2PBEA

Crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
263
Chain Sequence
LRSEQEMMDIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-adenylyltransferase
publication title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 82
structure length 263
sequence length 282
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2pbeA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2pbeA01
3HW8A 8ICGA 4AT9A 5J0SA 2DRBA 4X5VA 2I9GA 4IQWA 7ICNA 5HR9A 4NKTA 2P66A 3LQCB 4QZIA 5J0RA 5J2BA 1Q79A 3RJKA 4TURA 2W9MA 5IIKA 9ICBA 4NM2A 5J0TA 1ZQPA 1MIYA 3C66A 2L6FA 1JN3A 1TFYA 5J2AA 5J2JA 3C2LA 4WC1A 4P2HA 2ZHBA 1YLQA 5HRGA 3C2MA 1HUOA 2JPUA 2O1PA 5J0WA 4X4RA 4QZHA 1K40A 4UB1A 3OUYB 3MGIA 2BPFA 8ICRA 4WBZA 3U0CA 3RJEA 8ICZA 4M9LA 3OVBA 3PMLA 2HHPA 3JPPA 7ICVA 4UD4A 4M04A 5IIIA 4XQ8A 1ZQHA 4M2YA 1UETA 7ICOA 4QZFA 9ICQA 3K7DA 4FH3A 5HRHA 4KLJA 4I2GA 7ICHA 1ZQWA 4PHPA 4UBCA 1BPEA 3WFOA 8ICFA 5J2IA 5J0QA 2ZH3A 4NM1A 4LZGA 4M9GA 8ICJA 9ICJA 2Q00A 3AU2A 4P4OA 9ICUA 2BE3A 4R64A 4XA5A 2LK4A 4RQ5A 1FA0A 5IIJA 4UB2A 7ICLA 3L9DA 1UEVA 4Z6FA 3HX0A 1MQ2A 9ICFA 4AT8B 4AT9B 3AUOA 2FMQA 4KLEA 8ICNA 9ICKA 4DOBA 1BPYA 4WC0A 3MBYA 1V4AA 4NQFA 3RH4A 1QVXA 4MFAA 4KLIA 5CB1A 2ZH5A 2ISOA 5HRDA 4PGXA 3HWTA 4FH5A 8ICTA 4NLKA 5BOLA 3C5GA 7ICIA 7ICGA 1ZQGA 1ZQBA 4WC5A 3WFPA 5DBBA 5J0UA 3MFNA 4K4GA 1F5AA 4WC7A 4JWMA 4X4OA 4K4HA 2NRKA 4R65A 3MGHA 4FHXA 1KEJA 3H38A 8ICKA 4X4PA 4KLLA 1BPDA 5DDMA 4RPYA 4DO9A 2PFNA 8ICLA 3OV7A 1XSLA 3RJFA 3RJHA 2L6HA 2DRAA 9ICSA 3PNCA 2ZH8A 4E7XA 2ZH4A 4I2BA 4I2EA 1UFBA 4AT8A 1ZQQA 3GM1A 8ICOA 7ICSA 4XRHA 9ICCA 7ICPA 4WC6A 4ATBB 8ICIA 4YN4A 3RQEA 2DR7A 1ZQFA 4I2IA 4WC3A 4RQ1A 4MFFA 1PV3A 3O10A 4YMOA 4YD1A 4PHDA 2M2UA 3U3FA 4S3NA 1ZQSA 1ZQXA 4RPXA 5DECA 1R89A 4FHWA 4M9NA 4P4MA 5DEDA 3RH6A 1WWPA 4RPZA 4RT2A 4LVSA 3HJ1A 3UXOA 2O5AA 3JZ0A 4RQ0A 1KNYA 4RQ3A 3RQFA 1BPZA 4QZCA 1ZQAA 1XSNA 4I2HA 9ICOA 4X4QA 9ICAA 5CP2A 3JPQA 9ICWA 5J2HA 4GXJA 4QZBA 5DB9A 3TULA 5J2GA 4O9MA 1ZQIA 4RQ7A 4F5QA 4X0AA 3V7LA 3TFSA 8ICWA 2DVIA 3TFRA 3AU6A 4ATBA 2ZH2A 4XUSA 4E80A 4X4NA 4RWQA 3UQ0A 4NKUA 4LT6A 5DDYA 5CWRA 3AQNA 8ICAA 5IINA 4QZAA 4RWPA 1JOGA 1MQ3A 1K05A 1ZQEA 4Z6CA 4I2AA 3K75D 4X4UA 4KLQA 4PGYA 3RH5A 5BPCA 2ZH6A 1K04A 4I27A 3WFSC 8ICCA 2VANA 1TV9A 7ICQA 2M2TA 3JPSA 