2PBCA

Fk506-binding protein 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
GSPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 2
publication title Structure of FK506-Binding Protein 2
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 23
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pbcA00
5HW6A 3MDYB 4DRJA 3ODKA 1D7IA 1JNTA 1Y0OA 2F2DA 2FKEA 1JVWA 1FKDA 1ZK6A 5HTGA 1W26A 1ZCNA 2XP5A 4ODPA 2ZQSA 3JYMA 1PBKA 3KAHA 1FKFA 3CGNA 4FN2A 3O5LA 2M2AA 1J4RA 1FKTA 2D9FA 3UI6A 1D6OA 4DRQA 2PBCA 3I6CA 1FKJA 3IK8A 1JNSA 2KR7A 1YW5A 2PV3A 2ZQUA 1FJDA 3KAFA 1BKFA 2XPBA 4LAWA 4G2PA 2K8IA 3O5FA 3O5QA 3PA7A 4GGQA 4ODNA 3KCEA 4QT3A 3KABA 2PPPA 2RUDA 4JYSA 4U85A 2VN1A 3VAWA 3UQIA 2PPOA 4TW7A 2XPAA 2UZ5A 1QPFA 1EYMA 1FAPA 4JFJA 2ZR5A 2XP4A 3LUOA 1NMVA 1C9HA 1F8AB 4R0XA 4W9OA 1FKHA 4DRMA 4ODKA 2MF9A 4IQ2A 2DG9A 1Q6IA 2Q5AA 2FAPA 3GPKA 4LAYA 3UF8A 4O2TA 2M08A 3JXVA 4TNSA 2LJ4A 4TYOA 4IQCA 3RGCA 2KFWA 3OOBA 2ZQTA 1QZ2A 2AWGA 3O5MA 3RFWA 1J6YA 1BL4A 2MLXA 4DRNA 4ODLA 4DRHA 3TC5A 3O5PA 5I98A 5HWBA 1FKGA 3JYJA 4JFIA 4DZ3A 4DROA 1ROTA 4J4NA 2MNTA 2ZR6A 3WH0A 2XP7A 3KZ7A 3PRDA 2L2SA 4N19A 2PV1A 3H9RB 3PRBA 1NSGA 2KO7A 2DG3A 3UI4A 5B8IC 5J6EA 4DRKA 1N1AA 2XP3A 5HW8A 2XP9A 2RSEA 1L1PA 2RUCA 1J4HA 1ROUA 1FKKA 5DIVA 4C02B 1FD9A 5HT1A 4ODQA 2LPVA 5HW7A 4MSPA 4W9QA 2F4EA 2LKNA 2MLYA 5GPGA 2LGOA 3TCZA 4J4OA 2ZR4A 2KI3A 1Q6HA 4MGVA 5HKGA 4GIVA 5HWCA 3KAGA 4ITZA 4NNRA 4DT4A 1FKBA 1B6CA 4W9PA 1TCOC 1T11A 5HUAA 3UQBA 4TW6A 1HXVA 3EY6A 2KGJA 1EQ3A 1FKLA 3UQAA 2MLZA 1FKRA 3B7XA 4G50A 1PINA 1D7HA 1KT0A 4TW8A 4QIBA 3O5KA 3KADA 2RQSA 2F21A 3O5OA 2Y78A 3IHZA 3O5JA 3O5EA 3O5IA 4ODRA 4JFMA 3IKDA 3KACA 1J4IA 2XP8A 3NI6A 4LAXA 4QT2A 1U79A 3TDBA 1F40A 1M5YA 3IKGA 3O5DA 2N87A 2M1IA 4ODOA 2ZQVA 1R9HA 5DIUA 4FAPA 3UI5A 1QPLA 2KE0A 2MPHA 3CGMA 1KT1A 2DG4A 1FKIA 1FKSA 1P5QA 1YATA 2RURA 3KAIA 4ODMA 5DITA 4BF8A 4TX0A 2OFNA 4LAVA 5D75A 5BXJA 1Q1CA 3O5RA 4DIPA 4DH0A 2VCDA 1A7XA 3NTPA 3O5GA 2RUQA 4DRPA 4DRIA 1D7JA 2XP6A 4IPXA 2PPNA 4JFLA 4JFKA 4U84A 1NMWA 2PV2A 3FAPA 2ITKA 4DZ2A 2IF4A 2JZVA 1Q6UA 3NRKA 4U86A
chains in the Genus database with same CATH superfamily
3ARYA 4DRJA 3B9AA 2A3EA 4MAVA 4WKHA 3JYMA 2PI6A 3KAHA 1FKFA 3CGNA 2M2AA 1FKTA 4DRQA 2PBCA 1W9PA 1BKFA 1XHGA 3O5FA 3PA7A 2DT0A 4QT3A 2PPPA 4JYSA 1GPFA 2PPOA 3G6LA 1FAPA 2QF8A 1C9HA 4Q22A 1FKHA 3ARXA 2Q5AA 4LAYA 2M08A 4TNSA 2LJ4A 4ZPWR 4P8VA 1HKIA 4MTVA 3WQWA 2AWGA 3O5MA 3RFWA 3ALFA 2G41A 1HJXA 3WQVA 2WM0A 1FKGA 3ARRA 3JYJA 1NH6A 1ROTA 2ZR6A 3PRDA 4N19A 1E15A 2IUZA 1NSGA 1OGGA 2DG3A 2KO7A 1E6NA 1JNDA 1FD9A 1SR0A 5HT1A 1W1YA 5HW7A 2LKNA 3WL0A 1SYTA 3GU0A 1HJVA 