2P9VA

Structure of ampc beta-lactamase with cross-linked active site after exposure to small molecule inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
358
structure length
354
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINNKIALAARPVKAITPPTPAVRASWVHTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title O-Aryloxycarbonyl Hydroxamates: New beta-Lactamase Inhibitors That Cross-Link the Active Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 119
structure length 354
sequence length 358
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p9vA00
4KZ9A 4X56A 4KENB 1KVLA 1YMXA 3NY4A 1GA9A 3PBOA 4BL2A 1MWRA 4Q8IA 4GDNA 3IH9A 3PBSA 2Y2GA 1SDNA 2ZQ7A 5EUAA 2R9WA 3NC8A 2X01A 2I72A 3S1YA 1ERQA 5EVID 4KG2A 1NYMA 4KZ7A 1XA1A 2WAEA 3OCLA 3PTEA 1L2SA 3UE0A 5CHUA 3DWKA 3S22A 3PBTA 4OP5A 1K54C 4ZJ1A 3MBZA 3IXBA 3G2ZA 5M19A 4GD6A 3C4OA 2DNSA 2IWDA 2ZM0A 3WRTA 4B4ZA 1MXOA 1W79A 3LEZA 2Y2PA 2Q9NA 1K6RA 3SH8A 1VQQA 1RP5A 3BFFA 4JPMA 3GSGA 5FASA 1GHMA 4KZAA 4WZ5C 1TDLA 4RX2A 3OPPA 3VP0A 3Q7ZA 1XPBA 5TGFA 4QY5A 1KE3A 4FD8A 3G34A 3A3EA 3EQVA 4JF4A 4IVIA 3G32A 3HREA 4N1XA 5EPHA 3MKFA 4L0LA 1MBLA 1MY8A 3OPRA 4QJGA 1XX2A 2XLNA 2Y2JA 4U0XA 2IWCA 5GLBA 4EBNA 1CEGA 4LV3A 3GV9A 5CERA 3HLCA 4O7DA 1SDEA 1CEFA 1ES3A 4OP8A 4UA6A 4H8RA 3M6BA 4OPYA 1XGJA 3VP2A 3IWQA 1O07A 5E2HA 2V1ZA 3ZFZA 2PU4A 1FCNA 3AGDA 2Y2IA 4P6BA 3UPPA 3Q81A 5HX9A 3ZG0A 1CI9A 1TDGA 4MBKA 4MBFA 5GHYA 3ZGAB 4R4RA 4R1GA 1K54A 4E6WA 4C6YA 1LL5A 3JYIA 1H8ZA 2WGVA 3O86A 5GHZA 4OLDA 2XDMA 3VSLA 2J7VA 4R3BA 3UNWA 4X53A 3LO7A 4PPRA 1ZKJA 4E3IA 4E3MA 2J9PA 3C7UA 4WZ5A 3FWLA 3PBNA 2EXAA 3GMWA 4DE3A 2ZQCA 5HL1A 3BFDA 4NETA 4DDSA 3G31A 3IHAA 5G18A 5I94A 2JCHA 5HAIA 2ZC3B 2Y2QA 4WEKA 2EFUA 2Y4AA 1ESUA 3O3VA 2ZMAA 3WS2A 4M3KA 3UN7A 4PM7A 3PAGA 1TVFA 1YLPA 3HVFA 3N7WA 4S2KA 5FI2A 4DE2A 1K55A 1PI4A 3W4OA 1W8YA 4OQ0A 1GA0A 4JKTA 4JLFA 3IXGA 1PWCA 4UA7A 1K56D 1KDSA 5FI6A 2XFTA 3SH7A 2ZC7A 3VOYA 4DE0A 3OCNA 1BZAA 4CPKA 4YFMA 3UPOA 4Y0UA 2DCFA 2H10A 5TFQA 3VP1A 1SCWA 4KG6A 4LENA 3MXSA 5EOEA 1JTGA 2P9VB 3IF6C 5FQIA 2ZC4B 3VFFA 1ERMA 2X02A 4FH2A 3W4PA 4CJNA 3BECA 4X69A 5FI7A 1GCEA 3BLSA 1FCOA 2Q9MA 3MKEA 3ZVWA 3C4PA 3PBRA 1BT5A 2ZM2A 3FKVA 3OZHA 2HP6A 5GL9A 1FR6A 1I2SA 4E3JA 1GHPA 3FYZA 2HDUA 5CTNA 2P9VA 1HVBA 3DW0A 4P87A 1KE0A 2XR0A 2WKEA 4EUZA 3A3DA 2ZQ8A 1MWUA 3A3IA 3BFGA 4C3QA 5F1FA 4ZJ3A 4KZ8A 5GLAA 1IYSA 1K56A 5HFOA 2Y59A 3QNBA 3ZNTA 3W4QA 5KMWA 3NIAA 5EVIC 3LCEA 1KGGA 3N8RA 5EECA 1FR1A 4R0QA 1L0EA 3VMAA 3GRJA 3UDFA 2XEPA 3HBRA 2VGJA 4E3LA 1GHIA 3AGEA 5D3OA 3IF6B 4QB8A 5HARA 4IBXA 3E2KA 3MZFA 4X68A 5GLDA 4EBLA 2ZD8A 3Q7VB 1FSWA 3Q1FA 4IVKA 5CEDA 1JTDA 2XH9A 5FAQA 1DJBA 4JXWA 1N9BA 2BLSA 5EOOA 3TSGA 2HP9A 4KZ3A 1DY6A 4BD1A 3I7JA 3IF6A 3BFCA 4JXSA 4MBHA 4HESA 3ZCZA 4YINA 3S4XA 3UE1A 1K6SA 4RVAA 3ZDJA 1YLYA 4PM8A 3Q7VA 3EQUA 1NRFA 5E43A 5HAPA 1ZC2A 1HZOA 3IXHA 1S0WA 3A3FA 3HLFA 2Y91A 5EVIB 4GN2A 2V2FF 1ES4A 3IH8A 1KGEA 2JE5A 2ZQAA 3Q82A 4OPRA 4WZ4A 4GOGA 2H0TA 4PM5A 4BL3A 1W5DA 1HTZA 2Y2OA 1IYOA 4DXBA 4EBPA 4XXRA 1BTLA 1RGZA 2C6WB 2EX9A 3CG5A 4OQHA 5EE8A 5EVIA 3V39A 5A90A 4C75A 1ONGA 4OQGA 1K57C 1N4OA 2A3UA 5FA7A 4ZBEA 1IEMA 1NZOA 4BENA 5CHJA 4N1HA 2RCXA 1L0GA 3QNCA 3TG9A 1SHVA 3MZDA 4OPQA 1PW1A 1BLPA 2XQZA 1YM1A 4S2NC 4UHUA 4OH0A 3ZHHA 1XA7A 3NBLA 4HBUA 3BFEA 2Z2LB 3V3RA 2CC1A 4WYYA 3N4IA 1IELA 5AQBA 3M2KA 1LLBA 4JBFA 1FOFA 1ES5A 2XF3A 1DJAA 1HD8A 1OMEA 1XXMA 3NI9A 3P09A 2ZC5B 4QY6A 1YQSA 5E2FA 4S2OA 2XK1A 2JBFA 1LHYA 1KDWA 4U3TA 2RL3A 3AGFA 2WKHA 5JYOA 3UPNA 1YLWA 5DF7A 3LY3A 5FQ9A 5A92A 2EX8A 1C3BA 1PZOA 1K4EA 2OSUA 5CEBA 3FV7A 5F1GA 4KQRA 2XFSA 3UO9A 1ZG6A 4F94A 5KSHA 4GKUA 3ITAA 3ZNYA 3O87A 3NDEA 3VP3A 3WRZA 2ZM8A 2R9XA 1PWDA 2XGNA 1ALQA 4PM9A 1AXBA 3OPLA 3IF5A 5DVAA 1K57A 4K0WA 5DTTA 2HP5A 1BLCA 2WKIA 2WZZA 3P98A 4QD4A 3RJUA 3N8LA 3MXRA 1YT4A 4EQIA 4ID4A 4EWFA 1LL9A 1Q2QA 4S2NA 1L0DA 4R3JA 1ES2A 4JXVA 2WADA 4X6TA 4X55A 2Y2KA 3Q07A 1EWZA 4UA9A 1WYCA 4NK3A 4OQIA 1YLTA 1Y54A 2E8IA 1I5QA 1H5XA 1NJ4A 1IYQA 3G2YA 1VM1A 2GDNA 1G68A 1J9MA 4WBGA 3BYDA 4LCMA 3UDXA 2WGWB 4ZJ2A 5TR7A 3VFHA 4DF6A 1RGYA 4KZ5A 1WE4A 4B4XA 4MNRA 4LV1A 2OLVA 3HLEA 4GD8A 1FQGA 1EI5A 1QMEA 4U0TA 2EFXA 4WELA 3ZVTA 3N8SA 3NCKA 2WGWA 1YLZA 4FH4A 3RXWA 2QZ6A 3UY6A 4XUZA 5IHVA 2WUQA 2QPNA 4GB7A 2ZC6B 2Y2HA 5DTSA 2B5RA 3IHBA 4OLGA 2IWBA 5U47A 1IKGA 4ZTKA 3MFDA 1M40A 4RX3A 2WZXA 4KZBA 3HUOA 3IWOA 3FZCA 3NDGA 2H0YA 4E3NA 4DKIA 4EV4A 1JWVA 3HL9A 5E2EA 2VGKA 2OLUA 3VP4A 3W8KA 2Y55A 4N9KA 1K4FA 3IT9A 4R4SA 3OC2A 1KGFA 1PWGA 3SOIA 2QMIA 1I2WA 3ITBA 4K0XA 3DWZA 1ESIA 1XKZA 5FAPA 3V5MA 3GQZA 3G4PA 4IEDA 1JVJA 5HAQA 1BULA 2FFYA 1MPLA 3HLWA 3WS4A 3DTMA 2G2WA 1KE4A 4UAAA 3VSKA 1SKFA 1K25A 5A91A 2PU2A 5DTKA 5KSCA 1S6RA 4WEJA 1PIOA 3ZG8B 1DJCA 1W8QA 1IYPA 2Y2NA 4JF5A 4DDYA 4OOYA 5FQMA 4B88A 1PW8A 2Z2MB 4R23A 3WWXA 4FSFA 4XUXA 1TEMA 1ONHA 4KQQA 3FKWA 2EXBA 1YMSA 4OONA 5AQ9A 4GZBA 5FQQA 3UDIA 5A93A 4PM6A 1K38A 4S2PA 3CZDA 2OV5A 3SH9A 3WS0A 4DE1A 5FQJA 1Z6FA 1U60A 1BSGA 4DXCA 3HUNA 4Y7PA 3PAEA 3SS4A 3MZEA 4OVDA 3ZG5A 3HLGA 4JF6A 5GLCA 5AQ7A 4PMAA 4N92A 3IXDA 3M2JA 3N6IA 4KQOA 1PZPA 3HLBA 2V20A 5M18A 1E25A 4GNUA 2HDRA 5FAOA 1M6KA 2Y2LA 4IBRA 1PYYA 5BOHA 1RCJA 4HBTA 4S2IA 4KG5A 5CRFA 1NYYA 2ZQ9A 3B3XA 2HDQA 2UWXA 3GR2A 4S2MA 4BJPA 5F82A 3LY4A 5L2FA 3G35A 2XD5A 3BEBA 1JWPA 2EX6A 3GVBA 3M6HA 2G2UA 4Y0OA 1K55C 4E6XA 5EVLA 4BQMA 2HDSA 4OOMA 4RA7A 1L0FA 1MKIA 4Z9QA 4A5RA 3WS5A 4LV0A 3UE3A 3SS5A 3A3JA 5FATA 5GHXA 1EROA 4BLMA 4N9LA 4ZAMA 4E3OA 2P74A 4QHCA 4RYEA 1YLJA 4P85A 3SS3A 4WMCD 1LI9A 3ZG7B 2BG1A 4LCLA 4S2JA 4MEZA 5CHMA 3C5AA 3HUMA 4HEFA 1NY0A 2WYXA 1FSYA 1PI5A 4OOLA 4ZDXA 5J8XA 3VOZA 3CJMA 1Q2PA 3E2LA 1E3UD 2XD1A 3QHYA 1CI8A 2H5SA 3IWIA 4K91A 5E2GA 1QMFA 5CGWA 1CK3A 3G30A 4OKPA 2A49A 2ZQDA 2J8YA 1XGIA 3BLMA 1BLHA 2WGIA 1JWZA 1G6AA 2PBYA 3BM6A 4MLLA 4FCFA 1H8YA 1E4DA 3ZG9B 1BLSA 5JYPA 3OPHA 4BD0A 5CGXA 3RXXA 3CMZA 4JXGA 4OPZA 4WMCA 1NXYA 3O88A 2C5WB 1MWSA 2Y2MA 5DF9A 1NZUA 2WAFA 4D2OA 5F83A 4S2LA 5FQKA 2J9OA 3V50A 1O7EA 3BRMA 1E3UA 3PBQA 5M1AA 5CTMA 4WM9A 5FDHA 5AQAA 1KVMA 1ZG4A 4Y0TA 4DRTA 1IKIA 1BUEA 2JC7A 5CGSA 2ZJ9A 3GTCA 1FCMA 2WK0A 3HLDA 3IQAA 1LI0A 3WS1A 2DRWA 3ISGA 5DF8A 5HW3A 3C7VA 2ZLYA 4KZ6A 3TOIA 3V3SA 4P0MA 4KZ4A 1MWTA 1WYBA 4GDBA 2HPBA 3D4FA 1XP4A 5FSRA 4QU3A 5CECA 2EX2A 1W7FA 2FFFB 5CXWA 5KZHA 2X71A 4E3KA 4LV2A
chains in the Genus database with same CATH superfamily