4P4PA 5J2DA 3UPSA 4I2DA 2JX0A 4RQ4A 5HHIA 7ICJA 4R32A 3H3AA 3LK9A 2Q66A 3WFRE 1KTMA 3C8GD 5J2EA 1ZQCA 4F5OA 8ICHA 3H39A 1ZQYA 4QZ9A 2M2VA 2GWSA 4YCXA 1KDHA 4XEFA 3MDCA 5CHGA 3RJGA 4DOAA 1VFGA 2M2WA 4MF2A 4PHEA 4MF8A 2BCVA 9ICMA 7ICUA 3C8GA 5J0XA 4QZGA 5J2CA 5J0PA 1JQRA 5HREA 4UB4A 1ZQMA 8ICEA 4UAWA 2L6GA 3ISDA 3BRJA 5DB8A 1ZJMA 2PFOA 2IHMA 9ICRA 4M0AA 5BOMA 1NO5A 4UD5A 4YMNA 3OVAA 4WC4A 5CJ7A 5IIMA 4X4SA 8ICBA 3HJ4A 8ICXA 5CR0A 1ZQUA 1WOLA 3UQ2A 2ZH1A 1ZQTA 2PFPA 9ICTA 5D46A 8ICMA 4RWOA 1MIWA 1Q78A 1TVAA 2FMSA 4O5EA 3JPRA 5HHHA 8ICPA 1BPXA 4TUQA 3ISCA 1ZQRA 1PX5A 2ID1A 8ICQA 3UXNA 3GM3A 9ICIA 2PBEA 3C2KA 4O5KA 3AQLA 9ICVA 4NLZA 1ZJNA 4KLUA 4UBBA 4AT7A 1ZQJA 3C5FA 4WBYA 3UXPA 2BPCA 3RJIA 3HIYA 3UPQA 1BPBA 9ICXA 4YD2A 3L8JA 1ZQOA 4EP7A 1TFWA 4FHYA 3RQGA 4I29A 3WFQE 1JMSA 4I2JA 1R8CA 4X4VA 3ISBA 1R8BA 4IG8A 4XEKA 1ZQKA 9ICGA 4KLDA 1OW7A 2HSBA 4O5CA 9ICNA 4F5RA 1ZQVA 4QZEA 4IQVA 3B71A 4NXZA 3C18A 1RPLA 3B0YA 1VJ7A 3NYBA 4XQ7A 2BCQA 5CA7A 5F2VO 2DR5A 5HRLA 5J2FA 1R8AA 1OW6A 5EOZA 4RQ6A 4RQ8A 4PPXA 1ZZPA 8ICSA 5HRBA 4R63A 4LZDA 4RT3A 4YMMA 2FMPA 5IILA 3MDAA 3V72A 5J0YA 4NY8A 1ZQZA 3C8GB 3S9OA 4XEVA 4UB3A 5HRIA 4UAYA 4KLSA 3JPTA 3OGUA 1WOTA 4EBKA 4PHAA 4KLGA 3AQMA 3GM2A 4R66A 2BCRA 4TUPA 5HC9A 3JPOA 3OVSA 7ICEA 9ICHA 4M5DA 1O3UA 4Z6DA 3V7JA 2PXIA 4M9HA 5J29A 4I2CA 5DB6A 2BPGA 4I2FA 4K4IA 2ZH7A 2YWAA 8ICUA 4PGQA 7ICKA 3L8IA 4JWNA 4KLMA 4DOCA 4KLHA 9ICEA 4WCWA 4EBJA 4IQTA 1NOMA 4WC2A 3JYYA 3V7KA 9ICLA 4X4TA 4AT7B 1ZQNA 3JPNA 2DR9A 4I28A 7ICTA 1WTYA 4TUSA 4KLOA 3OUYA 7ICMA 9ICPA 4GXKA 2KK1A 4X0BA 4UAZA 1ZQLA 2RFFA 5IIOA 5HRFA 4F5NA 4FHPA 4MFCA 4RQ2A 1OW8A 3GDXA 4FO6A 4FHVA 1OU5A 3RJJA 2ZHAA 4GXIA 5D49A 4PH5A 1HUZA 3H37A 2BCSA 4F5PA 5DBCA 5DBAA 1ZQDA 4Z6EA 5J2KA 1UEUA 3B0XA 2ISPA 7ICFA 8ICVA 4UB5A 1XSPA 3AJMA 1MIVA 3PMNA 4E8FA 5J0OA 2BCUA 1RZTA 2DR8A 4M47A 5HRKA 4QZDA 5DKWA 4KLFA 4M9JA 5DB7A 5TZVA 1JAJA 4RWNA 5F28E 3AQKA 4QZ8A 4KLTA 7ICRA 4NLNA 8ICYA 2PFQA 2ZH9A 4IQUA 5D4BA
chains in the Genus database with same CATH superfamily
