2PB2A

Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
382
structure length
378
Chain Sequence
ADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylornithine/succinyldiaminopimelate aminotransferase
publication title Structure of biosynthetic N-acetylornithine aminotransferase from Salmonella typhimurium: Studies on substrate specificity and inhibitor binding
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 139
structure length 378
sequence length 382
chains with identical sequence B
ec nomenclature ec 2.6.1.11: Acetylornithine transaminase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2pb2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2pb2A01
3HQTA 4F5GA 1GC3A 1AJRA 3E2YA 3QI6A 1GD9A 1DFOA 1RV3A 2BI1A 2FQ6A 1AMQA 3AV7A 1BJNA 3QGUA 3A9YA 3MC6A 5FT8A 3NYSA 4Y0IA 3DXWA 2VIAA 4ZM3A 2X8UA 2GQNA 1V72A 1AIAA 5EIGA 1B9HA 3ATHA 1OHWA 4F4EA 4GRXA 1O69A 4R5FA 1Z7DA 2ORDA 3ISLA 4J8LA 4ZWVA 3EZSA 1M7YA 2O7CA 1UKJA 4H51A 3BWNC 1ARHA 2QA3A 3BV0A 3GETA 2D65A 1O62A 4WB0B 1RVUA 2D64A 3JWAA 3LVMA 1M0QA 4CBRA 1MLYA 4FFCA 4OBUA 3K28A 2VGWA 1CZEA 3D6KA 4EMYA 4Q31A 4XJMA 5G2QA 1SF2A 3L8AA 1IVRA 4OYTA 2DR1A 4ZWMA 2X5FA 4WBTA 1KMKA 4LC3A 4MKKA 1AIBA 3HBXA 1AJSB 2VMPA 2XH1A 4RLGA 5EUEA 1ZC9A 1LW4A 2CH2A 1MAPA 3DXVA 1DGDA 3KGWA 3MKJA 3BCAA 4WLJA 4R2NA 4WYGA 1BKGA 3JTXA 1EQBA 2W7EA 3LVJA 4ADBA 2BKWA 3DODA 5FT4A 1KKPA 3GR9A 5AX8A 1SVVA 4ZSYA 4XQ2A 3ASBA 3E2ZA 4JEXA 4OMAA 2AY8A 3PDBB 1FC4A 2HOYA 2Q7WA 3AEMC 3AOVA 1W3UA 3MAFA 3AEPA 3USFA 1QJ3A 2JJFA 3HDOA 3VK2A 2BI5A 3IHJA 2YKUA 2CY8A 4A0FA 2D61A 3EIBA 1W23A 4PFFA 4MKJA 1D2FA 2ZUKA 3A2BA 3P6KA 2ZY3A 1ZODA 2VIBA 2PB2A 1ASEA 1QITA 2D7YA 1LW5A 3LVKA 1M6SA 1XEYA 3PD6A 1GEWA 4GE4A 3RCHB 2R5EA 1GC0A 3NTJA 2Z1YA 4RJ0A 3BWOA 2E54A 3BCBA 3GWPA 3G8MA 3W1JA 1UU1A 2C7TA 1C4KA 2VMSA 1E5EA 3NUBA 1MAQA 2OKJA 1FG7A 2ZY4A 2PB0A 1GCKA 2WK8A 3UWCA 1ASMA 4UOYA 3KE3A 1I48A 1ZOBA 4JE5D 4UQVA 1J32A 4GE7A 2EH6A 2HUFA 3E2FA 3NX3A 1W7NA 4ZDOA 4O6ZA 3I5TA 4W91A 3TFUA 4RIZA 2WKAA 2AEUA 4F5KA 2JISA 5F8VA 2ZY5A 1W7LA 3ZRQA 2ZP7A 4A0GA 5IWQA 4R8DA 4MSOA 3WZFA 2BWPA 4JF0A 5M4DA 2VMWA 2JJGA 2VLHA 2VMYA 3N0LA 4AOAA 4MQQA 2HOXA 1C0NA 3WGCA 2VYCA 1IUGA 3LG0A 2BYJA 2BI2A 5EIGB 4ZAHA 1B4XA 5EUNA 1BQAA 4KAMA 4JE5A 1AMAA 2YCPA 1VP4A 3WCNA 2C44A 2O0RA 3IF2A 1TATA 4J5UA 3HL2A 4IXOA 1X2AA 1S06A 1CJ0A 3ELEA 2R0TA 2R5CA 1C9CA 3A8UX 4MQPA 3LY1A 1WYVA 2W8VA 2EPJA 2VMVA 3DR4A 2AY3A 2JG2A 3K7YA 5D95A 1IAYA 5FT5A 4DGTA 4EFFA 1CS1A 2NMPA 1M0NA 1I41A 4JF1A 3GZDC 3VAXA 3UAKA 2ZYJA 3ELPA 4MQRA 3NYUA 1AX4A 4DBCA 5K8BA 1IJIA 4M2KA 3FQ7A 1M4NA 4BHDA 2DKBA 1CQ7A 3R9AA 1MLZA 2VMZA 4XJOA 2VLFA 1AHFA 1AKCA 2HP1A 3B1CA 3B46A 3H14A 2DGLA 1DJEA 2BHXA 4P3MA 3OP7A 2ZY2A 5E5IA 5G4JA 1ASNA 2V0YA 2X3LA 3E2ZB 3FVXA 5G09A 4ZM4A 1D7UA 1KMJA 4EB7A 3MAFB 1TARA 4KYOA 4AZKA 2WK7A 2QMAA 4U2HA 2PO3A 1QIRA 4ADCA 2CJGA 3AEJC 1YIZA 2D66A 2JJEA 1LC7A 1WYUB 1Y4IA 1AY8A 1O4SA 3CQ4A 3NDNA 3JZLA 1CZCA 1EJIA 3T32A 3PD6B 3MEBA 2WK9A 3MBBA 3EUCA 1H1CA 1JG8A 2GMSA 4W5KA 5HHYA 1UU2A 5LH9A 2GSAA 4L0OA 2OQXA 1C7NA 1TPLA 1ORDA 2YRIA 1IX6A 3W1IA 1PMOA 2VGTA 3E77A 3CQ5A 4M2JA 4RKCA 4CXQA 1T3IA 3ACZA 1VEFA 3L44A 4XEWA 4ZDLA 3FZ7A 4Q75A 2Z61A 3GJUA 3KKIA 5EFSA 2HOZA 1N2TA 2Z67A 4TV7A 1BT4A 4F5MA 3N5MA 2W7MA 4BA4A 1KKJA 1N8PA 1LS3A 4EU1A 1LC5A 2FNIA 3BCXA 2BIAA 3N75A 3I4JA 1AY5A 2AY4A 2VMTA 2D63A 4W1WA 1MDXA 4WYDA 5E3KA 5DX5A 2W7KA 2Z9XA 3GSBA 5G0AA 2Z9VA 1QGNA 1DJUA 3F6TA 3TCMA 1KL1A 1SFFA 1IBJA 2VMNA 1WYTA 2D7ZA 3F0HA 3QN6A 4BQ0A 3MC6C 3Q8NA 1CQ8A 4OC9A 3A9ZA 4ITXA 1AHGA 3VK4A 4WXBA 2OKKA 2EZ2A 2R5CB 2W7DA 1V2DA 4RJYA 2W8WA 1DTYA 3PJ0A 3FZ6A 4GDYA 4PVFA 4QGRA 4A6UA 5G2PA 3G7QA 1GC4A 1LKCA 2FYFA 1SZUA 2EZ1A 1AHXA 1XI9A 2AY7A 3COGA 3KGXA 2CTZA 1ARIA 2EGYA 4RAEA 1FG3A 2ZSLA 2F8JA 1C7OA 1IAXA 1IX7A 4TMRA 4W8IA 1AHEA 3UE8A 3FFHA 1G7WA 2TPLA 4ATPA 4E77A 3EI8A 4LW2A 1WKHA 4ITGA 1W7MA 2CSTA 4BMKA 2CJHA 1I29A 4IXSA 4MY5A 1GDEA 1B5OA 1YNUA 2GB3A 2VMXA 4E1OA 4MGRA 4A00A 1MDZA 4LNLA 2Z20A 5EUDA 2VMUA 5EQCA 3FFRA 2Z9WA 4JEVA 3FCRA 4RITA 4RKDA 3E9KA 4Q6RA 2FNUA 3BC8A 1ASBA 4JEWA 1S0AA 1TOEA 4WYCA 3W1HA 2E7JA 1CL2A 1C7GA 2E7UA 1DJ9A 3RBFA 1BJOA 3BB8A 1PG8A 2Z9UA 2GMUA 3B1EA 3JWBA 3P1TA 4W1XA 3EI9A 4FL0A 1M0PA 3JW9A 3H7FA 1MGVA 1ASGA 4K2BA 4CBSA 4CXRA 5JAYA 3B1DA 3WGBA 2E7IA 3AELA 4LW4A 1D7SA 1DKAA 2JJHA 3FQ8A 4ATQA 4A0HA 1GEYA 1U08A 3AENA 3E6GA 4DQ6A 3CBFA 1ASDA 3MADA 4AH3A 2HUUA 2FN6A 4IYOA 4UHNA 3HMUA 3FTBA 4M2MA 3ZZJA 3GZCA 3II0A 1BJWA 3PIUA 5F9SA 2QB2A 3BWNA 1N31A 2QB3A 4U1TA 4F5FA 2CJDA 3HVYA 3CAIA 3WY7A 2YKVA 8AATA 1IX8A 3OKSA 2DGMA 3LVLB 5TF5A 1DGEA 4N0BA 4W1VA 2C0RA 3RCHA 4WXGA 1ARSA 1BS0A 1SPAA 3LWSA 5M46A 4PIWA 5FT6A 4F5LA 4ZASA 1AKBA 1LC8A 3NNKA 4WP0A 2AY9A 1P3WA 4LNJA 5M4BA 1PFFA 2XBNA 1D7VA 4Y0HA 1V2EA 2OGAA 1PMMA 2YHKA 3I16A 3NYTA 3F9TA 1OHYA 4IX8A 1AKAA 1RVYA 1AMRA 2CFBA 2W8JA 2BWOA 1GEXA 3AEMA 4ADEA 1AAWA 4JEYA 1TOIA 3DR7A 4A6RA 4HVKA 1OATA 3WX9A 3CQ6A 1X29A 1YIYA 4AO9A 2YCNA 3EI6A 2JGTA 3FDBA 4HF8A 1X28A 2QLRA 2W7JA 3QPGA 2HP2A 3NU7A 2VGSA 2BIEA 3FVUA 5BJ3A 4UHMA 3HT4A 9AATA 3AEOA 2YKYA 2HORA 1E5FA 3GBXA 2DGKA 1H0CA 1S09A 1G4VA 1ARTA 3RUYA 1AY4A 3DYDA 1QJ5A 2V1PA 4IY7A 4E3RA 1AHYA 2AATA 1S08A 1YOOA 3PAAA 3ZRRA 5HXXA 1BW0A 3ASAA 2YRRA 2RFVA 1ASAA 3QHXA 4PFNA 4ZLVA 4N0WA 3PDXA 1BJOB 1YJSA 2HUIA 4NOGA 2BI9A 4OCAA 3G0TA 3ZRPA 4A72A 2FM1A 3FD0A 1TOKA 3PPLA 4XJPA 5E4ZA 5HDMA 4R5ZA 5G4IA 3DRDA 2C81A 1YJZA 4ZSWA 3WCOA 1VJOA 1ASLA 3FDDA 1WYVB 4P7YA 3BS8A 3AENB 1CL1A 2BWNA 4JEZA 2W8TA 3VK3A 1ARGA 4OT8A 5M49A 1ASFA 5DB5A 4IYOB 1OXPA 1QZ9A 4IW7A 5DJ1A 1J04A 3FRKA 3FQAA 4K2IA 3PA9A 1M32A 7AATA 1S07A 4OTLA 1WYUA 3ECDA 2CH1A 2VGVA 3AATA 4IXZA 4K2MA 4EB5A 2VMOA 2VI8A 1Z3ZA 3NUIA 5EAVA 3QBOA 4WLHA 4E3QA 2VMQA 4XAUA 5LHAA 1AMSA 1GC2A 4WXFA 1D7RA 4WD2A 1LK9A 4B98A 1TOJA 2VGZA 3TATA 4WB0A 1TOGA 2ZJGA 1SZKA 1WSTA 4Q76A 2D5YA 1G4XA 3ZZKA 1ELQA 4F5JA 2O1BA 2BI3A 1CQ6A 3GZDA 