5HWCA 1FKBA 3WKZA 2F23A 2PN0A 3WD3A 1LL6A 3PR9A 1T11A 1X6LA 3UQBA 4TW6A 1HXVA 1EQ3A 1ZU8A 2MLZA 3RMEA 4UDMA 5JH8A 4WKAA 3KADA 1NWTA 3AS0A 2Y78A 1KFWA 1XRVA 3B9DA 1TFVA 1FFRA 2YBTA 1J4IA 3TDBA 1M5YA 4ODOA 3UI5A 1QPLA 2KE0A 2MPHA 1KT1A 1P5QA 3KAIA 4BF8A 2ESCA 2OFNA 1EDQA 1EIBA 4DIPA 1CTNA 1LJYA 1UR8A 3NTPA 4DH0A 1D7JA 3ARVA 4JFKA 3FAPA 3AQUA 2IF4A 1UR9A 2RURA 1Q6UA 3EIPA 3NRKA 3ODKA 2AOSA 1JNTA 1JVWA 1OWQA 3ARWA 1W26A 4ODPA 1WNOA 4P8XA 2ZQSA 1PBKA 1HKJA 2DSZA 1D6OA 1JNSA 2KR7A 2PV3A 1HKMA 2XPBA 4LAWA 4Z2IA 4G2PA 5DO2A 4GGQA 3KCEA 3KABA 2RUDA 3WD4A 4IT6A 2DSUA 1JNEA 5DF0A 1QPFA 4URIA 2DSWA 2ZR5A 4HBEA 3OA5A 4R0XA 4Z2KA 3ARPA 4IQ2A 4AY1A 2OLHA 3CHCA 3RGCA 1X6NA 2KFWA 4DRNA 4ODLA 5I98A 2MNTA 3WH0A 2PV1A 3H9RB 2A3BA 3PRBA 2B5UB 1NWRA 5J6EA 4Z2LA 2XP3A 5HW8A 2RSEA 1L1PA 2RUCA 1ROUA 1W9VA 1LQ0A 5GQBA 1ITXA 3RM8A 5GPGA 3TCZA 1GRJA 3ARZA 3KAGA 4ITZA 4NNRA 1E9LA 1E6PA 2FDMA 2DSVA 1ZBWA 1FKLA 4R5EA 1HJWA 1FKRA 4G50A 3G6MA 2P4VA 3WIJA 1KT0A 5HBFA 1GOIA 3WL1A 2RQSA 2DT2A 4WK9A 4HBOA 3O5JA 3O5EA 3O5IA 3IKDA 3NI6A 4QT2A 1U79A 1F40A 2B31A 4XAKA 3O5DA 5DIUA 4FAPA 3ARSA 3CGMA 2DG4A 1FKIA 1FKSA 1YATA 4ODMA 3PRAA 4L3NA 3B9EA 4IPXA 3RM4A 4DWSD 2A3AA 4JFLA 4WJXA 1E6RA 2G8ZA 1NMWA 4DZ2A 2JZVA 4MNMA 4J4NA 4U86A 5HW6A 1D7IA 4P8UA 1LG2A 4PTMA 2FKEA 2F2DA 1WB0A 1ZK6A 4S3JA 2XP5A 1E44A 1J4RA 2D9FA 4KR0B 3CHEA 3I6CA 1FKJA 3IK8A 2ZQUA 1YW5A 4LGXA 3KAFA 3QOKA 3AS1A 2K8IA 3O5QA 3GTYX 5GPRA 4ODNA 3ARUA 4U85A 2VN1A 3VAWA 3UQIA 2XPAA 1W1VA 2UZ5A 1EYMA 1K9TA 3LUOA 5DEZA 1NMVA 2O92A 4W9OA 1NWSA 4ODKA 1Q6IA 3AS3A 3GPKA 4O2TA 4MNKA 4TYOA 4IQCA 2O9OA 3OOBA 2ZQTA 1QZ2A 3WD2A 1NWUA 4NSBA 1HKKA 1E6ZA 2XP7A 2L2SA 1W9UA 5B8IC 4DRKA 1N1AA 3FY1A 1H0IA 1J4HA 4C02B 3RM9A 4ODQA 4MSPA 2F4EA 2MLYA 4P8WA 4MGVA 1B6CA 2WK2A 4ML4A 4WKFA 4Z2GA 2ETNA 3BMBA 3AROA 3B7XA 4TW8A 3O5KA 2F21A 3O5OA 3IHZA 4ODRA 4JFMA 4DWSC 2XP8A 2DT3A 4NZCA 2N87A 4W5UA 3WD1A 1R9HA 1LG1A 4ZS6A 1LL4A 3AS2A 4LAVA 5BXJA 1Q1CA 2DPEA 2VCDA 3O5GA 1H0GA 4Z2HA 2RUQA 4QZVB 2PPNA 4Q7NA 2PV2A 2ITKA 1ZCNA 3MDYB 1Y0OA 1FKDA 5HTGA 1RD6A 4FN2A 3O5LA 3CZ8A 2EULA 3UI6A 1FFQA 3ARQA 1FJDA 1IX5A 4L72B 1ZL1A 4TW7A 3CHFA 4JFJA 2XP4A 4ZPTR 1F8AB 4DRMA 4HARA 1ZBCA 2MF9A 2DG9A 4MNJA 3UF8A 2FAPA 3JXVA 3ALGA 1ZB5A 1LL7A 1J6YA 1BL4A 2MLXA 1O6IA 4DRHA 3TC5A 3O5PA 5HWBA 4JFIA 4DZ3A 4DROA 1GUVA 4Z2JA 3CHDA 2WLZA 3UI4A 1JCHB 2XP9A 1FKKA 5DIVA 2WLYA 2A3CA 3BXWA 2LPVA 3ARTA 4W9QA 2LGOA 1WAWA 4J4OA 2ZR4A 2KI3A 1Q6HA 5HKGA 4GIVA 4DT4A 4MPKA 3B8SA 4W9PA 4ZPVR 1TCOC 2YBUA 4DWSB 5HUAA 3EY6A 2KGJA 3UQAA 1W1PA 1PINA 1D7HA 3FXYA 4QIBA 4MNLA 1W1TA 4S3KA 4KQZA 3KACA 4IT4A 4LAXA 1VF8A 1EHNA 3IKGA 2M1IA 3WD0A 2ZQVA 3KZ7A 1ZBKA 5DITA 1OGBA 4TX0A 3W4RA 1D2KA 1ZBVA 5D75A 3O5RA 2DT1A 1A7XA 4DRPA 4DRIA 2XP6A 4WIWA 4U84A 4DWSA 3CH9A