8ICGA 3TK0A 4U5BE 5J0SA 4X5VA 4IQWA 2Y3BA 2F22A 4QZIA 4BJTA 5A6AA 5J2BA 3JT1A 3RJKA 4BJ6C 3IQTA 3UMKA 4TURA 5IIKA 4NM2A 5J0TA 1Q0FA 4XPXA 3V7OA 3C66A 2ZXRA 1JN3A 4EEDA 1PCXA 2VCCA 2R7VA 5DLJA 4HEAJ 1BDJB 1ZVZA 2J45A 2JPUA 2O1PA 3LNMB 1M2VB 1G8XA 3OUYB 3MGIA 4NXUA 4OAHA 8ICRA 3S90A 1R5ID 2HN1A 3OVBA 5IY5C 3PMLA 1G4WR 3ZTZA 2M64A 4UD4A 2M4EA 4XQ8A 3RKOF 4EBBA 2YL0A 2CW0F 5HRHA 3US6A 2Y3HA 4N6CA 3I5QA 4DXWA 2ZXOA 4E7ZA 4LZGA 4M9GA 8ICJA 2YKZA 3N24A 4KM5A 1TKNA 3HLZA 5JP7A 4DVYP 2XL6A 3KH2A 4XA5A 4BEMJ 5IIJA 7ICLA 3L9DA 2NSFA 1LIHA 1S7ZA 1E83A 1ZW3A 2XL4A 3VAYA 4MVRA 3AUOA 2FMQA 4RD9A 4KLEA 4JEAA 1XZQA 3ZQYA 4U9EA 1QVXA 4MFAA 4O67A 3GEIA 1CPRA 5HRDA 4PGXA 4FH5A 4NLKA 3EFOA 5JT4A 4WC5A 1FFTC 4BEJA 1EA8A 1GGQA 1FTSA 3LEVA 2PFDA 5DBBA 4C3DA 1YA9A 1F5AA 4WC7A 4JWMA 4X4OA 3EQLF 2OEXA 5CI9A 5E3CA 3Q6MA 3X2QC 1LVKA 4JTCB 4X4PA 2YQYA 1BPDA 5DDMA 2A0BA 8ICLA 3HNLA 3JRTA 4W8KA 2Q3TA 4JTDB 9ICSA 4E7XA 2EIMC 1T6IA 4XWJA 5BQGA 4I2EA 2XLEA 1UFBA 4AT8A 4ONSA 4EHPA 2FAPB 5F5HA 3JSEO 2R9RB 4WC6A 1BR4A 3C7JA 3G50A 4JJGA 2D5RB 2YLGA 1VLSA 4RQ1A 4MFFA 1PV3A 3O10A 3OEOA 4YMOA 4YD1A 3A11A 4L6RA 4RPXA 5CHEA 4WGZA 4KNVA 3U5SA 3HTKC 1MQVA 4FO1A 3RQFA 1BPZA 4PJLA 4I2HA 5CP2A 4WGYA 1J8MF 1CGME 2A6HF 3JPQA 2IXOA 4QZBA 5DB9A 4GEHA 4YK5A 2P61A 4RQ7A 3V7LA 4DRIB 8ICWA 2DVIA 3TFRA 3UR3C 2XLHA 4CS8A 4E80A 1MNEA 5GPGB 1ZHZA 4LT6A 2R03A 4RDAA 2NUTA 5A6BD 3DI5A 1OKKA 3S84A 1MQ3A 3M1CB 3SXKA 1APCA 2H7OA 1K04A 4I27A 2R05A 4PR9A 1QKRA 3ABKC 4P4PA 5J2DA 3UPSA 4AK9A 4RQ4A 4K97A 5HHIA 2P0NA 7ICJA 3K1IC 3H3AA 3LK9A 4YJWA 1NFNA 2XM0A 1Y6DA 4O69A 1YLMA 1ZQYA 4YCXA 2XLOA 2L81A 3MDCA 5KYWA 2QY9A 1VFGA 4Q7CA 4MF2A 2BCVA 3NMIA 4JZAA 5J0PA 2NPUA 3ER8C 4KB6A 2L6GA 3BRJA 5DB8A 3A9CA 3TOMA 5K0IA 5BOMA 2JD3A 3CEXA 4YMNA 3S0XA 4WC4A 5IIMA 3K66A 3FOPA 2VB6A 8ICXA 1ZQUA 1WOLA 3N2ZB 1JMWA 4RWOA 1T01A 1Q78A 2Q9AA 2YRFA 2FMSA 4O5EA 1ZW2A 5HHHA 1E85A 3TJ5A 5CFSA 1PX5A 1LS1A 1WATA 4O5KA 3ATPA 1I5NA 4K0DA 2B4VA 4JCZA 4JTAB 1ZJNA 1M57C 2NUTB 4LDKA 3RJIA 2IOQA 2UUIA 9ICXA 2X51A 2HV7A 4YD2A 3ITFA 4NXWA 1GS9A 4WQLA 4EP7A 1TFWA 4FHYA 3RQGA 2LP4A 3WFQE 3GEHA 4XQ1A 1Q0KA 1R8CA 4X4VA 2MYSA 5A69A 9ICGA 3AG2C 4E17A 2HSBA 3HKKA 3RYLA 3GWNA 2HS5A 4QZEA 3B71A 5COFA 4NXZA 3B0YA 4JKVA 3NYBA 2BCQA 4XTKA 3H65A 5HRLA 5J2FA 1YA7O 1OW6A 4PPXA 1ZZPA 5HRBA 4LZDA 4YMMA 5KYWB 2Y69C 3MDAA 5J0YA 2HJMA 2LQGA 4XLNF 2G3KA 2ZD9A 4K9AA 2XLVA 2L9JA 4O7GA 3DD7A 4KLGA 3AQMA 4R66A 1VB5A 1G4US 2B0HA 3W4YA 4LLEA 3JPOA 3EH2A 7ICEA 3MBGA 1O3UA 4B6IA 4I2CA 4I2FA 4I3MA 