RA 2ZQAA 4F94A 3C7VA 1YMSA 3LEZA 4E3MA 4OQIA 4MNRA 1ESUA 3BECA 4ZAMA 1ESIA 3UPNA 1ALQA 1BLSA 4PMAA 3QNBA 5FA7A 1LLBA 2Y2NA 2JBFA 4E3OA 1K56D 3HLDA 3TSGA 3JYIA 5DF8A 5CHUA 4E3LA 5HAPA 4CJNA 1AXBA 1YLJA 3NDEA 4YINA 4JXSA 4EWFA 4E3NA 4UA6A 3S1YA 1WYCA 1TEMA 3HLFA 4S2JA 2V2FF 4E6XA 4E3KA 4UHUA 3C4PA 4R3JA 4EBNA 3IF6B 3BFEA 1PWDA 5FSRA 4ZTKA 1MWSA 5M1AA 3W4OA 4S2PA 2HDRA 2J7VA 3ITBA 2Y91A 1ONGA 3O3VA 3BEBA 3IWOA 3HLBA 3OPHA 3RJUA 3MXRA 4S2MA 1YM1A 4LV3A 4KENB 5FQMA 1FCMA 3IH8A 2ZQ7A 3IF5A 1Y54A 1KE3A 1MWUA 1U60A 3ZG5A 1XX2A 1KGEA 1MWTA 4JXWA 1XGJA 1PWCA 2EX2A 1HZOA 5FAOA 3SH8A 2XD1A 2OV5A 3FKVA 3ZG8B 3EQUA 5F83A 2WK0A 2EFUA 1S0WA 1K56A 3O87A 4HESA 4U0TA 4KQQA 1KE0A 1XP4A 5GHZA 2ZQ8A 5GLAA 2WGWB 1ERMA 3HLCA 3MXSA 2WZXA 1BLCA 1K55A 1H8ZA 3PBTA 4N1HA 1W7FA 4LENA 3A3JA 3VP4A 2WAEA 2XR0A 5EECA 3VSKA 4BD0A 3ISGA 3IT9A 4BL3A 4K91A 4LCMA 1K38A 2RL3A 2ZC4B 2C6WB 3PAGA 5FAPA 4OLGA 5KSHA 5CGWA 4KZ9A 2OLVA 2IWCA 3Q82A 3ZG0A 3GRJA 3IXDA 3UDFA 2R9WA 4C6YA 5HFOA 2C5WB 4HBTA 4OONA 3VOZA 3W8KA 2PBYA 2EXBA 1BLHA 1K54A 3G32A 1C3BA 1MXOA 4Y0UA 1Z6FA 4GOGA 3SH9A 2ZC3B 1NYYA 1RGYA 3CMZA 3AGFA 5FASA 5G18A 2WADA 4UA9A 4GD6A 4QU3A 4GZBA 4X55A 1N4OA 4FH4A 3D4FA 1K6SA 5TR7A 1PW1A 4O7DA 2OSUA 4RX3A 1PIOA 2VGKA 2H0YA 1MKIA 5AQAA 1PWGA 4HEFA 1GCEA 4ZJ2A 4JF4A 2EX9A 5EE8A 2EX8A 1RCJA 2HDSA 1KVLA 2H0TA 3VMAA 4BL2A 1E25A 1L0EA 4E6WA 5A93A 4WZ5C 4LV2A 3IF6C 5EVIA 3E2LA 3BYDA 4DDSA 3LCEA 4Q8IA 4KZBA 1VM1A 1O07A 1ES2A 3PAEA 5E2GA 2ZQCA 4R23A 2RCXA 2WGIA 3RXXA 3ZVTA 4C3QA 5CTMA 1NZUA 5EUAA 3S22A 2Y2OA 4GN2A 3VSLA 1W8YA 5F1GA 4DE3A 3W4PA 2XDMA 3UE3A 2XD5A 4OQ0A 3VFHA 1SDNA 1K6RA 5M19A 4YFMA 4NETA 5DTSA 1KVMA 5A90A 2OLUA 1SKFA 3IXBA 2ZM2A 1EI5A 2Y4AA 3AGDA 2HP6A 1DJCA 1LI9A 2Y55A 3HVFA 4E3IA 1ES3A 3NBLA 4GB7A 4OOYA 4MBFA 3HBRA 4GDBA 4P0MA 4KQOA 5E2HA 4A5RA 3CJMA 2H10A 2Y59A 3G34A 3GR2A 5FI7A 1NJ4A 1FCOA 4GKUA 4PM9A 5CGSA 5CTNA 1PW8A 2JC7A 4OOMA 3M6BA 4Y0OA 5CRFA 3UE0A 2HPBA 2Y2KA 1L0GA 3ZCZA 4B88A 1Q2PA 2ZLYA 4DXBA 4KZ3A 1LHYA 1BSGA 2CC1A 3DTMA 4N9LA 1W79A 1TVFA 3A3DA 4JKTA 5FAQA 2XF3A 3B3XA 1DJBA 3DWZA 4S2NC 2Y2LA 3HUOA 4X68A 1IYSA 5CXWA 4B4ZA 4DXCA 3FV7A 1WYBA 5M18A 2Y2GA 4PM5A 4N9KA 1XA7A 2BG1A 2ZMAA 5GLBA 3FZCA 3IHAA 2G2WA 4LCLA 4E3JA 5TGFA 3DWKA 1ES5A 5E43A 4BQMA 2P9VB 3NY4A 2ZC6B 5FI2A 3V3SA 3ZVWA 4L0LA 1TDGA 4WMCD 1JTDA 5A91A 1K57A 1ERQA 4HBUA 3UN7A 2QZ6A 4WM9A 1XKZA 4RA7A 4C75A 3G35A 2ZM8A 1RGZA 1WE4A 5E2EA 5BOHA 3S4XA 4OPYA 3TOIA 2VGJA 4OVDA 3ZFZA 3Q81A 1MY8A 4IBXA 4X56A 4BENA 2GDNA 5HL1A 3BRMA 3ZG9B 4JXVA 3NC8A 4P6BA 4X53A 1M40A 2E8IA 3BFFA 4S2LA 4GD8A 4S2KA 3C4OA 1N9BA 2JE5A 5HAQA 5L2FA 1LL9A 1FQGA 3OCLA 3P09A 5FQ9A 4OH0A 4S2OA 1K25A 4WMCA 4D2OA 4WYYA 1FR6A 1H8YA 4WELA 1GA9A 3OC2A 5CGXA 5D3OA 3AGEA 2DRWA 4X69A 3Q7VB 4ZJ1A 1L0DA 4FD8A 4R4RA 5CHJA 5KMWA 4QHCA 5F82A 1IKGA 4KZ7A 3V5MA 3VFFA 3MBZA 1EWZA 2Y2QA 1YLZA 4N1XA 3ZG7B 3BLSA 1QMEA 1GA0A 2IWDA 2XK1A 3A3IA 5DTTA 4KQRA 3ZHHA 4DE0A 2Y2JA 3LY4A 3N7WA 4LV0A 4N92A 2J9PA 3OPPA 1FSYA 1YT4A 2WKEA 2DNSA 3UPPA 3NDGA 4ID4A 4KG6A 2HDUA 4B4XA 3Q1FA 1BT5A 1DJAA 1W8QA 3PBSA 4IVKA 3N4IA 5FI6A 3WRTA 3GMWA 2WKHA 3HUNA 5AQ9A 3GSGA 3PBQA 4EQIA 1NYMA 2XGNA 2ZC5B 3V39A 1J9MA 4XUZA 1PZPA 3WS2A 2I72A 2XFTA 1JVJA 3N8RA 3IWIA 1ES4A 3M6HA 2Y2PA 3FKWA 4LV1A 1VQQA 4RX2A 4U0XA 5IHVA 3WWXA 3MZFA 4P85A 2WZZA 3ZNTA 3PBOA 1E3UD 3M2KA 4QD4A 4RYEA 3I7JA 4MEZA 3HLWA 3G31A 3MZDA 2J9OA 3BM6A 1XPBA 2WKIA 5HX9A 5CHMA 3UDXA 3GQZA 3MKEA 2EXAA 4Y0TA 1YLTA 2EX6A 4R4SA 3BFDA 4WEKA 1MWRA 1PYYA 2BLSA 1ZC2A 4JLFA 1YQSA 2Y2MA 5EOEA 3G4PA 4JF6A 3IQAA 3LO7A 3ZGAB 4S2NA 3EQVA 2ZM0A 5F1FA 1TDLA 1MBLA 3IH9A 4NK3A 1DY6A 2ZQ9A 4IBRA 4Y7PA 3A3FA 3Q07A 3N6IA 4MBHA 4GDNA 1JWVA 2HP5A 4R1GA 4UA7A 1G6AA 3BFCA 2QPNA 3BLMA 4DDYA 3HUMA 2XH9A 1O7EA 1CEGA 3PBNA 1KE4A 2A49A 3G2YA 3IF6A 5GHYA 4WZ4A 1XGIA 5EVIB 1K57C 5FQQA 3V50A 5CEBA 4XXRA 1YLWA 2V20A 2WUQA 3IXGA 3ZNYA 2HDQA
chains in the Genus database with same CATH superfamily
1BLPA 4PHTA 1XA1A 4MN7A 4EBLA 5EPHA 1N9NA 3G2ZA 2J3WA 5GHXA 5EVID 2M7VA 1K4EA 5U47A 3SOIA 4KZ5A 3ZDJA 5GLDA 2H5SA 4QY5A 4WEJA 2V0WA 1HVBA 3L9KA 4AFIA 3CPTB 3DW0A 2Y2IA 3SS3A 1IELA 4WZ5A 4ZBEA 1KGGA 4M3KA 4CLCA 3W2ZA 5TFQA 3MKFA 2J8YA 2O99A 2UWXA 2XQZA 1IYOA 2WYXA 4EUZA 5E2FA 2OWHA 3JVUA 3QP8A 2Q9NA 2A3UA 5KSCA 5DVAA 2EA9A 3R7WB 3C8CA 2PD7A 3MMHA 3KSGA 3CLOA 1FOFA 1PI5A 1ONHA 2Z6DA 1SDEA 5DF7A 3BQAA 2P08A 2X01A 1H5XA 1G68A 4JGPA 3QP6A 3R4KA 4XUXA 4PM8A 1OMEA 4OKPA 4OQHA 5GLCA 4KZ8A 1SHVA 4BD1A 5EM0A 4KG5A 2V0UA 1YSQA 1BYWA 5CEDA 5FQIA 4B93A 3NOPC 1OTBA 2V9AA 4IVIA 2Q9MA 3MXQA 4KZ4A 4Y13A 4Y5FA 4PM7A 2Y2HA 1T1CA 2W3GA 5I94A 4OPQA 3NCKA 5CERA 2FFFB 1SKOA 3OLOA 1FR1A 3OPRA 3VE4A 4I39A 1LI0A 3MZEA 1NY0A 3QHYA 3HREA 4OQGA 3SS4A 3H7WA 1A0KA 3C7VA 4MNRA 3LI9A 3BECA 2W0NA 1LSVA 2JBFA 1K56D 3HLDA 4HJ4A 3JYIA 5CHUA 1AXBA 1YLJA 4JXSA 4E3NA 4UA6A 3S1YA 4BBVA 4LPZA 4E3KA 3B42A 3FPVA 4EBNA 3IF6B 4S2PA 3ZYTA 3ITBA 2Y91A 3O3VA 2W1TB 1DP6A 4GJ4A 4WL9A 4I3AA 1F2KA 4S2MA 2W3FA 1FCMA 1MWUA 3KSFA 1XGJA 1N9LA 2EFUA 1K56A 1XP4A 1SZVA 3MXSA 2KOIA 5DFYA 5IU1A 3PBTA 5HPIA 2UV0E 3A3JA 1XJ4A 5EECA 1HLUP 3ISGA 4BL3A 1K38A 2RL3A 2ZC4B 3MFXA 4PAUA 3PAGA 1XJ2A 5KSHA 5CGWA 3ZG0A 2R9WA 3IBJA 4L9FA 4JGQA 5HFOA 4HBTA 3VOZA 4F3LA 1K54A 3CUEC 2VA0A 4Y0UA 1Z6FA 3C38A 5G18A 4GZBA 2VV6A 5TR7A 2VK3A 3LR0A 4HEFA 1GCEA 2H0TA 4BL2A 1E25A 3BYDA 2GJ3A 5I5LA 2WGIA 3RXXA 3ZVTA 5FEFA 3JPUA 2K31A 2KX6A 2XDMA 2XD5A 2OLUA 2ZM2A 1EI5A 4MN6A 2Y4AA 3AGDA 3LI8A 1LI9A 4E3IA 3HVFA 3MR0A 2PYPA 3HBRA 3CJMA 3GR2A 5HWTA 1FCOA 5CTNA 4EU0A 2Z6CA 3KYQA 2AVXA 1S1ZA 4N9LA 1TS8A 4JKTA 3A3DA 4S2NC 1IYSA 4O8GA 3E4OA 3FV7A 1WYBA 1XA7A 2BG1A 3NHQA 4E3JA 3BW6A 3DWKA 4R70A 1ES5A 5EM1A 1V9YA 3V3SA 4MCWA 1VEUA 5A91A 1N9OA 4HBUA 3G35A 1RGZA 1T19A 2VEAA 4OVDA 2K2NA 3ZFZA 3Q81A 4BENA 4P6BA 4X53A 3BFFA 2E8IA 4S2LA 4S2KA 4GD8A 2O9AA 5L2FA 4NXEA 2ZBBA 1FR6A 4ZJ1A 1VB6A 1L0DA 5FDSA 3S7NA 5CHJA 3T4QA 5F82A 1CQAA 3VFFA 4N1XA 3ZG7B 4CLCC 1QMEA 3A3IA 4Y2FA 4DE0A 3LY4A 4HH3A 2JKFA 4LV0A 4N92A 3IX3A 4BMWA 1YT4A 3LYXA 1G28A 4B4XA 2PBDP 3Q1FA 3PBSA 2WKHA 3HUNA 5HDSA 2W3DA 2QWSA 3PBQA 1NYMA 3EOIA 3K2NA 2ZC5B 1J9MA 3WS2A 1ES4A 3M6HA 2Y2PA 5IHVA 2HGVA 3PR6A 3ZNTA 3I7JA 1GSXA 3HLWA 3MZDA 3F1PB 4Y0TA 5CHMA 2EXAA 1YLTA 2EX6A 2ZMFA 2BLSA 3G4PA 3ZGAB 3EQVA 1TDLA 1MBLA 4MBHA 2XA7S 1JWVA 4R1GA 4BBUA 1STZA 1O7EA 1CEGA 3PBNA 5GHYA 2A49A 3IF6A 4HJ3A 1XGIA 5FQQA 4IUHA 3U2AA 2V20A 2WUQA 2W1TA 2HDQA 1YSPA 1CI8A 1MZUA 3UMEA 4X6TA 1YLPA 5J3WA 4I3IA 2PU4A 5DTKA 4R3BA 3CUEA 2V1AA 3OZHA 3VP1A 4BJPA 5JYPA 4MBKA 3UDIA 3LGOA 