chains in the Genus database with same CATH topology
3ARYA 4DRJA 3B9AA 2A3EA 4MAVA 4WKHA 3JYMA 2PI6A 3KAHA 1FKFA 3CGNA 2M2AA 1FKTA 4DRQA 2PBCA 1W9PA 1BKFA 1XHGA 3O5FA 3PA7A 2DT0A 4QT3A 2PPPA 4JYSA 1GPFA 2PPOA 3G6LA 1FAPA 2QF8A 1C9HA 4Q22A 1FKHA 3ARXA 2Q5AA 4LAYA 2M08A 4TNSA 2LJ4A 4ZPWR 4P8VA 1HKIA 4MTVA 3WQWA 2AWGA 3O5MA 3RFWA 3ALFA 2G41A 1HJXA 3WQVA 2WM0A 1FKGA 3ARRA 3JYJA 1NH6A 1ROTA 2ZR6A 3PRDA 4N19A 1E15A 2IUZA 1NSGA 1OGGA 2DG3A 2KO7A 1E6NA 1JNDA 1FD9A 1SR0A 5HT1A 1W1YA 5HW7A 2LKNA 3WL0A 1SYTA 1HJVA 5HWCA 1FKBA 3WKZA 3WD3A 1LL6A 3PR9A 1T11A 1X6LA 3UQBA 4TW6A 1HXVA 1EQ3A 1ZU8A 2MLZA 3RMEA 5JH8A 4WKAA 3KADA 1NWTA 3AS0A 2Y78A 1KFWA 1XRVA 3B9DA 1TFVA 1FFRA 2YBTA 1J4IA 3TDBA 1M5YA 4ODOA 3UI5A 1QPLA 2KE0A 2MPHA 1KT1A 1P5QA 3KAIA 4BF8A 2ESCA 2OFNA 1EDQA 1EIBA 4DIPA 1CTNA 1LJYA 1UR8A 3NTPA 4DH0A 1D7JA 3ARVA 4JFKA 3FAPA 3AQUA 2IF4A 1UR9A 2RURA 1Q6UA 3NRKA 3ODKA 2AOSA 1JNTA 1JVWA 1OWQA 3ARWA 1W26A 4ODPA 1WNOA 4P8XA 2ZQSA 1PBKA 1HKJA 2DSZA 1D6OA 1JNSA 2KR7A 2PV3A 1HKMA 2XPBA 4LAWA 4Z2IA 4G2PA 5DO2A 4GGQA 3KCEA 3KABA 2RUDA 3WD4A 4IT6A 2DSUA 1JNEA 5DF0A 1QPFA 4URIA 2DSWA 2ZR5A 4HBEA 3OA5A 4R0XA 4Z2KA 3ARPA 4IQ2A 4AY1A 2OLHA 3CHCA 3RGCA 1X6NA 2KFWA 4DRNA 4ODLA 5I98A 2MNTA 3WH0A 2PV1A 3H9RB 2A3BA 3PRBA 1NWRA 5J6EA 4Z2LA 2XP3A 5HW8A 2RSEA 1L1PA 2RUCA 1ROUA 1W9VA 1LQ0A 5GQBA 1ITXA 3RM8A 5GPGA 3TCZA 3ARZA 3KAGA 4ITZA 4NNRA 1E9LA 1E6PA 2FDMA 2DSVA 1ZBWA 1FKLA 4R5EA 1HJWA 1FKRA 4G50A 3G6MA 3WIJA 1KT0A 5HBFA 1GOIA 3WL1A 2RQSA 2DT2A 4WK9A 4HBOA 3O5JA 3O5EA 3O5IA 3IKDA 3NI6A 4QT2A 1U79A 1F40A 2B31A 4XAKA 3O5DA 5DIUA 4FAPA 3ARSA 3CGMA 2DG4A 1FKIA 1FKSA 1YATA 4ODMA 3PRAA 4L3NA 3B9EA 4IPXA 3RM4A 4DWSD 2A3AA 4JFLA 4WJXA 1E6RA 2G8ZA 1NMWA 4DZ2A 2JZVA 4MNMA 4J4NA 4U86A 5HW6A 1D7IA 4P8UA 1LG2A 4PTMA 2FKEA 2F2DA 1WB0A 1ZK6A 4S3JA 2XP5A 1J4RA 2D9FA 4KR0B 3CHEA 3I6CA 1FKJA 3IK8A 2ZQUA 1YW5A 4LGXA 3KAFA 3QOKA 3AS1A 2K8IA 3O5QA 5GPRA 4ODNA 3ARUA 4U85A 2VN1A 3VAWA 3UQIA 2XPAA 1W1VA 2UZ5A 1EYMA 1K9TA 3LUOA 5DEZA 1NMVA 2O92A 4W9OA 1NWSA 4ODKA 1Q6IA 3AS3A 3GPKA 4O2TA 4MNKA 4TYOA 4IQCA 2O9OA 3OOBA 2ZQTA 1QZ2A 3WD2A 1NWUA 4NSBA 1HKKA 1E6ZA 2XP7A 2L2SA 1W9UA 5B8IC 4DRKA 1N1AA 3FY1A 1H0IA 1J4HA 4C02B 3RM9A 4ODQA 4MSPA 2F4EA 2MLYA 4P8WA 4MGVA 1B6CA 2WK2A 4ML4A 4WKFA 4Z2GA 3AROA 3B7XA 4TW8A 3O5KA 2F21A 3O5OA 3IHZA 4ODRA 4JFMA 4DWSC 2XP8A 2DT3A 4NZCA 2N87A 4W5UA 3WD1A 1R9HA 1LG1A 4ZS6A 1LL4A 3AS2A 4LAVA 5BXJA 1Q1CA 2DPEA 2VCDA 3O5GA 1H0GA 4Z2HA 2RUQA 4QZVB 2PPNA 4Q7NA 2PV2A 2ITKA 1ZCNA 3MDYB 1Y0OA 