4YT4A 2WL8A 1J8YF 4PGQA 7ICKA 4KLHA 3WODF 3ZC4A 4EWCA 1HE9A 4WC2A 4YN0B 1GQAA 1RKCA 3V7KA 9ICLA 1SYQA 5B3IA 3LAYA 4I28A 2RD9A 4TUSA 4ER9A 3VYWA 2HMQA 4GXKA 2QNLA 2KK1A 3ZDLA 5AC5A 2B56A 4JJFA 3FAJA 3NYJA 4FHPA 3GDXA 3F47A 5BUOA 3RJJA 4GXIA 5D49A 5DS6A 1HUZA 3H37A 2QUPA 3O39A 3KMIA 4IAOA 4Z6EA 2ISPA 5L0DA 3FDQA 1XSPA 3AJMA 2BC5A 4KLQA 1CGNA 4E8FA 3V5ZA 2BCUA 1RZTA 4M47A 4NLNA 3IPMO 1B68A 5KYUA 4YT2A 2FCLA 3S27A 2XLDA 2DRBA 7ICNA 5HR9A 2P66A 2NG1A 3FMSA 4OAGA 3OWGA 4NXVA 2W45A 1E84A 4WH5A 5J0RA 4ZLDA 3PHZA 5T3TA 3NRHA 1A41A 3DMDA 1OCOC 2D4UA 1RMVA 5J2JA 2YEVA 4P2HA 1AUEA 1IW7F 1YLQA 3DAGA 1HUOA 1OXBA 4NY3A 4X4RA 4DRHB 3CK6A 2EINC 3RJEA 5JLIA 8ICZA 2CYDA 4M9LA 2HZ8A 2J9BA 1EQ1A 2HHPA 3JPPA 1D0YA 4HFFB 4M04A 3DZAA 1L7CA 2FFHA 2KC3A 4I1OB 4E7SA 3JYHA 4C7OA 1VK5A 4KLJA 2AVKA 3EHNA 4GYTA 4I2GA 1ORJA 1DOWA 4PHPA 2PP4A 2GAQA 2HN2A 1BPEA 5EK0A 3WFOA 4IGGA 2ZH3A 4NM1A 2Q00A 9ICUA 2LK4A 4RQ5A 4UB2A 3H2UA 2HFIA 4JE9A 1NLXA 4YL3A 4Q4ZF 3PMRA 4KBLA 9ICKA 3RH4A 5CB1A 1JAFA 3VM6A 2LCHA 5BOLA 7ICIA 4QDLA 2ZXWC 3WFPA 2BBJA 2X0CA 4NTBA 3UMIA 1T9KA 2NRKA 3DE8A 5D61A 5DQTA 3QVZA 1RJ9A 3EG9A 8ICKA 4KLLA 2HV6A 2PFNA 4K1OA 1XSLA 3RJFA 2PX0A 3VRCA 4M63A 3GM1A 4XRHA 3CQZA 1Q0GA 2DR7A 1ZQFA 4C7OB 4WC3A 4MTFA 4D4XA 4K96A 4Q5SF 4PHDA 4WJ0A 1JRAA 1ST6A 2R7TA 1ZQSA 1ZQXA 1W2WA 3KPHA 4P4MA 1O87A 3RH6A 1VTMP 1RKEA 3CAXA 3DJUB 3LLIA 1C03A 4RQ3A 4CSAA 4OINF 2VH3A 2G3VA 9ICAA 2AU5A 2O9XA 4GXJA 1XZPA 4O9MA 1ZQIA 3TFSA 4Z9IA 1U89A 1GM5A 3AU6A 4K8VA 4XUSA 4I44A 1T5OA 1YDIA 3UQ0A 5T1DB 4UDVA 1ZHXA 3MYIA 2I15A 3MYFA 3SXYA 4MVOA 3DWWA 2C04A 2XLMA 1RJ9B 3EG9B 4PGYA 4HE8D 3RVYA 3NWIA 1OCCC 3K1HA 4JRZA 5DQZA 3NG1A 3ERCC 1TWHA 2EWRA 4N06A 2R7SA 4PJMA 3ZG1A 1KTMA 5J2EA 1ZQCA 2WZLA 2DB4A 1BR1A 2GWSA 3EHMA 1KDHA 4XEFA 1NZEA 3RJGA 1NU7D 1YZCA 3PDMP 3RF3A 5KYXA 1JQRA 4UB4A 8ICEA 4OD5A 3ISDA 1A7VA 3SNHA 5E33A 9ICRA 1RKEB 2P7VA 3AG3C 3LS1A 3MCRA 4M0AA 5KYYB 2CNWD 1CGOA 3HJ4A 5CR0A 5D46A 8ICMA 5B1AC 2MWQA 1TVAA 4MVMA 5DS5A 5B3SC 3JPRA 4Z9HA 3GWLA 1BPXA 4CS8C 1H7IA 1ZQRA 2ID1A 3CSKA 8ICQA 3GM3A 2PBEA 2GA0A 4OD4A 3ZIBA 3QZCA 4KLUA 2R7QA 4UBBA 1NG1A 2LFFA 1ZQJA 4YT5A 3DM9B 5COMA 2XSEA 1O5HA 4LACB 3GORA 4JC7A 2EIKC 1HE1A 2V26A 4W8PA 1JMSA 4I2JA 4IG8A 3SEOA 3RW0A 2QTVA 9ICNA 1ZQVA 4IQVA 3NKEA 1VJ7A 