3LY3A 1XJ3A 1PZOA 4FCFA 1FCNA 3NI9A 1YLYA 3VV4A 5FDHA 2BASA 3WS4A 4JF5A 5G4YA 1Q2QA 5HARA 4OP5A 1VETA 2ZL1A 2MJ6A 3DTEA 1I5QA 4MDZA 1CEFA 4X25A 3IXHA 3OCNA 3MF0A 4KZ6A 3O86A 3UE1A 4IJGA 2FH5A 5DF9A 5EOOA 5L8MA 3N8SA 1CF0A 1IEMA 3L7HA 4P6ZM 3UY6A 5CECA 2PT7A 1S4RA 4U3TA 4HP9A 3UB8A 2QMIA 3LIFA 1RP5A 1M6KA 5J8XA 2B5RA 4R3AA 1GSVA 3BY9A 4XT2B 2IWBA 4ZJ3A 2PHYA 4DE2A 1K54C 2Z2MB 1J3WA 3LIBA 3W4QA 1L0FA 4UAAA 1G6OA 3M2JA 4ZDXA 4OP8A 4OPRA 5DJTA 4FTXA 2I9VA 2WGWA 2JHEA 4GS9B 2OAP1 2WKPA 2XFSA 3WS0A 1HTZA 3FPWA 1JWZA 1GHPA 3GV9A 2R78A 3E4PA 2H28A 3T12B 4BLMA 3QNCA 4DF6A 1L3LA 1IYPA 3T4LA 3ITAA 3MFDA 1VETB 5HAIA 5HD5A 2ZJ9A 3N8LA 3SS5A 3A3EA 3MQ0A 3LEZA 4E3MA 4OQIA 1S4SA 1ESIA 3UPNA 4PMAA 5FA7A 3TSGA 5DF8A 4E3LA 4LFUA 3NDEA 3CITA 4H6JA 4EWFA 1OJGA 3HLFA 3EGDC 1PWDA 4ZTKA 1OTDA 4EW7A 5LBRA 3RJUA 3T4KA 1AWIA 3MXRA 1YM1A 4KENB 4MMNA 5FQMA 3ZG5A 2VKSA 2LB9A 2EX2A 5FAOA 1HZOA 2V8CA 3ZG8B 2WK0A 3O87A 4U0TA 3IBRA 2ZQ8A 5GLAA 3HLCA 5AJGA 4N1HA 4WLAA 2C6WB 2KLIA 4KZ9A 2OLVA 2O9CA 4NKPA 4HI4A 4R38A 4C6YA 3W8KA 2PBYA 2EXBA 1BLHA 3G32A 1C3BA 5L10A 2ZC3B 3CMZA 3AGFA 5FASA 2B02A 4UA9A 4FH4A 1PW1A 4O7DA 2J3TD 2OSUA 3LR5A 1P9RA 1PIOA 2VGKA 4RX3A 3QP5A 1P9WA 2EX8A 3VMAA 5A93A 4LV2A 5EVEA 4DDSA 1ZHHB 1VM1A 1O07A 5E2GA 4HIAA 2HV1A 2ZQCA 2RCXA 4EETB 4DE3A 3JVVA 3UE3A 1K6RA 3A0RA 4YFMA 4NETA 5DTSA 1KVMA 4Y15A 5A90A 4BBTA 3C30A 1DJCA 4MBFA 1S1YA 4GDBA 4KQOA 4A5RA 2H10A 2Y59A 3MS6A 5G4ZA 4PM9A 1PW8A 2VLGA 2J3TC 1K0KA 3M6BA 5CRFA 4Q0IA 3UE0A 2Y2KA 2ZL1B 2ZLYA 4KZ3A 1LHYA 3DTMA 2QYBA 2XF3A 3B3XA 5CXWA 3TJZC 2ZMAA 4NG2A 2G2WA 4LCLA 5TGFA 5E43A 2ZC6B 4M4XA 1ERQA 3UN7A 2QZ6A 1UGUA 2ZM8A 2PR5A 5E2EA 3S4XA 4OPYA 4EERA 1UWPX 4BWIA 5AVEA 2L4RA 4EXOA 5HL1A 3ZG9B 4Q0HA 3QP2A 3C4OA 3PXPA 3EWKA 3OCLA 4D2OA 2Q0OA 4WYYA 1OTAA 4WELA 5D3OA 1GA9A 3T1SA 3MSHA 3Q7VB 4P6ZS 3ICYA 3E0YA 1MC0A 4NXGA 4R4RA 5KMWA 3CHWP 4QHCA 4KZ7A 1YLZA 4NEED 1D7EA 3BLSA 3KSHA 1GA0A 2IWDA 2YKFA 3QP1A 3GDIA 4KQRA 3ZHHA 2Y2JA 2J9PA 3OPPA 4NXFA 2IA2A 2HDUA 4IVKA 1BT5A 1DJAA 1W8QA 5DKLA 1PZPA 4GCZA 4DMZA 3WWXA 2B18A 4LV1A 3FKWA 4RX2A 3MZFA 2WZZA 4RYEA 3R7WA 3LEQA 4MEZA 3UDXA 1XPBA 2P04A 3GQZA 3LUQA 2XSSA 2W1RA 4WEKA 1MWRA 5EOEA 2NUPC 4JF6A 1W63M 3D72A 4MN5A 4NXBA 4O0PA 1F9IA 5F1FA 1TS7A 4NK3A 4Y7PA 4IBRA 1DY6A 2KDKA 2K7SA 2ZQ9A 3Q07A 3TE8A 3KYEA 1G6AA 3BLMA 1KE4A 3LFVA 3V50A 5HDDA 3RTYA 5EVIB 1K57C 2O0YA 1P97A 3S7QA 4FOFA 3IXGA 3ZNYA 5HPFA 1FIKA 3NULA 4I3JA 4K08A 5FQJA 3LIEA 1OT6A 3S7PA 1NRFA 4IEDA 3RXWA 1SCWA 5KIZA 3T1QB 3IWQA 4P87A 3FWLA 1XFQA 3VP0A 4EV4A 1I2SA 5HDCA 3EEHA 1MPLA 3HLGA 1L2SA 3CI6A 4R0QA 1DP8A 2ZC7A 2XLNA 5AQBA 3NOUC 3UNWA 5HL6A 3PHYA 4JPMA 3UB9A 2HP9A 1LL5A 2JCHA 3C2WA 1CK3A 4K0WA 4K0XA 4UEYA 4EUVA 5J4EA 3F1OA 4LRXC 2EWVA 2JKRM 1NWZA 3BFGA 4B9OA 1IOUA 1GHMA 2Y8HA 2W27A 2V1ZA 3OPLA 2ZMVA 4OPZA 2R9XA 5F6AA 3RH8B 4KQDA 5HWVA 2M1CA 2VX8A 4Z9QA 1KDWA 2Y79A 2HZ5A 1NRJA 5AQ7A 4GW9A 3V3RA 3WS1A 1H0MA 1WA9A 1E3UA 1XXMA 3Q7VA 1BTLA 4DKIA 4G3KA 2WGVA 3C5AA 4X1LA 2ZQDA 3NIAA 4DJ2A 2W3EA 3VOYA 4JGOA 4OOLA 3KSIA 2X02A 3UO9A 4HP4A 1IYQA 4FSFA 3NJAA 3LICA 4QB8A 3T4OA 1EROA 4LLOB 3P7NA 3PBRA 5HW3A 1DP9A 3CZDA 4WBGA 4HQAA 3NECA 3SH7A 1CI9A 1NZOA 1NXYA 3O88A 4S2IA 2ACGA 1PFLA 2XA7M 3H9WA 1YAXA 3FG8A 4RVAA 5DJUA 2P9VA 3UB5P 2B95A 1KGFA 1S6RA 2ZQAA 4F94A 1ESUA 3GECA 1ALQA 1BLSA 2XRNA 1LLBA 2Y2NA 1CJFA 2QKPA 4CJNA 4YINA 1WYCA 1TEMA 4S2JA 1XFNA 3C4PA 4R3JA 3BFEA 5FSRA 4EQ1A 3IWOA 3PYPA 3HLBA 3OPHA 2JKTM 5A8BA 4LV3A 4ME4A 1Y28A 3IS2B 4L9EA 3UE6A 2GNXA 2ZQ7A 1KE3A 1KGEA 3A0SA 4JXWA 1PWCA 3TRCA 3FKVA 3EQUA 1F98A 5F83A 4ARZA 2E8JA 4KUOA 1S0WA 4KQQA 3SZTA 5GHZA 2WGWB 2WZXA 3HJIA 1BLCA 5HZHA 1H8ZA 1W7FA 3EGXC 3HJKA 2XR0A 3VSKA 1OT9A 3IT9A 4HH2A 5FAPA 4CLCB 3GRJA 4HOIA 2L0WA 2C5WB 2W3HA 2VZWA 4WF0A 1YKDA 1G5UA 1MXOA 3SH9A 1NYYA 1RGYA 4Q0JA 2DMWA 4GD6A 4X55A 1N4OA 3DTIA 3D4FA 2V1BA 4GLQA 3VE3A 1X0OA 5C5KA 1MKIA 1PWGA 4ZJ2A 1V9ZA 4JF4A 2EX9A 5EE8A 4FUWA 3O5YA 4E6WA 4G3WA 3IF6C 3E2LA 1UWNX 3PAEA 4H6JB 2M7UA 2VGLS 2NUTC 5DKKA 5EUAA 5HD3A 4GHIB 2Y2OA 3VSLA 1W8YA 5TBMB 1SDNA 5M19A 4CLCE 3IXBA 3UB7A 4ZRRA 2HP6A 2Y55A 4GB7A 4P0MA 3B33A 3LR4A 3G34A 1TF1A 1Y4OA 1NJ4A 5CGSA 3UMDA 4ARZB 2JC7A 4OOMA 2HPBA 5F5YA 1L0GA 3ZCZA 4B88A 3LR3A 2INWA 2VJWA 2CC1A 1P0ZA 5FAQA 1DJBA 3DWZA 4DXCA 4X68A 2QHKA 3FZCA 3IHAA 4IUKA 2GX5A 3NY4A 3B47A 5FI2A 3ZVWA 1TDGA 2PYRA 1JTDA 2BTFP 1K57A 1XKZA 3H82A 4PKYG 5BOHA 4QWOA 1MY8A 4IBXA 2JKRI 3BRMA 4JXVA 3NC8A 1FQGA 5FQ9A 3P09A 4OH0A 4S2OA 3ZQ5A 5EFWA 5CGXA 3OC2A 3AGEA 2DRWA 4FD8A 3T4JA 3IX8A 4GHIA 3MBZA 3K3DA 3A0VA 1EWZA 1LSWA 2Y2QA 4LGWA 1JNUA 2XK1A 5DTTA 5IT5A 2FZ0A 2DNSA 5TJJA 3UPPA 3NDGA 3EEAA 3KYZA 3T4SA 3WRTA 3GMWA 5AQ9A 4EQIA 3CAXA 4XUZA 1ACFA 3MJQA 4E3OA 4U0XA 4P85A 3PBOA 1E3UD 3SW1A 2J9OA 4LRYC 4Z1WA 4R4SA 1PRQA 1PYYA 1ZC2A 4JLFA 2Y2MA 3IQAA 1XJ6A 3LO7A 1S67L 2ZM0A 2OOLA 4LRZE 3IH9A 3H82B 4CQHA 4GDNA 2HP5A 4XT2A 4EEUA 2PD8A 2QPNA 3HUMA 2XH9A 1NLZA 4HNBA 4WZ4A 4XXRA 4RQ9A 5K5BA 3E4QA 1ZG4A 3LIDA 5KZHA 3IS2A 2PDRA 2X71A 1YMXA 5TBMA 2G7UA 4PPRA 2EFXA 3UPOA 2ZD8A 5EV0A 4H8RA 2HJ9C 2VV8A 4E04A 1I2WA 4OLDA 1KOUA 4DE1A 3MQOA 3P98A 3IHBA 4JBFA 3E2KA 1PI4A 1JWPA 1K55C 4WN5A 3GVBA 2FFYA 2WAFA 1Z09A 1YPRA 4DRTA 4HY8A 3UB6A 5MC7A 3HCYA 1HD8A 1BULA 2G2UA 5F69A 2VV7A 3P01A 4JXGA 3H7WB 3HLEA 3T50A 3GTCA 2HF6A 5GL9A 1ZKJA 5A92A 3FYZA 2DCFA 3U4LP 1VEUB 1OTIA 3CG5A 3T4TA 2XROA 4QJGA 3WS5A 2XEPA 1KDSA 1BZAA 1ODVA 2WKRA 3G30A 2P7JA 1IKIA 4HJ6A 1BUEA 5JYOA 2PU2A 3FC7A 5EVIC 3MQQA 5HSQA 2EWWA 4PM6A 4GNUA 5EVLA 2GZAA 4WUJA 4FH2A 3RFBA 2PRFA 1T18A 5FQKA 2A24A 3D3OA 1E4DA 3D9YA 4KZAA 3C7UA 1PNEA 4EBPA 1W63Q 3VP2A 3PTEA 4UQIS 4QY6A 1QMFA 1TS0A 4KG2A 3WRZA 4YWZA 4MLLA 3DBAA 2JKTI 1K4FA 3OOVA 1ZG6A 4QPRA 1FSWA 3TG9A 1GHIA 2Z2LB 3Q7ZA 3F1NB 3S7OA 3IX4A 1H8MA 3HL9A 1JTGA 4CPKA 3VP3A 1W5DA 3F1PA 5FATA 2P74A 2QJ5A 3G6OA 4X1MA 5L09A 1YMSA 4KUKA 4YNRA 4ZAMA 2PR6A 3BWLA 3F1OB 3QNBA 4EESA 5HAPA 3T1XA 2OAQ1 2J80A 2V2FF 4E6XA 5FL3A 4UHUA 3BY8A 3T1RA 5M1AA 1MWSA 3W4OA 2HDRA 2J7VA 1ONGA 5IS1A 3BEBA 2V8FA 4EEPA 5FEGA 1D1JA 1OPXA 3IH8A 2JKGA 3IF5A 1Y54A 1U60A 2CMNA 1XX2A 1MWTA 4DJ3A 3SH8A 2XD1A 2OV5A 3KX0X 4HESA 1KE0A 5J7EA 1ERMA 4GS9A 5CX7A 1H3QA 1K55A 4LENA 4JGRA 3VP4A 2WAEA 4BD0A 4Y17A 3CPTA 4K91A 4LCMA 4ETZA 4OLGA 2IWCA 3Q82A 3IXDA 3UDFA 4OONA 1SKOB 2ZOIA 1S66L 5L07A 4GOGA 4CLCD 2WADA 4QU3A 1K6SA 1OTEA 4R6LA 3E98A 2H0YA 3KO6A 5AQAA 4ESPA 4II7A 1RCJA 2HDSA 1T1BA 2WKQA 1KVLA 1L0EA 4WZ5C 5EVIA 4Q8IA 3LCEA 4KZBA 1ES2A 1EW0A 4R23A 4I38A 3OBFA 4C3QA 1ZTUA 1NZUA 5CTMA 3S22A 5F68A 4O01A 4GN2A 1LSXA 5F1GA 4L9GA 3W4PA 3K3CA 3VFHA 4OQ0A 1SKFA 2A2LA 1ES3A 3NBLA 1F5MA 4OOYA 5E2HA 2L1MA 1LT0A 5FI7A 4GKUA 3BJNA 4Y0OA 1Q2PA 4HHDA 1GSWA 4DXBA 1BSGA 4Y3IA 3V67A 1W79A 1TVFA 2Y2LA 3HUOA 4I5SA 4B4ZA 5M18A 2Y2GA 4PM5A 4N9KA 4UQIM 5GLBA 1VHMA 2JN7A 3DTKA 3QP4A 4BQMA 2P9VB 4PKYA 4L0LA 4WMCD 3TW8A 4WM9A 4RA7A 4C75A 1WE4A 3TOIA 2VGJA 3BQ8A 2QJ7A 4X56A 2GDNA 5DFXA 1M40A 1N9BA 2JE5A 5HAQA 1LL9A 2PAVP 1MKMA 3ULFA 1K25A 4WMCA 3LIAA 1FILA 1H8YA 4X69A 3CWFA 1TD5A 1IKGA 3V5MA 4ETXA 2O9BA 3DAVA 2D01A 2D02A 3N7WA 1FSYA 1D06A 4G3VA 1T1AA 4YOFA 3NOTC 2WKEA 4ID4A 4KG6A 5FI6A 3N4IA 1LL8A 1NLYA 3GSGA 4D60A 2XGNA 3V39A 2I72A 3F1NA 2XFTA 1JVJA 3N8RA 3IWIA 1VQQA 2OWJA 3M2KA 4QD4A 3G31A 4F3LB 3BM6A 2WKIA 5HX9A 3MKEA 5HWWA 3BFDA 1DRMA 2VGLM 1YQSA 5AVFA 2YKHA 1TS6A 2ZOHA 4S2NA 4IHQA 1IFQA 3VOLA 1OJ5A 2HJEA 2LB5A 3A3FA 3N6IA 4UA7A 3BFCA 4DDYA 4DN0A 3G2YA 5CEBA 2A24B 1YLWA