4GEBA 4LNMA 5J8QA 2AY1A 1X0MA 1ELUA 3EIAA 2YOBA 3EI7A 3MAUA 1M0OA 4RM1A 4AO4A 3A9XA 1UU0A 1B8GA 2EO5A 2VI9A 5I92A 2QBTA 2AY5A 1AJSA 2ZSMA 3FKDA 3RQ1A 4B9BA 3VOMA 1B5PA 4A0RA 1G7XA 2YKXA 1SZSA 4ISYA 1JF9A 2BYLA 5C6UA 3TFTA 1O61A 2W7HA 1YJYA 2HZPA 2OGEA 2DOUA 3QM2A 4XJLA 3NRAA 2W7LA 4ZDPA 1BJ4A 2Z1ZA 1V2FA 1RV4A 2CANA 3AEJA 3BN1A 3DZZA 3M5UA 2G6WA 5DJ9A 3WLXA 4CVQA 4F5IA 4WYEA 4Y0DA 1OHVA 3PDBA 2AY2A 4AZJA 4KXKA 3JU7A 2YCTA 3R4TA 1AICA 1QISA 4I8AA 3NU8A 5BJ4A 2X5DA 1MDOA 3RBLA 3EI5A 1AAMA 4A6TA 2CB1A 4BA5A 3PGYA 4TN4A 2AY6A 1JS3A 4OBVA 2W7FA 2W7GA 1EG5A 1ECXA 3K40A 1B9IA 1OXOA 3FVSA 2R2NA 3AOWA 2CINA 4GE9A 1WYTB 4GSAA 3LV2A 2VMRA 3WKRA 2OATA 4WYFA 3B8XA 3WKSA 3FZ8A 1TASA 3DU4A 3HLMA 3DC1A 1I43A 5EAAA 2DKJA 3VP6A 4F5HA 1BQDA 2W8UA 1GBNA 4ADDA 3FSLA 2BIGA 4UHOA 1JS6A 4XK1A 2VGUA 1WKGA 3TQXA 1ASCA 2ZC0A 4WYAA 2W7IA 2AEVA 5D5SA 3RI6A 3EZ1A 1KL2A 1YAAA
chains in the Genus database with same CATH superfamily
3HQTA 4F5GA 1GC3A 1AJRA 3E2YA 3QI6A 1GD9A 1DFOA 1RV3A 2BI1A 2FQ6A 1AMQA 3AV7A 1BJNA 3QGUA 3A9YA 3MC6A 5FT8A 3NYSA 4Y0IA 5KTBA 3DXWA 2VIAA 4ZM3A 2X8UA 2GQNA 1V72A 1AIAA 5EIGA 1B9HA 3ATHA 1OHWA 4F4EA 4GRXA 1O69A 4R5FA 1Z7DA 2ORDA 3ISLA 4J8LA 4ZWVA 2FKIA 3EZSA 1M7YA 2O7CA 1UKJA 4H51A 3BWNC 1ARHA 2QA3A 3BV0A 3GETA 2D65A 1O62A 4WB0B 1RVUA 2D64A 3JWAA 3LVMA 1M0QA 4CBRA 1MLYA 4FFCA 4OBUA 3K28A 2VGWA 1CZEA 3D6KA 4EMYA 4Q31A 4XJMA 5G2QA 3N7NA 1SF2A 3L8AA 1IVRA 4OYTA 2DR1A 4ZWMA 2X5FA 4WBTA 1KMKA 4LC3A 4MKKA 1AIBA 3HBXA 1AJSB 2VMPA 2XH1A 4RLGA 5EUEA 1ZC9A 1LW4A 2CH2A 1MAPA 3DXVA 1DGDA 3KGWA 3MKJA 3BCAA 4WLJA 4R2NA 4WYGA 1BKGA 3JTXA 1EQBA 2W7EA 3LVJA 4ADBA 2BKWA 3DODA 5FT4A 1KKPA 3GR9A 5AX8A 1SVVA 4ZSYA 4XQ2A 3ASBA 3E2ZA 4JEXA 4OMAA 2AY8A 3PDBB 1FC4A 2HOYA 2Q7WA 3AEMC 3AOVA 1W3UA 3MAFA 3AEPA 3USFA 1QJ3A 2JJFA 3HDOA 3VK2A 2BI5A 3IHJA 2YKUA 2CY8A 4A0FA 2D61A 3EIBA 1W23A 4PFFA 4MKJA 1D2FA 2ZUKA 3A2BA 3P6KA 2ZY3A 1ZODA 2VIBA 2PB2A 1ASEA 1QITA 2D7YA 1LW5A 3LVKA 1M6SA 1XEYA 3PD6A 1GEWA 4GE4A 3RCHB 2R5EA 1GC0A 3NTJA 2Z1YA 4RJ0A 3BWOA 2E54A 3BCBA 3GWPA 3G8MA 3W1JA 1UU1A 2C7TA 1C4KA 2VMSA 1E5EA 3NUBA 1MAQA 2OKJA 1FG7A 2ZY4A 2PB0A 1GCKA 2WK8A 3UWCA 1ASMA 4UOYA 3KE3A 1I48A 1ZOBA 4JE5D 4UQVA 1J32A 4GE7A 2EH6A 2HUFA 3E2FA 3NX3A 1W7NA 4ZDOA 4O6ZA 3I5TA 4W91A 3TFUA 4RIZA 2WKAA 2AEUA 4F5KA 2JISA 5F8VA 2ZY5A 1W7LA 3ZRQA 2ZP7A 4A0GA 5IWQA 4R8DA 4MSOA 3WZFA 2BWPA 4JF0A 5M4DA 2VMWA 2JJGA 2VLHA 2VMYA 3N0LA 4AOAA 4MQQA 2HOXA 1C0NA 3WGCA 2VYCA 1IUGA 3LG0A 2BYJA 2BI2A 5EIGB 4ZAHA 1B4XA 5EUNA 1BQAA 4KAMA 4JE5A 1AMAA 2YCPA 1VP4A 3WCNA 2C44A 2O0RA 3IF2A 1TATA 4J5UA 4K05A 3HL2A 4IXOA 1X2AA 1S06A 1CJ0A 3ELEA 2R0TA 2R5CA 1C9CA 3A8UX 4MQPA 3LY1A 1WYVA 2W8VA 2EPJA 2VMVA 3DR4A 2AY3A 2JG2A 3K7YA 5D95A 1IAYA 5FT5A 4DGTA 4EFFA 1CS1A 2NMPA 1M0NA 1I41A 4JF1A 3GZDC 3VAXA 3UAKA 2ZYJA 3ELPA 4MQRA 3NYUA 1AX4A 4DBCA 5K8BA 1IJIA 4M2KA 3FQ7A 1M4NA 4BHDA 2DKBA 1CQ7A 3R9AA 1MLZA 2VMZA 4XJOA 2VLFA 1AHFA 1AKCA 2HP1A 3B1CA 3B46A 3H14A 2DGLA 1DJEA 2BHXA 4P3MA 3OP7A 2QSRA 5E5IA 5G4JA 1ASNA 2ZY2A 2V0YA 2X3LA 3E2ZB 3FVXA 5G09A 4ZM4A 1D7UA 1KMJA 4EB7A 3MAFB 1TARA 4KYOA 4AZKA 2WK7A 2QMAA 4U2HA 2PO3A 1QIRA 4ADCA 2CJGA 3AEJC 1YIZA 2D66A 2JJEA 1LC7A 1WYUB 1Y4IA 1AY8A 1O4SA 3CQ4A 3NDNA 3JZLA 1CZCA 1EJIA 3T32A 3PD6B 3MEBA 2WK9A 3MBBA 3EUCA 1H1CA 1JG8A 2GMSA 4W5KA 5HHYA 1UU2A 5LH9A 2GSAA 4L0OA 2OQXA 1C7NA 1TPLA 1ORDA 2YRIA 1IX6A 3W1IA 1PMOA 2VGTA 3E77A 3CQ5A 4M2JA 4RKCA 4CXQA 1T3IA 3ACZA 1VEFA 3L44A 4XEWA 4ZDLA 3FZ7A 4Q75A 2Z61A 3GJUA 3KKIA 5EFSA 2HOZA 1N2TA 2Z67A 4TV7A 3N4SA 1BT4A 4F5MA 3N5MA 2W7MA 4BA4A 1KKJA 1N8PA 1LS3A 4EU1A 1LC5A 2FNIA 3BCXA 2BIAA 3N4XA 3N75A 3I4JA 1AY5A 2AY4A 2VMTA 2D63A 4W1WA 1MDXA 4WYDA 5E3KA 5DX5A 2W7KA 2Z9XA 3GSBA 5G0AA 2Z9VA 1QGNA 1DJUA 3F6TA 3TCMA 1KL1A 1SFFA 1IBJA 2VMNA 1WYTA 2D7ZA 3F0HA 3QN6A 4BQ0A 3MC6C 3Q8NA 1CQ8A 4OC9A 3A9ZA 4ITXA 1AHGA 3VK4A 4WXBA 2OKKA 2EZ2A 2R5CB 2W7DA 1V2DA 4RJYA 2W8WA 1DTYA 3PJ0A 3FZ6A 4GDYA 4PVFA 4QGRA 4A6UA 5G2PA 3G7QA 1GC4A 1LKCA 2FYFA 1SZUA 2EZ1A 1AHXA 1XI9A 2AY7A 3COGA 3KGXA 2CTZA 1ARIA 2EGYA 4RAEA 1FG3A 2ZSLA 2F8JA 1C7OA 1IAXA 1IX7A 4TMRA 4W8IA 1AHEA 3UE8A 3FFHA 1G7WA 2TPLA 4ATPA 4E77A 3EI8A 4LW2A 1WKHA 4ITGA 1W7MA 2CSTA 4BMKA 2CJHA 1I29A 4IXSA 4MY5A 1GDEA 1B5OA 1YNUA 2GB3A 2VMXA 4E1OA 4MGRA 4A00A 1MDZA 4LNLA 2Z20A 5EUDA 3N4RA 2VMUA 5EQCA 3FFRA 2Z9WA 4JEVA 3FCRA 4RITA 4RKDA 3E9KA 4Q6RA 2FNUA 3BC8A 1ASBA 4JEWA 1S0AA 1TOEA 4WYCA 3W1HA 2E7JA 1CL2A 1C7GA 2E7UA 1DJ9A 3RBFA 1BJOA 3BB8A 1PG8A 2Z9UA 2GMUA 3B1EA 3JWBA 3P1TA 4W1XA 3EI9A 4FL0A 1M0PA 3JW9A 3H7FA 1MGVA 1ASGA 4K2BA 4CBSA 4CXRA 5JAYA 3B1DA 3WGBA 2E7IA 3AELA 4LW4A 1D7SA 1DKAA 2JJHA 3FQ8A 4ATQA 4A0HA 1GEYA 1U08A 3AENA 3E6GA 4DQ6A 3CBFA 1ASDA 1KAFA 3MADA 3H9XA 4AH3A 2HUUA 2FN6A 4IYOA 4UHNA 3HMUA 3FTBA 4M2MA 3ZZJA 3GZCA 3II0A 1BJWA 3PIUA 5F9SA 2QB2A 3BWNA 1N31A 2QB3A 4U1TA 4F5FA 2CJDA 3HVYA 3CAIA 3WY7A 2YKVA 8AATA 1IX8A 3OKSA 2DGMA 3LVLB 5TF5A 1DGEA 2A1VA 4N0BA 4W1VA 2C0RA 3RCHA 4WXGA 1ARSA 2EYQA 1BS0A 1SPAA 3LWSA 5M46A 4PIWA 5FT6A 4F5LA 4ZASA 1AKBA 1LC8A 3NNKA 4WP0A 2AY9A 1P3WA 4LNJA 5M4BA 2KFPA 1PFFA 2XBNA 1D7VA 4Y0HA 1V2EA 2OGAA 1PMMA 2YHKA 3I16A 3NYTA 3F9TA 1OHYA 4IX8A 1AKAA 1RVYA 1AMRA 2CFBA 2W8JA 2BWOA 1GEXA 3AEMA 4ADEA 1AAWA 4JEYA 1TOIA 3DR7A 4A6RA 4HVKA 2WB6A 4H63Q 1OATA 3WX9A 3CQ6A 1X29A 1YIYA 4AO9A 2YCNA 3EI6A 2JGTA 3FDBA 4HF8A 1X28A 2QLRA 2W7JA 3QPGA 2HP2A 3NU7A 2VGSA 2BIEA 3FVUA 5BJ3A 4UHMA 3HT4A 9AATA 3AEOA 2YKYA 2HORA 1E5FA 3GBXA 2DGKA 1H0CA 1S09A 1G4VA 1ARTA 3RUYA 1AY4A 3DYDA 1QJ5A 2V1PA 4IY7A 4E3RA 1AHYA 2AATA 1S08A 1YOOA 3PAAA 3ZRRA 5HXXA 1BW0A 3ASAA 2YRRA 2RFVA 1ASAA 3QHXA 4PFNA 4ZLVA 4N0WA 3PDXA 1BJOB 1YJSA 2HUIA 4NOGA 2BI9A 4OCAA 3G0TA 3ZRPA 4A72A 2FM1A 3FD0A 1TOKA 3PPLA 4XJPA 5E4ZA 5HDMA 4R5ZA 5G4IA 3DRDA 2C81A 1YJZA 4ZSWA 3WCOA 1VJOA 1ASLA 3FDDA 1WYVB 4P7YA 3BS8A 3AENB 1CL1A 2BWNA 4JEZA 2W8TA 3VK3A 1ARGA 4OT8A 5M49A 1ASFA 5DB5A 4IYOB 1OXPA 1QZ9A 4IW7A 