2HF6A 1CQAA 4KENB 1YMXA 3LGOA 4Y3IA 5HL6A 1F5MA 1ERQA 4KG2A 1XA1A 2MJ6A 3UE0A 5CHUA 1K54C 3MBZA 1MKMA 3G2ZA 4EEPA 1VQQA 1RP5A 4JPMA 1GHMA 3VP0A 3G34A 3MKFA 5GLBA 3GV9A 5CERA 5TJJA 4UEYA 4H8RA 3M6BA 4O01A 3LR5A 3VP2A 3IWQA 1YSQA 2V1ZA 3ZFZA 2PU4A 4P6BA 4IJGA 3UPPA 1CI9A 4MBKA 4R4RA 4R1GA 3T4SA 2HZ5A 2PAVP 4HIAA 1H8ZA 2WGVA 5GHZA 2J7VA 3UNWA 5KIZA 4PPRA 3T4OA 5HL1A 3BFDA 2ACGA 3C8CA 1Y28A 3LFVA 3O3VA 2ZMAA 3WS2A 1TVFA 1YLPA 3N7WA 4X25A 1PI4A 4UA7A 3IXGA 1PWCA 3LI9A 2XFTA 4X1LA 3SH7A 2ZC7A 3VOYA 3UPOA 4Y0UA 2H10A 5FQIA 4KUOA 4NXBA 1FCOA 4EEUA 3C4PA 3DAVA 3PBRA 4HP9A 3DTIA 2HDUA 3DW0A 4MDZA 1ZTUA 4ZJ3A 3E0YA 4KZ8A 5GLAA 4EQ1A 1K56A 2Y59A 3GECA 3NIAA 4HY8A 5EVIC 2VZWA 2KX6A 3VMAA 3UDFA 4E3LA 1GHIA 3E2KA 4EBLA 4NXEA 5CEDA 1FIKA 5FAQA 4JXWA 2V0UA 4JGPA 4YINA 3S4XA 4RVAA 4PM8A 1NRFA 1P0ZA 1S0WA 3A3FA 2ZQAA 4OPRA 2H0TA 2ZL1B 1HTZA 2J80A 4QWOA 4L9EA 3CG5A 4OQHA 3V39A 4C75A 2ZL1A 1L0GA 3MZDA 4OPQA 2QHKA 4HBUA 3F1NB 3NBLA 1L3LA 2H28A 3V3RA 2PR6A 2V1BA 4BMWA 4Y17A 1OMEA 5L07A 4WN5A 4S2OA 4U3TA 1LHYA 2RL3A 2W27A 3AGFA 3F1NA 4LRZE 3LEQA 3UB9A 5FQ9A 3R7WB 2EX8A 3P01A 4GHIB 1PZOA 5CEBA 2OSUA 5C5KA 5KSHA 3ITAA 2PT7A 3NDEA 3VP3A 2ZM8A 2R9XA 1PWDA 2FZ0A 3R7WA 5DTTA 4GLQA 4K0WA 2WZZA 2WKIA 3RJUA 1XJ2A 1LL9A 3LYXA 1OT9A 1W63Q 4UA9A 4NK3A 4LPZA 4YWZA 1YLTA 1Y54A 1IYQA 4GW9A 1D1JA 2WKPA 3BYDA 4LCMA 3UDXA 2WGWB 2D02A 4M4XA 3VFHA 4KQDA 4LFUA 4MNRA 4LV1A 2OLVA 1TD5A 3JVUA 3H7WB 2WGWA 3NCKA 1YLZA 1DP6A 3UY6A 2WUQA 2QPNA 2ZC6B 2IWBA 1V9ZA 1IKGA 5L8MA 3H7WA 3HUOA 3MS6A 1XJ4A 2CMNA 3IWOA 2Y79A 3HL9A 2VGKA 3UB6A 1XJ3A 1PWGA 3SOIA 3ITBA 2J3TC 2K7SA 5FAPA 1NLZA 3MXQA 4IEDA 1JVJA 1K0KA 2FFYA 3PXPA 2LB5A 2Z6DA 5DTKA 4WEJA 3ZG8B 2XRNA 4UQIS 1DJCA 1DRMA 2O9AA 4DDYA 2AVXA 3FG8A 4XUXA 1TEMA 3FKWA 4OONA 1K38A 2OV5A 4HOIA 1OTEA 1Z6FA 4Y7PA 3PAEA 4Y13A 3EOIA 3HLBA 1TF1A 2L1MA 3O5YA 2NUPC 2Y2LA 4IBRA 3T4JA 3CPTB 4S2IA 2ZQ9A 3RTYA 5F82A 2EWVA 3GVBA 3CPTA 4E6XA 4IUHA 4OOMA 4RA7A 4A5RA 3UE3A 2W3HA 1EROA 4ZAMA 4QHCA 2PRFA 2BTFP 5EM0A 3HUMA 4ZDXA 3MF0A 3MMHA 4R3AA 1QMFA 4HP4A 5CGWA 1CK3A 3JPUA 2ZQDA 2VGLS 3IX4A 3G6OA 2Q0OA 1JWZA 2V9AA 3BM6A 5CGXA 4JXGA 4O8GA 4NXGA 2C5WB 1MWSA 2Y2MA 4Y2FA 3KYZA 3V50A 1E3UA 3MFXA 3PBQA 5CTMA 5AQAA 4DRTA 1BUEA 2W1TB 4MN7A 3BQAA 1FCMA 3HLDA 3ISGA 5DF8A 5L09A 4KZ4A 1MWTA 1WYBA 3D4FA 3FPWA 4NG2A 1XP4A 2W1TA 4ETXA 5CECA 5CXWA 5KZHA 4E3KA 5BOHA 4X56A 1OT6A 3FC7A 4ME4A 2X01A 3S1YA 1J3WA 2M1CA 3KX0X 5EVID 1L2SA 1S4RA 4OP5A 4MN5A 2ZMVA 2W0NA 3WRTA 1W79A 3LEZA 3PR6A 3R4KA 2Y2PA 4KZAA 4WZ5C 2PR5A 1XPBA 5TGFA 1KE3A 1S67L 4FD8A 3A3EA 3HREA 4NKPA 5EPHA 2JKFA 1MBLA 1MY8A 3OPRA 5F5YA 1XX2A 4QJGA 4U0XA 4DJ2A 1CEFA 1ES3A 4UA6A 4OPYA 1XGJA 1GSVA 1O07A 4B93A 5F69A 5MC7A 4KUKA 3AGDA 1VETB 3ZG0A 1TDGA 4MBFA 5HWVA 4LGWA 3ZGAB 1UWPX 1K54A 4E6WA 4NEED 3BQ8A 1VETA 3ULFA 4P6ZS 4OLDA 4LRYC 4R3BA 5HZHA 3C7UA 3BJNA 5LBRA 2EXAA 3GMWA 2ZQCA 2Y8HA 4NETA 4DDSA 3IHAA 5G18A 3H9WA 5I94A 2JCHA 2EFUA 1ESUA 3UN7A 4D60A 3PAGA 2FH5A 1K55A 1W8YA 2VV7A 1K56D 1OTIA 5FDSA 3IS2B 5G4YA 3E4OA 5EOEA 3IF6C 2ZC4B 3VFFA 2X02A 4FH2A 4X69A 2Q9MA 3S7OA 3IS2A 1BT5A 3DTEA 2O99A 2HP6A 3EGXC 5GL9A 1FR6A 2JKTM 5CTNA 5J7EA 4HI4A 1KE0A 2WKEA 5EVEA 3A3DA 4PKYG 3BFGA 5F1FA 3ZNTA 5HFOA 2M7UA 2JKRI 3N8RA 1FR1A 2VK3A 1TS0A 2VGJA 3AGEA 4Y5FA 4IBXA 3NOUC 5GLDA 5CX7A 3Q7VB 1FSWA 3KSIA 4DMZA 1JTDA 2XH9A 3UB7A 1DJBA 3TSGA 3I7JA 4JXSA 3Q7VA 5HDSA 1ZC2A 5IT5A 3QP1A 4P6ZM 3IXHA 5EVIB 1ES4A 4FUWA 3NECA 4XT2B 3OLOA 4PM5A 3S7NA 2QYBA 5HWWA 1IYOA 4EBPA 4XXRA 1BTLA 1RGZA 2EX9A 5A90A 5EVIA 3SW1A 3D72A 4Z1WA 1ONGA 2PYPA 4OQGA 1K57C 5FA7A 4BENA 5CHJA 4N1HA 2RCXA 4S2NC 4EESA 3ZHHA 3L9KA 1XA7A 3BFEA 3N4IA 1IELA 5AQBA 1N9LA 1LLBA 1NRJA 1FOFA 1ES5A 2W3DA 2YKFA 2ZC5B 4I5SA 1KDWA 3UPNA 2OOLA 1P9WA 3S7QA 3FV7A 4KQRA 2XFSA 3UO9A 4G3WA 1ZG6A 3DBAA 3ZNYA 3TE8A 2XGNA 1AXBA 3OPLA 1JNUA 4ID4A 1Y4OA 1ES2A 2EA9A 3Q07A 4JGRA 1WYCA 4OQIA 2E8IA 1OTBA 1NJ4A 3P7NA 5F6AA 1VM1A 1G68A 1J9MA 2BASA 3VE4A 3TJZC 2A24B 4DF6A 1P9RA 3QP2A 1RGYA 4KZ5A 1WE4A 4JGQA 4U0TA 2EFXA 4XUZA 2A24A 5IHVA 4BBUA 2K2NA 4GB7A 2Y2HA 5DTSA 1AWIA 3B33A 4ZTKA 5I5LA 4DKIA 2EWWA 2Y55A 4N9KA 1YKDA 2QMIA 4K0XA 1ESIA 4HJ3A 4R6LA 3D9YA 3ZYTA 3VOLA 3HLWA 1GSWA 5TBMB 5A91A 2PU2A 1S6RA 5K5BA 1IYPA 1HLUP 2XROA 2ZOIA 4EU0A 5TBMA 1YMSA 5FQQA 4GZBA 3UDIA 3WS0A 2HV1A 3SH9A 3K2NA 5FQJA 2OAQ1 4OVDA 3HLGA 4JF6A 5GLCA 2JKGA 3N6IA 1G28A 1E25A 5FAOA 1M6KA 3CAXA 1PYYA 4K08A 1RCJA 5CRFA 3B3XA 4F3LB 2UWXA 4BJPA 5L2FA 3G35A 3BEBA 4Q0JA 4ZRRA 1S1ZA 4F3LA 5EVLA 1PFLA 3T12B 3WS5A 2P7JA 4LV0A 1IFQA 5GHXA 4N9LA 5DFYA 2P74A 3LIAA 5DJUA 2R78A 1YLJA 4GHIA 1LI9A 5HDDA 4MEZA 5CHMA 1BYWA 5J8XA 4OOLA 3VOZA 3QP8A 3CJMA 3VV4A 1E3UD 2H5SA 5E2GA 5HPFA 3IX8A 3MQQA 4AFIA 3E98A 4QPRA 5JYPA 3NHQA 4BD0A 4ESPA 3LIBA 4WMCA 4RQ9A 1NZUA 4LRXC 4D2OA 5FQKA 1O7EA 3BRMA 2VJWA 4Y0TA 3V67A 1W63M 3BY8A 2ZJ9A 1LSXA 4CLCC 3EGDC 1LI0A 2DRWA 2L4RA 5HW3A 2ZLYA 1T18A 3BY9A 3V3SA 4I3JA 2W3EA 2HPBA 1WA9A 5FSRA 4QU3A 2X71A 2PD7A 3NY4A 1GA9A 3PBOA 4BL2A 1VB6A 2KLIA 2V0WA 4ETZA 4GDNA 3IH9A 3PBSA 1H8MA 3UB8A 5F68A 4I3IA 3NC8A 2WAEA 3PTEA 2YKHA 3PBTA 3U2AA 3NOTC 2WKQA 3KSHA 5M19A 4GD6A 3C4OA 2ZM0A 3SH8A 3LIFA 3GSGA 2K31A 1TDLA 4RX2A 4JF4A 3EQVA 1D7EA 3G32A 1KOUA 2XLNA 2Y2JA 2W1RA 1CEGA 4LV3A 2VLGA 3HLCA 4OP8A 1OJ5A 4NXFA 5J4EA 1FCNA 2VV6A 2E8JA 3Q81A 2P04A 3CHWP 5GHYA 2ZOHA 2B95A 2HJ9C 4PAUA 1Z09A 4C6YA 1LL5A 3JYIA 3O86A 3VSLA 3TRCA 4X53A 1ZKJA 1YSPA 2J9PA 2PBDP 2DMWA 4WZ5A 4YOFA 5EM1A 3FWLA 4DE3A 2XSSA 2GNXA 3EWKA 1YPRA 4BBVA 3OBFA 5HAIA 5HDCA 4M3KA 1X0OA 4ARZB 4S2KA 4DE2A 4WF0A 3W4OA 4OQ0A 1GA0A 4JLFA 4CQHA 1KDSA 2D01A 4UQIM 3OCNA 1BZAA 4CPKA 1VEUB 5TFQA 1SCWA 4R70A 3MXSA 1JTGA 1UWNX 1ERMA 3W4PA 3BECA 3KSGA 2W3GA 3ZVWA 2ZM2A 2M7VA 1VEUA 1ACFA 3FKVA 1I2SA 3FYZA 3HJKA 2XR0A 4EUZA 3KYEA 1S1YA 2ZQ8A 1F9IA 1MWUA 3A3IA 1IYSA 5KMWA 3QNBA 3W4QA 3LICA 3NJAA 3LCEA 1KGGA 5EECA 1L0EA 3GRJA 2XEPA 5D3OA 3IF6B 4QB8A 5HARA 1NLYA 3MZFA 2OWHA 2ZD8A 3Q1FA 4IVKA 1N9BA 2BLSA 3T50A 4KZ3A 1DY6A 3IF6A 3LIEA 3BFCA 4R38A 4MBHA 3ZCZA 3T4QA 3ZDJA 1K6SA 3EQUA 4EERA 2Y91A 1KGEA 2JE5A 4GOGA 4BL3A 3MJQA 4DXBA 1T1BA 1OTDA 4HH3A 3RFBA 2VGLM 1N4OA 1NZOA 3TG9A 3QNCA 5AVFA 2XQZA 1YM1A 4OH0A 5DKKA 4WYYA 3M2KA 4JBFA 1ZHHB 2XF3A 1XXMA 3B47A 3MSHA 5L10A 2XK1A 2JBFA 1XFQA 4GCZA 3BWLA 3LY3A 5A92A 4Y15A 1C3BA 1K4EA 2G7UA 2VEAA 5F1GA 4EXOA 4B9OA 1OPXA 3MR0A 4GKUA 1ALQA 3FPVA 4PM9A 4E04A 3IF5A 1K57A 2HP5A 3P98A 4WL9A 3MXRA 3SZTA 1Q2QA 4S2NA 4HQAA 3S7PA 4X6TA 2WADA 2Y2KA 3CUEC 1EWZA 4FOFA 1H5XA 4EUVA 3G2YA 3A0VA 4ZJ2A 2QJ5A 4B4XA 3F1PB 4WELA 3ZVTA 3N8SA 4FH4A 5AVEA 3IHBA 3F1PA 3MFDA 1M40A 4RX3A 2WZXA 4YNRA 1CF0A 3NDGA 2H0YA 4E3NA 4EV4A 3W8KA 3VP4A 3LR0A 1K4FA 1CJFA 1I2WA 3LR3A 2L0WA 1XKZA 3VE3A 4I38A 3GQZA 2B18A 3G4PA 1BULA 1MPLA 3WS4A 2OAP1 3BW6A 1UGUA 1KE4A 1SKFA 4BWIA 2J3TD 4FTXA 1PIOA 1W8QA 3IBRA 4OOYA 5FQMA 2Z2MB 4FSFA 1ONHA 4KQQA 5AQ9A 1G6OA 4S2PA 3CZDA 3ICYA 4DE1A 1A0KA 4HJ6A 4EW7A 3HUNA 5A8BA 3ZG5A 4XT2A 5AQ7A 4PMAA 4N92A 3IXDA 3M2JA 1N9NA 1S66L 4GNUA 2HDRA 2IA2A 4KG5A 3GR2A 4S2MA 2HDQA 2UV0E 3LY4A 2XD5A 4HNBA 2EX6A 3QP4A 2B02A 2G2UA 2W3FA 3D3OA 4Y0OA 1K55C 3KYQA 4I3AA 4Z9QA 1L0FA 3SS5A 4I39A 4BLMA 4E3OA 2JN7A 1TS7A 4P85A 3LIDA 3SS3A 4WMCD 3ZG7B 5J3WA 2BG1A 2ZBBA 4LCLA 2QWSA 4S2JA 1NY0A 3E2LA 1Q2PA 3QHYA 5HPIA 2A49A 3BLMA 