chains in the Genus database with same CATH topology
1CI8A 1BLPA 4X6TA 1ZG4A 1YLPA 1XA1A 2PU4A 5FQJA 5KZHA 5DTKA 2X71A 4R3BA 1YMXA 4EBLA 4PPRA 2EFXA 1NRFA 3UPOA 2ZD8A 4IEDA 3OZHA 1SCWA 3RXWA 5EPHA 4H8RA 3VP1A 3G2ZA 4BJPA 5GHXA 1I2WA 4OLDA 5EVID 5JYPA 1K4EA 3IWQA 4MBKA 3UDIA 4DE1A 5U47A 3SOIA 3LY3A 3P98A 4KZ5A 4P87A 3IHBA 3FWLA 5GLDA 4JBFA 3ZDJA 3E2KA 1PI4A 3VP0A 2H5SA 1JWPA 1PZOA 4EV4A 4QY5A 4FCFA 4WEJA 1I2SA 1FCNA 1K55C 3NI9A 1HVBA 1YLYA 3GVBA 5FDHA 3WS4A 1MPLA 2FFYA 3HLGA 1Q2QA 1L2SA 3DW0A 4JF5A 2Y2IA 5HARA 1IELA 4OP5A 4WZ5A 4ZBEA 1KGGA 2WAFA 3SS3A 4R0QA 4DRTA 2ZC7A 4M3KA 1I5QA 2XLNA 1CEFA 5AQBA 5TFQA 3IXHA 3MKFA 3UNWA 1HD8A 1BULA 2J8YA 2UWXA 2XQZA 3OCNA 2G2UA 4JPMA 1IYOA 2WYXA 4JXGA 2HP9A 1LL5A 2JCHA 3HLEA 4EUZA 5E2FA 3GTCA 2Q9NA 1CK3A 2A3UA 3O86A 4K0WA 4K0XA 4KZ6A 5GL9A 3UE1A 5KSCA 5DVAA 1ZKJA 3BFGA 5DF9A 5A92A 3FYZA 5EOOA 2DCFA 3N8SA 1GHMA 1IEMA 1FOFA 3CG5A 1PI5A 1ONHA 4QJGA 3UY6A 5CECA 2V1ZA 3OPLA 3WS5A 4OPZA 2XEPA 1KDSA 2R9XA 1BZAA 4U3TA 1SDEA 5DF7A 3G30A 1H5XA 2X01A 1G68A 1IKIA 1BUEA 5JYOA 4XUXA 2QMIA 1RP5A 4PM8A 1M6KA 2PU2A 5EVIC 5J8XA 2B5RA 1OMEA 4PM6A 4OKPA 4Z9QA 4GNUA 5EVLA 1KDWA 2IWBA 4OQHA 4ZJ3A 5AQ7A 4FH2A 5GLCA 3V3RA 4DE2A 3WS1A 1K54C 4KZ8A 1E3UA 1XXMA 5FQKA 3Q7VA 1BTLA 1SHVA 4DKIA 2Z2MB 4BD1A 1E4DA 2WGVA 3W4QA 3C5AA 4KG5A 1L0FA 4UAAA 3M2JA 4ZDXA 4OP8A 2ZQDA 3NIAA 4KZAA 3C7UA 4OPRA 3VOYA 5CEDA 2WGWA 4OOLA 5FQIA 4EBPA 2X02A 3UO9A 3VP2A 2XFSA 3PTEA 3WS0A 4QY6A 1IYQA 1QMFA 4FSFA 4KG2A 4IVIA 1HTZA 3WRZA 4MLLA 1JWZA 2Q9MA 4QB8A 1EROA 1GHPA 3PBRA 5HW3A 4KZ4A 3GV9A 1K4FA 3CZDA 4WBGA 4PM7A 2Y2HA 3SH7A 4BLMA 1ZG6A 4OPQA 5I94A 3QNCA 1CI9A 4DF6A 1FSWA 1NZOA 3NCKA 5CERA 1IYPA 1NXYA 2FFFB 1GHIA 3TG9A 3ITAA 3O88A 4S2IA 3MFDA 2Z2LB 1FR1A 3Q7ZA 5HAIA 3OPRA 2ZJ9A 3N8LA 1LI0A 3MZEA 1NY0A 3HL9A 3QHYA 1JTGA 4RVAA 3SS5A 3A3EA 2P9VA 4CPKA 3HREA 3VP3A 4OQGA 1W5DA 5FATA 2P74A 3SS4A 1KGFA 1S6RA 2ZQAA 4F94A 3C7VA 1YMSA 3LEZA 4E3MA 4OQIA 4MNRA 1ESUA 3BECA 4ZAMA 1ESIA 3UPNA 1ALQA 1BLSA 4PMAA 3QNBA 5FA7A 1LLBA 2Y2NA 2JBFA 4E3OA 1K56D 3HLDA 3TSGA 3JYIA 5DF8A 5CHUA 4E3LA 5HAPA 4CJNA 1AXBA 1YLJA 3NDEA 4YINA 4JXSA 4EWFA 4E3NA 4UA6A 3S1YA 1WYCA 1TEMA 3HLFA 4S2JA 2V2FF 4E6XA 4E3KA 4UHUA 3C4PA 4R3JA 4EBNA 3IF6B 3BFEA 1PWDA 5FSRA 4ZTKA 1MWSA 5M1AA 3W4OA 4S2PA 2HDRA 2J7VA 3ITBA 2Y91A 1ONGA 3O3VA 3BEBA 3IWOA 3HLBA 3OPHA 3RJUA 3MXRA 4S2MA 1YM1A 4LV3A 4KENB 5FQMA 1FCMA 3IH8A 2ZQ7A 3IF5A 1Y54A 1KE3A 1MWUA 1U60A 3ZG5A 1XX2A 1KGEA 1MWTA 4JXWA 1XGJA 1PWCA 2EX2A 1HZOA 5FAOA 3SH8A 2XD1A 2OV5A 3FKVA 3ZG8B 3EQUA 5F83A 2WK0A 2EFUA 1S0WA 1K56A 3O87A 4HESA 4U0TA 4KQQA 1KE0A 1XP4A 5GHZA 2ZQ8A 5GLAA 2WGWB 1ERMA 3HLCA 3MXSA 2WZXA 1BLCA 1K55A 1H8ZA 3PBTA 4N1HA 1W7FA 4LENA 3A3JA 3VP4A 2WAEA 2XR0A 5EECA 3VSKA 4BD0A 3ISGA 3IT9A 4BL3A 4K91A 4LCMA 1K38A 2RL3A 2ZC4B 2C6WB 3PAGA 5FAPA 4OLGA 5KSHA 5CGWA 4KZ9A 2OLVA 2IWCA 3Q82A 3ZG0A 3GRJA 3IXDA 3UDFA 2R9WA 4C6YA 5HFOA 2C5WB 4HBTA 4OONA 3VOZA 3W8KA 2PBYA 2EXBA 1BLHA 1K54A 3G32A 1C3BA 1MXOA 4Y0UA 1Z6FA 4GOGA 3SH9A 2ZC3B 1NYYA 1RGYA 3CMZA 3AGFA 5FASA 5G18A 2WADA 4UA9A 4GD6A 4QU3A 4GZBA 4X55A 1N4OA 4FH4A 3D4FA 1K6SA 5TR7A 1PW1A 4O7DA 2OSUA 4RX3A 1PIOA 2VGKA 2H0YA 1MKIA 5AQAA 1PWGA 4HEFA 1GCEA 4ZJ2A 4JF4A 2EX9A 5EE8A 2EX8A 1RCJA 2HDSA 1KVLA 2H0TA 3VMAA 4BL2A 1E25A 1L0EA 4E6WA 5A93A 4WZ5C 4LV2A 3IF6C 5EVIA 3E2LA 3BYDA 4DDSA 3LCEA 4Q8IA 4KZBA 1VM1A 1O07A 1ES2A 3PAEA 5E2GA 2ZQCA 4R23A 2RCXA 2WGIA 3RXXA 3ZVTA 4C3QA 5CTMA 1NZUA 5EUAA 3S22A 2Y2OA 4GN2A 3VSLA 1W8YA 5F1GA 4DE3A 3W4PA 2XDMA 3UE3A 2XD5A 4OQ0A 3VFHA 1SDNA 1K6RA 5M19A 4YFMA 4NETA 5DTSA 1KVMA 5A90A 2OLUA 1SKFA 3IXBA 2ZM2A 1EI5A 2Y4AA 3AGDA 2HP6A 1DJCA 1LI9A 2Y55A 3HVFA 4E3IA 1ES3A 3NBLA 4GB7A 4OOYA 4MBFA 3HBRA 4GDBA 4P0MA 4KQOA 5E2HA 4A5RA 3CJMA 2H10A 2Y59A 3G34A 3GR2A 5FI7A 1NJ4A 1FCOA 4GKUA 4PM9A 5CGSA 5CTNA 1PW8A 2JC7A 4OOMA 3M6BA 4Y0OA 5CRFA 3UE0A 2HPBA 2Y2KA 1L0GA 3ZCZA 4B88A 1Q2PA 2ZLYA 4DXBA 4KZ3A 1LHYA 1BSGA 2CC1A 3DTMA 4N9LA 1W79A 1TVFA 3A3DA 4JKTA 5FAQA 2XF3A 3B3XA 1DJBA 3DWZA 4S2NC 2Y2LA 3HUOA 4X68A 1IYSA 5CXWA 4B4ZA 4DXCA 3FV7A 1WYBA 5M18A 2Y2GA 4PM5A 4N9KA 1XA7A 2BG1A 2ZMAA 5GLBA 3FZCA 3IHAA 2G2WA 4LCLA 4E3JA 5TGFA 3DWKA 1ES5A 5E43A 4BQMA 2P9VB 3NY4A 2ZC6B 5FI2A 3V3SA 3ZVWA 4L0LA 1TDGA 4WMCD 1JTDA 5A91A 1K57A 1ERQA 4HBUA 3UN7A 2QZ6A 4WM9A 1XKZA 4RA7A 4C75A 3G35A 2ZM8A 1RGZA 1WE4A 5E2EA 5BOHA 3S4XA 4OPYA 3TOIA 2VGJA 4OVDA 3ZFZA 3Q81A 1MY8A 4IBXA 4X56A 4BENA 2GDNA 5HL1A 3BRMA 3ZG9B 4JXVA 3NC8A 4P6BA 4X53A 1M40A 2E8IA 3BFFA 4S2LA 4GD8A 4S2KA 3C4OA 1N9BA 2JE5A 5HAQA 5L2FA 1LL9A 1FQGA 3OCLA 3P09A 5FQ9A 4OH0A 4S2OA 1K25A 4WMCA 4D2OA 4WYYA 1FR6A 1H8YA 4WELA 1GA9A 3OC2A 5CGXA 5D3OA 3AGEA 2DRWA 4X69A 3Q7VB 4ZJ1A 1L0DA 4FD8A 4R4RA 5CHJA 5KMWA 4QHCA 5F82A 1IKGA 4KZ7A 3V5MA 3VFFA 3MBZA 1EWZA 2Y2QA 1YLZA 4N1XA 3ZG7B 3BLSA 1QMEA 1GA0A 2IWDA 2XK1A 3A3IA 5DTTA 4KQRA 3ZHHA 4DE0A 2Y2JA 3LY4A 3N7WA 4LV0A 4N92A 2J9PA 3OPPA 1FSYA 1YT4A 2WKEA 2DNSA 3UPPA 3NDGA 4ID4A 4KG6A 2HDUA 4B4XA 3Q1FA 1BT5A 1DJAA 1W8QA 3PBSA 4IVKA 3N4IA 5FI6A 3WRTA 3GMWA 2WKHA 3HUNA 5AQ9A 3GSGA 3PBQA 4EQIA 1NYMA 2XGNA 2ZC5B 3V39A 1J9MA 4XUZA 1PZPA 3WS2A 2I72A 2XFTA 1JVJA 3N8RA 3IWIA 1ES4A 3M6HA 2Y2PA 3FKWA 4LV1A 1VQQA 4RX2A 4U0XA 5IHVA 3WWXA 3MZFA 4P85A 2WZZA 3ZNTA 3PBOA 1E3UD 3M2KA 4QD4A 4RYEA 3I7JA 4MEZA 3HLWA 3G31A 3MZDA 2J9OA 3BM6A 1XPBA 2WKIA 5HX9A 5CHMA 3UDXA 3GQZA 3MKEA 2EXAA 4Y0TA 1YLTA 2EX6A 4R4SA 3BFDA 4WEKA 1MWRA 1PYYA 2BLSA 1ZC2A 4JLFA 1YQSA 2Y2MA 5EOEA 3G4PA 4JF6A 3IQAA 3LO7A 3ZGAB 4S2NA 3EQVA 2ZM0A 5F1FA 1TDLA 1MBLA 3IH9A 4NK3A 1DY6A 2ZQ9A 4IBRA 4Y7PA 3A3FA 3Q07A 3N6IA 4MBHA 4GDNA 1JWVA 2HP5A 4R1GA 4UA7A 1G6AA 