5DJ1A 1J04A 3FRKA 3FQAA 4K2IA 3PA9A 1M32A 7AATA 1S07A 4OTLA 1WYUA 3ECDA 2CH1A 2VGVA 3AATA 4IXZA 4K2MA 4EB5A 2VMOA 2VI8A 1Z3ZA 3NUIA 5EAVA 3QBOA 4WLHA 4E3QA 2VMQA 4XAUA 5LHAA 1AMSA 1GC2A 4WXFA 1D7RA 4WD2A 1LK9A 4B98A 1TOJA 2VGZA 3TATA 4WB0A 1TOGA 2ZJGA 1SZKA 1WSTA 4Q76A 2D5YA 1G4XA 3ZZKA 1ELQA 4F5JA 2O1BA 2BI3A 1CQ6A 3GZDA 4GEBA 4LNMA 5J8QA 2AY1A 1X0MA 1ELUA 3EIAA 2YOBA 3EI7A 3MAUA 1M0OA 4RM1A 4AO4A 3A9XA 1UU0A 1B8GA 2EO5A 2VI9A 5I92A 2QBTA 2AY5A 1AJSA 2ZSMA 3FKDA 3RQ1A 4B9BA 3VOMA 1B5PA 4A0RA 1G7XA 2YKXA 1SZSA 4ISYA 1JF9A 2BYLA 5C6UA 3TFTA 1O61A 2W7HA 1YJYA 2HZPA 2OGEA 2DOUA 3QM2A 4XJLA 3NRAA 2W7LA 4ZDPA 1BJ4A 2Z1ZA 1V2FA 1RV4A 2CANA 3AEJA 3BN1A 3DZZA 3M5UA 2G6WA 5DJ9A 3WLXA 4CVQA 4F5IA 4WYEA 4Y0DA 1OHVA 3PDBA 2AY2A 4AZJA 4KXKA 3JU7A 2YCTA 3R4TA 1AICA 1QISA 4I8AA 3NU8A 5BJ4A 2X5DA 1MDOA 3RBLA 3EI5A 1AAMA 4A6TA 2CB1A 4BA5A 3PGYA 4TN4A 2AY6A 1JS3A 4OBVA 2W7FA 2W7GA 1EG5A 1ECXA 3K40A 1B9IA 1OXOA 3FVSA 2R2NA 3AOWA 2CINA 4GE9A 1WYTB 4GSAA 3LV2A 2VMRA 3WKRA 2OATA 4WYFA 3B8XA 3WKSA 3FZ8A 1TASA 3DU4A 3HLMA 3DC1A 1I43A 5EAAA 2DKJA 3VP6A 4F5HA 1BQDA 2W8UA 1GBNA 4ADDA 3FSLA 2BIGA 4UHOA 1JS6A 4XK1A 2VGUA 1WKGA 3TQXA 1ASCA 2ZC0A 4WYAA 2W7IA 2AEVA 5D5SA 3RI6A 2G7JA 3EZ1A 1KL2A 1YAAA
chains in the Genus database with same CATH topology
3HQTA 4F5GA 1GC3A 1AJRA 3E2YA 3QI6A 1GD9A 1DFOA 1RV3A 2BI1A 2FQ6A 1AMQA 3AV7A 1BJNA 3QGUA 3A9YA 3MC6A 5FT8A 3NYSA 4Y0IA 5KTBA 3DXWA 2VIAA 4ZM3A 2X8UA 2GQNA 1V72A 1AIAA 5EIGA 1B9HA 3ATHA 1OHWA 4F4EA 4GRXA 1O69A 4R5FA 1Z7DA 2ORDA 3ISLA 4J8LA 4ZWVA 2FKIA 3EZSA 1M7YA 2O7CA 1UKJA 4H51A 3BWNC 1ARHA 2QA3A 3BV0A 3GETA 2D65A 1O62A 4WB0B 1RVUA 2D64A 3JWAA 3LVMA 1M0QA 4CBRA 1MLYA 4FFCA 4OBUA 3K28A 2VGWA 1CZEA 3D6KA 4EMYA 4Q31A 4XJMA 5G2QA 3N7NA 1SF2A 3L8AA 1IVRA 4OYTA 2DR1A 4ZWMA 2X5FA 4WBTA 1KMKA 4LC3A 4MKKA 1AIBA 3HBXA 1AJSB 2VMPA 2XH1A 4RLGA 5EUEA 1ZC9A 1LW4A 2CH2A 1MAPA 3DXVA 1DGDA 3KGWA 3MKJA 3BCAA 4WLJA 4R2NA 4WYGA 1BKGA 3JTXA 1EQBA 2W7EA 3LVJA 4ADBA 2BKWA 3DODA 5FT4A 1KKPA 3GR9A 5AX8A 1SVVA 4ZSYA 4XQ2A 3ASBA 3E2ZA 4JEXA 4OMAA 2AY8A 3PDBB 1FC4A 2HOYA 2Q7WA 3AEMC 3AOVA 1W3UA 3MAFA 3AEPA 3USFA 1QJ3A 2JJFA 3HDOA 3VK2A 2BI5A 3IHJA 2YKUA 2CY8A 4A0FA 2D61A 3EIBA 1W23A 4PFFA 4MKJA 1D2FA 2ZUKA 3A2BA 3P6KA 2ZY3A 1ZODA 2VIBA 2PB2A 1ASEA 1QITA 2D7YA 1LW5A 3LVKA 1M6SA 1XEYA 3PD6A 1GEWA 4GE4A 3RCHB 2R5EA 1GC0A 3NTJA 2Z1YA 4RJ0A 3BWOA 2E54A 3BCBA 3GWPA 3G8MA 3W1JA 1UU1A 2C7TA 1C4KA 2VMSA 1E5EA 3NUBA 1MAQA 2OKJA 1FG7A 2ZY4A 2PB0A 1GCKA 2WK8A 3UWCA 1ASMA 4UOYA 3KE3A 1I48A 1ZOBA 4JE5D 4UQVA 1J32A 4GE7A 2EH6A 2HUFA 3E2FA 3NX3A 1W7NA 4ZDOA 4O6ZA 3I5TA 4W91A 3TFUA 4RIZA 2WKAA 2AEUA 4F5KA 2JISA 5F8VA 2ZY5A 1W7LA 3ZRQA 2ZP7A 4A0GA 5IWQA 4R8DA 4MSOA 3WZFA 2BWPA 4JF0A 5M4DA 2VMWA 2JJGA 2VLHA 2VMYA 3N0LA 4AOAA 4MQQA 2HOXA 1C0NA 3WGCA 2VYCA 1IUGA 3LG0A 2BYJA 2BI2A 5EIGB 4ZAHA 1B4XA 5EUNA 1BQAA 4KAMA 4JE5A 1AMAA 2YCPA 1VP4A 3WCNA 2C44A 2O0RA 3IF2A 1TATA 4J5UA 4K05A 3HL2A 4IXOA 1X2AA 1S06A 1CJ0A 3ELEA 2R0TA 2R5CA 1C9CA 3A8UX 4MQPA 3LY1A 1WYVA 2W8VA 2EPJA 2VMVA 3DR4A 2AY3A 2JG2A 3K7YA 5D95A 1IAYA 5FT5A 4DGTA 4EFFA 1CS1A 2NMPA 1M0NA 1I41A 4JF1A 3GZDC 3VAXA 3UAKA 2ZYJA 3ELPA 4MQRA 3NYUA 1AX4A 4DBCA 5K8BA 1IJIA 4M2KA 3FQ7A 1M4NA 4BHDA 2DKBA 1CQ7A 3R9AA 1MLZA 2VMZA 4XJOA 2VLFA 1AHFA 1AKCA 2HP1A 3B1CA 3B46A 3H14A 2DGLA 1DJEA 2BHXA 4P3MA 3OP7A 2QSRA 5E5IA 5G4JA 1ASNA 2ZY2A 2V0YA 2X3LA 3E2ZB 3FVXA 5G09A 4ZM4A 1D7UA 1KMJA 4EB7A 3MAFB 1TARA 4KYOA 4AZKA 2WK7A 2QMAA 4U2HA 2PO3A 1QIRA 4ADCA 2CJGA 3AEJC 1YIZA 2D66A 2JJEA 1LC7A 1WYUB 1Y4IA 1AY8A 1O4SA 3CQ4A 3NDNA 3JZLA 1CZCA 1EJIA 3T32A 3PD6B 3MEBA 2WK9A 3MBBA 3EUCA 1H1CA 1JG8A 2GMSA 4W5KA 5HHYA 1UU2A 5LH9A 2GSAA 4L0OA 2OQXA 1C7NA 1TPLA 1ORDA 2YRIA 1IX6A 3W1IA 1PMOA 2VGTA 3E77A 3CQ5A 4M2JA 4RKCA 4CXQA 1T3IA 3ACZA 1VEFA 3L44A 4XEWA 4ZDLA 3FZ7A 4Q75A 2Z61A 3GJUA 3KKIA 5EFSA 2HOZA 1N2TA 2Z67A 4TV7A 3N4SA 1BT4A 4F5MA 3N5MA 2W7MA 4BA4A 1KKJA 1N8PA 1LS3A 4EU1A 1LC5A 2FNIA 3BCXA 2BIAA 3N4XA 3N75A 3I4JA 1AY5A 2AY4A 2VMTA 2D63A 4W1WA 1MDXA 4WYDA 5E3KA 5DX5A 2W7KA 2Z9XA 3GSBA 5G0AA 2Z9VA 1QGNA 1DJUA 3F6TA 3TCMA 1KL1A 1SFFA 1IBJA 2VMNA 1WYTA 2D7ZA 3F0HA 3QN6A 4BQ0A 3MC6C 3Q8NA 1CQ8A 4OC9A 3A9ZA 4ITXA 1AHGA 3VK4A 4WXBA 2OKKA 2EZ2A 2R5CB 2W7DA 1V2DA 4RJYA 2W8WA 1DTYA 3PJ0A 3FZ6A 4GDYA 4PVFA 4QGRA 4A6UA 5G2PA 3G7QA 1GC4A 1LKCA 2FYFA 1SZUA 2EZ1A 1AHXA 1XI9A 2AY7A 3COGA 3KGXA 2CTZA 1ARIA 2EGYA 4RAEA 1FG3A 2ZSLA 2F8JA 1C7OA 1IAXA 1IX7A 4TMRA 4W8IA 1AHEA 3UE8A 3FFHA 1G7WA 2TPLA 4ATPA 4E77A 3EI8A 4LW2A 1WKHA 4ITGA 1W7MA 2CSTA 4BMKA 2CJHA 1I29A 4IXSA 4MY5A 1GDEA 1B5OA 1YNUA 2GB3A 2VMXA 4E1OA 4MGRA 4A00A 1MDZA 4LNLA 2Z20A 5EUDA 3N4RA 2VMUA 5EQCA 3FFRA 2Z9WA 4JEVA 3FCRA 4RITA 4RKDA 3E9KA 4Q6RA 2FNUA 3BC8A 1ASBA 4JEWA 1S0AA 1TOEA 4WYCA 3W1HA 2E7JA 1CL2A 1C7GA 2E7UA 1DJ9A 3RBFA 1BJOA 3BB8A 1PG8A 2Z9UA 2GMUA 3B1EA 3JWBA 3P1TA 4W1XA 3EI9A 4FL0A 1M0PA 3JW9A 3H7FA 1MGVA 1ASGA 4K2BA 4CBSA 4CXRA 5JAYA 3B1DA 3WGBA 2E7IA 3AELA 4LW4A 1D7SA 1DKAA 2JJHA 3FQ8A 4ATQA 4A0HA 1GEYA 1U08A 3AENA 3E6GA 4DQ6A 3CBFA 1ASDA 3H9XA 3MADA 4AH3A 2HUUA 2FN6A 4IYOA 4UHNA 3HMUA 3FTBA 4M2MA 3ZZJA 3GZCA 3II0A 1BJWA 3PIUA 5F9SA 2QB2A 3BWNA 1N31A 2QB3A 4U1TA 4F5FA 2CJDA 3HVYA 3CAIA 3WY7A 2YKVA 8AATA 1IX8A 3OKSA 2DGMA 3LVLB 5TF5A 1DGEA 2A1VA 4N0BA 4W1VA 2C0RA 3RCHA 4WXGA 1ARSA 2EYQA 1BS0A 1SPAA 3LWSA 5M46A 4PIWA 5FT6A 4F5LA 4ZASA 1AKBA 1LC8A 3NNKA 4WP0A 2AY9A 1P3WA 4LNJA 5M4BA 2KFPA 1PFFA 2XBNA 1D7VA 4Y0HA 1V2EA 2OGAA 1PMMA 2YHKA 3I16A 3NYTA 3F9TA 1OHYA 4IX8A 1AKAA 1RVYA 1AMRA 2CFBA 2W8JA 2BWOA 1GEXA 3AEMA 4ADEA 1AAWA 4JEYA 1TOIA 3DR7A 4A6RA 4HVKA 2WB6A 4H63Q 1OATA 3WX9A 3CQ6A 1X29A 1YIYA 4AO9A 2YCNA 3EI6A 2JGTA 3FDBA 4HF8A 1X28A 2QLRA 2W7JA 3QPGA 2HP2A 3NU7A 2VGSA 2BIEA 3FVUA 5BJ3A 4UHMA 3HT4A 9AATA 3AEOA 2YKYA 2HORA 1E5FA 3GBXA 2DGKA 1H0CA 1S09A 1G4VA 1ARTA 3RUYA 1AY4A 3DYDA 1QJ5A 2V1PA 4IY7A 4E3RA 1AHYA 2AATA 1S08A 1YOOA 3PAAA 3ZRRA 5HXXA 