2WGIA 2PD8A 4MLLA 4FCFA 1H8YA 3OPHA 3RXXA 3CMZA 4OPZA 4PKYA 5DF9A 2WAFA 2J9OA 1T19A 5M1AA 3TW8A 4WM9A 1KVMA 3K3CA 4X1MA 3GTCA 3PHYA 2JKTI 3WS1A 2O9CA 3C7VA 3TOIA 1XFNA 4P0MA 4GDBA 3KO6A 4G3KA 3IBJA 1PNEA 4KZ9A 1KVLA 3CITA 1MWRA 4DN0A 3C30A 4Q8IA 1DP8A 2Y2GA 1SDNA 2ZQ7A 5EUAA 2R9WA 2I72A 4CLCB 3A0SA 1NYMA 2ZMFA 4KZ7A 3OCLA 3DWKA 3S22A 2NUTC 1PRQA 2VV8A 4ZJ1A 3IXBA 4CLCA 2DNSA 2IWDA 3DTKA 4B4ZA 1MXOA 2Q9NA 1K6RA 3B42A 3BFFA 1DP9A 5FASA 1S4SA 3OPPA 3Q7ZA 3L7HA 4QY5A 2I9VA 4IVIA 4N1XA 4L0LA 2IWCA 4EBNA 3U4LP 4O7DA 1SDEA 3UE6A 5E2HA 1IOUA 2Y2IA 2V8FA 5HX9A 5FEGA 4II7A 4GJ4A 3CWFA 1D06A 2XDMA 3LO7A 5EV0A 4E3IA 4E3MA 3PBNA 4HJ4A 3UB5P 4PHTA 5DFXA 3G31A 2ZC3B 2Y2QA 4WEKA 2Y4AA 4PM7A 3HVFA 5FI2A 4JKTA 5FI6A 4DE0A 4YFMA 2DCFA 5DKLA 3VP1A 4KG6A 4LENA 3GDIA 2P9VB 2GZAA 4CJNA 5FI7A 1GCEA 3BLSA 3MKEA 1H3QA 3OZHA 4E3JA 1GHPA 5FEFA 2P9VA 1HVBA 3T1XA 4P87A 4C3QA 2VKSA 1MZUA 2OWJA 4IUKA 3E4PA 5HSQA 2VA0A 4R0QA 3HBRA 3W2ZA 4X68A 1STZA 2QJ7A 5EOOA 2HP9A 4BD1A 3QP6A 4HESA 1GSXA 3C2WA 3UE1A 1YLYA 4WLAA 1OTAA 5E43A 5HAPA 4JGOA 2VX8A 1HZOA 3HLFA 4GN2A 2V2FF 3IH8A 3Q82A 4WZ4A 2JHEA 1XJ6A 1W5DA 4EETB 2Y2OA 3T4LA 2C6WB 5EE8A 3HCYA 3PYPA 2A3UA 4ZBEA 1IEMA 2HJEA 2PDRA 1ODVA 1SHVA 1PW1A 1BLPA 4UHUA 1FILA 2Z2LB 2CC1A 3LI8A 5FL3A 1DJAA 1HD8A 3NI9A 3P09A 4QY6A 1YQSA 5E2FA 3LUQA 2WKHA 5JYOA 1YLWA 1MC0A 2PHYA 5DF7A 4H6JB 1F2KA 3H82B 1P97A 3IX3A 4F94A 3K3DA 3O87A 3WRZA 2XA7S 4H6JA 2KOIA 5DVAA 3H82A 1BLCA 4QD4A 3N8LA 1YT4A 4EQIA 2A2LA 3KSFA 4EWFA 1L0DA 4R3JA 4JXVA 5HD5A 4X55A 1SZVA 1G5UA 5IU1A 4ARZA 1I5QA 3OOVA 2GDNA 4WBGA 4G3VA 5TR7A 3T1RA 3T4KA 4HH2A 1LL8A 3UMDA 3HLEA 4GD8A 1FQGA 1EI5A 1QMEA 4Q0HA 4WUJA 2O9BA 3RXWA 2QZ6A 3T1SA 2LB9A 3MQ0A 2B5RA 3NULA 4OLGA 5U47A 4KZBA 2QKPA 2JKRM 5HD3A 5EFWA 4BBTA 3FZCA 1JWVA 3E4QA 5E2EA 2OLUA 3NOPC 3IT9A 2V8CA 1OJGA 4R4SA 3OC2A 2Z6CA 1KGFA 3CUEA 4L9GA 3DWZA 4IHQA 3V5MA 3ZQ5A 4Q0IA 3JVVA 5HAQA 3DTMA 2G2WA 3VSKA 4UAAA 1K25A 1TS8A 5KSCA 3LR4A 2Y2NA 2O0YA 4JF5A 5HWTA 4B88A 1PW8A 4R23A 3WWXA 3C38A 1T1AA 2EXBA 5A93A 4PM6A 1U60A 1BSGA 4DXCA 3SS4A 3MZEA 2XA7M 3A0RA 4KQOA 1PZPA 4MCWA 2V20A 5M18A 4L9FA 4HBTA 1NYYA 3MQOA 2P08A 4MN6A 3RH8B 1SKOB 2PYRA 1JWPA 5DJTA 3M6HA 4HHDA 4BQMA 4CLCE 1T1CA 2HDSA 1MKIA 1SKOA 2V1AA 3A3JA 5FATA 4RYEA 2HGVA 2GJ3A 2KDKA 1TS6A 1LT0A 1VHMA 3C5AA 4HEFA 2WYXA 1FSYA 1PI5A 4GS9B 3QP5A 3CLOA 2XD1A 1CI8A 3IWIA 4K91A 4O0PA 1H0MA 3G30A 4OKPA 3F1OB 4DJ3A 2INWA 2J8YA 1XGIA 1V9YA 1BLHA 3T4TA 4GS9A 1G6AA 2PBYA 1NWZA 1N9OA 1E4DA 3ZG9B 1BLSA 3EEAA 3F1OA 1LSWA 1LSVA 3CI6A 1NXYA 4MMNA 3O88A 2J3WA 2WKRA 3HJIA 5F83A 4S2LA 5G4ZA 5FDHA 1ZG4A 1IKIA 2JC7A 5CGSA 4LLOB 2WK0A 3IQAA 1F98A 2GX5A 4KZ6A 1EW0A 3EEHA 5AJGA 3T1QB 1YAXA 4CLCD 2EX2A 1W7FA 2FFFB 3UMEA 5IS1A 4LV2A
chains in the Genus database with same CATH topology
4KZ9A 4X56A 4KENB 1KVLA 1YMXA 3NY4A 1GA9A 3PBOA 4BL2A 1MWRA 4Q8IA 4GDNA 3IH9A 3PBSA 2Y2GA 1SDNA 2ZQ7A 5EUAA 2R9WA 3NC8A 2X01A 2I72A 3S1YA 1ERQA 5EVID 4KG2A 1NYMA 4KZ7A 1XA1A 2WAEA 3OCLA 3PTEA 1L2SA 3UE0A 5CHUA 3DWKA 3S22A 3PBTA 4OP5A 1K54C 4ZJ1A 3MBZA 3IXBA 3G2ZA 5M19A 4GD6A 3C4OA 2DNSA 2IWDA 2ZM0A 3WRTA 4B4ZA 1MXOA 1W79A 3LEZA 2Y2PA 2Q9NA 1K6RA 3SH8A 1VQQA 1RP5A 3BFFA 4JPMA 3GSGA 5FASA 1GHMA 4KZAA 4WZ5C 1TDLA 4RX2A 3OPPA 3VP0A 3Q7ZA 1XPBA 5TGFA 4QY5A 1KE3A 4FD8A 3G34A 3A3EA 3EQVA 4JF4A 4IVIA 3G32A 3HREA 4N1XA 5EPHA 3MKFA 4L0LA 1MBLA 1MY8A 3OPRA 4QJGA 1XX2A 2XLNA 2Y2JA 4U0XA 2IWCA 5GLBA 4EBNA 1CEGA 4LV3A 3GV9A 5CERA 3HLCA 4O7DA 1SDEA 1CEFA 1ES3A 4OP8A 4UA6A 4H8RA 3M6BA 4OPYA 1XGJA 3VP2A 3IWQA 1O07A 5E2HA 2V1ZA 3ZFZA 2PU4A 1FCNA 3AGDA 2Y2IA 4P6BA 3UPPA 3Q81A 5HX9A 3ZG0A 1CI9A 1TDGA 4MBKA 4MBFA 5GHYA 3ZGAB 4R4RA 4R1GA 1K54A 4E6WA 4C6YA 1LL5A 3JYIA 1H8ZA 2WGVA 3O86A 5GHZA 4OLDA 2XDMA 3VSLA 2J7VA 4R3BA 3UNWA 4X53A 3LO7A 4PPRA 1ZKJA 4E3IA 4E3MA 2J9PA 3C7UA 4WZ5A 3FWLA 3PBNA 2EXAA 3GMWA 4DE3A 2ZQCA 5HL1A 3BFDA 4NETA 4DDSA 3G31A 3IHAA 5G18A 5I94A 2JCHA 5HAIA 2ZC3B 2Y2QA 4WEKA 2EFUA 2Y4AA 1ESUA 3O3VA 2ZMAA 3WS2A 4M3KA 3UN7A 4PM7A 3PAGA 1TVFA 1YLPA 3HVFA 3N7WA 4S2KA 5FI2A 4DE2A 1K55A 1PI4A 3W4OA 1W8YA 4OQ0A 1GA0A 4JKTA 4JLFA 3IXGA 1PWCA 4UA7A 1K56D 1KDSA 5FI6A 2XFTA 3SH7A 2ZC7A 3VOYA 4DE0A 3OCNA 1BZAA 4CPKA 4YFMA 3UPOA 4Y0UA 2DCFA 2H10A 5TFQA 3VP1A 1SCWA 4KG6A 4LENA 3MXSA 5EOEA 1JTGA 2P9VB 3IF6C 5FQIA 2ZC4B 3VFFA 1ERMA 2X02A 4FH2A 3W4PA 4CJNA 3BECA 4X69A 5FI7A 1GCEA 3BLSA 1FCOA 2Q9MA 3MKEA 3ZVWA 3C4PA 3PBRA 1BT5A 2ZM2A 3FKVA 3OZHA 2HP6A 5GL9A 1FR6A 1I2SA 4E3JA 1GHPA 3FYZA 2HDUA 5CTNA 2P9VA 1HVBA 3DW0A 4P87A 1KE0A 2XR0A 2WKEA 4EUZA 3A3DA 2ZQ8A 1MWUA 3A3IA 3BFGA 4C3QA 5F1FA 4ZJ3A 4KZ8A 5GLAA 1IYSA 1K56A 5HFOA 2Y59A 3QNBA 3ZNTA 3W4QA 5KMWA 3NIAA 5EVIC 3LCEA 1KGGA 3N8RA 5EECA 1FR1A 4R0QA 1L0EA 3VMAA 3GRJA 3UDFA 2XEPA 3HBRA 2VGJA 4E3LA 1GHIA 3AGEA 5D3OA 3IF6B 4QB8A 5HARA 4IBXA 3E2KA 3MZFA 4X68A 5GLDA 4EBLA 2ZD8A 3Q7VB 1FSWA 3Q1FA 4IVKA 5CEDA 1JTDA 2XH9A 5FAQA 1DJBA 4JXWA 1N9BA 2BLSA 5EOOA 3TSGA 2HP9A 4KZ3A 1DY6A 4BD1A 3I7JA 3IF6A 3BFCA 4JXSA 4MBHA 4HESA 3ZCZA 4YINA 3S4XA 3UE1A 1K6SA 4RVAA 3ZDJA 1YLYA 4PM8A 3Q7VA 3EQUA 1NRFA 5E43A 5HAPA 1ZC2A 1HZOA 3IXHA 1S0WA 3A3FA 3HLFA 2Y91A 5EVIB 4GN2A 2V2FF 1ES4A 3IH8A 1KGEA 2JE5A 2ZQAA 3Q82A 4OPRA 4WZ4A 4GOGA 2H0TA 4PM5A 4BL3A 1W5DA 1HTZA 2Y2OA 1IYOA 4DXBA 4EBPA 4XXRA 1BTLA 1RGZA 2C6WB 2EX9A 3CG5A 4OQHA 5EE8A 5EVIA 3V39A 5A90A 4C75A 1ONGA 4OQGA 1K57C 1N4OA 2A3UA 5FA7A 4ZBEA 1IEMA 1NZOA 4BENA 5CHJA 4N1HA 2RCXA 1L0GA 3QNCA 3TG9A 1SHVA 3MZDA 4OPQA 1PW1A 1BLPA 2XQZA 1YM1A 4S2NC 4UHUA 4OH0A 3ZHHA 1XA7A 3NBLA 4HBUA 3BFEA 2Z2LB 3V3RA 2CC1A 4WYYA 3N4IA 1IELA 5AQBA 3M2KA 1LLBA 4JBFA 1FOFA 1ES5A 2XF3A 1DJAA 1HD8A 1OMEA 1XXMA 3NI9A 3P09A 2ZC5B 4QY6A 1YQSA 5E2FA 4S2OA 2XK1A 2JBFA 1LHYA 1KDWA 4U3TA 2RL3A 3AGFA 2WKHA 5JYOA 3UPNA 1YLWA 5DF7A 3LY3A 5FQ9A 5A92A 2EX8A 1C3BA 1PZOA 1K4EA 2OSUA 5CEBA 3FV7A 5F1GA 4KQRA 2XFSA 3UO9A 1ZG6A 4F94A 5KSHA 4GKUA 3ITAA 3ZNYA 3O87A 3NDEA 3VP3A 3WRZA 2ZM8A 2R9XA 1PWDA 2XGNA 1ALQA 4PM9A 1AXBA 3OPLA 3IF5A 5DVAA 1K57A 4K0WA 5DTTA 2HP5A 1BLCA 2WKIA 2WZZA 3P98A 4QD4A 3RJUA 3N8LA 3MXRA 1YT4A 4EQIA 4ID4A 4EWFA 1LL9A 1Q2QA 4S2NA 1L0DA 4R3JA 1ES2A 4JXVA 2WADA 4X6TA 4X55A 2Y2KA 3Q07A 1EWZA 4UA9A 1WYCA 4NK3A 4OQIA 1YLTA 1Y54A 2E8IA 1I5QA 1H5XA 1NJ4A 1IYQA 3G2YA 1VM1A 2GDNA 1G68A 1J9MA 4WBGA 3BYDA 4LCMA 3UDXA 2WGWB 4ZJ2A 5TR7A 3VFHA 4DF6A 1RGYA 4KZ5A 1WE4A 4B4XA 4MNRA 4LV1A 2OLVA 3HLEA 4GD8A 1FQGA 1EI5A 1QMEA 4U0TA 2EFXA 4WELA 3ZVTA 3N8SA 3NCKA 2WGWA 1YLZA 4FH4A 3RXWA 2QZ6A 3UY6A 4XUZA 5IHVA 2WUQA 2QPNA 4GB7A 2ZC6B 2Y2HA 5DTSA 2B5RA 3IHBA 4OLGA 2IWBA 5U47A 1IKGA 4ZTKA 3MFDA 1M40A 4RX3A 2WZXA 4KZBA 3HUOA 3IWOA 3FZCA 3NDGA 2H0YA 4E3NA 4DKIA 4EV4A 1JWVA 3HL9A 5E2EA 2VGKA 2OLUA 3VP4A 3W8KA 2Y55A 4N9KA 1K4FA 3IT9A 4R4SA 3OC2A 1KGFA 1PWGA 3SOIA 2QMIA 1I2WA 3ITBA 4K0XA 3DWZA 1ESIA 1XKZA 5FAPA 3V5MA 3GQZA 3G4PA 4IEDA 1JVJA 5HAQA 1BULA 