3BFCA 2QPNA 3BLMA 4DDYA 3HUMA 2XH9A 1O7EA 1CEGA 3PBNA 1KE4A 2A49A 3G2YA 3IF6A 5GHYA 4WZ4A 1XGIA 5EVIB 1K57C 5FQQA 3V50A 5CEBA 4XXRA 1YLWA 2V20A 2WUQA 3IXGA 3ZNYA 2HDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI8 A;  1BLP A;  4X6T A;  1ZG4 A;  1YLP A;  1XA1 A;  2PU4 A;  5FQJ A;  5KZH A;  5DTK A;  2X71 A;  4R3B A;  1YMX A;  4EBL A;  4PPR A;  2EFX A;  1NRF A;  3UPO A;  2ZD8 A;  4IED A;  3OZH A;  1SCW A;  3RXW A;  5EPH A;  4H8R A;  3VP1 A;  3G2Z A;  4BJP A;  5GHX A;  1I2W A;  4OLD A;  5EVI D;  5JYP A;  1K4E A;  3IWQ A;  4MBK A;  3UDI A;  4DE1 A;  5U47 A;  3SOI A;  3LY3 A;  3P98 A;  4KZ5 A;  4P87 A;  3IHB A;  3FWL A;  5GLD A;  4JBF A;  3ZDJ A;  3E2K A;  1PI4 A;  3VP0 A;  2H5S A;  1JWP A;  1PZO A;  4EV4 A;  4QY5 A;  4FCF A;  4WEJ A;  1I2S A;  1FCN A;  1K55 C;  3NI9 A;  1HVB A;  1YLY A;  3GVB A;  5FDH A;  3WS4 A;  1MPL A;  2FFY A;  3HLG A;  1Q2Q A;  1L2S A;  3DW0 A;  4JF5 A;  2Y2I A;  5HAR A;  1IEL A;  4OP5 A;  4WZ5 A;  4ZBE A;  1KGG A;  2WAF A;  3SS3 A;  4R0Q A;  4DRT A;  2ZC7 A;  4M3K A;  1I5Q A;  2XLN A;  1CEF A;  5AQB A;  5TFQ A;  3IXH A;  3MKF A;  3UNW A;  1HD8 A;  1BUL A;  2J8Y A;  2UWX A;  2XQZ A;  3OCN A;  2G2U A;  4JPM A;  1IYO A;  2WYX A;  4JXG A;  2HP9 A;  1LL5 A;  2JCH A;  3HLE A;  4EUZ A;  5E2F A;  3GTC A;  2Q9N A;  1CK3 A;  2A3U A;  3O86 A;  4K0W A;  4K0X A;  4KZ6 A;  5GL9 A;  3UE1 A;  5KSC A;  5DVA A;  1ZKJ A;  3BFG A;  5DF9 A;  5A92 A;  3FYZ A;  5EOO A;  2DCF A;  3N8S A;  1GHM A;  1IEM A;  1FOF A;  3CG5 A;  1PI5 A;  1ONH A;  4QJG A;  3UY6 A;  5CEC A;  2V1Z A;  3OPL A;  3WS5 A;  4OPZ A;  2XEP A;  1KDS A;  2R9X A;  1BZA A;  4U3T A;  1SDE A;  5DF7 A;  3G30 A;  1H5X A;  2X01 A;  1G68 A;  1IKI A;  1BUE A;  5JYO A;  4XUX A;  2QMI A;  1RP5 A;  4PM8 A;  1M6K A;  2PU2 A;  5EVI C;  5J8X A;  2B5R A;  1OME A;  4PM6 A;  4OKP A;  4Z9Q A;  4GNU A;  5EVL A;  1KDW A;  2IWB A;  4OQH A;  4ZJ3 A;  5AQ7 A;  4FH2 A;  5GLC A;  3V3R A;  4DE2 A;  3WS1 A;  1K54 C;  4KZ8 A;  1E3U A;  1XXM A;  5FQK A;  3Q7V A;  1BTL A;  1SHV A;  4DKI A;  2Z2M B;  4BD1 A;  1E4D A;  2WGV A;  3W4Q A;  3C5A A;  4KG5 A;  1L0F A;  4UAA A;  3M2J A;  4ZDX A;  4OP8 A;  2ZQD A;  3NIA A;  4KZA A;  3C7U A;  4OPR A;  3VOY A;  5CED A;  2WGW A;  4OOL A;  5FQI A;  4EBP A;  2X02 A;  3UO9 A;  3VP2 A;  2XFS A;  3PTE A;  3WS0 A;  4QY6 A;  1IYQ A;  1QMF A;  4FSF A;  4KG2 A;  4IVI A;  1HTZ A;  3WRZ A;  4MLL A;  1JWZ A;  2Q9M A;  4QB8 A;  1ERO A;  1GHP A;  3PBR A;  5HW3 A;  4KZ4 A;  3GV9 A;  1K4F A;  3CZD A;  4WBG A;  4PM7 A;  2Y2H A;  3SH7 A;  4BLM A;  1ZG6 A;  4OPQ A;  5I94 A;  3QNC A;  1CI9 A;  4DF6 A;  1FSW A;  1NZO A;  3NCK A;  5CER A;  1IYP A;  1NXY A;  2FFF B;  1GHI A;  3TG9 A;  3ITA A;  3O88 A;  4S2I A;  3MFD A;  2Z2L B;  1FR1 A;  3Q7Z A;  5HAI A;  3OPR A;  2ZJ9 A;  3N8L A;  1LI0 A;  3MZE A;  1NY0 A;  3HL9 A;  3QHY A;  1JTG A;  4RVA A;  3SS5 A;  3A3E A;  2P9V A;  4CPK A;  3HRE A;  3VP3 A;  4OQG A;  1W5D A;  5FAT A;  2P74 A;  3SS4 A;  1KGF A;  1S6R A;  2ZQA A;  4F94 A;  3C7V A;  1YMS A;  3LEZ A;  4E3M A;  4OQI A;  4MNR A;  1ESU A;  3BEC A;  4ZAM A;  1ESI A;  3UPN A;  1ALQ A;  1BLS A;  4PMA A;  3QNB A;  5FA7 A;  1LLB A;  2Y2N A;  2JBF A;  4E3O A;  1K56 D;  3HLD A;  3TSG A;  3JYI A;  5DF8 A;  5CHU A;  4E3L A;  5HAP A;  4CJN A;  1AXB A;  1YLJ A;  3NDE A;  4YIN A;  4JXS A;  4EWF A;  4E3N A;  4UA6 A;  3S1Y A;  1WYC A;  1TEM A;  3HLF A;  4S2J A;  2V2F F;  4E6X A;  4E3K A;  4UHU A;  3C4P A;  4R3J A;  4EBN A;  3IF6 B;  3BFE A;  1PWD A;  5FSR A;  4ZTK A;  1MWS A;  5M1A A;  3W4O A;  4S2P A;  2HDR A;  2J7V A;  3ITB A;  2Y91 A;  1ONG A;  3O3V A;  3BEB A;  3IWO A;  3HLB A;  3OPH A;  3RJU A;  3MXR A;  4S2M A;  1YM1 A;  4LV3 A;  4KEN B;  5FQM A;  1FCM A;  3IH8 A;  2ZQ7 A;  3IF5 A;  1Y54 A;  1KE3 A;  1MWU A;  1U60 A;  3ZG5 A;  1XX2 A;  1KGE A;  1MWT A;  4JXW A;  1XGJ A;  1PWC A;  2EX2 A;  1HZO A;  5FAO A;  3SH8 A;  2XD1 A;  2OV5 A;  3FKV A;  3ZG8 B;  3EQU A;  5F83 A;  2WK0 A;  2EFU A;  1S0W A;  1K56 A;  3O87 A;  4HES A;  4U0T A;  4KQQ A;  1KE0 A;  1XP4 A;  5GHZ A;  2ZQ8 A;  5GLA A;  2WGW B;  1ERM A;  3HLC A;  3MXS A;  2WZX A;  1BLC A;  1K55 A;  1H8Z A;  3PBT A;  4N1H A;  1W7F A;  4LEN A;  3A3J A;  3VP4 A;  2WAE A;  2XR0 A;  5EEC A;  3VSK A;  4BD0 A;  3ISG A;  3IT9 A;  4BL3 A;  4K91 A;  4LCM A;  1K38 A;  2RL3 A;  2ZC4 B;  2C6W B;  3PAG A;  5FAP A;  4OLG A;  5KSH A;  5CGW A;  4KZ9 A;  2OLV A;  2IWC A;  3Q82 A;  3ZG0 A;  3GRJ A;  3IXD A;  3UDF A;  2R9W A;  4C6Y A;  5HFO A;  2C5W B;  4HBT A;  4OON A;  3VOZ A;  3W8K A;  2PBY A;  2EXB A;  1BLH A;  1K54 A;  3G32 A;  1C3B A;  1MXO A;  4Y0U A;  1Z6F A;  4GOG A;  3SH9 A;  2ZC3 B;  1NYY A;  1RGY A;  3CMZ A;  3AGF A;  5FAS A;  5G18 A;  2WAD A;  4UA9 A;  4GD6 A;  4QU3 A;  4GZB A;  4X55 A;  1N4O A;  4FH4 A;  3D4F A;  1K6S A;  5TR7 A;  1PW1 A;  4O7D A;  2OSU A;  4RX3 A;  1PIO A;  2VGK A;  2H0Y A;  1MKI A;  5AQA A;  1PWG A;  4HEF A;  1GCE A;  4ZJ2 A;  4JF4 A;  2EX9 A;  5EE8 A;  2EX8 A;  1RCJ A;  2HDS A;  1KVL A;  2H0T A;  3VMA A;  4BL2 A;  1E25 A;  1L0E A;  4E6W A;  5A93 A;  4WZ5 C;  4LV2 A;  3IF6 C;  5EVI A;  3E2L A;  3BYD A;  4DDS A;  3LCE A;  4Q8I A;  4KZB A;  1VM1 A;  1O07 A;  1ES2 A;  3PAE A;  5E2G A;  2ZQC A;  4R23 A;  2RCX A;  2WGI A;  3RXX A;  3ZVT A;  4C3Q A;  5CTM A;  1NZU A;  5EUA A;  3S22 A;  2Y2O A;  4GN2 A;  3VSL A;  1W8Y A;  5F1G A;  4DE3 A;  3W4P A;  2XDM A;  3UE3 A;  2XD5 A;  4OQ0 A;  3VFH A;  1SDN A;  1K6R A;  5M19 A;  4YFM A;  4NET A;  5DTS A;  1KVM A;  5A90 A;  2OLU A;  1SKF A;  3IXB A;  2ZM2 A;  1EI5 A;  2Y4A A;  3AGD A;  2HP6 A;  1DJC A;  1LI9 A;  2Y55 A;  3HVF A;  4E3I A;  1ES3 A;  3NBL A;  4GB7 A;  4OOY A;  4MBF A;  3HBR A;  4GDB A;  4P0M A;  4KQO A;  5E2H A;  4A5R A;  3CJM A;  2H10 A;  2Y59 A;  3G34 A;  3GR2 A;  5FI7 A;  1NJ4 A;  1FCO A;  4GKU A;  4PM9 A;  5CGS A;  5CTN A;  1PW8 A;  2JC7 A;  4OOM A;  3M6B A;  4Y0O A;  5CRF A;  3UE0 A;  2HPB A;  2Y2K A;  1L0G A;  3ZCZ A;  4B88 A;  1Q2P A;  2ZLY A;  4DXB A;  4KZ3 A;  1LHY A;  1BSG A;  2CC1 A;  3DTM A;  4N9L A;  1W79 A;  1TVF A;  3A3D A;  4JKT A;  5FAQ A;  2XF3 A;  3B3X A;  1DJB A;  3DWZ A;  4S2N C;  2Y2L A;  3HUO A;  4X68 A;  1IYS A;  5CXW A;  4B4Z A;  4DXC A;  3FV7 A;  1WYB A;  5M18 A;  2Y2G A;  4PM5 A;  4N9K A;  1XA7 A;  2BG1 A;  2ZMA A;  5GLB A;  3FZC A;  3IHA A;  2G2W A;  4LCL A;  4E3J A;  5TGF A;  3DWK A;  1ES5 A;  5E43 A;  4BQM A;  2P9V B;  3NY4 A;  2ZC6 B;  5FI2 A;  3V3S A;  3ZVW A;  4L0L A;  1TDG A;  4WMC D;  1JTD A;  5A91 A;  