1BW0A 3ASAA 2YRRA 2RFVA 1ASAA 3QHXA 4PFNA 4ZLVA 4N0WA 3PDXA 1BJOB 1YJSA 2HUIA 4NOGA 2BI9A 4OCAA 3G0TA 3ZRPA 4A72A 2FM1A 3FD0A 1TOKA 3PPLA 4XJPA 5E4ZA 5HDMA 4R5ZA 5G4IA 3DRDA 2C81A 1YJZA 4ZSWA 3WCOA 1VJOA 1ASLA 3FDDA 1WYVB 4P7YA 3BS8A 3AENB 1CL1A 2BWNA 4JEZA 2W8TA 3VK3A 1ARGA 4OT8A 5M49A 1ASFA 5DB5A 4IYOB 1OXPA 1QZ9A 4IW7A 5DJ1A 1J04A 3FRKA 3FQAA 4K2IA 3PA9A 1M32A 7AATA 1S07A 4OTLA 1WYUA 3ECDA 2CH1A 2VGVA 3AATA 4IXZA 4K2MA 4EB5A 2VMOA 2VI8A 1Z3ZA 3NUIA 5EAVA 3QBOA 4WLHA 4E3QA 2VMQA 4XAUA 5LHAA 1AMSA 1GC2A 4WXFA 1D7RA 4WD2A 1LK9A 4B98A 1TOJA 2VGZA 3TATA 4WB0A 1TOGA 2ZJGA 1SZKA 1WSTA 4Q76A 2D5YA 1G4XA 3ZZKA 1ELQA 4F5JA 2O1BA 2BI3A 1CQ6A 3GZDA 4GEBA 4LNMA 5J8QA 2AY1A 1X0MA 1ELUA 3EIAA 2YOBA 3EI7A 3MAUA 1M0OA 4RM1A 4AO4A 3A9XA 1UU0A 1B8GA 2EO5A 2VI9A 5I92A 2QBTA 2AY5A 1AJSA 2ZSMA 3FKDA 3RQ1A 4B9BA 3VOMA 1B5PA 4A0RA 1G7XA 2YKXA 1SZSA 4ISYA 1JF9A 2BYLA 5C6UA 3TFTA 1O61A 2W7HA 1YJYA 2HZPA 2OGEA 2DOUA 3QM2A 4XJLA 3NRAA 2W7LA 4ZDPA 1BJ4A 2Z1ZA 1V2FA 1RV4A 2CANA 3AEJA 3BN1A 3DZZA 3M5UA 2G6WA 5DJ9A 3WLXA 4CVQA 4F5IA 4WYEA 4Y0DA 1OHVA 3PDBA 2AY2A 4AZJA 4KXKA 3JU7A 2YCTA 3R4TA 1AICA 1QISA 4I8AA 3NU8A 5BJ4A 2X5DA 1MDOA 3RBLA 3EI5A 1AAMA 4A6TA 2CB1A 4BA5A 3PGYA 4TN4A 2AY6A 1JS3A 4OBVA 2W7FA 2W7GA 1EG5A 1ECXA 3K40A 1B9IA 1OXOA 3FVSA 2R2NA 3AOWA 2CINA 4GE9A 1WYTB 4GSAA 3LV2A 2VMRA 3WKRA 2OATA 4WYFA 3B8XA 3WKSA 3FZ8A 1TASA 3DU4A 3HLMA 3DC1A 1I43A 5EAAA 2DKJA 3VP6A 4F5HA 1BQDA 2W8UA 1GBNA 4ADDA 3FSLA 2BIGA 4UHOA 1JS6A 4XK1A 2VGUA 1WKGA 3TQXA 1ASCA 2ZC0A 4WYAA 2W7IA 2AEVA 5D5SA 3RI6A 2G7JA 3EZ1A 1KL2A 1YAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQT A;  4F5G A;  1GC3 A;  1AJR A;  3E2Y A;  3QI6 A;  1GD9 A;  1DFO A;  1RV3 A;  2BI1 A;  2FQ6 A;  1AMQ A;  3AV7 A;  1BJN A;  3QGU A;  3A9Y A;  3MC6 A;  5FT8 A;  3NYS A;  4Y0I A;  3DXW A;  2VIA A;  4ZM3 A;  2X8U A;  2GQN A;  1V72 A;  1AIA A;  5EIG A;  1B9H A;  3ATH A;  1OHW A;  4F4E A;  4GRX A;  1O69 A;  4R5F A;  1Z7D A;  2ORD A;  3ISL A;  4J8L A;  4ZWV A;  3EZS A;  1M7Y A;  2O7C A;  1UKJ A;  4H51 A;  3BWN C;  1ARH A;  2QA3 A;  3BV0 A;  3GET A;  2D65 A;  1O62 A;  4WB0 B;  1RVU A;  2D64 A;  3JWA A;  3LVM A;  1M0Q A;  4CBR A;  1MLY A;  4FFC A;  4OBU A;  3K28 A;  2VGW A;  1CZE A;  3D6K A;  4EMY A;  4Q31 A;  4XJM A;  5G2Q A;  1SF2 A;  3L8A A;  1IVR A;  4OYT A;  2DR1 A;  4ZWM A;  2X5F A;  4WBT A;  1KMK A;  4LC3 A;  4MKK A;  1AIB A;  3HBX A;  1AJS B;  2VMP A;  2XH1 A;  4RLG A;  5EUE A;  1ZC9 A;  1LW4 A;  2CH2 A;  1MAP A;  3DXV A;  1DGD A;  3KGW A;  3MKJ A;  3BCA A;  4WLJ A;  4R2N A;  4WYG A;  1BKG A;  3JTX A;  1EQB A;  2W7E A;  3LVJ A;  4ADB A;  2BKW A;  3DOD A;  5FT4 A;  1KKP A;  3GR9 A;  5AX8 A;  1SVV A;  4ZSY A;  4XQ2 A;  3ASB A;  3E2Z A;  4JEX A;  4OMA A;  2AY8 A;  3PDB B;  1FC4 A;  2HOY A;  2Q7W A;  3AEM C;  3AOV A;  1W3U A;  3MAF A;  3AEP A;  3USF A;  1QJ3 A;  2JJF A;  3HDO A;  3VK2 A;  2BI5 A;  3IHJ A;  2YKU A;  2CY8 A;  4A0F A;  2D61 A;  3EIB A;  1W23 A;  4PFF A;  4MKJ A;  1D2F A;  2ZUK A;  3A2B A;  3P6K A;  2ZY3 A;  1ZOD A;  2VIB A;  2PB2 A;  1ASE A;  1QIT A;  2D7Y A;  1LW5 A;  3LVK A;  1M6S A;  1XEY A;  3PD6 A;  1GEW A;  4GE4 A;  3RCH B;  2R5E A;  1GC0 A;  3NTJ A;  2Z1Y A;  4RJ0 A;  3BWO A;  2E54 A;  3BCB A;  3GWP A;  3G8M A;  3W1J A;  1UU1 A;  2C7T A;  1C4K A;  2VMS A;  1E5E A;  3NUB A;  1MAQ A;  2OKJ A;  1FG7 A;  2ZY4 A;  2PB0 A;  1GCK A;  2WK8 A;  3UWC A;  1ASM A;  4UOY A;  3KE3 A;  1I48 A;  1ZOB A;  4JE5 D;  4UQV A;  1J32 A;  4GE7 A;  2EH6 A;  2HUF A;  3E2F A;  3NX3 A;  1W7N A;  4ZDO A;  4O6Z A;  3I5T A;  4W91 A;  3TFU A;  4RIZ A;  2WKA A;  2AEU A;  4F5K A;  2JIS A;  5F8V A;  2ZY5 A;  1W7L A;  3ZRQ A;  2ZP7 A;  4A0G A;  5IWQ A;  4R8D A;  4MSO A;  3WZF A;  2BWP A;  4JF0 A;  5M4D A;  2VMW A;  2JJG A;  2VLH A;  2VMY A;  3N0L A;  4AOA A;  4MQQ A;  2HOX A;  1C0N A;  3WGC A;  2VYC A;  1IUG A;  3LG0 A;  2BYJ A;  2BI2 A;  5EIG B;  4ZAH A;  1B4X A;  5EUN A;  1BQA A;  4KAM A;  4JE5 A;  1AMA A;  2YCP A;  1VP4 A;  3WCN A;  2C44 A;  2O0R A;  3IF2 A;  1TAT A;  4J5U A;  3HL2 A;  4IXO A;  1X2A A;  1S06 A;  1CJ0 A;  3ELE A;  2R0T A;  2R5C A;  1C9C A;  3A8U X;  4MQP A;  3LY1 A;  1WYV A;  2W8V A;  2EPJ A;  2VMV A;  3DR4 A;  2AY3 A;  2JG2 A;  3K7Y A;  5D95 A;  1IAY A;  5FT5 A;  4DGT A;  4EFF A;  1CS1 A;  2NMP A;  1M0N A;  1I41 A;  4JF1 A;  3GZD C;  3VAX A;  3UAK A;  2ZYJ A;  3ELP A;  4MQR A;  3NYU A;  1AX4 A;  4DBC A;  5K8B A;  1IJI A;  4M2K A;  3FQ7 A;  1M4N A;  4BHD A;  2DKB A;  1CQ7 A;  3R9A A;  1MLZ A;  2VMZ A;  4XJO A;  2VLF A;  1AHF A;  1AKC A;  2HP1 A;  3B1C A;  3B46 A;  3H14 A;  2DGL A;  1DJE A;  2BHX A;  4P3M A;  3OP7 A;  2ZY2 A;  5E5I A;  5G4J A;  1ASN A;  2V0Y A;  2X3L A;  3E2Z B;  3FVX A;  5G09 A;  4ZM4 A;  1D7U A;  1KMJ A;  4EB7 A;  3MAF B;  1TAR A;  4KYO A;  4AZK A;  2WK7 A;  2QMA A;  4U2H A;  2PO3 A;  1QIR A;  4ADC A;  2CJG A;  3AEJ C;  1YIZ A;  2D66 A;  2JJE A;  1LC7 A;  1WYU B;  1Y4I A;  1AY8 A;  1O4S A;  3CQ4 A;  3NDN A;  3JZL A;  1CZC A;  1EJI A;  3T32 A;  3PD6 B;  3MEB A;  2WK9 A;  3MBB A;  3EUC A;  1H1C A;  1JG8 A;  2GMS A;  4W5K A;  5HHY A;  1UU2 A;  5LH9 A;  2GSA A;  4L0O A;  2OQX A;  1C7N A;  1TPL A;  1ORD A;  2YRI A;  1IX6 A;  3W1I A;  1PMO A;  2VGT A;  3E77 A;  3CQ5 A;  4M2J A;  4RKC A;  4CXQ A;  1T3I A;  3ACZ A;  1VEF A;  3L44 A;  4XEW A;  4ZDL A;  3FZ7 A;  4Q75 A;  2Z61 A;  3GJU A;  3KKI A;  5EFS A;  2HOZ A;  1N2T A;  2Z67 A;  4TV7 A;  1BT4 A;  4F5M A;  3N5M A;  2W7M A;  4BA4 A;  1KKJ A;  1N8P A;  1LS3 A;  4EU1 A;  1LC5 A;  2FNI A;  3BCX A;  2BIA A;  3N75 A;  3I4J A;  1AY5 A;  2AY4 A;  2VMT A;  2D63 A;  4W1W A;  1MDX A;  4WYD A;  5E3K A;  5DX5 A;  2W7K A;  2Z9X A;  3GSB A;  5G0A A;  2Z9V A;  1QGN A;  1DJU A;  3F6T A;  3TCM A;  1KL1 A;  1SFF A;  1IBJ A;  2VMN A;  1WYT A;  2D7Z A;  3F0H A;  3QN6 A;  4BQ0 A;  3MC6 C;  3Q8N A;  1CQ8 A;  4OC9 A;  3A9Z A;  4ITX A;  