4XQ7A 5A6JA 2GWWA 1GPJA 1TWGA 4X0RA 1R8AA 1WN0A 4LEYA 2YL7A 1MMDA 8ICSA 4FX5A 2XS8A 1OQCA 2WZFA 3HJCA 3RFYA 2FMPA 4NY8A 4ULVA 4C3BA 1YYJA 4CJOA 3S9OA 4XEVA 5KYXB 5HRIA 3HNJA 4KLSA 4YT8A 4KI2A 1WOTA 1BBHA 4U5HA 2A69F 2BCRA 5CI8A 4TUPA 1VLTA 4E0IA 4FAPB 3NKDA 2Z15A 3EGXA 3LJBA 4M9HA 5J29A 3QVYA 4K4IA 2YWAA 3U2LA 3MX3A 3L8IA 1DOVA 4DOCA 9ICEA 3TD7A 3EPVA 3EZHA 4EBJA 3JYYA 4EIYA 4X4TA 3K33A 1RCPA 1WTYA 9ICPA 4X0BA 4LDQA 3NDBB 1ZQLA 3OWTA 3DAFA 4U5CE 3QMKA 1VYIA 1I4YA 4MFCA 2IHOA 3JSZA 3GEEA 4FO6A 3RVZA 5D63A 1OU5A 4RBNA 2ZHAA 4O68A 1Z23A 5DBCA 1ZQDA 5J2KA 1UEUA 1V55C 7ICFA 2Q7RA 2GDCA 3PMNA 5J0OA 2WVOA 5HRKA 4M9JA 5DB7A 2ETSA 5TZVA 5F28E 4YL0A 1ZU5A 3O6XA 1M2OA 3HW8A 2Q9BA 3U3BA 4AT9A 1QZXA 4LERA 1FAPB 1HY5A 2OCCC 3EGXB 3W2VA 2R7WA 1HMDA 3T4RA 2G62A 5EGYA 1Q79A 1R4TA 1JR8A 1SMYF 1VMAA 3B29A 4MNDA 3ABLC 4OIRF 4Z9JA 4CDVA 1OCZC 4LEVA 5CFTA 1ZQPA 1MIYA 4CS9A 5L0JA 1A7DA 3EF2A 2A1DD 3C2LA 2DI3A 2EPMX 1LKXA 3C2MA 4P9TA 2KGOA 1WGWA 3RIPA 4QZHA 1YJGA 4KNWA 4XJEA 3M4BA 2NUPA 2ASRA 2LSEA 4NCQA 3M79A 7ICVA 3U9MA 1Q0MA 3MLGA 1ZQHA 4BG0A 1UETA 1TWCA 7ICOA 2R7XA 2IYLD 2OU6A 4JW1A 4UBCA 3T6JA 5DVWA 4WQKA 1LI5A 3SYNA 5L3QA 4BPMA 2FGYA 2B0JA 2QE9A 9ICJA 2A0UA 2BE3A 3AGTA 2IXMA 2XXAA 1PD0A 1FA0A 1ZHTA 2AWYA 4PK4A 4JEBA 1UEVA 4Z6FA 3HX0A 1MQ2A 9ICFA 4AT9B 1Z63A 256BA 2IBFA 8ICNA 4U5FE 4DOBA 4WC0A 3JRMO 4CX9A 1V4AA 4KLIA 2ISOA 2PNOA 1H9GA 3UNGC 8ICTA 3L0IA 1ZQBA 3ABMC 4J7YA 2AWCA 2LIGA 4IARA 3ZVRA 3B0UX 1Z7Qc 3VF0A 5JVEA 1Z5ZA 4K4HA 3C63A 4R65A 3MGHA 4FHXA 1LE4A 2YL1A 3JCFA 4PJNA 3J06A 2L6HA 3B9QA 1LE2A 2DRAA 3PNCA 2ZH8A 2NUPB 1EI7A 2ZH4A 3AQCA 4CIHA 2IXNA 4OIPF 4EKWA 2J9UA 8ICOA 3I4UA 9ICCA 4ATBB 8ICIA 4YN4A 4K99A 3RQEA 2P6VA 3U2MA 2J0XA 3KYIA 2W9YA 1OR3A 3WG7C 4N7RA 4K9BA 2M2UA 1CPQA 4G7OF 2XXAB 2AP3A 4FHWA 4N4WA 5BQHA 4U5GA 4RT2A 4LVSA 2O5AA 3V5XA 4RQ0A 3AGUA 1HW1A 2B51A 2XLWA 1KNYA 5KYNA 1ZQAA 9ICOA 4X4QA 4JURI 5HSWA 4NTFA 9ICWA 3B0PA 2WZGA 3AOUA 2HSQA 4YWQA 5J2GA 4X0AA 3M4CA 5COGA 2XL8A 3JCUQ 4X4NA 4RWQA 4NKUA 5DDYA 5CWRA 3AQNA 1NBBA 3SP1A 2OG2A 5IINA 3LEOA 1MNDA 4ULWA 4RWPA 3JTLO 2PF4E 4Z6CA 4I2AA 2Y39A 4X4UA 4A2NB 1OR2A 3RH5A 4MW8A 4JLXA 2VANA 4MVSA 2M2TA 3EJNA 3JPSA 3ZWIA 4BJ5A 4I2DA 2JX0A 2HMZA 1OXKA 4R32A 2Q66A 1M56C 3WFRE 3C8GD 3B0VC 4LDRA 4EUKB 2M2VA 4QZ9A 