1K57 A;  1ERQ A;  4HBU A;  3UN7 A;  2QZ6 A;  4WM9 A;  1XKZ A;  4RA7 A;  4C75 A;  3G35 A;  2ZM8 A;  1RGZ A;  1WE4 A;  5E2E A;  5BOH A;  3S4X A;  4OPY A;  3TOI A;  2VGJ A;  4OVD A;  3ZFZ A;  3Q81 A;  1MY8 A;  4IBX A;  4X56 A;  4BEN A;  2GDN A;  5HL1 A;  3BRM A;  3ZG9 B;  4JXV A;  3NC8 A;  4P6B A;  4X53 A;  1M40 A;  2E8I A;  3BFF A;  4S2L A;  4GD8 A;  4S2K A;  3C4O A;  1N9B A;  2JE5 A;  5HAQ A;  5L2F A;  1LL9 A;  1FQG A;  3OCL A;  3P09 A;  5FQ9 A;  4OH0 A;  4S2O A;  1K25 A;  4WMC A;  4D2O A;  4WYY A;  1FR6 A;  1H8Y A;  4WEL A;  1GA9 A;  3OC2 A;  5CGX A;  5D3O A;  3AGE A;  2DRW A;  4X69 A;  3Q7V B;  4ZJ1 A;  1L0D A;  4FD8 A;  4R4R A;  5CHJ A;  5KMW A;  4QHC A;  5F82 A;  1IKG A;  4KZ7 A;  3V5M A;  3VFF A;  3MBZ A;  1EWZ A;  2Y2Q A;  1YLZ A;  4N1X A;  3ZG7 B;  3BLS A;  1QME A;  1GA0 A;  2IWD A;  2XK1 A;  3A3I A;  5DTT A;  4KQR A;  3ZHH A;  4DE0 A;  2Y2J A;  3LY4 A;  3N7W A;  4LV0 A;  4N92 A;  2J9P A;  3OPP A;  1FSY A;  1YT4 A;  2WKE A;  2DNS A;  3UPP A;  3NDG A;  4ID4 A;  4KG6 A;  2HDU A;  4B4X A;  3Q1F A;  1BT5 A;  1DJA A;  1W8Q A;  3PBS A;  4IVK A;  3N4I A;  5FI6 A;  3WRT A;  3GMW A;  2WKH A;  3HUN A;  5AQ9 A;  3GSG A;  3PBQ A;  4EQI A;  1NYM A;  2XGN A;  2ZC5 B;  3V39 A;  1J9M A;  4XUZ A;  1PZP A;  3WS2 A;  2I72 A;  2XFT A;  1JVJ A;  3N8R A;  3IWI A;  1ES4 A;  3M6H A;  2Y2P A;  3FKW A;  4LV1 A;  1VQQ A;  4RX2 A;  4U0X A;  5IHV A;  3WWX A;  3MZF A;  4P85 A;  2WZZ A;  3ZNT A;  3PBO A;  1E3U D;  3M2K A;  4QD4 A;  4RYE A;  3I7J A;  4MEZ A;  3HLW A;  3G31 A;  3MZD A;  2J9O A;  3BM6 A;  1XPB A;  2WKI A;  5HX9 A;  5CHM A;  3UDX A;  3GQZ A;  3MKE A;  2EXA A;  4Y0T A;  1YLT A;  2EX6 A;  4R4S A;  3BFD A;  4WEK A;  1MWR A;  1PYY A;  2BLS A;  1ZC2 A;  4JLF A;  1YQS A;  2Y2M A;  5EOE A;  3G4P A;  4JF6 A;  3IQA A;  3LO7 A;  3ZGA B;  4S2N A;  3EQV A;  2ZM0 A;  5F1F A;  1TDL A;  1MBL A;  3IH9 A;  4NK3 A;  1DY6 A;  2ZQ9 A;  4IBR A;  4Y7P A;  3A3F A;  3Q07 A;  3N6I A;  4MBH A;  4GDN A;  1JWV A;  2HP5 A;  4R1G A;  4UA7 A;  1G6A A;  3BFC A;  2QPN A;  3BLM A;  4DDY A;  3HUM A;  2XH9 A;  1O7E A;  1CEG A;  3PBN A;  1KE4 A;  2A49 A;  3G2Y A;  3IF6 A;  5GHY A;  4WZ4 A;  1XGI A;  5EVI B;  1K57 C;  5FQQ A;  3V50 A;  5CEB A;  4XXR A;  1YLW A;  2V20 A;  2WUQ A;  3IXG A;  3ZNY A;  2HDQ A; 
#chains in the Genus database with same CATH topology
 1BLP A;  4PHT A;  1XA1 A;  4MN7 A;  4EBL A;  5EPH A;  1N9N A;  3G2Z A;  2J3W A;  5GHX A;  5EVI D;  2M7V A;  1K4E A;  5U47 A;  3SOI A;  4KZ5 A;  3ZDJ A;  5GLD A;  2H5S A;  4QY5 A;  4WEJ A;  2V0W A;  1HVB A;  3L9K A;  4AFI A;  3CPT B;  3DW0 A;  2Y2I A;  3SS3 A;  1IEL A;  4WZ5 A;  4ZBE A;  1KGG A;  4M3K A;  4CLC A;  3W2Z A;  5TFQ A;  3MKF A;  2J8Y A;  2O99 A;  2UWX A;  2XQZ A;  1IYO A;  2WYX A;  4EUZ A;  5E2F A;  2OWH A;  3JVU A;  3QP8 A;  2Q9N A;  2A3U A;  5KSC A;  5DVA A;  2EA9 A;  3R7W B;  3C8C A;  2PD7 A;  3MMH A;  3KSG A;  3CLO A;  1FOF A;  1PI5 A;  1ONH A;  2Z6D A;  1SDE A;  5DF7 A;  3BQA A;  2P08 A;  2X01 A;  1H5X A;  1G68 A;  4JGP A;  3QP6 A;  3R4K A;  4XUX A;  4PM8 A;  1OME A;  4OKP A;  4OQH A;  5GLC A;  4KZ8 A;  1SHV A;  4BD1 A;  5EM0 A;  4KG5 A;  2V0U A;  1YSQ A;  1BYW A;  5CED A;  5FQI A;  4B93 A;  3NOP C;  1OTB A;  2V9A A;  4IVI A;  2Q9M A;  3MXQ A;  4KZ4 A;  4Y13 A;  4Y5F A;  4PM7 A;  2Y2H A;  1T1C A;  2W3G A;  5I94 A;  4OPQ A;  3NCK A;  5CER A;  2FFF B;  1SKO A;  3OLO A;  1FR1 A;  3OPR A;  3VE4 A;  4I39 A;  1LI0 A;  3MZE A;  1NY0 A;  3QHY A;  3HRE A;  4OQG A;  3SS4 A;  3H7W A;  1A0K A;  3C7V A;  4MNR A;  3LI9 A;  3BEC A;  2W0N A;  1LSV A;  2JBF A;  1K56 D;  3HLD A;  4HJ4 A;  3JYI A;  5CHU A;  1AXB A;  1YLJ A;  4JXS A;  4E3N A;  4UA6 A;  3S1Y A;  4BBV A;  4LPZ A;  4E3K A;  3B42 A;  3FPV A;  4EBN A;  3IF6 B;  4S2P A;  3ZYT A;  3ITB A;  2Y91 A;  3O3V A;  2W1T B;  1DP6 A;  4GJ4 A;  4WL9 A;  4I3A A;  1F2K A;  4S2M A;  2W3F A;  1FCM A;  1MWU A;  3KSF A;  1XGJ A;  1N9L A;  2EFU A;  1K56 A;  1XP4 A;  1SZV A;  3MXS A;  2KOI A;  5DFY A;  5IU1 A;  3PBT A;  5HPI A;  2UV0 E;  3A3J A;  1XJ4 A;  5EEC A;  1HLU P;  3ISG A;  4BL3 A;  1K38 A;  2RL3 A;  2ZC4 B;  3MFX A;  4PAU A;  3PAG A;  1XJ2 A;  5KSH A;  5CGW A;  3ZG0 A;  2R9W A;  3IBJ A;  4L9F A;  4JGQ A;  5HFO A;  4HBT A;  3VOZ A;  4F3L A;  1K54 A;  3CUE C;  2VA0 A;  4Y0U A;  1Z6F A;  3C38 A;  5G18 A;  4GZB A;  2VV6 A;  5TR7 A;  2VK3 A;  3LR0 A;  4HEF A;  1GCE A;  2H0T A;  4BL2 A;  1E25 A;  3BYD A;  2GJ3 A;  5I5L A;  2WGI A;  3RXX A;  3ZVT A;  5FEF A;  3JPU A;  2K31 A;  2KX6 A;  2XDM A;  2XD5 A;  2OLU A;  2ZM2 A;  1EI5 A;  4MN6 A;  2Y4A A;  3AGD A;  3LI8 A;  1LI9 A;  4E3I A;  3HVF A;  3MR0 A;  2PYP A;  3HBR A;  3CJM A;  3GR2 A;  5HWT A;  1FCO A;  5CTN A;  4EU0 A;  2Z6C A;  3KYQ A;  2AVX A;  1S1Z A;  4N9L A;  1TS8 A;  4JKT A;  3A3D A;  4S2N C;  1IYS A;  4O8G A;  3E4O A;  3FV7 A;  1WYB A;  1XA7 A;  2BG1 A;  3NHQ A;  4E3J A;  3BW6 A;  3DWK A;  4R70 A;  1ES5 A;  5EM1 A;  1V9Y A;  3V3S A;  4MCW A;  1VEU A;  5A91 A;  1N9O A;  4HBU A;  3G35 A;  1RGZ A;  1T19 A;  2VEA A;  4OVD A;  2K2N A;  3ZFZ A;  3Q81 A;  4BEN A;  4P6B A;  4X53 A;  3BFF A;  2E8I A;  4S2L A;  4S2K A;  4GD8 A;  2O9A A;  5L2F A;  4NXE A;  2ZBB A;  1FR6 A;  4ZJ1 A;  1VB6 A;  1L0D A;  5FDS A;  3S7N A;  5CHJ A;  3T4Q A;  5F82 A;  1CQA A;  3VFF A;  4N1X A;  3ZG7 B;  4CLC C;  1QME A;  3A3I A;  4Y2F A;  4DE0 A;  3LY4 A;  4HH3 A;  2JKF A;  4LV0 A;  4N92 A;  3IX3 A;  4BMW A;  1YT4 A;  3LYX A;  1G28 A;  4B4X A;  2PBD P;  3Q1F A;  3PBS A;  2WKH A;  3HUN A;  5HDS A;  2W3D A;  2QWS A;  3PBQ A;  1NYM A;  3EOI A;  3K2N A;  2ZC5 B;  1J9M A;  3WS2 A;  1ES4 A;  3M6H A;  2Y2P A;  5IHV A;  2HGV A;  3PR6 A;  3ZNT A;  3I7J A;  1GSX A;  3HLW A;  3MZD A;  3F1P B;  4Y0T A;  5CHM A;  2EXA A;  1YLT A;  2EX6 A;  2ZMF A;  2BLS A;  3G4P A;  3ZGA B;  3EQV A;  1TDL A;  1MBL A;  4MBH A;  2XA7 S;  1JWV A;  4R1G A;  4BBU A;  1STZ A;  1O7E A;  1CEG A;  3PBN A;  5GHY A;  2A49 A;  3IF6 A;  4HJ3 A;  1XGI A;  5FQQ A;  4IUH A;  3U2A A;  2V20 A;  2WUQ A;  2W1T A;  2HDQ A;  1YSP A;  1CI8 A;  1MZU A;  3UME A;  4X6T A;  1YLP A;  5J3W A;  4I3I A;  2PU4 A;  5DTK A;  4R3B A;  3CUE A;  2V1A A;  3OZH A;  3VP1 A;  4BJP A;  5JYP A;  4MBK A;  3UDI A;  3LGO A;  3LY3 A;  1XJ3 A;  1PZO A;  4FCF A;  1FCN A;  3NI9 A;  1YLY A;  3VV4 A;  5FDH A;  2BAS A;  3WS4 A;  4JF5 A;  5G4Y A;  1Q2Q A;  5HAR A;  4OP5 A;  1VET A;  2ZL1 A;  2MJ6 A;  3DTE A;  1I5Q A;  4MDZ A;  1CEF A;  4X25 A;  3IXH A;  3OCN A;  3MF0 A;  4KZ6 A;  3O86 A;  3UE1 A;  