1AHG A;  3VK4 A;  4WXB A;  2OKK A;  2EZ2 A;  2R5C B;  2W7D A;  1V2D A;  4RJY A;  2W8W A;  1DTY A;  3PJ0 A;  3FZ6 A;  4GDY A;  4PVF A;  4QGR A;  4A6U A;  5G2P A;  3G7Q A;  1GC4 A;  1LKC A;  2FYF A;  1SZU A;  2EZ1 A;  1AHX A;  1XI9 A;  2AY7 A;  3COG A;  3KGX A;  2CTZ A;  1ARI A;  2EGY A;  4RAE A;  1FG3 A;  2ZSL A;  2F8J A;  1C7O A;  1IAX A;  1IX7 A;  4TMR A;  4W8I A;  1AHE A;  3UE8 A;  3FFH A;  1G7W A;  2TPL A;  4ATP A;  4E77 A;  3EI8 A;  4LW2 A;  1WKH A;  4ITG A;  1W7M A;  2CST A;  4BMK A;  2CJH A;  1I29 A;  4IXS A;  4MY5 A;  1GDE A;  1B5O A;  1YNU A;  2GB3 A;  2VMX A;  4E1O A;  4MGR A;  4A00 A;  1MDZ A;  4LNL A;  2Z20 A;  5EUD A;  2VMU A;  5EQC A;  3FFR A;  2Z9W A;  4JEV A;  3FCR A;  4RIT A;  4RKD A;  3E9K A;  4Q6R A;  2FNU A;  3BC8 A;  1ASB A;  4JEW A;  1S0A A;  1TOE A;  4WYC A;  3W1H A;  2E7J A;  1CL2 A;  1C7G A;  2E7U A;  1DJ9 A;  3RBF A;  1BJO A;  3BB8 A;  1PG8 A;  2Z9U A;  2GMU A;  3B1E A;  3JWB A;  3P1T A;  4W1X A;  3EI9 A;  4FL0 A;  1M0P A;  3JW9 A;  3H7F A;  1MGV A;  1ASG A;  4K2B A;  4CBS A;  4CXR A;  5JAY A;  3B1D A;  3WGB A;  2E7I A;  3AEL A;  4LW4 A;  1D7S A;  1DKA A;  2JJH A;  3FQ8 A;  4ATQ A;  4A0H A;  1GEY A;  1U08 A;  3AEN A;  3E6G A;  4DQ6 A;  3CBF A;  1ASD A;  3MAD A;  4AH3 A;  2HUU A;  2FN6 A;  4IYO A;  4UHN A;  3HMU A;  3FTB A;  4M2M A;  3ZZJ A;  3GZC A;  3II0 A;  1BJW A;  3PIU A;  5F9S A;  2QB2 A;  3BWN A;  1N31 A;  2QB3 A;  4U1T A;  4F5F A;  2CJD A;  3HVY A;  3CAI A;  3WY7 A;  2YKV A;  8AAT A;  1IX8 A;  3OKS A;  2DGM A;  3LVL B;  5TF5 A;  1DGE A;  4N0B A;  4W1V A;  2C0R A;  3RCH A;  4WXG A;  1ARS A;  1BS0 A;  1SPA A;  3LWS A;  5M46 A;  4PIW A;  5FT6 A;  4F5L A;  4ZAS A;  1AKB A;  1LC8 A;  3NNK A;  4WP0 A;  2AY9 A;  1P3W A;  4LNJ A;  5M4B A;  1PFF A;  2XBN A;  1D7V A;  4Y0H A;  1V2E A;  2OGA A;  1PMM A;  2YHK A;  3I16 A;  3NYT A;  3F9T A;  1OHY A;  4IX8 A;  1AKA A;  1RVY A;  1AMR A;  2CFB A;  2W8J A;  2BWO A;  1GEX A;  3AEM A;  4ADE A;  1AAW A;  4JEY A;  1TOI A;  3DR7 A;  4A6R A;  4HVK A;  1OAT A;  3WX9 A;  3CQ6 A;  1X29 A;  1YIY A;  4AO9 A;  2YCN A;  3EI6 A;  2JGT A;  3FDB A;  4HF8 A;  1X28 A;  2QLR A;  2W7J A;  3QPG A;  2HP2 A;  3NU7 A;  2VGS A;  2BIE A;  3FVU A;  5BJ3 A;  4UHM A;  3HT4 A;  9AAT A;  3AEO A;  2YKY A;  2HOR A;  1E5F A;  3GBX A;  2DGK A;  1H0C A;  1S09 A;  1G4V A;  1ART A;  3RUY A;  1AY4 A;  3DYD A;  1QJ5 A;  2V1P A;  4IY7 A;  4E3R A;  1AHY A;  2AAT A;  1S08 A;  1YOO A;  3PAA A;  3ZRR A;  5HXX A;  1BW0 A;  3ASA A;  2YRR A;  2RFV A;  1ASA A;  3QHX A;  4PFN A;  4ZLV A;  4N0W A;  3PDX A;  1BJO B;  1YJS A;  2HUI A;  4NOG A;  2BI9 A;  4OCA A;  3G0T A;  3ZRP A;  4A72 A;  2FM1 A;  3FD0 A;  1TOK A;  3PPL A;  4XJP A;  5E4Z A;  5HDM A;  4R5Z A;  5G4I A;  3DRD A;  2C81 A;  1YJZ A;  4ZSW A;  3WCO A;  1VJO A;  1ASL A;  3FDD A;  1WYV B;  4P7Y A;  3BS8 A;  3AEN B;  1CL1 A;  2BWN A;  4JEZ A;  2W8T A;  3VK3 A;  1ARG A;  4OT8 A;  5M49 A;  1ASF A;  5DB5 A;  4IYO B;  1OXP A;  1QZ9 A;  4IW7 A;  5DJ1 A;  1J04 A;  3FRK A;  3FQA A;  4K2I A;  3PA9 A;  1M32 A;  7AAT A;  1S07 A;  4OTL A;  1WYU A;  3ECD A;  2CH1 A;  2VGV A;  3AAT A;  4IXZ A;  4K2M A;  4EB5 A;  2VMO A;  2VI8 A;  1Z3Z A;  3NUI A;  5EAV A;  3QBO A;  4WLH A;  4E3Q A;  2VMQ A;  4XAU A;  5LHA A;  1AMS A;  1GC2 A;  4WXF A;  1D7R A;  4WD2 A;  1LK9 A;  4B98 A;  1TOJ A;  2VGZ A;  3TAT A;  4WB0 A;  1TOG A;  2ZJG A;  1SZK A;  1WST A;  4Q76 A;  2D5Y A;  1G4X A;  3ZZK A;  1ELQ A;  4F5J A;  2O1B A;  2BI3 A;  1CQ6 A;  3GZD A;  4GEB A;  4LNM A;  5J8Q A;  2AY1 A;  1X0M A;  1ELU A;  3EIA A;  2YOB A;  3EI7 A;  3MAU A;  1M0O A;  4RM1 A;  4AO4 A;  3A9X A;  1UU0 A;  1B8G A;  2EO5 A;  2VI9 A;  5I92 A;  2QBT A;  2AY5 A;  1AJS A;  2ZSM A;  3FKD A;  3RQ1 A;  4B9B A;  3VOM A;  1B5P A;  4A0R A;  1G7X A;  2YKX A;  1SZS A;  4ISY A;  1JF9 A;  2BYL A;  5C6U A;  3TFT A;  1O61 A;  2W7H A;  1YJY A;  2HZP A;  2OGE A;  2DOU A;  3QM2 A;  4XJL A;  3NRA A;  2W7L A;  4ZDP A;  1BJ4 A;  2Z1Z A;  1V2F A;  1RV4 A;  2CAN A;  3AEJ A;  3BN1 A;  3DZZ A;  3M5U A;  2G6W A;  5DJ9 A;  3WLX A;  4CVQ A;  4F5I A;  4WYE A;  4Y0D A;  1OHV A;  3PDB A;  2AY2 A;  4AZJ A;  4KXK A;  3JU7 A;  2YCT A;  3R4T A;  1AIC A;  1QIS A;  4I8A A;  3NU8 A;  5BJ4 A;  2X5D A;  1MDO A;  3RBL A;  3EI5 A;  1AAM A;  4A6T A;  2CB1 A;  4BA5 A;  3PGY A;  4TN4 A;  2AY6 A;  1JS3 A;  4OBV A;  2W7F A;  2W7G A;  1EG5 A;  1ECX A;  3K40 A;  1B9I A;  1OXO A;  3FVS A;  2R2N A;  3AOW A;  2CIN A;  4GE9 A;  1WYT B;  4GSA A;  3LV2 A;  2VMR A;  3WKR A;  2OAT A;  4WYF A;  3B8X A;  3WKS A;  3FZ8 A;  1TAS A;  3DU4 A;  3HLM A;  3DC1 A;  1I43 A;  5EAA A;  2DKJ A;  3VP6 A;  4F5H A;  1BQD A;  2W8U A;  1GBN A;  4ADD A;  3FSL A;  2BIG A;  4UHO A;  1JS6 A;  4XK1 A;  2VGU A;  1WKG A;  3TQX A;  1ASC A;  2ZC0 A;  4WYA A;  2W7I A;  2AEV A;  5D5S A;  3RI6 A;  3EZ1 A;  1KL2 A;  1YAA A; 
#chains in the Genus database with same CATH topology
 3HQT A;  4F5G A;  1GC3 A;  1AJR A;  3E2Y A;  3QI6 A;  1GD9 A;  1DFO A;  1RV3 A;  2BI1 A;  2FQ6 A;  1AMQ A;  3AV7 A;  1BJN A;  3QGU A;  3A9Y A;  3MC6 A;  5FT8 A;  3NYS A;  4Y0I A;  5KTB A;  3DXW A;  2VIA A;  4ZM3 A;  2X8U A;  2GQN A;  1V72 A;  1AIA A;  5EIG A;  1B9H A;  3ATH A;  1OHW A;  4F4E A;  4GRX A;  1O69 A;  4R5F A;  1Z7D A;  2ORD A;  3ISL A;  4J8L A;  4ZWV A;  2FKI A;  3EZS A;  1M7Y A;  2O7C A;  1UKJ A;  4H51 A;  3BWN C;  1ARH A;  2QA3 A;  3BV0 A;  3GET A;  2D65 A;  1O62 A;  4WB0 B;  1RVU A;  2D64 A;  3JWA A;  3LVM A;  1M0Q A;  4CBR A;  1MLY A;  4FFC A;  4OBU A;  3K28 A;  2VGW A;  1CZE A;  3D6K A;  4EMY A;  4Q31 A;  4XJM A;  5G2Q A;  3N7N A;  1SF2 A;  3L8A A;  1IVR A;  4OYT A;  2DR1 A;  4ZWM A;  2X5F A;  4WBT A;  1KMK A;  4LC3 A;  4MKK A;  1AIB A;  3HBX A;  1AJS B;  2VMP A;  2XH1 A;  4RLG A;  5EUE A;  1ZC9 A;  1LW4 A;  2CH2 A;  1MAP A;  3DXV A;  1DGD A;  3KGW A;  3MKJ A;  3BCA A;  4WLJ A;  4R2N A;  4WYG