1FKDA 5HTGA 1RD6A 4FN2A 3O5LA 3CZ8A 3UI6A 1FFQA 3ARQA 1FJDA 1IX5A 4L72B 1ZL1A 4TW7A 3CHFA 4JFJA 2XP4A 4ZPTR 1F8AB 4DRMA 4HARA 1ZBCA 2MF9A 2DG9A 4MNJA 3UF8A 2FAPA 3JXVA 3ALGA 1ZB5A 1LL7A 1J6YA 1BL4A 2MLXA 1O6IA 4DRHA 3TC5A 3O5PA 5HWBA 4JFIA 4DZ3A 4DROA 1GUVA 4Z2JA 3CHDA 2WLZA 3UI4A 2XP9A 1FKKA 5DIVA 2WLYA 2A3CA 3BXWA 2LPVA 3ARTA 4W9QA 2LGOA 1WAWA 4J4OA 2ZR4A 2KI3A 1Q6HA 5HKGA 4GIVA 4DT4A 4MPKA 3B8SA 4W9PA 4ZPVR 1TCOC 2YBUA 4DWSB 5HUAA 3EY6A 2KGJA 3UQAA 1W1PA 1PINA 1D7HA 3FXYA 4QIBA 4MNLA 1W1TA 4S3KA 4KQZA 3KACA 4IT4A 4LAXA 1VF8A 1EHNA 3IKGA 2M1IA 3WD0A 2ZQVA 3KZ7A 1ZBKA 5DITA 1OGBA 4TX0A 3W4RA 1D2KA 1ZBVA 5D75A 3O5RA 2DT1A 1A7XA 4DRPA 4DRIA 2XP6A 4WIWA 4U84A 4DWSA 3CH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW6 A;  3MDY B;  4DRJ A;  3ODK A;  1D7I A;  1JNT A;  1Y0O A;  2F2D A;  2FKE A;  1JVW A;  1FKD A;  1ZK6 A;  5HTG A;  1W26 A;  1ZCN A;  2XP5 A;  4ODP A;  2ZQS A;  3JYM A;  1PBK A;  3KAH A;  1FKF A;  3CGN A;  4FN2 A;  3O5L A;  2M2A A;  1J4R A;  1FKT A;  2D9F A;  3UI6 A;  1D6O A;  4DRQ A;  2PBC A;  3I6C A;  1FKJ A;  3IK8 A;  1JNS A;  2KR7 A;  1YW5 A;  2PV3 A;  2ZQU A;  1FJD A;  3KAF A;  1BKF A;  2XPB A;  4LAW A;  4G2P A;  2K8I A;  3O5F A;  3O5Q A;  3PA7 A;  4GGQ A;  4ODN A;  3KCE A;  4QT3 A;  3KAB A;  2PPP A;  2RUD A;  4JYS A;  4U85 A;  2VN1 A;  3VAW A;  3UQI A;  2PPO A;  4TW7 A;  2XPA A;  2UZ5 A;  1QPF A;  1EYM A;  1FAP A;  4JFJ A;  2ZR5 A;  2XP4 A;  3LUO A;  1NMV A;  1C9H A;  1F8A B;  4R0X A;  4W9O A;  1FKH A;  4DRM A;  4ODK A;  2MF9 A;  4IQ2 A;  2DG9 A;  1Q6I A;  2Q5A A;  2FAP A;  3GPK A;  4LAY A;  3UF8 A;  4O2T A;  2M08 A;  3JXV A;  4TNS A;  2LJ4 A;  4TYO A;  4IQC A;  3RGC A;  2KFW A;  3OOB A;  2ZQT A;  1QZ2 A;  2AWG A;  3O5M A;  3RFW A;  1J6Y A;  1BL4 A;  2MLX A;  4DRN A;  4ODL A;  4DRH A;  3TC5 A;  3O5P A;  5I98 A;  5HWB A;  1FKG A;  3JYJ A;  4JFI A;  4DZ3 A;  4DRO A;  1ROT A;  4J4N A;  2MNT A;  2ZR6 A;  3WH0 A;  2XP7 A;  3KZ7 A;  3PRD A;  2L2S A;  4N19 A;  2PV1 A;  3H9R B;  3PRB A;  1NSG A;  2KO7 A;  2DG3 A;  3UI4 A;  5B8I C;  5J6E A;  4DRK A;  1N1A A;  2XP3 A;  5HW8 A;  2XP9 A;  2RSE A;  1L1P A;  2RUC A;  1J4H A;  1ROU A;  1FKK A;  5DIV A;  4C02 B;  1FD9 A;  5HT1 A;  4ODQ A;  2LPV A;  5HW7 A;  4MSP A;  4W9Q A;  2F4E A;  2LKN A;  2MLY A;  5GPG A;  2LGO A;  3TCZ A;  4J4O A;  2ZR4 A;  2KI3 A;  1Q6H A;  4MGV A;  5HKG A;  4GIV A;  5HWC A;  3KAG A;  4ITZ A;  4NNR A;  4DT4 A;  1FKB A;  1B6C A;  4W9P A;  1TCO C;  1T11 A;  5HUA A;  3UQB A;  4TW6 A;  1HXV A;  3EY6 A;  2KGJ A;  1EQ3 A;  1FKL A;  3UQA A;  2MLZ A;  1FKR A;  3B7X A;  4G50 A;  1PIN A;  1D7H A;  1KT0 A;  4TW8 A;  