2FFYA 1MPLA 3HLWA 3WS4A 3DTMA 2G2WA 1KE4A 4UAAA 3VSKA 1SKFA 1K25A 5A91A 2PU2A 5DTKA 5KSCA 1S6RA 4WEJA 1PIOA 3ZG8B 1DJCA 1W8QA 1IYPA 2Y2NA 4JF5A 4DDYA 4OOYA 5FQMA 4B88A 1PW8A 2Z2MB 4R23A 3WWXA 4FSFA 4XUXA 1TEMA 1ONHA 4KQQA 3FKWA 2EXBA 1YMSA 4OONA 5AQ9A 4GZBA 5FQQA 3UDIA 5A93A 4PM6A 1K38A 4S2PA 3CZDA 2OV5A 3SH9A 3WS0A 4DE1A 5FQJA 1Z6FA 1U60A 1BSGA 4DXCA 3HUNA 4Y7PA 3PAEA 3SS4A 3MZEA 4OVDA 3ZG5A 3HLGA 4JF6A 5GLCA 5AQ7A 4PMAA 4N92A 3IXDA 3M2JA 3N6IA 4KQOA 1PZPA 3HLBA 2V20A 5M18A 1E25A 4GNUA 2HDRA 5FAOA 1M6KA 2Y2LA 4IBRA 1PYYA 5BOHA 1RCJA 4HBTA 4S2IA 4KG5A 5CRFA 1NYYA 2ZQ9A 3B3XA 2HDQA 2UWXA 3GR2A 4S2MA 4BJPA 5F82A 3LY4A 5L2FA 3G35A 2XD5A 3BEBA 1JWPA 2EX6A 3GVBA 3M6HA 2G2UA 4Y0OA 1K55C 4E6XA 5EVLA 4BQMA 2HDSA 4OOMA 4RA7A 1L0FA 1MKIA 4Z9QA 4A5RA 3WS5A 4LV0A 3UE3A 3SS5A 3A3JA 5FATA 5GHXA 1EROA 4BLMA 4N9LA 4ZAMA 4E3OA 2P74A 4QHCA 4RYEA 1YLJA 4P85A 3SS3A 4WMCD 1LI9A 3ZG7B 2BG1A 4LCLA 4S2JA 4MEZA 5CHMA 3C5AA 3HUMA 4HEFA 1NY0A 2WYXA 1FSYA 1PI5A 4OOLA 4ZDXA 5J8XA 3VOZA 3CJMA 1Q2PA 3E2LA 1E3UD 2XD1A 3QHYA 1CI8A 2H5SA 3IWIA 4K91A 5E2GA 1QMFA 5CGWA 1CK3A 3G30A 4OKPA 2A49A 2ZQDA 2J8YA 1XGIA 3BLMA 1BLHA 2WGIA 1JWZA 1G6AA 2PBYA 3BM6A 4MLLA 4FCFA 1H8YA 1E4DA 3ZG9B 1BLSA 5JYPA 3OPHA 4BD0A 5CGXA 3RXXA 3CMZA 4JXGA 4OPZA 4WMCA 1NXYA 3O88A 2C5WB 1MWSA 2Y2MA 5DF9A 1NZUA 2WAFA 4D2OA 5F83A 4S2LA 5FQKA 2J9OA 3V50A 1O7EA 3BRMA 1E3UA 3PBQA 5M1AA 5CTMA 4WM9A 5FDHA 5AQAA 1KVMA 1ZG4A 4Y0TA 4DRTA 1IKIA 1BUEA 2JC7A 5CGSA 2ZJ9A 3GTCA 1FCMA 2WK0A 3HLDA 3IQAA 1LI0A 3WS1A 2DRWA 3ISGA 5DF8A 5HW3A 3C7VA 2ZLYA 4KZ6A 3TOIA 3V3SA 4P0MA 4KZ4A 1MWTA 1WYBA 4GDBA 2HPBA 3D4FA 1XP4A 5FSRA 4QU3A 5CECA 2EX2A 1W7FA 2FFFB 5CXWA 5KZHA 2X71A 4E3KA 4LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ9 A;  4X56 A;  4KEN B;  1KVL A;  1YMX A;  3NY4 A;  1GA9 A;  3PBO A;  4BL2 A;  1MWR A;  4Q8I A;  4GDN A;  3IH9 A;  3PBS A;  2Y2G A;  1SDN A;  2ZQ7 A;  5EUA A;  2R9W A;  3NC8 A;  2X01 A;  2I72 A;  3S1Y A;  1ERQ A;  5EVI D;  4KG2 A;  1NYM A;  4KZ7 A;  1XA1 A;  2WAE A;  3OCL A;  3PTE A;  1L2S A;  3UE0 A;  5CHU A;  3DWK A;  3S22 A;  3PBT A;  4OP5 A;  1K54 C;  4ZJ1 A;  3MBZ A;  3IXB A;  3G2Z A;  5M19 A;  4GD6 A;  3C4O A;  2DNS A;  2IWD A;  2ZM0 A;  3WRT A;  4B4Z A;  1MXO A;  1W79 A;  3LEZ A;  2Y2P A;  2Q9N A;  1K6R A;  3SH8 A;  1VQQ A;  1RP5 A;  3BFF A;  4JPM A;  3GSG A;  5FAS A;  1GHM A;  4KZA A;  4WZ5 C;  1TDL A;  4RX2 A;  3OPP A;  3VP0 A;  3Q7Z A;  1XPB A;  5TGF A;  4QY5 A;  1KE3 A;  4FD8 A;  3G34 A;  3A3E A;  3EQV A;  4JF4 A;  4IVI A;  3G32 A;  3HRE A;  4N1X A;  5EPH A;  3MKF A;  4L0L A;  1MBL A;  1MY8 A;  3OPR A;  4QJG A;  1XX2 A;  2XLN A;  2Y2J A;  4U0X A;  2IWC A;  5GLB A;  4EBN A;  1CEG A;  4LV3 A;  3GV9 A;  5CER A;  3HLC A;  4O7D A;  1SDE A;  1CEF A;  1ES3 A;  4OP8 A;  4UA6 A;  4H8R A;  3M6B A;  4OPY A;  1XGJ A;  3VP2 A;  3IWQ A;  1O07 A;  5E2H A;  2V1Z A;  3ZFZ A;  2PU4 A;  1FCN A;  3AGD A;  2Y2I A;  4P6B A;  3UPP A;  3Q81 A;  5HX9 A;  3ZG0 A;  1CI9 A;  1TDG A;  4MBK A;  4MBF A;  5GHY A;  3ZGA B;  4R4R A;  4R1G A;  1K54 A;  4E6W A;  4C6Y A;  1LL5 A;  3JYI A;  1H8Z A;  2WGV A;  3O86 A;  5GHZ A;  4OLD A;  2XDM A;  3VSL A;  2J7V A;  4R3B A;  3UNW A;  4X53 A;  3LO7 A;  4PPR A;  1ZKJ A;  4E3I A;  4E3M A;  2J9P A;  3C7U A;  4WZ5 A;  3FWL A;  3PBN A;  2EXA A;  3GMW A;  4DE3 A;  2ZQC A;  5HL1 A;  3BFD A;  4NET A;  4DDS A;  3G31 A;  3IHA A;  5G18 A;  5I94 A;  2JCH A;  5HAI A;  2ZC3 B;  2Y2Q A;  4WEK A;  2EFU A;  2Y4A A;  1ESU A;  3O3V A;  2ZMA A;  3WS2 A;  4M3K A;  3UN7 A;  4PM7 A;  3PAG A;  1TVF A;  1YLP A;  3HVF A;  3N7W A;  4S2K A;  5FI2 A;  4DE2 A;  1K55 A;  1PI4 A;  3W4O A;  1W8Y A;  4OQ0 A;  1GA0 A;  4JKT A;  4JLF A;  3IXG A;  1PWC A;  4UA7 A;  1K56 D;  1KDS A;  5FI6 A;  2XFT A;  3SH7 A;  2ZC7 A;  3VOY A;  4DE0 A;  3OCN A;  1BZA A;  4CPK A;  4YFM A;  3UPO A;  4Y0U A;  2DCF A;  2H10 A;  5TFQ A;  3VP1 A;  1SCW A;  4KG6 A;  4LEN A;  3MXS A;  5EOE A;  1JTG A;  2P9V B;  3IF6 C;  5FQI A;  2ZC4 B;  3VFF A;  1ERM A;  2X02 A;  4FH2 A;  3W4P A;  4CJN A;  3BEC A;  4X69 A;  5FI7 A;  1GCE A;  3BLS A;  1FCO A;  2Q9M A;  3MKE A;  3ZVW A;  3C4P A;  3PBR A;  1BT5 A;  2ZM2 A;  3FKV A;  3OZH A;  2HP6 A;  5GL9 A;  1FR6 A;  1I2S A;  4E3J A;  1GHP A;  3FYZ A;  2HDU A;  5CTN A;  2P9V A;  1HVB A;  3DW0 A;  4P87 A;  1KE0 A;  2XR0 A;  2WKE A;  4EUZ A;  3A3D A;  2ZQ8 A;  1MWU A;  3A3I A;  3BFG A;  4C3Q A;  5F1F A;  4ZJ3 A;  4KZ8 A;  5GLA A;  1IYS A;  1K56 A;  5HFO A;  2Y59 A;  3QNB A;  3ZNT A;  3W4Q A;  5KMW A;  3NIA A;  5EVI C;  3LCE A;  1KGG A;  3N8R A;  5EEC A;  1FR1 A;  4R0Q A;  1L0E A;  3VMA A;  3GRJ A;  3UDF A;  2XEP A;  3HBR A;  2VGJ A;  4E3L A;  1GHI A;  3AGE A;  5D3O A;  3IF6 B;  4QB8 A;  5HAR A;  4IBX A;  3E2K A;  3MZF A;  4X68 A;  5GLD A;  4EBL A;  2ZD8 A;  3Q7V B;  1FSW A;  3Q1F A;  4IVK A;  5CED A;  1JTD A;  2XH9 A;  5FAQ A;  1DJB A;  4JXW A;  1N9B A;  2BLS A;  5EOO A;  3TSG A;  2HP9 A;  4KZ3 A;  1DY6 A;  4BD1 A;  3I7J A;  3IF6 A;  3BFC A;  4JXS A;  4MBH A;  4HES A;  3ZCZ A;  4YIN A;  3S4X A;  3UE1 A;  1K6S A;  4RVA A;  3ZDJ A;  1YLY A;  4PM8 A;  3Q7V A;  3EQU A;  1NRF A;  5E43 A;  5HAP A;  1ZC2 A;  1HZO A;  3IXH A;  1S0W A;  3A3F A;  3HLF A;  2Y91 A;  5EVI B;  4GN2 A;  2V2F F;  1ES4 A;  3IH8 A;  1KGE A;  2JE5 A;  2ZQA A;  3Q82 A;  4OPR A;  4WZ4 A;  4GOG A;  2H0T A;  4PM5 A;  4BL3 A;  1W5D A;  1HTZ A;  2Y2O A;  1IYO A;  4DXB A;  4EBP A;  4XXR A;  1BTL A;  1RGZ A;  2C6W B;  2EX9 A;  3CG5 A;  4OQH A;  5EE8 A;  5EVI A;  3V39 A;  5A90 A;  4C75 A;  1ONG A;  4OQG A;  1K57 C;  1N4O A;  2A3U A;  5FA7 A;  4ZBE A;  1IEM A;  1NZO A;  4BEN A;  5CHJ A;  4N1H A;  2RCX A;  1L0G A;  3QNC A;  3TG9 A;  1SHV A;  3MZD A;  4OPQ A;  1PW1 A;  1BLP A;  2XQZ A;  1YM1 A;  4S2N C;  4UHU A;  4OH0 A;  3ZHH A;  1XA7 A;  3NBL A;  4HBU A;  3BFE A;  2Z2L B;  3V3R A;  2CC1 A;  4WYY A;  3N4I A;  1IEL A;  5AQB A;  3M2K A;  1LLB A;  4JBF A;  1FOF A;  1ES5 A;  2XF3 A;  1DJA A;  1HD8 A;  1OME A;  1XXM A;  3NI9 A;  3P09 A;  2ZC5 B;  4QY6 A;  1YQS A;  5E2F A;  4S2O A;  2XK1 A;  2JBF A;  1LHY A;  1KDW A;  4U3T A;  2RL3 A;  3AGF A;  2WKH A;  5JYO A;  3UPN A;  1YLW A;  5DF7 A;  3LY3 A;  5FQ9 A;  5A92 A;  2EX8 A;  1C3B A;  1PZO A;  1K4E A;  2OSU A;  5CEB A;  3FV7 A;  5F1G A;  4KQR A;  2XFS A;  3UO9 A;  1ZG6 A;  4F94 A;  5KSH A;  4GKU A;  3ITA A;  3ZNY A;  3O87 A;  3NDE A;  3VP3 A;  3WRZ A;  2ZM8 A;  2R9X A;  1PWD A;  2XGN A;  1ALQ A;  4PM9 A;  1AXB A;  3OPL A;  3IF5 A;  5DVA A;  1K57 A;  4K0W A;  5DTT A;  2HP5 A;  1BLC A;  2WKI A;  2WZZ A;  3P98 A;  4QD4 A;  3RJU A;  3N8L A;  3MXR A;  1YT4 A;  4EQI A;  4ID4 A;  4EWF A;  1LL9 A;  1Q2Q A;  4S2N A;  1L0D A;  4R3J A;  1ES2 A;  4JXV A;  2WAD A;  4X6T A;  4X55 A;  2Y2K A;  3Q07 A;  1EWZ A;  4UA9 A;  1WYC A;  4NK3 A;  4OQI A;  1YLT A;  1Y54 