A;  1BKG A;  3JTX A;  1EQB A;  2W7E A;  3LVJ A;  4ADB A;  2BKW A;  3DOD A;  5FT4 A;  1KKP A;  3GR9 A;  5AX8 A;  1SVV A;  4ZSY A;  4XQ2 A;  3ASB A;  3E2Z A;  4JEX A;  4OMA A;  2AY8 A;  3PDB B;  1FC4 A;  2HOY A;  2Q7W A;  3AEM C;  3AOV A;  1W3U A;  3MAF A;  3AEP A;  3USF A;  1QJ3 A;  2JJF A;  3HDO A;  3VK2 A;  2BI5 A;  3IHJ A;  2YKU A;  2CY8 A;  4A0F A;  2D61 A;  3EIB A;  1W23 A;  4PFF A;  4MKJ A;  1D2F A;  2ZUK A;  3A2B A;  3P6K A;  2ZY3 A;  1ZOD A;  2VIB A;  2PB2 A;  1ASE A;  1QIT A;  2D7Y A;  1LW5 A;  3LVK A;  1M6S A;  1XEY A;  3PD6 A;  1GEW A;  4GE4 A;  3RCH B;  2R5E A;  1GC0 A;  3NTJ A;  2Z1Y A;  4RJ0 A;  3BWO A;  2E54 A;  3BCB A;  3GWP A;  3G8M A;  3W1J A;  1UU1 A;  2C7T A;  1C4K A;  2VMS A;  1E5E A;  3NUB A;  1MAQ A;  2OKJ A;  1FG7 A;  2ZY4 A;  2PB0 A;  1GCK A;  2WK8 A;  3UWC A;  1ASM A;  4UOY A;  3KE3 A;  1I48 A;  1ZOB A;  4JE5 D;  4UQV A;  1J32 A;  4GE7 A;  2EH6 A;  2HUF A;  3E2F A;  3NX3 A;  1W7N A;  4ZDO A;  4O6Z A;  3I5T A;  4W91 A;  3TFU A;  4RIZ A;  2WKA A;  2AEU A;  4F5K A;  2JIS A;  5F8V A;  2ZY5 A;  1W7L A;  3ZRQ A;  2ZP7 A;  4A0G A;  5IWQ A;  4R8D A;  4MSO A;  3WZF A;  2BWP A;  4JF0 A;  5M4D A;  2VMW A;  2JJG A;  2VLH A;  2VMY A;  3N0L A;  4AOA A;  4MQQ A;  2HOX A;  1C0N A;  3WGC A;  2VYC A;  1IUG A;  3LG0 A;  2BYJ A;  2BI2 A;  5EIG B;  4ZAH A;  1B4X A;  5EUN A;  1BQA A;  4KAM A;  4JE5 A;  1AMA A;  2YCP A;  1VP4 A;  3WCN A;  2C44 A;  2O0R A;  3IF2 A;  1TAT A;  4J5U A;  4K05 A;  3HL2 A;  4IXO A;  1X2A A;  1S06 A;  1CJ0 A;  3ELE A;  2R0T A;  2R5C A;  1C9C A;  3A8U X;  4MQP A;  3LY1 A;  1WYV A;  2W8V A;  2EPJ A;  2VMV A;  3DR4 A;  2AY3 A;  2JG2 A;  3K7Y A;  5D95 A;  1IAY A;  5FT5 A;  4DGT A;  4EFF A;  1CS1 A;  2NMP A;  1M0N A;  1I41 A;  4JF1 A;  3GZD C;  3VAX A;  3UAK A;  2ZYJ A;  3ELP A;  4MQR A;  3NYU A;  1AX4 A;  4DBC A;  5K8B A;  1IJI A;  4M2K A;  3FQ7 A;  1M4N A;  4BHD A;  2DKB A;  1CQ7 A;  3R9A A;  1MLZ A;  2VMZ A;  4XJO A;  2VLF A;  1AHF A;  1AKC A;  2HP1 A;  3B1C A;  3B46 A;  3H14 A;  2DGL A;  1DJE A;  2BHX A;  4P3M A;  3OP7 A;  2QSR A;  5E5I A;  5G4J A;  1ASN A;  2ZY2 A;  2V0Y A;  2X3L A;  3E2Z B;  3FVX A;  5G09 A;  4ZM4 A;  1D7U A;  1KMJ A;  4EB7 A;  3MAF B;  1TAR A;  4KYO A;  4AZK A;  2WK7 A;  2QMA A;  4U2H A;  2PO3 A;  1QIR A;  4ADC A;  2CJG A;  3AEJ C;  1YIZ A;  2D66 A;  2JJE A;  1LC7 A;  1WYU B;  1Y4I A;  1AY8 A;  1O4S A;  3CQ4 A;  3NDN A;  3JZL A;  1CZC A;  1EJI A;  3T32 A;  3PD6 B;  3MEB A;  2WK9 A;  3MBB A;  3EUC A;  1H1C A;  1JG8 A;  2GMS A;  4W5K A;  5HHY A;  1UU2 A;  5LH9 A;  2GSA A;  4L0O A;  2OQX A;  1C7N A;  1TPL A;  1ORD A;  2YRI A;  1IX6 A;  3W1I A;  1PMO A;  2VGT A;  3E77 A;  3CQ5 A;  4M2J A;  4RKC A;  4CXQ A;  1T3I A;  3ACZ A;  1VEF A;  3L44 A;  4XEW A;  4ZDL A;  3FZ7 A;  4Q75 A;  2Z61 A;  3GJU A;  3KKI A;  5EFS A;  2HOZ A;  1N2T A;  2Z67 A;  4TV7 A;  3N4S A;  1BT4 A;  4F5M A;  3N5M A;  2W7M A;  4BA4 A;  1KKJ A;  1N8P A;  1LS3 A;  4EU1 A;  1LC5 A;  2FNI A;  3BCX A;  2BIA A;  3N4X A;  3N75 A;  3I4J A;  1AY5 A;  2AY4 A;  2VMT A;  2D63 A;  4W1W A;  1MDX A;  4WYD A;  5E3K A;  5DX5 A;  2W7K A;  2Z9X A;  3GSB A;  5G0A A;  2Z9V A;  1QGN A;  1DJU A;  3F6T A;  3TCM A;  1KL1 A;  1SFF A;  1IBJ A;  2VMN A;  1WYT A;  2D7Z A;  3F0H A;  3QN6 A;  4BQ0 A;  3MC6 C;  3Q8N A;  1CQ8 A;  4OC9 A;  3A9Z A;  4ITX A;  1AHG A;  3VK4 A;  4WXB A;  2OKK A;  2EZ2 A;  2R5C B;  2W7D A;  1V2D A;  4RJY A;  2W8W A;  1DTY A;  3PJ0 A;  3FZ6 A;  4GDY A;  4PVF A;  4QGR A;  4A6U A;  5G2P A;  3G7Q A;  1GC4 A;  1LKC A;  2FYF A;  1SZU A;  2EZ1 A;  1AHX A;  1XI9 A;  2AY7 A;  3COG A;  3KGX A;  2CTZ A;  1ARI A;  2EGY A;  4RAE A;  1FG3 A;  2ZSL A;  2F8J A;  1C7O A;  1IAX A;  1IX7 A;  4TMR A;  4W8I A;  1AHE A;  3UE8 A;  3FFH A;  1G7W A;  2TPL A;  4ATP A;  4E77 A;  3EI8 A;  4LW2 A;  1WKH A;  4ITG A;  1W7M A;  2CST A;  4BMK A;  2CJH A;  1I29 A;  4IXS A;  4MY5 A;  1GDE A;  1B5O A;  1YNU A;  2GB3 A;  2VMX A;  4E1O A;  4MGR A;  4A00 A;  1MDZ A;  4LNL A;  2Z20 A;  5EUD A;  3N4R A;  2VMU A;  5EQC A;  3FFR A;  2Z9W A;  4JEV A;  3FCR A;  4RIT A;  4RKD A;  3E9K A;  4Q6R A;  2FNU A;  3BC8 A;  1ASB A;  4JEW A;  1S0A A;  1TOE A;  4WYC A;  3W1H A;  2E7J A;  1CL2 A;  1C7G A;  2E7U A;  1DJ9 A;  3RBF A;  1BJO A;  3BB8 A;  1PG8 A;  2Z9U A;  2GMU A;  3B1E A;  3JWB A;  3P1T A;  4W1X A;  3EI9 A;  4FL0 A;  1M0P A;  3JW9 A;  3H7F A;  1MGV A;  1ASG A;  4K2B A;  4CBS A;  4CXR A;  5JAY A;  3B1D A;  3WGB A;  2E7I A;  3AEL A;  4LW4 A;  1D7S A;  1DKA A;  2JJH A;  3FQ8 A;  4ATQ A;  4A0H A;  1GEY A;  1U08 A;  3AEN A;  3E6G A;  4DQ6 A;  3CBF A;  1ASD A;  1KAF A;  3MAD A;  3H9X A;  4AH3 A;  2HUU A;  2FN6 A;  4IYO A;  4UHN A;  3HMU A;  3FTB A;  4M2M A;  3ZZJ A;  3GZC A;  3II0 A;  1BJW A;  3PIU A;  5F9S A;  2QB2 A;  3BWN A;  1N31 A;  2QB3 A;  4U1T A;  4F5F A;  2CJD A;  3HVY A;  3CAI A;  3WY7 A;  2YKV A;  8AAT A;  1IX8 A;  3OKS A;  2DGM A;  3LVL B;  5TF5 A;  1DGE A;  2A1V A;  4N0B A;  4W1V A;  2C0R A;  3RCH A;  4WXG A;  1ARS A;  2EYQ A;  1BS0 A;  1SPA A;  3LWS A;  5M46 A;  4PIW A;  5FT6 A;  4F5L A;  4ZAS A;  1AKB A;  1LC8 A;  3NNK A;  4WP0 A;  2AY9 A;  1P3W A;  4LNJ A;  5M4B A;  2KFP A;  1PFF A;  2XBN A;  1D7V A;  4Y0H A;  1V2E A;  2OGA A;  1PMM A;  2YHK A;  3I16 A;  3NYT A;  3F9T A;  1OHY A;  4IX8 A;  1AKA A;  1RVY A;  1AMR A;  2CFB A;  2W8J A;  2BWO A;  1GEX A;  3AEM A;  4ADE A;  1AAW A;  4JEY A;  1TOI A;  3DR7 A;  4A6R A;  4HVK A;  2WB6 A;  4H63 Q;  1OAT A;  3WX9 A;  3CQ6 A;  1X29 A;  1YIY A;  4AO9 A;  2YCN A;  3EI6 A;  2JGT A;  3FDB A;  4HF8 A;  1X28 A;  2QLR A;  2W7J A;  3QPG A;  2HP2 A;  3NU7 A;  2VGS A;  2BIE A;  3FVU A;  5BJ3 A;  4UHM A;  3HT4 A;  9AAT A;  3AEO A;  2YKY A;  2HOR A;  1E5F A;  3GBX A;  2DGK A;  1H0C A;  1S09 A;  1G4V A;  1ART A;  3RUY A;  1AY4 A;  3DYD A;  1QJ5 A;  2V1P A;  4IY7 A;  4E3R A;  1AHY A;  2AAT A;  1S08 A;  1YOO A;  