4QIB A;  3O5K A;  3KAD A;  2RQS A;  2F21 A;  3O5O A;  2Y78 A;  3IHZ A;  3O5J A;  3O5E A;  3O5I A;  4ODR A;  4JFM A;  3IKD A;  3KAC A;  1J4I A;  2XP8 A;  3NI6 A;  4LAX A;  4QT2 A;  1U79 A;  3TDB A;  1F40 A;  1M5Y A;  3IKG A;  3O5D A;  2N87 A;  2M1I A;  4ODO A;  2ZQV A;  1R9H A;  5DIU A;  4FAP A;  3UI5 A;  1QPL A;  2KE0 A;  2MPH A;  3CGM A;  1KT1 A;  2DG4 A;  1FKI A;  1FKS A;  1P5Q A;  1YAT A;  2RUR A;  3KAI A;  4ODM A;  5DIT A;  4BF8 A;  4TX0 A;  2OFN A;  4LAV A;  5D75 A;  5BXJ A;  1Q1C A;  3O5R A;  4DIP A;  4DH0 A;  2VCD A;  1A7X A;  3NTP A;  3O5G A;  2RUQ A;  4DRP A;  4DRI A;  1D7J A;  2XP6 A;  4IPX A;  2PPN A;  4JFL A;  4JFK A;  4U84 A;  1NMW A;  2PV2 A;  3FAP A;  2ITK A;  4DZ2 A;  2IF4 A;  2JZV A;  1Q6U A;  3NRK A;  4U86 A; 
#chains in the Genus database with same CATH topology
 3ARY A;  4DRJ A;  3B9A A;  2A3E A;  4MAV A;  4WKH A;  3JYM A;  2PI6 A;  3KAH A;  1FKF A;  3CGN A;  2M2A A;  1FKT A;  4DRQ A;  2PBC A;  1W9P A;  1BKF A;  1XHG A;  3O5F A;  3PA7 A;  2DT0 A;  4QT3 A;  2PPP A;  4JYS A;  1GPF A;  2PPO A;  3G6L A;  1FAP A;  2QF8 A;  1C9H A;  4Q22 A;  1FKH A;  3ARX A;  2Q5A A;  4LAY A;  2M08 A;  4TNS A;  2LJ4 A;  4ZPW R;  4P8V A;  1HKI A;  4MTV A;  3WQW A;  2AWG A;  3O5M A;  3RFW A;  3ALF A;  2G41 A;  1HJX A;  3WQV A;  2WM0 A;  1FKG A;  3ARR A;  3JYJ A;  1NH6 A;  1ROT A;  2ZR6 A;  3PRD A;  4N19 A;  1E15 A;  2IUZ A;  1NSG A;  1OGG A;  2DG3 A;  2KO7 A;  1E6N A;  1JND A;  1FD9 A;  1SR0 A;  5HT1 A;  1W1Y A;  5HW7 A;  2LKN A;  3WL0 A;  1SYT A;  3GU0 A;  1HJV A;  5HWC A;  1FKB A;  3WKZ A;  2F23 A;  2PN0 A;  3WD3 A;  1LL6 A;  3PR9 A;  1T11 A;  1X6L A;  3UQB A;  4TW6 A;  1HXV A;  1EQ3 A;  1ZU8 A;  2MLZ A;  3RME A;  4UDM A;  5JH8 A;  4WKA A;  3KAD A;  1NWT A;  3AS0 A;  2Y78 A;  1KFW A;  1XRV A;  3B9D A;  1TFV A;  1FFR A;  2YBT A;  1J4I A;  3TDB A;  1M5Y A;  4ODO A;  3UI5 A;  1QPL A;  2KE0 A;  2MPH A;  1KT1 A;  1P5Q A;  3KAI A;  4BF8 A;  2ESC A;  2OFN A;  1EDQ A;  1EIB A;  4DIP A;  1CTN A;  1LJY A;  1UR8 A;  3NTP A;  4DH0 A;  1D7J A;  3ARV A;  4JFK A;  3FAP A;  3AQU A;  2IF4 A;  1UR9 A;  2RUR A;  1Q6U A;  3EIP A;  3NRK A;  3ODK A;  2AOS A;  1JNT A;  1JVW A;  1OWQ A;  3ARW A;  1W26 A;  4ODP A;  1WNO A;  4P8X A;  2ZQS A;  1PBK A;  1HKJ A;  2DSZ A;  1D6O A;  1JNS A;  2KR7 A;  2PV3 A;  1HKM A;  2XPB A;  4LAW A;  4Z2I A;  4G2P A;  5DO2 A;  4GGQ A;  3KCE A;  3KAB A;  2RUD A;  3WD4 A;  4IT6 A;  2DSU A;  1JNE A;  5DF0 A;  1QPF A;  4URI A;  2DSW A;  2ZR5 A;  4HBE A;  3OA5 A;  4R0X A;  4Z2K A;  3ARP A;  4IQ2 A;  4AY1 A;  2OLH A;  3CHC A;  3RGC A;  1X6N A;  2KFW A;  4DRN A;  4ODL A;  5I98 A;  2MNT