4IJG A;  2FH5 A;  5DF9 A;  5EOO A;  5L8M A;  3N8S A;  1CF0 A;  1IEM A;  3L7H A;  4P6Z M;  3UY6 A;  5CEC A;  2PT7 A;  1S4R A;  4U3T A;  4HP9 A;  3UB8 A;  2QMI A;  3LIF A;  1RP5 A;  1M6K A;  5J8X A;  2B5R A;  4R3A A;  1GSV A;  3BY9 A;  4XT2 B;  2IWB A;  4ZJ3 A;  2PHY A;  4DE2 A;  1K54 C;  2Z2M B;  1J3W A;  3LIB A;  3W4Q A;  1L0F A;  4UAA A;  1G6O A;  3M2J A;  4ZDX A;  4OP8 A;  4OPR A;  5DJT A;  4FTX A;  2I9V A;  2WGW A;  2JHE A;  4GS9 B;  2OAP 1;  2WKP A;  2XFS A;  3WS0 A;  1HTZ A;  3FPW A;  1JWZ A;  1GHP A;  3GV9 A;  2R78 A;  3E4P A;  2H28 A;  3T12 B;  4BLM A;  3QNC A;  4DF6 A;  1L3L A;  1IYP A;  3T4L A;  3ITA A;  3MFD A;  1VET B;  5HAI A;  5HD5 A;  2ZJ9 A;  3N8L A;  3SS5 A;  3A3E A;  3MQ0 A;  3LEZ A;  4E3M A;  4OQI A;  1S4S A;  1ESI A;  3UPN A;  4PMA A;  5FA7 A;  3TSG A;  5DF8 A;  4E3L A;  4LFU A;  3NDE A;  3CIT A;  4H6J A;  4EWF A;  1OJG A;  3HLF A;  3EGD C;  1PWD A;  4ZTK A;  1OTD A;  4EW7 A;  5LBR A;  3RJU A;  3T4K A;  1AWI A;  3MXR A;  1YM1 A;  4KEN B;  4MMN A;  5FQM A;  3ZG5 A;  2VKS A;  2LB9 A;  2EX2 A;  5FAO A;  1HZO A;  2V8C A;  3ZG8 B;  2WK0 A;  3O87 A;  4U0T A;  3IBR A;  2ZQ8 A;  5GLA A;  3HLC A;  5AJG A;  4N1H A;  4WLA A;  2C6W B;  2KLI A;  4KZ9 A;  2OLV A;  2O9C A;  4NKP A;  4HI4 A;  4R38 A;  4C6Y A;  3W8K A;  2PBY A;  2EXB A;  1BLH A;  3G32 A;  1C3B A;  5L10 A;  2ZC3 B;  3CMZ A;  3AGF A;  5FAS A;  2B02 A;  4UA9 A;  4FH4 A;  1PW1 A;  4O7D A;  2J3T D;  2OSU A;  3LR5 A;  1P9R A;  1PIO A;  2VGK A;  4RX3 A;  3QP5 A;  1P9W A;  2EX8 A;  3VMA A;  5A93 A;  4LV2 A;  5EVE A;  4DDS A;  1ZHH B;  1VM1 A;  1O07 A;  5E2G A;  4HIA A;  2HV1 A;  2ZQC A;  2RCX A;  4EET B;  4DE3 A;  3JVV A;  3UE3 A;  1K6R A;  3A0R A;  4YFM A;  4NET A;  5DTS A;  1KVM A;  4Y15 A;  5A90 A;  4BBT A;  3C30 A;  1DJC A;  4MBF A;  1S1Y A;  4GDB A;  4KQO A;  4A5R A;  2H10 A;  2Y59 A;  3MS6 A;  5G4Z A;  4PM9 A;  1PW8 A;  2VLG A;  2J3T C;  1K0K A;  3M6B A;  5CRF A;  4Q0I A;  3UE0 A;  2Y2K A;  2ZL1 B;  2ZLY A;  4KZ3 A;  1LHY A;  3DTM A;  2QYB A;  2XF3 A;  3B3X A;  5CXW A;  3TJZ C;  2ZMA A;  4NG2 A;  2G2W A;  4LCL A;  5TGF A;  5E43 A;  2ZC6 B;  4M4X A;  1ERQ A;  3UN7 A;  2QZ6 A;  1UGU A;  2ZM8 A;  2PR5 A;  5E2E A;  3S4X A;  4OPY A;  4EER A;  1UWP X;  4BWI A;  5AVE A;  2L4R A;  4EXO A;  5HL1 A;  3ZG9 B;  4Q0H A;  3QP2 A;  3C4O A;  3PXP A;  3EWK A;  3OCL A;  4D2O A;  2Q0O A;  4WYY A;  1OTA A;  4WEL A;  5D3O A;  1GA9 A;  3T1S A;  3MSH A;  3Q7V B;  4P6Z S;  3ICY A;  3E0Y A;  1MC0 A;  4NXG A;  4R4R A;  5KMW A;  3CHW P;  4QHC A;  4KZ7 A;  1YLZ A;  4NEE D;  1D7E A;  3BLS A;  3KSH A;  1GA0 A;  2IWD A;  2YKF A;  3QP1 A;  3GDI A;  4KQR A;  3ZHH A;  2Y2J A;  2J9P A;  3OPP A;  4NXF A;  2IA2 A;  2HDU A;  4IVK A;  1BT5 A;  1DJA A;  1W8Q A;  5DKL A;  1PZP A;  4GCZ A;  4DMZ A;  3WWX A;  2B18 A;  4LV1 A;  3FKW A;  4RX2 A;  3MZF A;  2WZZ A;  4RYE A;  3R7W A;  3LEQ A;  4MEZ A;  3UDX A;  1XPB A;  2P04 A;  3GQZ A;  3LUQ A;  2XSS A;  2W1R A;  4WEK A;  1MWR A;  5EOE A;  2NUP C;  4JF6 A;  1W63 M;  3D72 A;  4MN5 A;  4NXB A;  4O0P A;  1F9I A;  5F1F A;  1TS7 A;  4NK3 A;  4Y7P A;  4IBR A;  1DY6 A;  2KDK A;  2K7S A;  2ZQ9 A;  3Q07 A;  3TE8 A;  3KYE A;  1G6A A;  3BLM A;  1KE4 A;  3LFV A;  3V50 A;  5HDD A;  3RTY A;  5EVI B;  1K57 C;  2O0Y A;  1P97 A;  3S7Q A;  4FOF A;  3IXG A;  3ZNY A;  5HPF A;  1FIK A;  3NUL A;  4I3J A;  4K08 A;  5FQJ A;  3LIE A;  1OT6 A;  3S7P A;  1NRF A;  4IED A;  3RXW A;  1SCW A;  5KIZ A;  3T1Q B;  3IWQ A;  4P87 A;  3FWL A;  1XFQ A;  3VP0 A;  4EV4 A;  1I2S A;  5HDC A;  3EEH A;  1MPL A;  3HLG A;  1L2S A;  3CI6 A;  4R0Q A;  1DP8 A;  2ZC7 A;  2XLN A;  5AQB A;  3NOU C;  3UNW A;  5HL6 A;  3PHY A;  4JPM A;  3UB9 A;  2HP9 A;  1LL5 A;  2JCH A;  3C2W A;  1CK3 A;  4K0W A;  4K0X A;  4UEY A;  4EUV A;  5J4E A;  3F1O A;  4LRX C;  2EWV A;  2JKR M;  1NWZ A;  3BFG A;  4B9O A;  1IOU A;  1GHM A;  2Y8H A;  2W27 A;  2V1Z A;  3OPL A;  2ZMV A;  4OPZ A;  2R9X A;  5F6A A;  3RH8 B;  4KQD A;  5HWV A;  2M1C A;  2VX8 A;  4Z9Q A;  1KDW A;  2Y79 A;  2HZ5 A;  1NRJ A;  5AQ7 A;  4GW9 A;  3V3R A;  3WS1 A;  1H0M A;  1WA9 A;  1E3U A;  1XXM A;  3Q7V A;  1BTL A;  4DKI A;  4G3K A;  2WGV A;  3C5A A;  4X1L A;  2ZQD A;  3NIA A;  4DJ2 A;  2W3E A;  3VOY A;  4JGO A;  4OOL A;  3KSI A;  2X02 A;  3UO9 A;  4HP4 A;  1IYQ A;  4FSF A;  3NJA A;  3LIC A;  4QB8 A;  3T4O A;  1ERO A;  4LLO B;  3P7N A;  3PBR A;  5HW3 A;  1DP9 A;  3CZD A;  4WBG A;  4HQA A;  3NEC A;  3SH7 A;  1CI9 A;  1NZO A;  1NXY A;  3O88 A;  4S2I A;  2ACG A;  1PFL A;  2XA7 M;  3H9W A;  1YAX A;  3FG8 A;  4RVA A;  5DJU A;  2P9V A;  3UB5 P;  2B95 A;  1KGF A;  1S6R A;  2ZQA A;  4F94 A;  1ESU A;  3GEC A;  1ALQ A;  1BLS A;  2XRN A;  1LLB A;  2Y2N A;  1CJF A;  2QKP A;  4CJN A;  4YIN A;  1WYC A;  1TEM A;  4S2J A;  1XFN A;  3C4P A;  4R3J A;  3BFE A;  5FSR A;  4EQ1 A;  3IWO A;  3PYP A;  3HLB A;  3OPH A;  2JKT M;  5A8B A;  4LV3 A;  4ME4 A;  1Y28 A;  3IS2 B;  4L9E A;  3UE6 A;  2GNX A;  2ZQ7 A;  1KE3 A;  1KGE A;  3A0S A;  4JXW A;  1PWC A;  3TRC A;  3FKV A;  3EQU A;  1F98 A;  5F83 A;  4ARZ A;  2E8J A;  4KUO A;  1S0W A;  4KQQ A;  3SZT A;  5GHZ A;  2WGW B;  2WZX A;  3HJI A;  1BLC A;  5HZH A;  1H8Z A;  1W7F A;  3EGX C;  3HJK A;  2XR0 A;  3VSK A;  1OT9 A;  3IT9 A;  4HH2 A;  5FAP A;  4CLC B;  3GRJ A;  4HOI A;  2L0W A;  2C5W B;  2W3H A;  2VZW A;  4WF0 A;  1YKD A;  1G5U A;  1MXO A;  3SH9 A;  1NYY A;  1RGY A;  4Q0J A;  2DMW A;  4GD6 A;  4X55 A;  1N4O A;  3DTI A;  3D4F A;  2V1B A;  4GLQ A;  3VE3 A;  1X0O A;  5C5K A;  1MKI A;  1PWG A;  4ZJ2 A;  1V9Z A;  4JF4 A;  2EX9 A;  5EE8 A;  4FUW A;  3O5Y A;  4E6W A;  4G3W A;  3IF6 C;  3E2L A;  1UWN X;  3PAE A;  4H6J B;  2M7U A;  2VGL S;  2NUT C;  5DKK A;  5EUA A;  5HD3 A;  4GHI B;  2Y2O A;  3VSL A;  1W8Y A;  5TBM B;  1SDN A;  5M19 A;  4CLC E;  3IXB A;  3UB7 A;  4ZRR A;  2HP6 A;  2Y55 A;  4GB7 A;  4P0M A;  3B33 A;  3LR4 A;  3G34 A;  1TF1 A;  1Y4O A;  1NJ4 A;  5CGS A;  3UMD A;  4ARZ B;  2JC7 A;  4OOM A;  2HPB A;  5F5Y A;  1L0G A;  3ZCZ A;  4B88 A;  3LR3 A;  2INW A;  2VJW A;  2CC1 A;  1P0Z A;  5FAQ A;  1DJB A;  3DWZ A;  4DXC A;  4X68 A;  2QHK A;  3FZC A;  3IHA A;  4IUK A;  2GX5 A;  3NY4 A;  3B47 A;  5FI2 A;  3ZVW A;  1TDG A;  2PYR A;  1JTD A;  2BTF P;  1K57 A;  1XKZ A;  3H82 A;  4PKY G;  5BOH A;  4QWO A;  1MY8 A;  4IBX A;  2JKR I;  3BRM A;  4JXV A;  3NC8 A;  1FQG A;  5FQ9 A;  3P09 A;  4OH0 A;  4S2O A;  3ZQ5 A;  5EFW A;  5CGX A;  3OC2 A;  3AGE A;  2DRW A;  4FD8 A;  3T4J A;  3IX8 A;  4GHI A;  3MBZ A;  3K3D A;  