3PAA A;  3ZRR A;  5HXX A;  1BW0 A;  3ASA A;  2YRR A;  2RFV A;  1ASA A;  3QHX A;  4PFN A;  4ZLV A;  4N0W A;  3PDX A;  1BJO B;  1YJS A;  2HUI A;  4NOG A;  2BI9 A;  4OCA A;  3G0T A;  3ZRP A;  4A72 A;  2FM1 A;  3FD0 A;  1TOK A;  3PPL A;  4XJP A;  5E4Z A;  5HDM A;  4R5Z A;  5G4I A;  3DRD A;  2C81 A;  1YJZ A;  4ZSW A;  3WCO A;  1VJO A;  1ASL A;  3FDD A;  1WYV B;  4P7Y A;  3BS8 A;  3AEN B;  1CL1 A;  2BWN A;  4JEZ A;  2W8T A;  3VK3 A;  1ARG A;  4OT8 A;  5M49 A;  1ASF A;  5DB5 A;  4IYO B;  1OXP A;  1QZ9 A;  4IW7 A;  5DJ1 A;  1J04 A;  3FRK A;  3FQA A;  4K2I A;  3PA9 A;  1M32 A;  7AAT A;  1S07 A;  4OTL A;  1WYU A;  3ECD A;  2CH1 A;  2VGV A;  3AAT A;  4IXZ A;  4K2M A;  4EB5 A;  2VMO A;  2VI8 A;  1Z3Z A;  3NUI A;  5EAV A;  3QBO A;  4WLH A;  4E3Q A;  2VMQ A;  4XAU A;  5LHA A;  1AMS A;  1GC2 A;  4WXF A;  1D7R A;  4WD2 A;  1LK9 A;  4B98 A;  1TOJ A;  2VGZ A;  3TAT A;  4WB0 A;  1TOG A;  2ZJG A;  1SZK A;  1WST A;  4Q76 A;  2D5Y A;  1G4X A;  3ZZK A;  1ELQ A;  4F5J A;  2O1B A;  2BI3 A;  1CQ6 A;  3GZD A;  4GEB A;  4LNM A;  5J8Q A;  2AY1 A;  1X0M A;  1ELU A;  3EIA A;  2YOB A;  3EI7 A;  3MAU A;  1M0O A;  4RM1 A;  4AO4 A;  3A9X A;  1UU0 A;  1B8G A;  2EO5 A;  2VI9 A;  5I92 A;  2QBT A;  2AY5 A;  1AJS A;  2ZSM A;  3FKD A;  3RQ1 A;  4B9B A;  3VOM A;  1B5P A;  4A0R A;  1G7X A;  2YKX A;  1SZS A;  4ISY A;  1JF9 A;  2BYL A;  5C6U A;  3TFT A;  1O61 A;  2W7H A;  1YJY A;  2HZP A;  2OGE A;  2DOU A;  3QM2 A;  4XJL A;  3NRA A;  2W7L A;  4ZDP A;  1BJ4 A;  2Z1Z A;  1V2F A;  1RV4 A;  2CAN A;  3AEJ A;  3BN1 A;  3DZZ A;  3M5U A;  2G6W A;  5DJ9 A;  3WLX A;  4CVQ A;  4F5I A;  4WYE A;  4Y0D A;  1OHV A;  3PDB A;  2AY2 A;  4AZJ A;  4KXK A;  3JU7 A;  2YCT A;  3R4T A;  1AIC A;  1QIS A;  4I8A A;  3NU8 A;  5BJ4 A;  2X5D A;  1MDO A;  3RBL A;  3EI5 A;  1AAM A;  4A6T A;  2CB1 A;  4BA5 A;  3PGY A;  4TN4 A;  2AY6 A;  1JS3 A;  4OBV A;  2W7F A;  2W7G A;  1EG5 A;  1ECX A;  3K40 A;  1B9I A;  1OXO A;  3FVS A;  2R2N A;  3AOW A;  2CIN A;  4GE9 A;  1WYT B;  4GSA A;  3LV2 A;  2VMR A;  3WKR A;  2OAT A;  4WYF A;  3B8X A;  3WKS A;  3FZ8 A;  1TAS A;  3DU4 A;  3HLM A;  3DC1 A;  1I43 A;  5EAA A;  2DKJ A;  3VP6 A;  4F5H A;  1BQD A;  2W8U A;  1GBN A;  4ADD A;  3FSL A;  2BIG A;  4UHO A;  1JS6 A;  4XK1 A;  2VGU A;  1WKG A;  3TQX A;  1ASC A;  2ZC0 A;  4WYA A;  2W7I A;  2AEV A;  5D5S A;  3RI6 A;  2G7J A;  3EZ1 A;  1KL2 A;  1YAA A; 
#chains in the Genus database with same CATH homology
 3HQT A;  4F5G A;  1GC3 A;  1AJR A;  3E2Y A;  3QI6 A;  1GD9 A;  1DFO A;  1RV3 A;  2BI1 A;  2FQ6 A;  1AMQ A;  3AV7 A;  1BJN A;  3QGU A;  3A9Y A;  3MC6 A;  5FT8 A;  3NYS A;  4Y0I A;  5KTB A;  3DXW A;  2VIA A;  4ZM3 A;  2X8U A;  2GQN A;  1V72 A;  1AIA A;  5EIG A;  1B9H A;  3ATH A;  1OHW A;  4F4E A;  4GRX A;  1O69 A;  4R5F A;  1Z7D A;  2ORD A;  3ISL A;  4J8L A;  4ZWV A;  2FKI A;  3EZS A;  1M7Y A;  2O7C A;  1UKJ A;  4H51 A;  3BWN C;  1ARH A;  2QA3 A;  3BV0 A;  3GET A;  2D65 A;  1O62 A;  4WB0 B;  1RVU A;  2D64 A;  3JWA A;  3LVM A;  1M0Q A;  4CBR A;  1MLY A;  4FFC A;  4OBU A;  3K28 A;  2VGW A;  1CZE A;  3D6K A;  4EMY A;  4Q31 A;  4XJM A;  5G2Q A;  3N7N A;  1SF2 A;  3L8A A;  1IVR A;  4OYT A;  2DR1 A;  4ZWM A;  2X5F A;  4WBT A;  1KMK A;  4LC3 A;  4MKK A;  1AIB A;  3HBX A;  1AJS B;  2VMP A;  2XH1 A;  4RLG A;  5EUE A;  1ZC9 A;  1LW4 A;  2CH2 A;  1MAP A;  3DXV A;  1DGD A;  3KGW A;  3MKJ A;  3BCA A;  4WLJ A;  4R2N A;  4WYG A;  1BKG A;  3JTX A;  1EQB A;  2W7E A;  3LVJ A;  4ADB A;  2BKW A;  3DOD A;  5FT4 A;  1KKP A;  3GR9 A;  5AX8 A;  1SVV A;  4ZSY A;  4XQ2 A;  3ASB A;  3E2Z A;  4JEX A;  4OMA A;  2AY8 A;  3PDB B;  1FC4 A;  2HOY A;  2Q7W A;  3AEM C;  3AOV A;  1W3U A;  3MAF A;  3AEP A;  3USF A;  1QJ3 A;  2JJF A;  3HDO A;  3VK2 A;  2BI5 A;  3IHJ A;  2YKU A;  2CY8 A;  4A0F A;  2D61 A;  3EIB A;  1W23 A;  4PFF A;  4MKJ A;  1D2F A;  2ZUK A;  3A2B A;  3P6K A;  2ZY3 A;  1ZOD A;  2VIB A;  2PB2 A;  1ASE A;  1QIT A;  2D7Y A;  1LW5 A;  3LVK A;  1M6S A;  1XEY A;  3PD6 A;  1GEW A;  4GE4 A;  3RCH B;  2R5E A;  1GC0 A;  3NTJ A;  2Z1Y A;  4RJ0 A;  3BWO A;  2E54 A;  3BCB A;  3GWP A;  3G8M A;  3W1J A;  1UU1 A;  2C7T A;  1C4K A;  2VMS A;  1E5E A;  3NUB A;  1MAQ A;  2OKJ A;  1FG7 A;  2ZY4 A;  2PB0 A;  1GCK A;  2WK8 A;  3UWC A;  1ASM A;  4UOY A;  3KE3 A;  1I48 A;  1ZOB A;  4JE5 D;  4UQV A;  1J32 A;  4GE7 A;  2EH6 A;  2HUF A;  3E2F A;  3NX3 A;  1W7N A;  4ZDO A;  4O6Z A;  3I5T A;  4W91 A;  3TFU A;  4RIZ A;  2WKA A;  2AEU A;  4F5K A;  2JIS A;  5F8V A;  2ZY5 A;  1W7L A;  3ZRQ A;  2ZP7 A;  4A0G A;  5IWQ A;  4R8D A;  4MSO A;  3WZF A;  2BWP A;  4JF0 A;  5M4D A;  2VMW A;  2JJG A;  2VLH A;  2VMY A;  3N0L A;  4AOA A;  4MQQ A;  2HOX A;  1C0N A;  3WGC A;  2VYC A;  1IUG A;  3LG0 A;  2BYJ A;  2BI2 A;  5EIG B;  4ZAH A;  1B4X A;  5EUN A;  1BQA A;  4KAM A;  4JE5 A;  1AMA A;  2YCP A;  1VP4 A;  3WCN A;  2C44 A;  2O0R A;  3IF2 A;  1TAT A;  4J5U A;  4K05 A;  3HL2 A;  4IXO A;  1X2A A;  1S06 A;  1CJ0 A;  3ELE A;  2R0T A;  2R5C A;  1C9C A;  3A8U X;  4MQP A;  3LY1 A;  1WYV A;  2W8V A;  2EPJ A;  2VMV A;  3DR4 A;  2AY3 A;  2JG2 A;  3K7Y A;  5D95 A;  1IAY A;  5FT5 A;  4DGT A;  4EFF A;  1CS1 A;  2NMP A;  1M0N A;  1I41 A;  4JF1 A;  3GZD C;  3VAX A;  3UAK A;  2ZYJ A;  3ELP A;  4MQR A;  3NYU A;  1AX4 A;  4DBC A;  5K8B A;  1IJI A;  4M2K A;  3FQ7 A;  1M4N A;  4BHD A;  2DKB A;  1CQ7 A;  3R9A A;  1MLZ A;  2VMZ A;  4XJO A;  2VLF A;  1AHF A;  1AKC A;  2HP1 A;  3B1C A;  3B46 A;  3H14 A;  2DGL A;  1DJE A;  2BHX A;  4P3M A;  3OP7 A;  2QSR A;  5E5I A;  5G4J A;  1ASN A;  2ZY2 A;  2V0Y A;  2X3L A;  3E2Z B;  3FVX A;  5G09 A;  4ZM4 A;  1D7U A;  1KMJ A;  4EB7 A;  3MAF B;  1TAR A;  4KYO A;  4AZK A;  2WK7 A;  2QMA A;  4U2H A;  2PO3 A;  1QIR A;  4ADC A;  2CJG A;  3AEJ C;  1YIZ A;  2D66 A;  2JJE A;  1LC7 A;  1WYU B;  1Y4I A;  1AY8 A;  1O4S A;  3CQ4 A;  3NDN A;  3JZL A;  1CZC A;  1EJI A;  