A;  2E8I A;  1I5Q A;  1H5X A;  1NJ4 A;  1IYQ A;  3G2Y A;  1VM1 A;  2GDN A;  1G68 A;  1J9M A;  4WBG A;  3BYD A;  4LCM A;  3UDX A;  2WGW B;  4ZJ2 A;  5TR7 A;  3VFH A;  4DF6 A;  1RGY A;  4KZ5 A;  1WE4 A;  4B4X A;  4MNR A;  4LV1 A;  2OLV A;  3HLE A;  4GD8 A;  1FQG A;  1EI5 A;  1QME A;  4U0T A;  2EFX A;  4WEL A;  3ZVT A;  3N8S A;  3NCK A;  2WGW A;  1YLZ A;  4FH4 A;  3RXW A;  2QZ6 A;  3UY6 A;  4XUZ A;  5IHV A;  2WUQ A;  2QPN A;  4GB7 A;  2ZC6 B;  2Y2H A;  5DTS A;  2B5R A;  3IHB A;  4OLG A;  2IWB A;  5U47 A;  1IKG A;  4ZTK A;  3MFD A;  1M40 A;  4RX3 A;  2WZX A;  4KZB A;  3HUO A;  3IWO A;  3FZC A;  3NDG A;  2H0Y A;  4E3N A;  4DKI A;  4EV4 A;  1JWV A;  3HL9 A;  5E2E A;  2VGK A;  2OLU A;  3VP4 A;  3W8K A;  2Y55 A;  4N9K A;  1K4F A;  3IT9 A;  4R4S A;  3OC2 A;  1KGF A;  1PWG A;  3SOI A;  2QMI A;  1I2W A;  3ITB A;  4K0X A;  3DWZ A;  1ESI A;  1XKZ A;  5FAP A;  3V5M A;  3GQZ A;  3G4P A;  4IED A;  1JVJ A;  5HAQ A;  1BUL A;  2FFY A;  1MPL A;  3HLW A;  3WS4 A;  3DTM A;  2G2W A;  1KE4 A;  4UAA A;  3VSK A;  1SKF A;  1K25 A;  5A91 A;  2PU2 A;  5DTK A;  5KSC A;  1S6R A;  4WEJ A;  1PIO A;  3ZG8 B;  1DJC A;  1W8Q A;  1IYP A;  2Y2N A;  4JF5 A;  4DDY A;  4OOY A;  5FQM A;  4B88 A;  1PW8 A;  2Z2M B;  4R23 A;  3WWX A;  4FSF A;  4XUX A;  1TEM A;  1ONH A;  4KQQ A;  3FKW A;  2EXB A;  1YMS A;  4OON A;  5AQ9 A;  4GZB A;  5FQQ A;  3UDI A;  5A93 A;  4PM6 A;  1K38 A;  4S2P A;  3CZD A;  2OV5 A;  3SH9 A;  3WS0 A;  4DE1 A;  5FQJ A;  1Z6F A;  1U60 A;  1BSG A;  4DXC A;  3HUN A;  4Y7P A;  3PAE A;  3SS4 A;  3MZE A;  4OVD A;  3ZG5 A;  3HLG A;  4JF6 A;  5GLC A;  5AQ7 A;  4PMA A;  4N92 A;  3IXD A;  3M2J A;  3N6I A;  4KQO A;  1PZP A;  3HLB A;  2V20 A;  5M18 A;  1E25 A;  4GNU A;  2HDR A;  5FAO A;  1M6K A;  2Y2L A;  4IBR A;  1PYY A;  5BOH A;  1RCJ A;  4HBT A;  4S2I A;  4KG5 A;  5CRF A;  1NYY A;  2ZQ9 A;  3B3X A;  2HDQ A;  2UWX A;  3GR2 A;  4S2M A;  4BJP A;  5F82 A;  3LY4 A;  5L2F A;  3G35 A;  2XD5 A;  3BEB A;  1JWP A;  2EX6 A;  3GVB A;  3M6H A;  2G2U A;  4Y0O A;  1K55 C;  4E6X A;  5EVL A;  4BQM A;  2HDS A;  4OOM A;  4RA7 A;  1L0F A;  1MKI A;  4Z9Q A;  4A5R A;  3WS5 A;  4LV0 A;  3UE3 A;  3SS5 A;  3A3J A;  5FAT A;  5GHX A;  1ERO A;  4BLM A;  4N9L A;  4ZAM A;  4E3O A;  2P74 A;  4QHC A;  4RYE A;  1YLJ A;  4P85 A;  3SS3 A;  4WMC D;  1LI9 A;  3ZG7 B;  2BG1 A;  4LCL A;  4S2J A;  4MEZ A;  5CHM A;  3C5A A;  3HUM A;  4HEF A;  1NY0 A;  2WYX A;  1FSY A;  1PI5 A;  4OOL A;  4ZDX A;  5J8X A;  3VOZ A;  3CJM A;  1Q2P A;  3E2L A;  1E3U D;  2XD1 A;  3QHY A;  1CI8 A;  2H5S A;  3IWI A;  4K91 A;  5E2G A;  1QMF A;  5CGW A;  1CK3 A;  3G30 A;  4OKP A;  2A49 A;  2ZQD A;  2J8Y A;  1XGI A;  3BLM A;  1BLH A;  2WGI A;  1JWZ A;  1G6A A;  2PBY A;  3BM6 A;  4MLL A;  4FCF A;  1H8Y A;  1E4D A;  3ZG9 B;  1BLS A;  5JYP A;  3OPH A;  4BD0 A;  5CGX A;  3RXX A;  3CMZ A;  4JXG A;  4OPZ A;  4WMC A;  1NXY A;  3O88 A;  2C5W B;  1MWS A;  2Y2M A;  5DF9 A;  1NZU A;  2WAF A;  4D2O A;  5F83 A;  4S2L A;  5FQK A;  2J9O A;  3V50 A;  1O7E A;  3BRM A;  1E3U A;  3PBQ A;  5M1A A;  5CTM A;  4WM9 A;  5FDH A;  5AQA A;  1KVM A;  1ZG4 A;  4Y0T A;  4DRT A;  1IKI A;  1BUE A;  2JC7 A;  5CGS A;  2ZJ9 A;  3GTC A;  1FCM A;  2WK0 A;  3HLD A;  3IQA A;  1LI0 A;  3WS1 A;  2DRW A;  3ISG A;  5DF8 A;  5HW3 A;  3C7V A;  2ZLY A;  4KZ6 A;  3TOI A;  3V3S A;  4P0M A;  4KZ4 A;  1MWT A;  1WYB A;  4GDB A;  2HPB A;  3D4F A;  1XP4 A;  5FSR A;  4QU3 A;  5CEC A;  2EX2 A;  1W7F A;  2FFF B;  5CXW A;  5KZH A;  2X71 A;  4E3K A;  4LV2 A; 
#chains in the Genus database with same CATH topology
 2HF6 A;  1CQA A;  4KEN B;  1YMX A;  3LGO A;  4Y3I A;  5HL6 A;  1F5M A;  1ERQ A;  4KG2 A;  1XA1 A;  2MJ6 A;  3UE0 A;  5CHU A;  1K54 C;  3MBZ A;  1MKM A;  3G2Z A;  4EEP A;  1VQQ A;  1RP5 A;  4JPM A;  1GHM A;  3VP0 A;  3G34 A;  3MKF A;  5GLB A;  3GV9 A;  5CER A;  5TJJ A;  4UEY A;  4H8R A;  3M6B A;  4O01 A;  3LR5 A;  3VP2 A;  3IWQ A;  1YSQ A;  2V1Z A;  3ZFZ A;  2PU4 A;  4P6B A;  4IJG A;  3UPP A;  1CI9 A;  4MBK A;  4R4R A;  4R1G A;  3T4S A;  2HZ5 A;  2PAV P;  4HIA A;  1H8Z A;  2WGV A;  5GHZ A;  2J7V A;  3UNW A;  5KIZ A;  4PPR A;  3T4O A;  5HL1 A;  3BFD A;  2ACG A;  3C8C A;  1Y28 A;  3LFV A;  3O3V A;  2ZMA A;  3WS2 A;  1TVF A;  1YLP A;  3N7W A;  4X25 A;  1PI4 A;  4UA7 A;  3IXG A;  1PWC A;  3LI9 A;  2XFT A;  4X1L A;  3SH7 A;  2ZC7 A;  3VOY A;  3UPO A;  4Y0U A;  2H10 A;  5FQI A;  4KUO A;  4NXB A;  1FCO A;  4EEU A;  3C4P A;  3DAV A;  3PBR A;  4HP9 A;  3DTI A;  2HDU A;  3DW0 A;  4MDZ A;  1ZTU A;  4ZJ3 A;  3E0Y A;  4KZ8 A;  5GLA A;  4EQ1 A;  1K56 A;  2Y59 A;  3GEC A;  3NIA A;  4HY8 A;  5EVI C;  2VZW A;  2KX6 A;  3VMA A;  3UDF A;  4E3L A;  1GHI A;  3E2K A;  4EBL A;  4NXE A;  5CED A;  1FIK A;  5FAQ A;  4JXW A;  2V0U A;  4JGP A;  4YIN A;  3S4X A;  4RVA A;  4PM8 A;  1NRF A;  1P0Z A;  1S0W A;  3A3F A;  2ZQA A;  4OPR A;  2H0T A;  2ZL1 B;  1HTZ A;  2J80 A;  4QWO A;  4L9E A;  3CG5 A;  4OQH A;  3V39 A;  4C75 A;  2ZL1 A;  1L0G A;  3MZD A;  4OPQ A;  2QHK A;  4HBU A;  3F1N B;  3NBL A;  1L3L A;  2H28 A;  3V3R A;  2PR6 A;  2V1B A;  4BMW A;  4Y17 A;  1OME A;  5L07 A;  4WN5 A;  4S2O A;  4U3T A;  1LHY A;  2RL3 A;  2W27 A;  3AGF A;  3F1N A;  4LRZ E;  3LEQ A;  3UB9 A;  5FQ9 A;  3R7W B;  2EX8 A;  3P01 A;  4GHI B;  1PZO A;  5CEB A;  2OSU A;  5C5K A;  5KSH A;  3ITA A;  2PT7 A;  3NDE A;  3VP3 A;  2ZM8 A;  2R9X A;  1PWD A;  2FZ0 A;  3R7W A;  5DTT A;  4GLQ A;  4K0W A;  2WZZ A;  2WKI A;  3RJU A;  1XJ2 A;  1LL9 A;  3LYX A;  1OT9 A;  1W63 Q;  4UA9 A;  4NK3 A;  4LPZ A;  4YWZ A;  1YLT A;  1Y54 A;  1IYQ A;  4GW9 A;  1D1J A;  2WKP A;  3BYD A;  4LCM A;  3UDX A;  2WGW B;  2D02 A;  4M4X A;  3VFH A;  4KQD A;  4LFU A;  4MNR A;  4LV1 A;  2OLV A;  1TD5 A;  3JVU A;  3H7W B;  2WGW A;  3NCK A;  1YLZ A;  1DP6 A;  3UY6 A;  2WUQ A;  2QPN A;  2ZC6 B;  2IWB A;  1V9Z A;  1IKG A;  5L8M A;  3H7W A;  3HUO A;  3MS6 A;  1XJ4 A;  2CMN A;  3IWO A;  2Y79 A;  3HL9 A;  2VGK A;  3UB6 A;  1XJ3 A;  1PWG A;  3SOI A;  3ITB A;  2J3T C;  2K7S A;  5FAP A;  1NLZ A;  3MXQ A;  4IED A;  1JVJ A;  1K0K A;  2FFY A;  3PXP A;  2LB5 A;  2Z6D A;  5DTK A;  4WEJ A;  3ZG8 B;  2XRN A;  4UQI S;  1DJC A;  1DRM A;  2O9A A;  4DDY A;  2AVX A;  3FG8 A;  4XUX A;  1TEM A;  3FKW A;  4OON A;  1K38 A;  2OV5 A;  4HOI A;  1OTE A;  1Z6F A;  4Y7P A;  3PAE A;  4Y13 A;  3EOI A;  3HLB A;  1TF1 A;  2L1M A;  3O5Y A;  2NUP C;  2Y2L A;  4IBR A;  3T4J A;  3CPT B;  4S2I A;  2ZQ9 A;  3RTY A;  5F82 A;  2EWV A;  3GVB A;  3CPT A;  4E6X A;  4IUH A;  4OOM A;  4RA7 A;  4A5R A;  3UE3 A;  2W3H A;  1ERO A;  4ZAM A;  4QHC A;  2PRF A;  2BTF P;  5EM0 A;  3HUM A;  4ZDX A;  3MF0 A;  3MMH A;  4R3A A;  1QMF A;  4HP4 A;  5CGW A;  1CK3 A;  3JPU A;  2ZQD A;  2VGL S;  3IX4 A;  3G6O A;  2Q0O A;  1JWZ A;  2V9A A;  3BM6 A;  5CGX A;  4JXG A;  4O8G A;  4NXG