2PB7A

Crystal structure of the sra domain of the human uhrf1 protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
197
Chain Sequence
b'ECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title The mammalian SRA domain is a new nucleosome binding motif
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 53
structure length 197
sequence length 207
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 2pb7A01
4NJ5A 3DWHA 4PW7A 3FDEA 2ZKDA 3F8JB 2ZKEA 2ZO2B 3OLNA 3CLZA 3F8IA 2ZO1B 2PB7A 2ZO0B 4PW6A 3BI7A 2ZKFA 4PW5A 2ZKGA
chains in the Genus database with same CATH superfamily
4NJ5A 3DWHA 4PW7A 3FDEA 3Q0BX 2ZKDA 3F8JB 2ZKEA 4R28A 2ZO2B 3OLNA 3F8IA 3CLZA 4F0QA 4F0PA 2ZO1B 3Q0CA 3Q0FA 2PB7A 2ZO0B 4PW6A 3BI7A 4YGIA 4RZLA 3Q0DA 2ZKFA 4OC8A 4PW5A 2ZKGA
chains in the Genus database with same CATH topology
4NJ5A 3DWHA 4PW7A 3FDEA 2ZKDA 3F8JB 2ZKEA 2ZO2B 3OLNA 3CLZA 3F8IA 2ZO1B 2PB7A 2ZO0B 4PW6A 3BI7A 2ZKFA 4PW5A 2ZKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  3DWH A;  4PW7 A;  3FDE A;  2ZKD A;  3F8J B;  2ZKE A;  2ZO2 B;  3OLN A;  3CLZ A;  3F8I A;  2ZO1 B;  2PB7 A;  2ZO0 B;  4PW6 A;  3BI7 A;  2ZKF A;  4PW5 A;  2ZKG A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  3DWH A;  4PW7 A;  3FDE A;  3Q0B X;  2ZKD A;  3F8J B;  2ZKE A;  4R28 A;  2ZO2 B;  3OLN A;  3F8I A;  3CLZ A;  4F0Q A;  4F0P A;  2ZO1 B;  3Q0C A;  3Q0F A;  2PB7 A;  2ZO0 B;  4PW6 A;  3BI7 A;  4YGI A;  4RZL A;  3Q0D A;  2ZKF A;  4OC8 A;  4PW5 A;  2ZKG A; 
#chains in the Genus database with same CATH homology
 4NJ5 A;  3DWH A;  4PW7 A;  3FDE A;  2ZKD A;  3F8J B;  2ZKE A;  2ZO2 B;  3OLN A;  3CLZ A;  3F8I A;  2ZO1 B;  2PB7 A;  2ZO0 B;  4PW6 A;  3BI7 A;  2ZKF A;  4PW5 A;  2ZKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...