3T32 A;  3PD6 B;  3MEB A;  2WK9 A;  3MBB A;  3EUC A;  1H1C A;  1JG8 A;  2GMS A;  4W5K A;  5HHY A;  1UU2 A;  5LH9 A;  2GSA A;  4L0O A;  2OQX A;  1C7N A;  1TPL A;  1ORD A;  2YRI A;  1IX6 A;  3W1I A;  1PMO A;  2VGT A;  3E77 A;  3CQ5 A;  4M2J A;  4RKC A;  4CXQ A;  1T3I A;  3ACZ A;  1VEF A;  3L44 A;  4XEW A;  4ZDL A;  3FZ7 A;  4Q75 A;  2Z61 A;  3GJU A;  3KKI A;  5EFS A;  2HOZ A;  1N2T A;  2Z67 A;  4TV7 A;  3N4S A;  1BT4 A;  4F5M A;  3N5M A;  2W7M A;  4BA4 A;  1KKJ A;  1N8P A;  1LS3 A;  4EU1 A;  1LC5 A;  2FNI A;  3BCX A;  2BIA A;  3N4X A;  3N75 A;  3I4J A;  1AY5 A;  2AY4 A;  2VMT A;  2D63 A;  4W1W A;  1MDX A;  4WYD A;  5E3K A;  5DX5 A;  2W7K A;  2Z9X A;  3GSB A;  5G0A A;  2Z9V A;  1QGN A;  1DJU A;  3F6T A;  3TCM A;  1KL1 A;  1SFF A;  1IBJ A;  2VMN A;  1WYT A;  2D7Z A;  3F0H A;  3QN6 A;  4BQ0 A;  3MC6 C;  3Q8N A;  1CQ8 A;  4OC9 A;  3A9Z A;  4ITX A;  1AHG A;  3VK4 A;  4WXB A;  2OKK A;  2EZ2 A;  2R5C B;  2W7D A;  1V2D A;  4RJY A;  2W8W A;  1DTY A;  3PJ0 A;  3FZ6 A;  4GDY A;  4PVF A;  4QGR A;  4A6U A;  5G2P A;  3G7Q A;  1GC4 A;  1LKC A;  2FYF A;  1SZU A;  2EZ1 A;  1AHX A;  1XI9 A;  2AY7 A;  3COG A;  3KGX A;  2CTZ A;  1ARI A;  2EGY A;  4RAE A;  1FG3 A;  2ZSL A;  2F8J A;  1C7O A;  1IAX A;  1IX7 A;  4TMR A;  4W8I A;  1AHE A;  3UE8 A;  3FFH A;  1G7W A;  2TPL A;  4ATP A;  4E77 A;  3EI8 A;  4LW2 A;  1WKH A;  4ITG A;  1W7M A;  2CST A;  4BMK A;  2CJH A;  1I29 A;  4IXS A;  4MY5 A;  1GDE A;  1B5O A;  1YNU A;  2GB3 A;  2VMX A;  4E1O A;  4MGR A;  4A00 A;  1MDZ A;  4LNL A;  2Z20 A;  5EUD A;  3N4R A;  2VMU A;  5EQC A;  3FFR A;  2Z9W A;  4JEV A;  3FCR A;  4RIT A;  4RKD A;  3E9K A;  4Q6R A;  2FNU A;  3BC8 A;  1ASB A;  4JEW A;  1S0A A;  1TOE A;  4WYC A;  3W1H A;  2E7J A;  1CL2 A;  1C7G A;  2E7U A;  1DJ9 A;  3RBF A;  1BJO A;  3BB8 A;  1PG8 A;  2Z9U A;  2GMU A;  3B1E A;  3JWB A;  3P1T A;  4W1X A;  3EI9 A;  4FL0 A;  1M0P A;  3JW9 A;  3H7F A;  1MGV A;  1ASG A;  4K2B A;  4CBS A;  4CXR A;  5JAY A;  3B1D A;  3WGB A;  2E7I A;  3AEL A;  4LW4 A;  1D7S A;  1DKA A;  2JJH A;  3FQ8 A;  4ATQ A;  4A0H A;  1GEY A;  1U08 A;  3AEN A;  3E6G A;  4DQ6 A;  3CBF A;  1ASD A;  3H9X A;  3MAD A;  4AH3 A;  2HUU A;  2FN6 A;  4IYO A;  4UHN A;  3HMU A;  3FTB A;  4M2M A;  3ZZJ A;  3GZC A;  3II0 A;  1BJW A;  3PIU A;  5F9S A;  2QB2 A;  3BWN A;  1N31 A;  2QB3 A;  4U1T A;  4F5F A;  2CJD A;  3HVY A;  3CAI A;  3WY7 A;  2YKV A;  8AAT A;  1IX8 A;  3OKS A;  2DGM A;  3LVL B;  5TF5 A;  1DGE A;  2A1V A;  4N0B A;  4W1V A;  2C0R A;  3RCH A;  4WXG A;  1ARS A;  2EYQ A;  1BS0 A;  1SPA A;  3LWS A;  5M46 A;  4PIW A;  5FT6 A;  4F5L A;  4ZAS A;  1AKB A;  1LC8 A;  3NNK A;  4WP0 A;  2AY9 A;  1P3W A;  4LNJ A;  5M4B A;  2KFP A;  1PFF A;  2XBN A;  1D7V A;  4Y0H A;  1V2E A;  2OGA A;  1PMM A;  2YHK A;  3I16 A;  3NYT A;  3F9T A;  1OHY A;  4IX8 A;  1AKA A;  1RVY A;  1AMR A;  2CFB A;  2W8J A;  2BWO A;  1GEX A;  3AEM A;  4ADE A;  1AAW A;  4JEY A;  1TOI A;  3DR7 A;  4A6R A;  4HVK A;  2WB6 A;  4H63 Q;  1OAT A;  3WX9 A;  3CQ6 A;  1X29 A;  1YIY A;  4AO9 A;  2YCN A;  3EI6 A;  2JGT A;  3FDB A;  4HF8 A;  1X28 A;  2QLR A;  2W7J A;  3QPG A;  2HP2 A;  3NU7 A;  2VGS A;  2BIE A;  3FVU A;  5BJ3 A;  4UHM A;  3HT4 A;  9AAT A;  3AEO A;  2YKY A;  2HOR A;  1E5F A;  3GBX A;  2DGK A;  1H0C A;  1S09 A;  1G4V A;  1ART A;  3RUY A;  1AY4 A;  3DYD A;  1QJ5 A;  2V1P A;  4IY7 A;  4E3R A;  1AHY A;  2AAT A;  1S08 A;  1YOO A;  3PAA A;  3ZRR A;  5HXX A;  1BW0 A;  3ASA A;  2YRR A;  2RFV A;  1ASA A;  3QHX A;  4PFN A;  4ZLV A;  4N0W A;  3PDX A;  1BJO B;  1YJS A;  2HUI A;  4NOG A;  2BI9 A;  4OCA A;  3G0T A;  3ZRP A;  4A72 A;  2FM1 A;  3FD0 A;  1TOK A;  3PPL A;  4XJP A;  5E4Z A;  5HDM A;  4R5Z A;  5G4I A;  3DRD A;  2C81 A;  1YJZ A;  4ZSW A;  3WCO A;  1VJO A;  1ASL A;  3FDD A;  1WYV B;  4P7Y A;  3BS8 A;  3AEN B;  1CL1 A;  2BWN A;  4JEZ A;  2W8T A;  3VK3 A;  1ARG A;  4OT8 A;  5M49 A;  1ASF A;  5DB5 A;  4IYO B;  1OXP A;  1QZ9 A;  4IW7 A;  5DJ1 A;  1J04 A;  3FRK A;  3FQA A;  4K2I A;  3PA9 A;  1M32 A;  7AAT A;  1S07 A;  4OTL A;  1WYU A;  3ECD A;  2CH1 A;  2VGV A;  3AAT A;  4IXZ A;  4K2M A;  4EB5 A;  2VMO A;  2VI8 A;  1Z3Z A;  3NUI A;  5EAV A;  3QBO A;  4WLH A;  4E3Q A;  2VMQ A;  4XAU A;  5LHA A;  1AMS A;  1GC2 A;  4WXF A;  1D7R A;  4WD2 A;  1LK9 A;  4B98 A;  1TOJ A;  2VGZ A;  3TAT A;  4WB0 A;  1TOG A;  2ZJG A;  1SZK A;  1WST A;  4Q76 A;  2D5Y A;  1G4X A;  3ZZK A;  1ELQ A;  4F5J A;  2O1B A;  2BI3 A;  1CQ6 A;  3GZD A;  4GEB A;  4LNM A;  5J8Q A;  2AY1 A;  1X0M A;  1ELU A;  3EIA A;  2YOB A;  3EI7 A;  3MAU A;  1M0O A;  4RM1 A;  4AO4 A;  3A9X A;  1UU0 A;  1B8G A;  2EO5 A;  2VI9 A;  5I92 A;  2QBT A;  2AY5 A;  1AJS A;  2ZSM A;  3FKD A;  3RQ1 A;  4B9B A;  3VOM A;  1B5P A;  4A0R A;  1G7X A;  2YKX A;  1SZS A;  4ISY A;  1JF9 A;  2BYL A;  5C6U A;  3TFT A;  1O61 A;  2W7H A;  1YJY A;  2HZP A;  2OGE A;  2DOU A;  3QM2 A;  4XJL A;  3NRA A;  2W7L A;  4ZDP A;  1BJ4 A;  2Z1Z A;  1V2F A;  1RV4 A;  2CAN A;  3AEJ A;  3BN1 A;  3DZZ A;  3M5U A;  2G6W A;  5DJ9 A;  3WLX A;  4CVQ A;  4F5I A;  4WYE A;  4Y0D A;  1OHV A;  3PDB A;  2AY2 A;  4AZJ A;  4KXK A;  3JU7 A;  2YCT A;  3R4T A;  1AIC A;  1QIS A;  4I8A A;  3NU8 A;  5BJ4 A;  2X5D A;  1MDO A;  3RBL A;  3EI5 A;  1AAM A;  4A6T A;  2CB1 A;  4BA5 A;  3PGY A;  4TN4 A;  2AY6 A;  1JS3 A;  4OBV A;  2W7F A;  2W7G A;  1EG5 A;  1ECX A;  3K40 A;  1B9I A;  1OXO A;  3FVS A;  2R2N A;  3AOW A;  2CIN A;  4GE9 A;  1WYT B;  4GSA A;  3LV2 A;  2VMR A;  3WKR A;  2OAT A;  4WYF A;  3B8X A;  3WKS A;  3FZ8 A;  1TAS A;  3DU4 A;  3HLM A;  3DC1 A;  1I43 A;  5EAA A;  2DKJ A;  3VP6 A;  4F5H A;  1BQD A;  2W8U A;  1GBN A;  4ADD A;  3FSL A;  2BIG A;  4UHO A;  1JS6 A;  4XK1 A;  2VGU A;  1WKG A;  3TQX A;  1ASC A;  2ZC0 A;  4WYA A;  2W7I A;  2AEV A;  5D5S A;  3RI6 A;  2G7J A;  3EZ1 A;  1KL2 A;  1YAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...