A;  2C5W B;  1MWS A;  2Y2M A;  4Y2F A;  3KYZ A;  3V50 A;  1E3U A;  3MFX A;  3PBQ A;  5CTM A;  5AQA A;  4DRT A;  1BUE A;  2W1T B;  4MN7 A;  3BQA A;  1FCM A;  3HLD A;  3ISG A;  5DF8 A;  5L09 A;  4KZ4 A;  1MWT A;  1WYB A;  3D4F A;  3FPW A;  4NG2 A;  1XP4 A;  2W1T A;  4ETX A;  5CEC A;  5CXW A;  5KZH A;  4E3K A;  5BOH A;  4X56 A;  1OT6 A;  3FC7 A;  4ME4 A;  2X01 A;  3S1Y A;  1J3W A;  2M1C A;  3KX0 X;  5EVI D;  1L2S A;  1S4R A;  4OP5 A;  4MN5 A;  2ZMV A;  2W0N A;  3WRT A;  1W79 A;  3LEZ A;  3PR6 A;  3R4K A;  2Y2P A;  4KZA A;  4WZ5 C;  2PR5 A;  1XPB A;  5TGF A;  1KE3 A;  1S67 L;  4FD8 A;  3A3E A;  3HRE A;  4NKP A;  5EPH A;  2JKF A;  1MBL A;  1MY8 A;  3OPR A;  5F5Y A;  1XX2 A;  4QJG A;  4U0X A;  4DJ2 A;  1CEF A;  1ES3 A;  4UA6 A;  4OPY A;  1XGJ A;  1GSV A;  1O07 A;  4B93 A;  5F69 A;  5MC7 A;  4KUK A;  3AGD A;  1VET B;  3ZG0 A;  1TDG A;  4MBF A;  5HWV A;  4LGW A;  3ZGA B;  1UWP X;  1K54 A;  4E6W A;  4NEE D;  3BQ8 A;  1VET A;  3ULF A;  4P6Z S;  4OLD A;  4LRY C;  4R3B A;  5HZH A;  3C7U A;  3BJN A;  5LBR A;  2EXA A;  3GMW A;  2ZQC A;  2Y8H A;  4NET A;  4DDS A;  3IHA A;  5G18 A;  3H9W A;  5I94 A;  2JCH A;  2EFU A;  1ESU A;  3UN7 A;  4D60 A;  3PAG A;  2FH5 A;  1K55 A;  1W8Y A;  2VV7 A;  1K56 D;  1OTI A;  5FDS A;  3IS2 B;  5G4Y A;  3E4O A;  5EOE A;  3IF6 C;  2ZC4 B;  3VFF A;  2X02 A;  4FH2 A;  4X69 A;  2Q9M A;  3S7O A;  3IS2 A;  1BT5 A;  3DTE A;  2O99 A;  2HP6 A;  3EGX C;  5GL9 A;  1FR6 A;  2JKT M;  5CTN A;  5J7E A;  4HI4 A;  1KE0 A;  2WKE A;  5EVE A;  3A3D A;  4PKY G;  3BFG A;  5F1F A;  3ZNT A;  5HFO A;  2M7U A;  2JKR I;  3N8R A;  1FR1 A;  2VK3 A;  1TS0 A;  2VGJ A;  3AGE A;  4Y5F A;  4IBX A;  3NOU C;  5GLD A;  5CX7 A;  3Q7V B;  1FSW A;  3KSI A;  4DMZ A;  1JTD A;  2XH9 A;  3UB7 A;  1DJB A;  3TSG A;  3I7J A;  4JXS A;  3Q7V A;  5HDS A;  1ZC2 A;  5IT5 A;  3QP1 A;  4P6Z M;  3IXH A;  5EVI B;  1ES4 A;  4FUW A;  3NEC A;  4XT2 B;  3OLO A;  4PM5 A;  3S7N A;  2QYB A;  5HWW A;  1IYO A;  4EBP A;  4XXR A;  1BTL A;  1RGZ A;  2EX9 A;  5A90 A;  5EVI A;  3SW1 A;  3D72 A;  4Z1W A;  1ONG A;  2PYP A;  4OQG A;  1K57 C;  5FA7 A;  4BEN A;  5CHJ A;  4N1H A;  2RCX A;  4S2N C;  4EES A;  3ZHH A;  3L9K A;  1XA7 A;  3BFE A;  3N4I A;  1IEL A;  5AQB A;  1N9L A;  1LLB A;  1NRJ A;  1FOF A;  1ES5 A;  2W3D A;  2YKF A;  2ZC5 B;  4I5S A;  1KDW A;  3UPN A;  2OOL A;  1P9W A;  3S7Q A;  3FV7 A;  4KQR A;  2XFS A;  3UO9 A;  4G3W A;  1ZG6 A;  3DBA A;  3ZNY A;  3TE8 A;  2XGN A;  1AXB A;  3OPL A;  1JNU A;  4ID4 A;  1Y4O A;  1ES2 A;  2EA9 A;  3Q07 A;  4JGR A;  1WYC A;  4OQI A;  2E8I A;  1OTB A;  1NJ4 A;  3P7N A;  5F6A A;  1VM1 A;  1G68 A;  1J9M A;  2BAS A;  3VE4 A;  3TJZ C;  2A24 B;  4DF6 A;  1P9R A;  3QP2 A;  1RGY A;  4KZ5 A;  1WE4 A;  4JGQ A;  4U0T A;  2EFX A;  4XUZ A;  2A24 A;  5IHV A;  4BBU A;  2K2N A;  4GB7 A;  2Y2H A;  5DTS A;  1AWI A;  3B33 A;  4ZTK A;  5I5L A;  4DKI A;  2EWW A;  2Y55 A;  4N9K A;  1YKD A;  2QMI A;  4K0X A;  1ESI A;  4HJ3 A;  4R6L A;  3D9Y A;  3ZYT A;  3VOL A;  3HLW A;  1GSW A;  5TBM B;  5A91 A;  2PU2 A;  1S6R A;  5K5B A;  1IYP A;  1HLU P;  2XRO A;  2ZOI A;  4EU0 A;  5TBM A;  1YMS A;  5FQQ A;  4GZB A;  3UDI A;  3WS0 A;  2HV1 A;  3SH9 A;  3K2N A;  5FQJ A;  2OAQ 1;  4OVD A;  3HLG A;  4JF6 A;  5GLC A;  2JKG A;  3N6I A;  1G28 A;  1E25 A;  5FAO A;  1M6K A;  3CAX A;  1PYY A;  4K08 A;  1RCJ A;  5CRF A;  3B3X A;  4F3L B;  2UWX A;  4BJP A;  5L2F A;  3G35 A;  3BEB A;  4Q0J A;  4ZRR A;  1S1Z A;  4F3L A;  5EVL A;  1PFL A;  3T12 B;  3WS5 A;  2P7J A;  4LV0 A;  1IFQ A;  5GHX A;  4N9L A;  5DFY A;  2P74 A;  3LIA A;  5DJU A;  2R78 A;  1YLJ A;  4GHI A;  1LI9 A;  5HDD A;  4MEZ A;  5CHM A;  1BYW A;  5J8X A;  4OOL A;  3VOZ A;  3QP8 A;  3CJM A;  3VV4 A;  1E3U D;  2H5S A;  5E2G A;  5HPF A;  3IX8 A;  3MQQ A;  4AFI A;  3E98 A;  4QPR A;  5JYP A;  3NHQ A;  4BD0 A;  4ESP A;  3LIB A;  4WMC A;  4RQ9 A;  1NZU A;  4LRX C;  4D2O A;  5FQK A;  1O7E A;  3BRM A;  2VJW A;  4Y0T A;  3V67 A;  1W63 M;  3BY8 A;  2ZJ9 A;  1LSX A;  4CLC C;  3EGD C;  1LI0 A;  2DRW A;  2L4R A;  5HW3 A;  2ZLY A;  1T18 A;  3BY9 A;  3V3S A;  4I3J A;  2W3E A;  2HPB A;  1WA9 A;  5FSR A;  4QU3 A;  2X71 A;  2PD7 A;  3NY4 A;  1GA9 A;  3PBO A;  4BL2 A;  1VB6 A;  2KLI A;  2V0W A;  4ETZ A;  4GDN A;  3IH9 A;  3PBS A;  1H8M A;  3UB8 A;  5F68 A;  4I3I A;  3NC8 A;  2WAE A;  3PTE A;  2YKH A;  3PBT A;  3U2A A;  3NOT C;  2WKQ A;  3KSH A;  5M19 A;  4GD6 A;  3C4O A;  2ZM0 A;  3SH8 A;  3LIF A;  3GSG A;  2K31 A;  1TDL A;  4RX2 A;  4JF4 A;  3EQV A;  1D7E A;  3G32 A;  1KOU A;  2XLN A;  2Y2J A;  2W1R A;  1CEG A;  4LV3 A;  2VLG A;  3HLC A;  4OP8 A;  1OJ5 A;  4NXF A;  5J4E A;  1FCN A;  2VV6 A;  2E8J A;  3Q81 A;  2P04 A;  3CHW P;  5GHY A;  2ZOH A;  2B95 A;  2HJ9 C;  4PAU A;  1Z09 A;  4C6Y A;  1LL5 A;  3JYI A;  3O86 A;  3VSL A;  3TRC A;  4X53 A;  1ZKJ A;  1YSP A;  2J9P A;  2PBD P;  2DMW A;  4WZ5 A;  4YOF A;  5EM1 A;  3FWL A;  4DE3 A;  2XSS A;  2GNX A;  3EWK A;  1YPR A;  4BBV A;  3OBF A;  5HAI A;  5HDC A;  4M3K A;  1X0O A;  4ARZ B;  4S2K A;  4DE2 A;  4WF0 A;  3W4O A;  4OQ0 A;  1GA0 A;  4JLF A;  4CQH A;  1KDS A;  2D01 A;  4UQI M;  3OCN A;  1BZA A;  4CPK A;  1VEU B;  5TFQ A;  1SCW A;  4R70 A;  3MXS A;  1JTG A;  1UWN X;  1ERM A;  3W4P A;  3BEC A;  3KSG A;  2W3G A;  3ZVW A;  2ZM2 A;  2M7V A;  1VEU A;  1ACF A;  3FKV A;  1I2S A;  3FYZ A;  3HJK A;  2XR0 A;  4EUZ A;  3KYE A;  1S1Y A;  2ZQ8 A;  1F9I A;  1MWU A;  3A3I A;  1IYS A;  5KMW A;  3QNB A;  3W4Q A;  3LIC A;  3NJA A;  3LCE A;  1KGG A;  5EEC A;  1L0E A;  3GRJ A;  2XEP A;  5D3O A;  3IF6 B;  4QB8 A;  5HAR A;  1NLY A;  3MZF A;  2OWH A;  2ZD8 A;  3Q1F A;  4IVK A;  1N9B A;  2BLS A;  3T50 A;  4KZ3 A;  1DY6 A;  3IF6 A;  3LIE A;  3BFC A;  4R38 A;  4MBH A;  3ZCZ A;  3T4Q A;  3ZDJ A;  1K6S A;  3EQU A;  4EER A;  2Y91 A;  1KGE A;  2JE5 A;  4GOG A;  4BL3 A;  3MJQ A;  4DXB A;  1T1B A;  1OTD A;  4HH3 A;  3RFB A;  2VGL M;  1N4O A;  1NZO A;  3TG9 A;  3QNC A;  5AVF A;  2XQZ A;  1YM1 A;  4OH0 A;  5DKK A;  4WYY A;  3M2K A;  4JBF A;  1ZHH B;  2XF3 A;  1XXM A;  3B47 A;  3MSH A;  5L10 A;  2XK1 A;  2JBF A;  1XFQ A;  4GCZ A;  3BWL A;  3LY3 A;  5A92 A;  4Y15 A;  1C3B A;  1K4E A;  2G7U A;  2VEA A;  5F1G A;  4EXO A;  4B9O A;  1OPX A;  3MR0 A;  4GKU A;  1ALQ A;  3FPV A;  4PM9 A;  4E04 A;  3IF5 A;  1K57 A;  2HP5 A;  3P98 A;  4WL9 A;  3MXR A;  3SZT A;  1Q2Q A;  4S2N A;  4HQA A;  3S7P A;  4X6T A;  2WAD A;  2Y2K A;  3CUE C;  1EWZ A;  4FOF A;  1H5X A;  4EUV A;  3G2Y A;  3A0V A;  4ZJ2 A;  2QJ5 A;  4B4X A;  3F1P B;  4WEL A;  3ZVT A;  3N8S A;  4FH4 A;  5AVE A;  3IHB A;  3F1P A;  3MFD A;  1M40 A;  4RX3 A;  2WZX A;  4YNR A;  1CF0 A;  3NDG A;  2H0Y A;  4E3N A;  4EV4 A;  3W8K A;  3VP4 A;  3LR0 A;  1K4F A;  1CJF A;  1I2W A;  3LR3 A;  2L0W A;  1XKZ A;  3VE3 A;  4I38 A;  3GQZ A;  2B18 A;  3G4P A;  