A;  3WH0 A;  2PV1 A;  3H9R B;  2A3B A;  3PRB A;  2B5U B;  1NWR A;  5J6E A;  4Z2L A;  2XP3 A;  5HW8 A;  2RSE A;  1L1P A;  2RUC A;  1ROU A;  1W9V A;  1LQ0 A;  5GQB A;  1ITX A;  3RM8 A;  5GPG A;  3TCZ A;  1GRJ A;  3ARZ A;  3KAG A;  4ITZ A;  4NNR A;  1E9L A;  1E6P A;  2FDM A;  2DSV A;  1ZBW A;  1FKL A;  4R5E A;  1HJW A;  1FKR A;  4G50 A;  3G6M A;  2P4V A;  3WIJ A;  1KT0 A;  5HBF A;  1GOI A;  3WL1 A;  2RQS A;  2DT2 A;  4WK9 A;  4HBO A;  3O5J A;  3O5E A;  3O5I A;  3IKD A;  3NI6 A;  4QT2 A;  1U79 A;  1F40 A;  2B31 A;  4XAK A;  3O5D A;  5DIU A;  4FAP A;  3ARS A;  3CGM A;  2DG4 A;  1FKI A;  1FKS A;  1YAT A;  4ODM A;  3PRA A;  4L3N A;  3B9E A;  4IPX A;  3RM4 A;  4DWS D;  2A3A A;  4JFL A;  4WJX A;  1E6R A;  2G8Z A;  1NMW A;  4DZ2 A;  2JZV A;  4MNM A;  4J4N A;  4U86 A;  5HW6 A;  1D7I A;  4P8U A;  1LG2 A;  4PTM A;  2FKE A;  2F2D A;  1WB0 A;  1ZK6 A;  4S3J A;  2XP5 A;  1E44 A;  1J4R A;  2D9F A;  4KR0 B;  3CHE A;  3I6C A;  1FKJ A;  3IK8 A;  2ZQU A;  1YW5 A;  4LGX A;  3KAF A;  3QOK A;  3AS1 A;  2K8I A;  3O5Q A;  3GTY X;  5GPR A;  4ODN A;  3ARU A;  4U85 A;  2VN1 A;  3VAW A;  3UQI A;  2XPA A;  1W1V A;  2UZ5 A;  1EYM A;  1K9T A;  3LUO A;  5DEZ A;  1NMV A;  2O92 A;  4W9O A;  1NWS A;  4ODK A;  1Q6I A;  3AS3 A;  3GPK A;  4O2T A;  4MNK A;  4TYO A;  4IQC A;  2O9O A;  3OOB A;  2ZQT A;  1QZ2 A;  3WD2 A;  1NWU A;  4NSB A;  1HKK A;  1E6Z A;  2XP7 A;  2L2S A;  1W9U A;  5B8I C;  4DRK A;  1N1A A;  3FY1 A;  1H0I A;  1J4H A;  4C02 B;  3RM9 A;  4ODQ A;  4MSP A;  2F4E A;  2MLY A;  4P8W A;  4MGV A;  1B6C A;  2WK2 A;  4ML4 A;  4WKF A;  4Z2G A;  2ETN A;  3BMB A;  3ARO A;  3B7X A;  4TW8 A;  3O5K A;  2F21 A;  3O5O A;  3IHZ A;  4ODR A;  4JFM A;  4DWS C;  2XP8 A;  2DT3 A;  4NZC A;  2N87 A;  4W5U A;  3WD1 A;  1R9H A;  1LG1 A;  4ZS6 A;  1LL4 A;  3AS2 A;  4LAV A;  5BXJ A;  1Q1C A;  2DPE A;  2VCD A;  3O5G A;  1H0G A;  4Z2H A;  2RUQ A;  4QZV B;  2PPN A;  4Q7N A;  2PV2 A;  2ITK A;  1ZCN A;  3MDY B;  1Y0O A;  1FKD A;  5HTG A;  1RD6 A;  4FN2 A;  3O5L A;  3CZ8 A;  2EUL A;  3UI6 A;  1FFQ A;  3ARQ A;  1FJD A;  1IX5 A;  4L72 B;  1ZL1 A;  4TW7 A;  3CHF A;  4JFJ A;  2XP4 A;  4ZPT R;  1F8A B;  4DRM A;  4HAR A;  1ZBC A;  2MF9 A;  2DG9 A;  4MNJ A;  3UF8 A;  2FAP A;  3JXV A;  3ALG A;  1ZB5 A;  1LL7 A;  1J6Y A;  1BL4 A;  2MLX A;  1O6I A;  4DRH A;  3TC5 A;  3O5P A;  5HWB A;  4JFI A;  4DZ3 A;  4DRO A;  1GUV A;  4Z2J A;  3CHD A;  2WLZ A;  3UI4 A;  1JCH B;  2XP9 A;  1FKK A;  5DIV A;  2WLY A;  2A3C A;  3BXW A;  2LPV A;  3ART A;  4W9Q A;  2LGO A;  1WAW A;  4J4O A;  2ZR4 A;  2KI3 A;  1Q6H A;  5HKG A;  4GIV A;  4DT4 A;  4MPK A;  3B8S A;  4W9P A;  