2OQMA 4AE4A 1A0BA 5AGFA 3V5YA 2IUBA 2TMVP 4QZGA 1WASA 5J2CA 1TWAA 3SZRA 2J7PD 4WOYA 2YVKA 4CIPA 3EGDA 2R7UA 4CSAC 1IZMA 3K6BA 2GFHA 1ZHYA 3UGOA 4UD5A 1VYKA 3OVAA 5CJ7A 1LM3B 3UQ2A 4IRUA 2VC9A 3LLKA 1ZQTA 2PFPA 1D1CA 1MIWA 2H8AA 2KQ9A 4E0HA 1U0BB 8ICPA 4NXTA 4OAIZ 2CNWA 4O6MA 2WVQA 3UXNA 3C2KA 5BQIA 3CZ6A 9ICVA 1FFHA 4NLZA 1SZIA 3IEEA 1HW2A 4AT7A 1F1MA 4WBYA 3UXPA 3O55A 1Z3IX 3HIYA 4HX0A 3L8JA 1LS4A 4I29A 3POVA 3SXMA 4YL1A 1R8BA 4XEKA 4MTGA 5KYYA 5FCLA 3M15A 4F5RA 2OJQA 3PCVA 3C18A 1RPLA 2Y3DA 5CA7A 4BJ1A 1LPEA 2DYRC 3C62A 5D62A 5EOZA 4RQ6A 5B1BC 4AE4B 3L34A 4DOZA 4RT3A 1FMVA 3H2VA 2YHSA 1A7EA 1FR0A 5L0IA 1M6TA 5IILA 5JTGA 3V72A 4PFOA 5E2QA 1TFOB 2ZXPA 4JLZA 4UAYA 3T6GB 3JPTA 5JUAA 3OGUA 4XPWA 3EGDB 4PHAA 1ORSC 2CDQA 2MHRA 3GM2A 4C3EA 3WHNA 3KKBA 4U5DE 9ICHA 3X1OA 1I4ZA 2Y3GA 3U8VA 3V7JA 1QQ3A 2PXIA 5DB6A 2BPGA 2W4BA 5A6BA 4DJ9A 3DE9A 8ICUA 4BJ6A 2E87A 4KLMA 1KU2A 4WCWA 1NOMA 3BEHA 4P6IC 3U8PA 4AT7B 2R7RA 3JPNA 2DR9A 5L3VA 7ICTA 4KLOA 3U9JA 3EZIA 3PHF2 4MW3A 1VOMA 2RFFA 2L7AA 3DKAA 3S28A 1JPJA 2H7BA 4RQ2A 4QI2A 4I0UA 2BL2A 1D0ZA 3LESA 2A68F 4PH5A 1H6GA 2BCSA 3DJNB 4F5PA 3NYMA 5A6KA 1NU9C 2HKVA 3B0XA 2KW3C 3G4ZA 1TQGA 3LUTB 4G78A 5D92A 2OOCA 1JAJA 4KLFA 4E18A 4O6AA 4DRJB 4QZ8A 2YLIA 8ICYA 3S29A 1YAUO 2PFQA 4WABA 5D4BA 4N6HA 2W4MA 3ZQVA 2I9GA 3QW0A 4NKTA 4AL1A 4MVUA 3LQCB 1C02A 1ZHWA 2H7VC 5T3WA 2GA9D 3G4XA 3Q7GA 2W9MA 3NMKA 1ORYA 9ICBA 5AC4A 3UMHA 1HMOA 3DXJF 1G5ZA 2L6FA 1TFYA 5E3AA 5J2AA 4WC1A 4J32B 1L3PA 4LLCA 2EPLX 5DS4A 1QPUA 2ZHBA 5HRGA 4DBQA 5JS5A 2KYHA 5J0WA 1K40A 4UB1A 2BPFA 4WBZA 3U0CA 1SF8A 3OA1A 3FVYA 3EFOB 2ICWG 5IIIA 3W8HA 4O6YA 5L0FA 4M2YA 3FAPB 9ICQA 4QZFA 1U6HA 3K7DA 4FH3A 4JIOA 1S05A 7ICHA 4QI0A 4DBRA 1ZQWA 3GANA 4CDYA 5J0QA 5J2IA 8ICFA 3TJ6A 1T6UA 4K98A 1LI7A 3AG4C 2IM8A 3AU2A 4P4OA 5B3QA 4R64A 1MMGA 4OIQF 4AT8B 3DM5A 3NKUA 3EH1A 2VCAA 1BPYA 1ZU4A 4F4BA 3MBYA 3QW1A 4NQFA 5HV9A 2ZH5A 3HWTA 2EPOA 2J46A 4U5EE 3C5GA 7ICGA 1ZQGA 1C17M 2XRHA 5D91A 4G7ZF 1YVIA 2XM4A 5J0UA 4CS9C 3LS0A 1PD1A 3KYJA 4O79A 3HNKA 3I5PA 3MFNA 4K4GA 1RXQA 4NC3A 3UGPA 5L0GA 2P1AA 1YARO 1NSGB 1KEJA 3T9OA 4ANJA 3NMJA 3H38A 4JCHA 2DYSC 2RSEB 4RPYA 4DO9A 3OV7A 3RJHA 2J9VA 1Z6AA 4I2BA 4GQHA 1JPNA 1ZQQA 4A4AA 1OCRC 1T6QA 5JSLA 3NVOA 7ICSA 7ICPA 3K1IA 2VASA 3FOOA 