1BUL A;  1MPL A;  3WS4 A;  2OAP 1;  3BW6 A;  1UGU A;  1KE4 A;  1SKF A;  4BWI A;  2J3T D;  4FTX A;  1PIO A;  1W8Q A;  3IBR A;  4OOY A;  5FQM A;  2Z2M B;  4FSF A;  1ONH A;  4KQQ A;  5AQ9 A;  1G6O A;  4S2P A;  3CZD A;  3ICY A;  4DE1 A;  1A0K A;  4HJ6 A;  4EW7 A;  3HUN A;  5A8B A;  3ZG5 A;  4XT2 A;  5AQ7 A;  4PMA A;  4N92 A;  3IXD A;  3M2J A;  1N9N A;  1S66 L;  4GNU A;  2HDR A;  2IA2 A;  4KG5 A;  3GR2 A;  4S2M A;  2HDQ A;  2UV0 E;  3LY4 A;  2XD5 A;  4HNB A;  2EX6 A;  3QP4 A;  2B02 A;  2G2U A;  2W3F A;  3D3O A;  4Y0O A;  1K55 C;  3KYQ A;  4I3A A;  4Z9Q A;  1L0F A;  3SS5 A;  4I39 A;  4BLM A;  4E3O A;  2JN7 A;  1TS7 A;  4P85 A;  3LID A;  3SS3 A;  4WMC D;  3ZG7 B;  5J3W A;  2BG1 A;  2ZBB A;  4LCL A;  2QWS A;  4S2J A;  1NY0 A;  3E2L A;  1Q2P A;  3QHY A;  5HPI A;  2A49 A;  3BLM A;  2WGI A;  2PD8 A;  4MLL A;  4FCF A;  1H8Y A;  3OPH A;  3RXX A;  3CMZ A;  4OPZ A;  4PKY A;  5DF9 A;  2WAF A;  2J9O A;  1T19 A;  5M1A A;  3TW8 A;  4WM9 A;  1KVM A;  3K3C A;  4X1M A;  3GTC A;  3PHY A;  2JKT I;  3WS1 A;  2O9C A;  3C7V A;  3TOI A;  1XFN A;  4P0M A;  4GDB A;  3KO6 A;  4G3K A;  3IBJ A;  1PNE A;  4KZ9 A;  1KVL A;  3CIT A;  1MWR A;  4DN0 A;  3C30 A;  4Q8I A;  1DP8 A;  2Y2G A;  1SDN A;  2ZQ7 A;  5EUA A;  2R9W A;  2I72 A;  4CLC B;  3A0S A;  1NYM A;  2ZMF A;  4KZ7 A;  3OCL A;  3DWK A;  3S22 A;  2NUT C;  1PRQ A;  2VV8 A;  4ZJ1 A;  3IXB A;  4CLC A;  2DNS A;  2IWD A;  3DTK A;  4B4Z A;  1MXO A;  2Q9N A;  1K6R A;  3B42 A;  3BFF A;  1DP9 A;  5FAS A;  1S4S A;  3OPP A;  3Q7Z A;  3L7H A;  4QY5 A;  2I9V A;  4IVI A;  4N1X A;  4L0L A;  2IWC A;  4EBN A;  3U4L P;  4O7D A;  1SDE A;  3UE6 A;  5E2H A;  1IOU A;  2Y2I A;  2V8F A;  5HX9 A;  5FEG A;  4II7 A;  4GJ4 A;  3CWF A;  1D06 A;  2XDM A;  3LO7 A;  5EV0 A;  4E3I A;  4E3M A;  3PBN A;  4HJ4 A;  3UB5 P;  4PHT A;  5DFX A;  3G31 A;  2ZC3 B;  2Y2Q A;  4WEK A;  2Y4A A;  4PM7 A;  3HVF A;  5FI2 A;  4JKT A;  5FI6 A;  4DE0 A;  4YFM A;  2DCF A;  5DKL A;  3VP1 A;  4KG6 A;  4LEN A;  3GDI A;  2P9V B;  2GZA A;  4CJN A;  5FI7 A;  1GCE A;  3BLS A;  3MKE A;  1H3Q A;  3OZH A;  4E3J A;  1GHP A;  5FEF A;  2P9V A;  1HVB A;  3T1X A;  4P87 A;  4C3Q A;  2VKS A;  1MZU A;  2OWJ A;  4IUK A;  3E4P A;  5HSQ A;  2VA0 A;  4R0Q A;  3HBR A;  3W2Z A;  4X68 A;  1STZ A;  2QJ7 A;  5EOO A;  2HP9 A;  4BD1 A;  3QP6 A;  4HES A;  1GSX A;  3C2W A;  3UE1 A;  1YLY A;  4WLA A;  1OTA A;  5E43 A;  5HAP A;  4JGO A;  2VX8 A;  1HZO A;  3HLF A;  4GN2 A;  2V2F F;  3IH8 A;  3Q82 A;  4WZ4 A;  2JHE A;  1XJ6 A;  1W5D A;  4EET B;  2Y2O A;  3T4L A;  2C6W B;  5EE8 A;  3HCY A;  3PYP A;  2A3U A;  4ZBE A;  1IEM A;  2HJE A;  2PDR A;  1ODV A;  1SHV A;  1PW1 A;  1BLP A;  4UHU A;  1FIL A;  2Z2L B;  2CC1 A;  3LI8 A;  5FL3 A;  1DJA A;  1HD8 A;  3NI9 A;  3P09 A;  4QY6 A;  1YQS A;  5E2F A;  3LUQ A;  2WKH A;  5JYO A;  1YLW A;  1MC0 A;  2PHY A;  5DF7 A;  4H6J B;  1F2K A;  3H82 B;  1P97 A;  3IX3 A;  4F94 A;  3K3D A;  3O87 A;  3WRZ A;  2XA7 S;  4H6J A;  2KOI A;  5DVA A;  3H82 A;  1BLC A;  4QD4 A;  3N8L A;  1YT4 A;  4EQI A;  2A2L A;  3KSF A;  4EWF A;  1L0D A;  4R3J A;  4JXV A;  5HD5 A;  4X55 A;  1SZV A;  1G5U A;  5IU1 A;  4ARZ A;  1I5Q A;  3OOV A;  2GDN A;  4WBG A;  4G3V A;  5TR7 A;  3T1R A;  3T4K A;  4HH2 A;  1LL8 A;  3UMD A;  3HLE A;  4GD8 A;  1FQG A;  1EI5 A;  1QME A;  4Q0H A;  4WUJ A;  2O9B A;  3RXW A;  2QZ6 A;  3T1S A;  2LB9 A;  3MQ0 A;  2B5R A;  3NUL A;  4OLG A;  5U47 A;  4KZB A;  2QKP A;  2JKR M;  5HD3 A;  5EFW A;  4BBT A;  3FZC A;  1JWV A;  3E4Q A;  5E2E A;  2OLU A;  3NOP C;  3IT9 A;  2V8C A;  1OJG A;  4R4S A;  3OC2 A;  2Z6C A;  1KGF A;  3CUE A;  4L9G A;  3DWZ A;  4IHQ A;  3V5M A;  3ZQ5 A;  4Q0I A;  3JVV A;  5HAQ A;  3DTM A;  2G2W A;  3VSK A;  4UAA A;  1K25 A;  1TS8 A;  5KSC A;  3LR4 A;  2Y2N A;  2O0Y A;  4JF5 A;  5HWT A;  4B88 A;  1PW8 A;  4R23 A;  3WWX A;  3C38 A;  1T1A A;  2EXB A;  5A93 A;  4PM6 A;  1U60 A;  1BSG A;  4DXC A;  3SS4 A;  3MZE A;  2XA7 M;  3A0R A;  4KQO A;  1PZP A;  4MCW A;  2V20 A;  5M18 A;  4L9F A;  4HBT A;  1NYY A;  3MQO A;  2P08 A;  4MN6 A;  3RH8 B;  1SKO B;  2PYR A;  1JWP A;  5DJT A;  3M6H A;  4HHD A;  4BQM A;  4CLC E;  1T1C A;  2HDS A;  1MKI A;  1SKO A;  2V1A A;  3A3J A;  5FAT A;  4RYE A;  2HGV A;  2GJ3 A;  2KDK A;  1TS6 A;  1LT0 A;  1VHM A;  3C5A A;  4HEF A;  2WYX A;  1FSY A;  1PI5 A;  4GS9 B;  3QP5 A;  3CLO A;  2XD1 A;  1CI8 A;  3IWI A;  4K91 A;  4O0P A;  1H0M A;  3G30 A;  4OKP A;  3F1O B;  4DJ3 A;  2INW A;  2J8Y A;  1XGI A;  1V9Y A;  1BLH A;  3T4T A;  4GS9 A;  1G6A A;  2PBY A;  1NWZ A;  1N9O A;  1E4D A;  3ZG9 B;  1BLS A;  3EEA A;  3F1O A;  1LSW A;  1LSV A;  3CI6 A;  1NXY A;  4MMN A;  3O88 A;  2J3W A;  2WKR A;  3HJI A;  5F83 A;  4S2L A;  5G4Z A;  5FDH A;  1ZG4 A;  1IKI A;  2JC7 A;  5CGS A;  4LLO B;  2WK0 A;  3IQA A;  1F98 A;  2GX5 A;  4KZ6 A;  1EW0 A;  3EEH A;  5AJG A;  3T1Q B;  1YAX A;  4CLC D;  2EX2 A;  1W7F A;  2FFF B;  3UME A;  5IS1 A;  4LV2 A; 
#chains in the Genus database with same CATH homology
 4KZ9 A;  4X56 A;  4KEN B;  1KVL A;  1YMX A;  3NY4 A;  1GA9 A;  3PBO A;  4BL2 A;  1MWR A;  4Q8I A;  4GDN A;  3IH9 A;  3PBS A;  2Y2G A;  1SDN A;  2ZQ7 A;  5EUA A;  2R9W A;  3NC8 A;  2X01 A;  2I72 A;  3S1Y A;  1ERQ A;  5EVI D;  4KG2 A;  1NYM A;  4KZ7 A;  1XA1 A;  2WAE A;  3OCL A;  3PTE A;  1L2S A;  3UE0 A;  5CHU A;  3DWK A;  3S22 A;  3PBT A;  4OP5 A;  1K54 C;  4ZJ1 A;  3MBZ A;  3IXB A;  3G2Z A;  5M19 A;  4GD6 A;  3C4O A;  2DNS A;  2IWD A;  2ZM0 A;  3WRT A;  4B4Z A;  1MXO A;  1W79 A;  3LEZ A;  2Y2P A;  2Q9N A;  1K6R A;  3SH8 A;  1VQQ A;  1RP5 A;  3BFF A;  4JPM A;  3GSG A;  5FAS A;  1GHM A;  4KZA A;  4WZ5 C;  1TDL A;  4RX2 A;  3OPP A;  3VP0 A;  3Q7Z A;  1XPB A;  5TGF A;  4QY5 A;  1KE3 A;  4FD8 A;  3G34 A;  3A3E A;  3EQV A;  4JF4 A;  4IVI A;  3G32 A;  3HRE A;  4N1X A;  5EPH A;  3MKF A;  4L0L A;  1MBL A;  1MY8 A;  3OPR A;  4QJG A;  1XX2 A;  2XLN A;  2Y2J A;  4U0X A;  2IWC A;  5GLB A;  4EBN A;  1CEG A;  4LV3 A;  3GV9 A;  5CER A;  3HLC A;  4O7D A;  1SDE A;  1CEF A;  1ES3 A;  4OP8 A;  4UA6 A;  4H8R A;  3M6B A;  4OPY A;  1XGJ A;  3VP2 A;  3IWQ A;  1O07 A;  5E2H A;  2V1Z A;  3ZFZ A;  2PU4 A;  1FCN A;  3AGD A;  2Y2I A;  4P6B A;  3UPP A;  3Q81 A;  5HX9 A;  3ZG0 A;  1CI9 A;  1TDG A;  4MBK A;  4MBF A;  5GHY A;  3ZGA B;  4R4R A;  4R1G A;  1K54 A;  4E6W A;  4C6Y A;  1LL5 A;  3JYI A;  1H8Z A;  2WGV A;  3O86 A;  5GHZ A;  4OLD A;  2XDM A;  3VSL A;  2J7V A;  4R3B A;  3UNW A;  4X53 A;  3LO7 A;  4PPR A;  1ZKJ A;  4E3I A;  4E3M A;  2J9P A;  3C7U A;  4WZ5 A;  3FWL A;  3PBN A;  2EXA A;  3GMW A;  4DE3 A;  2ZQC A;  5HL1 A;  3BFD A;  4NET A;  4DDS A;  3G31 A;  3IHA A;  5G18 A;  5I94 A;  2JCH A;  5HAI A;  2ZC3 B;  2Y2Q A;  4WEK A;  2EFU A;  2Y4A A;  1ESU A;  3O3V A;  2ZMA A;  3WS2 A;  4M3K A;  3UN7 A;  4PM7 A;  3PAG A;  1TVF A;  1YLP A;  