3A0V A;  1EWZ A;  1LSW A;  2Y2Q A;  4LGW A;  1JNU A;  2XK1 A;  5DTT A;  5IT5 A;  2FZ0 A;  2DNS A;  5TJJ A;  3UPP A;  3NDG A;  3EEA A;  3KYZ A;  3T4S A;  3WRT A;  3GMW A;  5AQ9 A;  4EQI A;  3CAX A;  4XUZ A;  1ACF A;  3MJQ A;  4E3O A;  4U0X A;  4P85 A;  3PBO A;  1E3U D;  3SW1 A;  2J9O A;  4LRY C;  4Z1W A;  4R4S A;  1PRQ A;  1PYY A;  1ZC2 A;  4JLF A;  2Y2M A;  3IQA A;  1XJ6 A;  3LO7 A;  1S67 L;  2ZM0 A;  2OOL A;  4LRZ E;  3IH9 A;  3H82 B;  4CQH A;  4GDN A;  2HP5 A;  4XT2 A;  4EEU A;  2PD8 A;  2QPN A;  3HUM A;  2XH9 A;  1NLZ A;  4HNB A;  4WZ4 A;  4XXR A;  4RQ9 A;  5K5B A;  3E4Q A;  1ZG4 A;  3LID A;  5KZH A;  3IS2 A;  2PDR A;  2X71 A;  1YMX A;  5TBM A;  2G7U A;  4PPR A;  2EFX A;  3UPO A;  2ZD8 A;  5EV0 A;  4H8R A;  2HJ9 C;  2VV8 A;  4E04 A;  1I2W A;  4OLD A;  1KOU A;  4DE1 A;  3MQO A;  3P98 A;  3IHB A;  4JBF A;  3E2K A;  1PI4 A;  1JWP A;  1K55 C;  4WN5 A;  3GVB A;  2FFY A;  2WAF A;  1Z09 A;  1YPR A;  4DRT A;  4HY8 A;  3UB6 A;  5MC7 A;  3HCY A;  1HD8 A;  1BUL A;  2G2U A;  5F69 A;  2VV7 A;  3P01 A;  4JXG A;  3H7W B;  3HLE A;  3T50 A;  3GTC A;  2HF6 A;  5GL9 A;  1ZKJ A;  5A92 A;  3FYZ A;  2DCF A;  3U4L P;  1VEU B;  1OTI A;  3CG5 A;  3T4T A;  2XRO A;  4QJG A;  3WS5 A;  2XEP A;  1KDS A;  1BZA A;  1ODV A;  2WKR A;  3G30 A;  2P7J A;  1IKI A;  4HJ6 A;  1BUE A;  5JYO A;  2PU2 A;  3FC7 A;  5EVI C;  3MQQ A;  5HSQ A;  2EWW A;  4PM6 A;  4GNU A;  5EVL A;  2GZA A;  4WUJ A;  4FH2 A;  3RFB A;  2PRF A;  1T18 A;  5FQK A;  2A24 A;  3D3O A;  1E4D A;  3D9Y A;  4KZA A;  3C7U A;  1PNE A;  4EBP A;  1W63 Q;  3VP2 A;  3PTE A;  4UQI S;  4QY6 A;  1QMF A;  1TS0 A;  4KG2 A;  3WRZ A;  4YWZ A;  4MLL A;  3DBA A;  2JKT I;  1K4F A;  3OOV A;  1ZG6 A;  4QPR A;  1FSW A;  3TG9 A;  1GHI A;  2Z2L B;  3Q7Z A;  3F1N B;  3S7O A;  3IX4 A;  1H8M A;  3HL9 A;  1JTG A;  4CPK A;  3VP3 A;  1W5D A;  3F1P A;  5FAT A;  2P74 A;  2QJ5 A;  3G6O A;  4X1M A;  5L09 A;  1YMS A;  4KUK A;  4YNR A;  4ZAM A;  2PR6 A;  3BWL A;  3F1O B;  3QNB A;  4EES A;  5HAP A;  3T1X A;  2OAQ 1;  2J80 A;  2V2F F;  4E6X A;  5FL3 A;  4UHU A;  3BY8 A;  3T1R A;  5M1A A;  1MWS A;  3W4O A;  2HDR A;  2J7V A;  1ONG A;  5IS1 A;  3BEB A;  2V8F A;  4EEP A;  5FEG A;  1D1J A;  1OPX A;  3IH8 A;  2JKG A;  3IF5 A;  1Y54 A;  1U60 A;  2CMN A;  1XX2 A;  1MWT A;  4DJ3 A;  3SH8 A;  2XD1 A;  2OV5 A;  3KX0 X;  4HES A;  1KE0 A;  5J7E A;  1ERM A;  4GS9 A;  5CX7 A;  1H3Q A;  1K55 A;  4LEN A;  4JGR A;  3VP4 A;  2WAE A;  4BD0 A;  4Y17 A;  3CPT A;  4K91 A;  4LCM A;  4ETZ A;  4OLG A;  2IWC A;  3Q82 A;  3IXD A;  3UDF A;  4OON A;  1SKO B;  2ZOI A;  1S66 L;  5L07 A;  4GOG A;  4CLC D;  2WAD A;  4QU3 A;  1K6S A;  1OTE A;  4R6L A;  3E98 A;  2H0Y A;  3KO6 A;  5AQA A;  4ESP A;  4II7 A;  1RCJ A;  2HDS A;  1T1B A;  2WKQ A;  1KVL A;  1L0E A;  4WZ5 C;  5EVI A;  4Q8I A;  3LCE A;  4KZB A;  1ES2 A;  1EW0 A;  4R23 A;  4I38 A;  3OBF A;  4C3Q A;  1ZTU A;  1NZU A;  5CTM A;  3S22 A;  5F68 A;  4O01 A;  4GN2 A;  1LSX A;  5F1G A;  4L9G A;  3W4P A;  3K3C A;  3VFH A;  4OQ0 A;  1SKF A;  2A2L A;  1ES3 A;  3NBL A;  1F5M A;  4OOY A;  5E2H A;  2L1M A;  1LT0 A;  5FI7 A;  4GKU A;  3BJN A;  4Y0O A;  1Q2P A;  4HHD A;  1GSW A;  4DXB A;  1BSG A;  4Y3I A;  3V67 A;  1W79 A;  1TVF A;  2Y2L A;  3HUO A;  4I5S A;  4B4Z A;  5M18 A;  2Y2G A;  4PM5 A;  4N9K A;  4UQI M;  5GLB A;  1VHM A;  2JN7 A;  3DTK A;  3QP4 A;  4BQM A;  2P9V B;  4PKY A;  4L0L A;  4WMC D;  3TW8 A;  4WM9 A;  4RA7 A;  4C75 A;  1WE4 A;  3TOI A;  2VGJ A;  3BQ8 A;  2QJ7 A;  4X56 A;  2GDN A;  5DFX A;  1M40 A;  1N9B A;  2JE5 A;  5HAQ A;  1LL9 A;  2PAV P;  1MKM A;  3ULF A;  1K25 A;  4WMC A;  3LIA A;  1FIL A;  1H8Y A;  4X69 A;  3CWF A;  1TD5 A;  1IKG A;  3V5M A;  4ETX A;  2O9B A;  3DAV A;  2D01 A;  2D02 A;  3N7W A;  1FSY A;  1D06 A;  4G3V A;  1T1A A;  4YOF A;  3NOT C;  2WKE A;  4ID4 A;  4KG6 A;  5FI6 A;  3N4I A;  1LL8 A;  1NLY A;  3GSG A;  4D60 A;  2XGN A;  3V39 A;  2I72 A;  3F1N A;  2XFT A;  1JVJ A;  3N8R A;  3IWI A;  1VQQ A;  2OWJ A;  3M2K A;  4QD4 A;  3G31 A;  4F3L B;  3BM6 A;  2WKI A;  5HX9 A;  3MKE A;  5HWW A;  3BFD A;  1DRM A;  2VGL M;  1YQS A;  5AVF A;  2YKH A;  1TS6 A;  2ZOH A;  4S2N A;  4IHQ A;  1IFQ A;  3VOL A;  1OJ5 A;  2HJE A;  2LB5 A;  3A3F A;  3N6I A;  4UA7 A;  3BFC A;  4DDY A;  4DN0 A;  3G2Y A;  5CEB A;  2A24 B;  1YLW A; 
#chains in the Genus database with same CATH homology
 1CI8 A;  1BLP A;  4X6T A;  1ZG4 A;  1YLP A;  1XA1 A;  2PU4 A;  5FQJ A;  5KZH A;  5DTK A;  2X71 A;  4R3B A;  1YMX A;  4EBL A;  4PPR A;  2EFX A;  1NRF A;  3UPO A;  2ZD8 A;  4IED A;  3OZH A;  1SCW A;  3RXW A;  5EPH A;  4H8R A;  3VP1 A;  3G2Z A;  4BJP A;  5GHX A;  1I2W A;  4OLD A;  5EVI D;  5JYP A;  1K4E A;  3IWQ A;  4MBK A;  3UDI A;  4DE1 A;  5U47 A;  3SOI A;  3LY3 A;  3P98 A;  4KZ5 A;  4P87 A;  3IHB A;  3FWL A;  5GLD A;  4JBF A;  3ZDJ A;  3E2K A;  1PI4 A;  3VP0 A;  2H5S A;  1JWP A;  1PZO A;  4EV4 A;  4QY5 A;  4FCF A;  4WEJ A;  1I2S A;  1FCN A;  1K55 C;  3NI9 A;  1HVB A;  1YLY A;  3GVB A;  5FDH A;  3WS4 A;  1MPL A;  2FFY A;  3HLG A;  1Q2Q A;  1L2S A;  3DW0 A;  4JF5 A;  2Y2I A;  5HAR A;  1IEL A;  4OP5 A;  4WZ5 A;  4ZBE A;  1KGG A;  2WAF A;  3SS3 A;  4R0Q A;  4DRT A;  2ZC7 A;  4M3K A;  1I5Q A;  2XLN A;  1CEF A;  5AQB A;  5TFQ A;  3IXH A;  3MKF A;  3UNW A;  1HD8 A;  1BUL A;  2J8Y A;  2UWX A;  2XQZ A;  3OCN A;  2G2U A;  4JPM A;  1IYO A;  2WYX A;  4JXG A;  2HP9 A;  1LL5 A;  2JCH A;  3HLE A;  4EUZ A;  5E2F A;  3GTC A;  2Q9N A;  1CK3 A;  2A3U A;  3O86 A;  4K0W A;  4K0X A;  4KZ6 A;  5GL9 A;  3UE1 A;  5KSC A;  5DVA A;  1ZKJ A;  3BFG A;  5DF9 A;  5A92 A;  3FYZ A;  5EOO A;  2DCF A;  3N8S A;  1GHM A;  1IEM A;  1FOF A;  3CG5 A;  1PI5 A;  1ONH A;  4QJG A;  3UY6 A;  5CEC A;  2V1Z A;  3OPL A;  3WS5 A;  4OPZ A;  2XEP A;  1KDS A;  2R9X A;  1BZA A;  4U3T A;  1SDE A;  5DF7 A;  3G30 A;  1H5X A;  2X01 A;  1G68 A;  1IKI A;  1BUE A;  5JYO A;  4XUX A;  2QMI A;  1RP5 A;  4PM8 A;  1M6K A;  2PU2 A;  5EVI C;  5J8X A;  2B5R A;  1OME A;  4PM6 A;  4OKP A;  4Z9Q A;  4GNU A;  5EVL A;  1KDW A;  2IWB A;  4OQH A;  4ZJ3 A;  5AQ7 A;  4FH2 A;  5GLC A;  3V3R A;  4DE2 A;  3WS1 A;  1K54 C;  4KZ8 A;  1E3U A;  1XXM A;  5FQK A;  3Q7V A;  1BTL A;  1SHV A;  4DKI A;  2Z2M B;  4BD1 A;  1E4D A;  2WGV A;  3W4Q A;  3C5A A;  4KG5 A;  1L0F A;  4UAA A;  3M2J A;  4ZDX A;  4OP8 A;  2ZQD A;  3NIA A;  4KZA A;  3C7U A;  4OPR A;  3VOY A;  5CED A;  2WGW A;  4OOL A;  5FQI A;  4EBP A;  2X02 A;  3UO9 A;  3VP2 A;  2XFS A;  3PTE A;  3WS0 A;  4QY6 A;  1IYQ A;  1QMF