4ZPV R;  1TCO C;  2YBU A;  4DWS B;  5HUA A;  3EY6 A;  2KGJ A;  3UQA A;  1W1P A;  1PIN A;  1D7H A;  3FXY A;  4QIB A;  4MNL A;  1W1T A;  4S3K A;  4KQZ A;  3KAC A;  4IT4 A;  4LAX A;  1VF8 A;  1EHN A;  3IKG A;  2M1I A;  3WD0 A;  2ZQV A;  3KZ7 A;  1ZBK A;  5DIT A;  1OGB A;  4TX0 A;  3W4R A;  1D2K A;  1ZBV A;  5D75 A;  3O5R A;  2DT1 A;  1A7X A;  4DRP A;  4DRI A;  2XP6 A;  4WIW A;  4U84 A;  4DWS A;  3CH9 A; 
#chains in the Genus database with same CATH homology
 3ARY A;  4DRJ A;  3B9A A;  2A3E A;  4MAV A;  4WKH A;  3JYM A;  2PI6 A;  3KAH A;  1FKF A;  3CGN A;  2M2A A;  1FKT A;  4DRQ A;  2PBC A;  1W9P A;  1BKF A;  1XHG A;  3O5F A;  3PA7 A;  2DT0 A;  4QT3 A;  2PPP A;  4JYS A;  1GPF A;  2PPO A;  3G6L A;  1FAP A;  2QF8 A;  1C9H A;  4Q22 A;  1FKH A;  3ARX A;  2Q5A A;  4LAY A;  2M08 A;  4TNS A;  2LJ4 A;  4ZPW R;  4P8V A;  1HKI A;  4MTV A;  3WQW A;  2AWG A;  3O5M A;  3RFW A;  3ALF A;  2G41 A;  1HJX A;  3WQV A;  2WM0 A;  1FKG A;  3ARR A;  3JYJ A;  1NH6 A;  1ROT A;  2ZR6 A;  3PRD A;  4N19 A;  1E15 A;  2IUZ A;  1NSG A;  1OGG A;  2DG3 A;  2KO7 A;  1E6N A;  1JND A;  1FD9 A;  1SR0 A;  5HT1 A;  1W1Y A;  5HW7 A;  2LKN A;  3WL0 A;  1SYT A;  1HJV A;  5HWC A;  1FKB A;  3WKZ A;  3WD3 A;  1LL6 A;  3PR9 A;  1T11 A;  1X6L A;  3UQB A;  4TW6 A;  1HXV A;  1EQ3 A;  1ZU8 A;  2MLZ A;  3RME A;  5JH8 A;  4WKA A;  3KAD A;  1NWT A;  3AS0 A;  2Y78 A;  1KFW A;  1XRV A;  3B9D A;  1TFV A;  1FFR A;  2YBT A;  1J4I A;  3TDB A;  1M5Y A;  4ODO A;  3UI5 A;  1QPL A;  2KE0 A;  2MPH A;  1KT1 A;  1P5Q A;  3KAI A;  4BF8 A;  2ESC A;  2OFN A;  1EDQ A;  1EIB A;  4DIP A;  1CTN A;  1LJY A;  1UR8 A;  3NTP A;  4DH0 A;  1D7J A;  3ARV A;  4JFK A;  3FAP A;  3AQU A;  2IF4 A;  1UR9 A;  2RUR A;  1Q6U A;  3NRK A;  3ODK A;  2AOS A;  1JNT A;  1JVW A;  1OWQ A;  3ARW A;  1W26 A;  4ODP A;  1WNO A;  4P8X A;  2ZQS A;  1PBK A;  1HKJ A;  2DSZ A;  1D6O A;  1JNS A;  2KR7 A;  2PV3 A;  1HKM A;  2XPB A;  4LAW A;  4Z2I A;  4G2P A;  5DO2 A;  4GGQ A;  3KCE A;  3KAB A;  2RUD A;  3WD4 A;  4IT6 A;  2DSU A;  1JNE A;  5DF0 A;  1QPF A;  4URI A;  2DSW A;  2ZR5 A;  4HBE A;  3OA5 A;  4R0X A;  4Z2K A;  3ARP A;  4IQ2 A;  4AY1 A;  2OLH A;  3CHC A;  3RGC A;  1X6N A;  2KFW A;  4DRN A;  4ODL A;  5I98 A;  2MNT A;  3WH0 A;  2PV1 A;  3H9R B;  2A3B A;  3PRB A;  1NWR A;  5J6E A;  4Z2L A;  2XP3 A;  5HW8 A;  2RSE A;  1L1P A;  2RUC A;  1ROU A;  1W9V A;  1LQ0 A;  5GQB A;  1ITX A;  3RM8 A;  5GPG A;  3TCZ A;  3ARZ A;  3KAG A;  4ITZ A;  4NNR A;  1E9L A;  1E6P A;  2FDM A;  2DSV A;  1ZBW A;  1FKL A;  4R5E A;  1HJW A;  1FKR A;  4G50 A;  3G6M A;  3WIJ A;  1KT0 A;  5HBF A;  1GOI A;  3WL1 A;  