3QTHA 4PJJA 1YZAA 4H4KC 3C8ZA 4I2IA 1QSPA 2Q4FA 4LEWA 2I8BA 3U3FA 4S3NA 2IXPA 2YL3A 1XWJA 1Q0DA 5DECA 1R89A 1ZYRF 4M9NA 5DEDA 1WWPA 3L1MA 4RPZA 3KL4A 2DGJA 3HJ1A 3UXOA 3JZ0A 2OEVA 2HUJA 4J7TA 3Q6NA 2CCYA 4QZCA 2LFDA 1MMAA 4CJGA 1XSNA 4MKPA 5J2HA 2R25A 4OIOF 5FZTA 2R02A 1QLEC 4DVZA 3TULA 4OAFA 1OKKD 4F5QA 1Y4CA 4ATBA 2ZH2A 4PACA 3IQ6A 4KC9A 8ICAA 4QZAA 5B3PA 1D1BA 2A6EF 1JOGA 5F5FA 2NSGA 1K05A 1ZQEA 3K75D 4AX2A 3FXHA 2YZSA 5BPCA 2ZH6A 8ICCA 3WFSC 1TFKB 1H9TA 3AQBA 1TV9A 7ICQA 3HNIA 3IQCA 4MVZA 3ZTMA 4JVSA 5TJ5E 2WVNA 4CDAA 3FHDA 3GODA 4NXXA 2VCBA 4F5OA 8ICHA 3E70C 3H39A 5L0CA 5L0HA 2KJGA 4CBEA 5CHGA 5CFUA 4DOAA 2M2WA 4PHEA 4MF8A 9ICMA 4MTOA 7ICUA 3C8GA 5J0XA 4D4NA 5HREA 3IHUA 3N0TA 4UAWA 1ZQMA 4P9FA 1D0XA 3IQ5A 1ZJMA 4MVQA 2PFOA 2IHMA 1V74B 1UG7A 2BBHA 1NO5A 5CIVA 2C03A 4EEBA 4X4SA 8ICBA 4MS2A 4ZLCA 2UUHA 2ZH1A 2J7PA 4G7HF 9ICTA 1E86A 3LNRA 4U9DA 1BZ4A 3SXZA 4TUQA 3ISCA 9ICIA 4EGWA 3AQLA 3E9VA 4FESA 4IB4A 3C5FA 2BPCA 2EPKX 3UPQA 1BPBA 1SR2A 2PX3A 1ZQOA 4BJ5C 4CS7A 3T6BA 3ISBA 3ECSA 1ZQKA 4KLDA 1OW7A 4IJJA 4O5CA 3W2WA 5F2VO 2J9WA 4EV6A 2DR5A 2WB7A 4XPYA 3R7CA 4MQ9F 4RQ8A 1AVOB 1E2XA 4R63A 3W8IA 3WAQA 4PFPA 2J0WA 1ZQZA 3F46A 3C8GB 4UB3A 4LEZA 2KNHA 2KSFA 2Q9CA 1AEPA 3NYLA 2ZPAA 4EBKA 4J30B 4G0HA 3ZSUA 5HC9A 3OVSA 4M5DA 4O6NA 4Z6DA 1TR2A 2EIJC 2ZH7A 1BR2A 1V54C 2J8WA 2OKUA 3TQOA 1YYXA 4JWNA 2YLDA 1FNTc 4IQTA 5JRAA 3ASNC 1ZQNA 1D1AA 5KYUB 1M2VA 4XLPF 3OUYA 7ICMA 2OJED 4HFKB 2EILC 4UAZA 4NTAA 5IIOA 5HRFA 4AL0A 3AG1C 2V3CC 4FWVA 4F5NA 2QLAA 1EKYA 1OW8A 2EPNA 2HJ3A 4FHVA 2LD6A 4K7BA 2R7OA 1MMNA 5DBAA 2XS1A 4H54A 3Q7LA 1NFOA 2CGEA 3ASOC 2BE5F 4IWBA 1FMWA 5EHHA 8ICVA 3RH3A 4UB5A 1MIVA 4IAQA 2DR8A 4QZDA 5DKWA 3R2PA 4RWNA 4I1MA 3AQKA 4KLTA 7ICRA 2GAFD 3ER9B 2ZH9A 4IQUA 1N1CA 3TOLA
chains in the Genus database with same CATH topology
3HW8A 8ICGA 4AT9A 5J0SA 2DRBA 4X5VA 2I9GA 4IQWA 7ICNA 5HR9A 4NKTA 2P66A 3LQCB 4QZIA 5J0RA 5J2BA 1Q79A 3RJKA 4TURA 2W9MA 5IIKA 9ICBA 4NM2A 5J0TA 1ZQPA 1MIYA 3C66A 2L6FA 1JN3A 1TFYA 5J2AA 5J2JA 3C2LA 4WC1A 4P2HA 2ZHBA 1YLQA 5HRGA 3C2MA 1HUOA 2JPUA 2O1PA 5J0WA 4X4RA 4QZHA 1K40A 4UB1A 3OUYB 3MGIA 2BPFA 8ICRA 4WBZA 3U0CA 3RJEA 8ICZA 4M9LA 3OVBA 3PMLA 2HHPA 3JPPA 7ICVA 4UD4A 4M04A 5IIIA 4XQ8A 1ZQHA 4M2YA 1UETA 7ICOA 4QZFA 9ICQA 3K7DA 