A;  4FSF A;  4KG2 A;  4IVI A;  1HTZ A;  3WRZ A;  4MLL A;  1JWZ A;  2Q9M A;  4QB8 A;  1ERO A;  1GHP A;  3PBR A;  5HW3 A;  4KZ4 A;  3GV9 A;  1K4F A;  3CZD A;  4WBG A;  4PM7 A;  2Y2H A;  3SH7 A;  4BLM A;  1ZG6 A;  4OPQ A;  5I94 A;  3QNC A;  1CI9 A;  4DF6 A;  1FSW A;  1NZO A;  3NCK A;  5CER A;  1IYP A;  1NXY A;  2FFF B;  1GHI A;  3TG9 A;  3ITA A;  3O88 A;  4S2I A;  3MFD A;  2Z2L B;  1FR1 A;  3Q7Z A;  5HAI A;  3OPR A;  2ZJ9 A;  3N8L A;  1LI0 A;  3MZE A;  1NY0 A;  3HL9 A;  3QHY A;  1JTG A;  4RVA A;  3SS5 A;  3A3E A;  2P9V A;  4CPK A;  3HRE A;  3VP3 A;  4OQG A;  1W5D A;  5FAT A;  2P74 A;  3SS4 A;  1KGF A;  1S6R A;  2ZQA A;  4F94 A;  3C7V A;  1YMS A;  3LEZ A;  4E3M A;  4OQI A;  4MNR A;  1ESU A;  3BEC A;  4ZAM A;  1ESI A;  3UPN A;  1ALQ A;  1BLS A;  4PMA A;  3QNB A;  5FA7 A;  1LLB A;  2Y2N A;  2JBF A;  4E3O A;  1K56 D;  3HLD A;  3TSG A;  3JYI A;  5DF8 A;  5CHU A;  4E3L A;  5HAP A;  4CJN A;  1AXB A;  1YLJ A;  3NDE A;  4YIN A;  4JXS A;  4EWF A;  4E3N A;  4UA6 A;  3S1Y A;  1WYC A;  1TEM A;  3HLF A;  4S2J A;  2V2F F;  4E6X A;  4E3K A;  4UHU A;  3C4P A;  4R3J A;  4EBN A;  3IF6 B;  3BFE A;  1PWD A;  5FSR A;  4ZTK A;  1MWS A;  5M1A A;  3W4O A;  4S2P A;  2HDR A;  2J7V A;  3ITB A;  2Y91 A;  1ONG A;  3O3V A;  3BEB A;  3IWO A;  3HLB A;  3OPH A;  3RJU A;  3MXR A;  4S2M A;  1YM1 A;  4LV3 A;  4KEN B;  5FQM A;  1FCM A;  3IH8 A;  2ZQ7 A;  3IF5 A;  1Y54 A;  1KE3 A;  1MWU A;  1U60 A;  3ZG5 A;  1XX2 A;  1KGE A;  1MWT A;  4JXW A;  1XGJ A;  1PWC A;  2EX2 A;  1HZO A;  5FAO A;  3SH8 A;  2XD1 A;  2OV5 A;  3FKV A;  3ZG8 B;  3EQU A;  5F83 A;  2WK0 A;  2EFU A;  1S0W A;  1K56 A;  3O87 A;  4HES A;  4U0T A;  4KQQ A;  1KE0 A;  1XP4 A;  5GHZ A;  2ZQ8 A;  5GLA A;  2WGW B;  1ERM A;  3HLC A;  3MXS A;  2WZX A;  1BLC A;  1K55 A;  1H8Z A;  3PBT A;  4N1H A;  1W7F A;  4LEN A;  3A3J A;  3VP4 A;  2WAE A;  2XR0 A;  5EEC A;  3VSK A;  4BD0 A;  3ISG A;  3IT9 A;  4BL3 A;  4K91 A;  4LCM A;  1K38 A;  2RL3 A;  2ZC4 B;  2C6W B;  3PAG A;  5FAP A;  4OLG A;  5KSH A;  5CGW A;  4KZ9 A;  2OLV A;  2IWC A;  3Q82 A;  3ZG0 A;  3GRJ A;  3IXD A;  3UDF A;  2R9W A;  4C6Y A;  5HFO A;  2C5W B;  4HBT A;  4OON A;  3VOZ A;  3W8K A;  2PBY A;  2EXB A;  1BLH A;  1K54 A;  3G32 A;  1C3B A;  1MXO A;  4Y0U A;  1Z6F A;  4GOG A;  3SH9 A;  2ZC3 B;  1NYY A;  1RGY A;  3CMZ A;  3AGF A;  5FAS A;  5G18 A;  2WAD A;  4UA9 A;  4GD6 A;  4QU3 A;  4GZB A;  4X55 A;  1N4O A;  4FH4 A;  3D4F A;  1K6S A;  5TR7 A;  1PW1 A;  4O7D A;  2OSU A;  4RX3 A;  1PIO A;  2VGK A;  2H0Y A;  1MKI A;  5AQA A;  1PWG A;  4HEF A;  1GCE A;  4ZJ2 A;  4JF4 A;  2EX9 A;  5EE8 A;  2EX8 A;  1RCJ A;  2HDS A;  1KVL A;  2H0T A;  3VMA A;  4BL2 A;  1E25 A;  1L0E A;  4E6W A;  5A93 A;  4WZ5 C;  4LV2 A;  3IF6 C;  5EVI A;  3E2L A;  3BYD A;  4DDS A;  3LCE A;  4Q8I A;  4KZB A;  1VM1 A;  1O07 A;  1ES2 A;  3PAE A;  5E2G A;  2ZQC A;  4R23 A;  2RCX A;  2WGI A;  3RXX A;  3ZVT A;  4C3Q A;  5CTM A;  1NZU A;  5EUA A;  3S22 A;  2Y2O A;  4GN2 A;  3VSL A;  1W8Y A;  5F1G A;  4DE3 A;  3W4P A;  2XDM A;  3UE3 A;  2XD5 A;  4OQ0 A;  3VFH A;  1SDN A;  1K6R A;  5M19 A;  4YFM A;  4NET A;  5DTS A;  1KVM A;  5A90 A;  2OLU A;  1SKF A;  3IXB A;  2ZM2 A;  1EI5 A;  2Y4A A;  3AGD A;  2HP6 A;  1DJC A;  1LI9 A;  2Y55 A;  3HVF A;  4E3I A;  1ES3 A;  3NBL A;  4GB7 A;  4OOY A;  4MBF A;  3HBR A;  4GDB A;  4P0M A;  4KQO A;  5E2H A;  4A5R A;  3CJM A;  2H10 A;  2Y59 A;  3G34 A;  3GR2 A;  5FI7 A;  1NJ4 A;  1FCO A;  4GKU A;  4PM9 A;  5CGS A;  5CTN A;  1PW8 A;  2JC7 A;  4OOM A;  3M6B A;  4Y0O A;  5CRF A;  3UE0 A;  2HPB A;  2Y2K A;  1L0G A;  3ZCZ A;  4B88 A;  1Q2P A;  2ZLY A;  4DXB A;  4KZ3 A;  1LHY A;  1BSG A;  2CC1 A;  3DTM A;  4N9L A;  1W79 A;  1TVF A;  3A3D A;  4JKT A;  5FAQ A;  2XF3 A;  3B3X A;  1DJB A;  3DWZ A;  4S2N C;  2Y2L A;  3HUO A;  4X68 A;  1IYS A;  5CXW A;  4B4Z A;  4DXC A;  3FV7 A;  1WYB A;  5M18 A;  2Y2G A;  4PM5 A;  4N9K A;  1XA7 A;  2BG1 A;  2ZMA A;  5GLB A;  3FZC A;  3IHA A;  2G2W A;  4LCL A;  4E3J A;  5TGF A;  3DWK A;  1ES5 A;  5E43 A;  4BQM A;  2P9V B;  3NY4 A;  2ZC6 B;  5FI2 A;  3V3S A;  3ZVW A;  4L0L A;  1TDG A;  4WMC D;  1JTD A;  5A91 A;  1K57 A;  1ERQ A;  4HBU A;  3UN7 A;  2QZ6 A;  4WM9 A;  1XKZ A;  4RA7 A;  4C75 A;  3G35 A;  2ZM8 A;  1RGZ A;  1WE4 A;  5E2E A;  5BOH A;  3S4X A;  4OPY A;  3TOI A;  2VGJ A;  4OVD A;  3ZFZ A;  3Q81 A;  1MY8 A;  4IBX A;  4X56 A;  4BEN A;  2GDN A;  5HL1 A;  3BRM A;  3ZG9 B;  4JXV A;  3NC8 A;  4P6B A;  4X53 A;  1M40 A;  2E8I A;  3BFF A;  4S2L A;  4GD8 A;  4S2K A;  3C4O A;  1N9B A;  2JE5 A;  5HAQ A;  5L2F A;  1LL9 A;  1FQG A;  3OCL A;  3P09 A;  5FQ9 A;  4OH0 A;  4S2O A;  1K25 A;  4WMC A;  4D2O A;  4WYY A;  1FR6 A;  1H8Y A;  4WEL A;  1GA9 A;  3OC2 A;  5CGX A;  5D3O A;  3AGE A;  2DRW A;  4X69 A;  3Q7V B;  4ZJ1 A;  1L0D A;  4FD8 A;  4R4R A;  5CHJ A;  5KMW A;  4QHC A;  5F82 A;  1IKG A;  4KZ7 A;  3V5M A;  3VFF A;  3MBZ A;  1EWZ A;  2Y2Q A;  1YLZ A;  4N1X A;  3ZG7 B;  3BLS A;  1QME A;  1GA0 A;  2IWD A;  2XK1 A;  3A3I A;  5DTT A;  4KQR A;  3ZHH A;  4DE0 A;  2Y2J A;  3LY4 A;  3N7W A;  4LV0 A;  4N92 A;  2J9P A;  3OPP A;  1FSY A;  1YT4 A;  2WKE A;  2DNS A;  3UPP A;  3NDG A;  4ID4 A;  4KG6 A;  2HDU A;  4B4X A;  3Q1F A;  1BT5 A;  1DJA A;  1W8Q A;  3PBS A;  4IVK A;  3N4I A;  5FI6 A;  3WRT A;  3GMW A;  2WKH A;  3HUN A;  5AQ9 A;  3GSG A;  3PBQ A;  4EQI A;  1NYM A;  2XGN A;  2ZC5 B;  3V39 A;  1J9M A;  4XUZ A;  1PZP A;  3WS2 A;  2I72 A;  2XFT A;  1JVJ A;  3N8R A;  3IWI A;  1ES4 A;  3M6H A;  2Y2P A;  3FKW A;  4LV1 A;  1VQQ A;  4RX2 A;  4U0X A;  5IHV A;  3WWX A;  3MZF A;  4P85 A;  2WZZ A;  3ZNT A;  3PBO A;  1E3U D;  3M2K A;  4QD4 A;  4RYE A;  3I7J A;  4MEZ A;  3HLW A;  3G31 A;  3MZD A;  2J9O A;  3BM6 A;  1XPB A;  2WKI A;  5HX9 A;  5CHM A;  3UDX A;  3GQZ A;  3MKE A;  2EXA A;  4Y0T A;  1YLT A;  2EX6 A;  4R4S A;  3BFD A;  4WEK A;  1MWR A;  1PYY A;  2BLS A;  1ZC2 A;  4JLF A;  1YQS A;  2Y2M A;  5EOE A;  3G4P A;  4JF6 A;  3IQA A;  3LO7 A;  3ZGA B;  4S2N A;  3EQV A;  2ZM0 A;  5F1F A;  1TDL A;  1MBL A;  3IH9 A;  4NK3 A;  1DY6 A;  2ZQ9 A;  4IBR A;  4Y7P A;  3A3F A;  3Q07 A;  3N6I A;  4MBH A;  4GDN A;  1JWV A;  2HP5 A;  4R1G A;  4UA7 A;  1G6A A;  3BFC A;  2QPN A;  3BLM A;  4DDY A;  3HUM A;  2XH9 A;  1O7E A;  1CEG A;  3PBN A;  1KE4 A;  2A49 A;  3G2Y A;  3IF6 A;  5GHY A;  4WZ4 A;  1XGI A;  5EVI B;  1K57 C;  5FQQ A;  3V50 A;  5CEB A;  4XXR A;  1YLW A;  2V20 A;  2WUQ A;  3IXG A;  3ZNY A;  2HDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...