2RQS A;  2DT2 A;  4WK9 A;  4HBO A;  3O5J A;  3O5E A;  3O5I A;  3IKD A;  3NI6 A;  4QT2 A;  1U79 A;  1F40 A;  2B31 A;  4XAK A;  3O5D A;  5DIU A;  4FAP A;  3ARS A;  3CGM A;  2DG4 A;  1FKI A;  1FKS A;  1YAT A;  4ODM A;  3PRA A;  4L3N A;  3B9E A;  4IPX A;  3RM4 A;  4DWS D;  2A3A A;  4JFL A;  4WJX A;  1E6R A;  2G8Z A;  1NMW A;  4DZ2 A;  2JZV A;  4MNM A;  4J4N A;  4U86 A;  5HW6 A;  1D7I A;  4P8U A;  1LG2 A;  4PTM A;  2FKE A;  2F2D A;  1WB0 A;  1ZK6 A;  4S3J A;  2XP5 A;  1J4R A;  2D9F A;  4KR0 B;  3CHE A;  3I6C A;  1FKJ A;  3IK8 A;  2ZQU A;  1YW5 A;  4LGX A;  3KAF A;  3QOK A;  3AS1 A;  2K8I A;  3O5Q A;  5GPR A;  4ODN A;  3ARU A;  4U85 A;  2VN1 A;  3VAW A;  3UQI A;  2XPA A;  1W1V A;  2UZ5 A;  1EYM A;  1K9T A;  3LUO A;  5DEZ A;  1NMV A;  2O92 A;  4W9O A;  1NWS A;  4ODK A;  1Q6I A;  3AS3 A;  3GPK A;  4O2T A;  4MNK A;  4TYO A;  4IQC A;  2O9O A;  3OOB A;  2ZQT A;  1QZ2 A;  3WD2 A;  1NWU A;  4NSB A;  1HKK A;  1E6Z A;  2XP7 A;  2L2S A;  1W9U A;  5B8I C;  4DRK A;  1N1A A;  3FY1 A;  1H0I A;  1J4H A;  4C02 B;  3RM9 A;  4ODQ A;  4MSP A;  2F4E A;  2MLY A;  4P8W A;  4MGV A;  1B6C A;  2WK2 A;  4ML4 A;  4WKF A;  4Z2G A;  3ARO A;  3B7X A;  4TW8 A;  3O5K A;  2F21 A;  3O5O A;  3IHZ A;  4ODR A;  4JFM A;  4DWS C;  2XP8 A;  2DT3 A;  4NZC A;  2N87 A;  4W5U A;  3WD1 A;  1R9H A;  1LG1 A;  4ZS6 A;  1LL4 A;  3AS2 A;  4LAV A;  5BXJ A;  1Q1C A;  2DPE A;  2VCD A;  3O5G A;  1H0G A;  4Z2H A;  2RUQ A;  4QZV B;  2PPN A;  4Q7N A;  2PV2 A;  2ITK A;  1ZCN A;  3MDY B;  1Y0O A;  1FKD A;  5HTG A;  1RD6 A;  4FN2 A;  3O5L A;  3CZ8 A;  3UI6 A;  1FFQ A;  3ARQ A;  1FJD A;  1IX5 A;  4L72 B;  1ZL1 A;  4TW7 A;  3CHF A;  4JFJ A;  2XP4 A;  4ZPT R;  1F8A B;  4DRM A;  4HAR A;  1ZBC A;  2MF9 A;  2DG9 A;  4MNJ A;  3UF8 A;  2FAP A;  3JXV A;  3ALG A;  1ZB5 A;  1LL7 A;  1J6Y A;  1BL4 A;  2MLX A;  1O6I A;  4DRH A;  3TC5 A;  3O5P A;  5HWB A;  4JFI A;  4DZ3 A;  4DRO A;  1GUV A;  4Z2J A;  3CHD A;  2WLZ A;  3UI4 A;  2XP9 A;  1FKK A;  5DIV A;  2WLY A;  2A3C A;  3BXW A;  2LPV A;  3ART A;  4W9Q A;  2LGO A;  1WAW A;  4J4O A;  2ZR4 A;  2KI3 A;  1Q6H A;  5HKG A;  4GIV A;  4DT4 A;  4MPK A;  3B8S A;  4W9P A;  4ZPV R;  1TCO C;  2YBU A;  4DWS B;  5HUA A;  3EY6 A;  2KGJ A;  3UQA A;  1W1P A;  1PIN A;  1D7H A;  3FXY A;  4QIB A;  4MNL A;  1W1T A;  4S3K A;  4KQZ A;  3KAC A;  4IT4 A;  4LAX A;  1VF8 A;  1EHN A;  3IKG A;  2M1I A;  3WD0 A;  2ZQV A;  3KZ7 A;  1ZBK A;  5DIT A;  1OGB A;  4TX0 A;  3W4R A;  1D2K A;  1ZBV A;  5D75 A;  3O5R A;  2DT1 A;  1A7X A;  4DRP A;  4DRI A;  2XP6 A;  4WIW A;  4U84 A;  4DWS A;  3CH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...