3HVF A;  3N7W A;  4S2K A;  5FI2 A;  4DE2 A;  1K55 A;  1PI4 A;  3W4O A;  1W8Y A;  4OQ0 A;  1GA0 A;  4JKT A;  4JLF A;  3IXG A;  1PWC A;  4UA7 A;  1K56 D;  1KDS A;  5FI6 A;  2XFT A;  3SH7 A;  2ZC7 A;  3VOY A;  4DE0 A;  3OCN A;  1BZA A;  4CPK A;  4YFM A;  3UPO A;  4Y0U A;  2DCF A;  2H10 A;  5TFQ A;  3VP1 A;  1SCW A;  4KG6 A;  4LEN A;  3MXS A;  5EOE A;  1JTG A;  2P9V B;  3IF6 C;  5FQI A;  2ZC4 B;  3VFF A;  1ERM A;  2X02 A;  4FH2 A;  3W4P A;  4CJN A;  3BEC A;  4X69 A;  5FI7 A;  1GCE A;  3BLS A;  1FCO A;  2Q9M A;  3MKE A;  3ZVW A;  3C4P A;  3PBR A;  1BT5 A;  2ZM2 A;  3FKV A;  3OZH A;  2HP6 A;  5GL9 A;  1FR6 A;  1I2S A;  4E3J A;  1GHP A;  3FYZ A;  2HDU A;  5CTN A;  2P9V A;  1HVB A;  3DW0 A;  4P87 A;  1KE0 A;  2XR0 A;  2WKE A;  4EUZ A;  3A3D A;  2ZQ8 A;  1MWU A;  3A3I A;  3BFG A;  4C3Q A;  5F1F A;  4ZJ3 A;  4KZ8 A;  5GLA A;  1IYS A;  1K56 A;  5HFO A;  2Y59 A;  3QNB A;  3ZNT A;  3W4Q A;  5KMW A;  3NIA A;  5EVI C;  3LCE A;  1KGG A;  3N8R A;  5EEC A;  1FR1 A;  4R0Q A;  1L0E A;  3VMA A;  3GRJ A;  3UDF A;  2XEP A;  3HBR A;  2VGJ A;  4E3L A;  1GHI A;  3AGE A;  5D3O A;  3IF6 B;  4QB8 A;  5HAR A;  4IBX A;  3E2K A;  3MZF A;  4X68 A;  5GLD A;  4EBL A;  2ZD8 A;  3Q7V B;  1FSW A;  3Q1F A;  4IVK A;  5CED A;  1JTD A;  2XH9 A;  5FAQ A;  1DJB A;  4JXW A;  1N9B A;  2BLS A;  5EOO A;  3TSG A;  2HP9 A;  4KZ3 A;  1DY6 A;  4BD1 A;  3I7J A;  3IF6 A;  3BFC A;  4JXS A;  4MBH A;  4HES A;  3ZCZ A;  4YIN A;  3S4X A;  3UE1 A;  1K6S A;  4RVA A;  3ZDJ A;  1YLY A;  4PM8 A;  3Q7V A;  3EQU A;  1NRF A;  5E43 A;  5HAP A;  1ZC2 A;  1HZO A;  3IXH A;  1S0W A;  3A3F A;  3HLF A;  2Y91 A;  5EVI B;  4GN2 A;  2V2F F;  1ES4 A;  3IH8 A;  1KGE A;  2JE5 A;  2ZQA A;  3Q82 A;  4OPR A;  4WZ4 A;  4GOG A;  2H0T A;  4PM5 A;  4BL3 A;  1W5D A;  1HTZ A;  2Y2O A;  1IYO A;  4DXB A;  4EBP A;  4XXR A;  1BTL A;  1RGZ A;  2C6W B;  2EX9 A;  3CG5 A;  4OQH A;  5EE8 A;  5EVI A;  3V39 A;  5A90 A;  4C75 A;  1ONG A;  4OQG A;  1K57 C;  1N4O A;  2A3U A;  5FA7 A;  4ZBE A;  1IEM A;  1NZO A;  4BEN A;  5CHJ A;  4N1H A;  2RCX A;  1L0G A;  3QNC A;  3TG9 A;  1SHV A;  3MZD A;  4OPQ A;  1PW1 A;  1BLP A;  2XQZ A;  1YM1 A;  4S2N C;  4UHU A;  4OH0 A;  3ZHH A;  1XA7 A;  3NBL A;  4HBU A;  3BFE A;  2Z2L B;  3V3R A;  2CC1 A;  4WYY A;  3N4I A;  1IEL A;  5AQB A;  3M2K A;  1LLB A;  4JBF A;  1FOF A;  1ES5 A;  2XF3 A;  1DJA A;  1HD8 A;  1OME A;  1XXM A;  3NI9 A;  3P09 A;  2ZC5 B;  4QY6 A;  1YQS A;  5E2F A;  4S2O A;  2XK1 A;  2JBF A;  1LHY A;  1KDW A;  4U3T A;  2RL3 A;  3AGF A;  2WKH A;  5JYO A;  3UPN A;  1YLW A;  5DF7 A;  3LY3 A;  5FQ9 A;  5A92 A;  2EX8 A;  1C3B A;  1PZO A;  1K4E A;  2OSU A;  5CEB A;  3FV7 A;  5F1G A;  4KQR A;  2XFS A;  3UO9 A;  1ZG6 A;  4F94 A;  5KSH A;  4GKU A;  3ITA A;  3ZNY A;  3O87 A;  3NDE A;  3VP3 A;  3WRZ A;  2ZM8 A;  2R9X A;  1PWD A;  2XGN A;  1ALQ A;  4PM9 A;  1AXB A;  3OPL A;  3IF5 A;  5DVA A;  1K57 A;  4K0W A;  5DTT A;  2HP5 A;  1BLC A;  2WKI A;  2WZZ A;  3P98 A;  4QD4 A;  3RJU A;  3N8L A;  3MXR A;  1YT4 A;  4EQI A;  4ID4 A;  4EWF A;  1LL9 A;  1Q2Q A;  4S2N A;  1L0D A;  4R3J A;  1ES2 A;  4JXV A;  2WAD A;  4X6T A;  4X55 A;  2Y2K A;  3Q07 A;  1EWZ A;  4UA9 A;  1WYC A;  4NK3 A;  4OQI A;  1YLT A;  1Y54 A;  2E8I A;  1I5Q A;  1H5X A;  1NJ4 A;  1IYQ A;  3G2Y A;  1VM1 A;  2GDN A;  1G68 A;  1J9M A;  4WBG A;  3BYD A;  4LCM A;  3UDX A;  2WGW B;  4ZJ2 A;  5TR7 A;  3VFH A;  4DF6 A;  1RGY A;  4KZ5 A;  1WE4 A;  4B4X A;  4MNR A;  4LV1 A;  2OLV A;  3HLE A;  4GD8 A;  1FQG A;  1EI5 A;  1QME A;  4U0T A;  2EFX A;  4WEL A;  3ZVT A;  3N8S A;  3NCK A;  2WGW A;  1YLZ A;  4FH4 A;  3RXW A;  2QZ6 A;  3UY6 A;  4XUZ A;  5IHV A;  2WUQ A;  2QPN A;  4GB7 A;  2ZC6 B;  2Y2H A;  5DTS A;  2B5R A;  3IHB A;  4OLG A;  2IWB A;  5U47 A;  1IKG A;  4ZTK A;  3MFD A;  1M40 A;  4RX3 A;  2WZX A;  4KZB A;  3HUO A;  3IWO A;  3FZC A;  3NDG A;  2H0Y A;  4E3N A;  4DKI A;  4EV4 A;  1JWV A;  3HL9 A;  5E2E A;  2VGK A;  2OLU A;  3VP4 A;  3W8K A;  2Y55 A;  4N9K A;  1K4F A;  3IT9 A;  4R4S A;  3OC2 A;  1KGF A;  1PWG A;  3SOI A;  2QMI A;  1I2W A;  3ITB A;  4K0X A;  3DWZ A;  1ESI A;  1XKZ A;  5FAP A;  3V5M A;  3GQZ A;  3G4P A;  4IED A;  1JVJ A;  5HAQ A;  1BUL A;  2FFY A;  1MPL A;  3HLW A;  3WS4 A;  3DTM A;  2G2W A;  1KE4 A;  4UAA A;  3VSK A;  1SKF A;  1K25 A;  5A91 A;  2PU2 A;  5DTK A;  5KSC A;  1S6R A;  4WEJ A;  1PIO A;  3ZG8 B;  1DJC A;  1W8Q A;  1IYP A;  2Y2N A;  4JF5 A;  4DDY A;  4OOY A;  5FQM A;  4B88 A;  1PW8 A;  2Z2M B;  4R23 A;  3WWX A;  4FSF A;  4XUX A;  1TEM A;  1ONH A;  4KQQ A;  3FKW A;  2EXB A;  1YMS A;  4OON A;  5AQ9 A;  4GZB A;  5FQQ A;  3UDI A;  5A93 A;  4PM6 A;  1K38 A;  4S2P A;  3CZD A;  2OV5 A;  3SH9 A;  3WS0 A;  4DE1 A;  5FQJ A;  1Z6F A;  1U60 A;  1BSG A;  4DXC A;  3HUN A;  4Y7P A;  3PAE A;  3SS4 A;  3MZE A;  4OVD A;  3ZG5 A;  3HLG A;  4JF6 A;  5GLC A;  5AQ7 A;  4PMA A;  4N92 A;  3IXD A;  3M2J A;  3N6I A;  4KQO A;  1PZP A;  3HLB A;  2V20 A;  5M18 A;  1E25 A;  4GNU A;  2HDR A;  5FAO A;  1M6K A;  2Y2L A;  4IBR A;  1PYY A;  5BOH A;  1RCJ A;  4HBT A;  4S2I A;  4KG5 A;  5CRF A;  1NYY A;  2ZQ9 A;  3B3X A;  2HDQ A;  2UWX A;  3GR2 A;  4S2M A;  4BJP A;  5F82 A;  3LY4 A;  5L2F A;  3G35 A;  2XD5 A;  3BEB A;  1JWP A;  2EX6 A;  3GVB A;  3M6H A;  2G2U A;  4Y0O A;  1K55 C;  4E6X A;  5EVL A;  4BQM A;  2HDS A;  4OOM A;  4RA7 A;  1L0F A;  1MKI A;  4Z9Q A;  4A5R A;  3WS5 A;  4LV0 A;  3UE3 A;  3SS5 A;  3A3J A;  5FAT A;  5GHX A;  1ERO A;  4BLM A;  4N9L A;  4ZAM A;  4E3O A;  2P74 A;  4QHC A;  4RYE A;  1YLJ A;  4P85 A;  3SS3 A;  4WMC D;  1LI9 A;  3ZG7 B;  2BG1 A;  4LCL A;  4S2J A;  4MEZ A;  5CHM A;  3C5A A;  3HUM A;  4HEF A;  1NY0 A;  2WYX A;  1FSY A;  1PI5 A;  4OOL A;  4ZDX A;  5J8X A;  3VOZ A;  3CJM A;  1Q2P A;  3E2L A;  1E3U D;  2XD1 A;  3QHY A;  1CI8 A;  2H5S A;  3IWI A;  4K91 A;  5E2G A;  1QMF A;  5CGW A;  1CK3 A;  3G30 A;  4OKP A;  2A49 A;  2ZQD A;  2J8Y A;  1XGI A;  3BLM A;  1BLH A;  2WGI A;  1JWZ A;  1G6A A;  2PBY A;  3BM6 A;  4MLL A;  4FCF A;  1H8Y A;  1E4D A;  3ZG9 B;  1BLS A;  5JYP A;  3OPH A;  4BD0 A;  5CGX A;  3RXX A;  3CMZ A;  4JXG A;  4OPZ A;  4WMC A;  1NXY A;  3O88 A;  2C5W B;  1MWS A;  2Y2M A;  5DF9 A;  1NZU A;  2WAF A;  4D2O A;  5F83 A;  4S2L A;  5FQK A;  2J9O A;  3V50 A;  1O7E A;  3BRM A;  1E3U A;  3PBQ A;  5M1A A;  5CTM A;  4WM9 A;  5FDH A;  5AQA A;  1KVM A;  1ZG4 A;  4Y0T A;  4DRT A;  1IKI A;  1BUE A;  2JC7 A;  5CGS A;  2ZJ9 A;  3GTC A;  1FCM A;  2WK0 A;  3HLD A;  3IQA A;  1LI0 A;  3WS1 A;  2DRW A;  3ISG A;  5DF8 A;  5HW3 A;  3C7V A;  2ZLY A;  4KZ6 A;  3TOI A;  3V3S A;  4P0M A;  4KZ4 A;  1MWT A;  1WYB A;  4GDB A;  2HPB A;  3D4F A;  1XP4 A;  5FSR A;  4QU3 A;  5CEC A;  2EX2 A;  1W7F A;  2FFF B;  5CXW A;  5KZH A;  2X71 A;  4E3K A;  4LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...