4FH3A 5HRHA 4KLJA 4I2GA 7ICHA 1ZQWA 4PHPA 4UBCA 1BPEA 3WFOA 8ICFA 5J2IA 5J0QA 2ZH3A 4NM1A 4LZGA 4M9GA 8ICJA 9ICJA 2Q00A 3AU2A 4P4OA 9ICUA 2BE3A 4R64A 4XA5A 2LK4A 4RQ5A 1FA0A 5IIJA 4UB2A 7ICLA 3L9DA 1UEVA 4Z6FA 3HX0A 1MQ2A 9ICFA 4AT8B 4AT9B 3AUOA 2FMQA 4KLEA 8ICNA 9ICKA 4DOBA 1BPYA 4WC0A 3MBYA 1V4AA 4NQFA 3RH4A 1QVXA 4MFAA 4KLIA 5CB1A 2ZH5A 2ISOA 5HRDA 4PGXA 3HWTA 4FH5A 8ICTA 4NLKA 5BOLA 3C5GA 7ICIA 7ICGA 1ZQGA 1ZQBA 4WC5A 3WFPA 5DBBA 5J0UA 3MFNA 4K4GA 1F5AA 4WC7A 4JWMA 4X4OA 4K4HA 2NRKA 4R65A 3MGHA 4FHXA 1KEJA 3H38A 8ICKA 4X4PA 4KLLA 1BPDA 5DDMA 4RPYA 4DO9A 2PFNA 8ICLA 3OV7A 1XSLA 3RJFA 3RJHA 2L6HA 2DRAA 9ICSA 3PNCA 2ZH8A 4E7XA 2ZH4A 4I2BA 4I2EA 1UFBA 4AT8A 1ZQQA 3GM1A 8ICOA 7ICSA 4XRHA 9ICCA 7ICPA 4WC6A 4ATBB 8ICIA 4YN4A 3RQEA 2DR7A 1ZQFA 4I2IA 4WC3A 4RQ1A 4MFFA 1PV3A 3O10A 4YMOA 4YD1A 4PHDA 2M2UA 3U3FA 4S3NA 1ZQSA 1ZQXA 4RPXA 5DECA 1R89A 4FHWA 4M9NA 4P4MA 5DEDA 3RH6A 1WWPA 4RPZA 4RT2A 4LVSA 3HJ1A 3UXOA 2O5AA 3JZ0A 4RQ0A 1KNYA 4RQ3A 3RQFA 1BPZA 4QZCA 1ZQAA 1XSNA 4I2HA 9ICOA 4X4QA 9ICAA 5CP2A 3JPQA 9ICWA 5J2HA 4GXJA 4QZBA 5DB9A 3TULA 5J2GA 4O9MA 1ZQIA 4RQ7A 4F5QA 4X0AA 3V7LA 3TFSA 8ICWA 2DVIA 3TFRA 3AU6A 4ATBA 2ZH2A 4XUSA 4E80A 4X4NA 4RWQA 3UQ0A 4NKUA 4LT6A 5DDYA 5CWRA 3AQNA 8ICAA 5IINA 4QZAA 4RWPA 1JOGA 1MQ3A 1K05A 1ZQEA 4Z6CA 4I2AA 3K75D 4X4UA 4KLQA 4PGYA 3RH5A 5BPCA 2ZH6A 1K04A 4I27A 3WFSC 8ICCA 2VANA 1TV9A 7ICQA 2M2TA 3JPSA 4P4PA 5J2DA 3UPSA 4I2DA 2JX0A 4RQ4A 5HHIA 7ICJA 4R32A 3H3AA 3LK9A 2Q66A 3WFRE 1KTMA 3C8GD 5J2EA 1ZQCA 4F5OA 8ICHA 3H39A 1ZQYA 4QZ9A 2M2VA 2GWSA 4YCXA 1KDHA 4XEFA 3MDCA 5CHGA 3RJGA 4DOAA 1VFGA 2M2WA 4MF2A 4PHEA 4MF8A 2BCVA 9ICMA 7ICUA 3C8GA 5J0XA 4QZGA 5J2CA 5J0PA 1JQRA 5HREA 4UB4A 1ZQMA 8ICEA 4UAWA 2L6GA 3ISDA 3BRJA 5DB8A 1ZJMA 2PFOA 2IHMA 9ICRA 4M0AA 5BOMA 1NO5A 4UD5A 4YMNA 3OVAA 4WC4A 5CJ7A 5IIMA 4X4SA 8ICBA 3HJ4A 8ICXA 5CR0A 1ZQUA 1WOLA 3UQ2A 2ZH1A 1ZQTA 2PFPA 9ICTA 5D46A 8ICMA 4RWOA 1MIWA 1Q78A 1TVAA 2FMSA 4O5EA 3JPRA 5HHHA 8ICPA 1BPXA 4TUQA 3ISCA 1ZQRA 1PX5A 2ID1A 8ICQA 3UXNA 3GM3A 9ICIA 2PBEA 3C2KA 4O5KA 3AQLA 9ICVA 4NLZA 1ZJNA 4KLUA 4UBBA 4AT7A 1ZQJA 3C5FA 4WBYA 3UXPA 2BPCA 3RJIA 3HIYA 3UPQA 1BPBA 9ICXA 4YD2A 3L8JA 1ZQOA 4EP7A 1TFWA 4FHYA 3RQGA 4I29A 3WFQE 1JMSA 4I2JA 1R8CA 4X4VA 3ISBA 1R8BA 4IG8A 4XEKA 1ZQKA 9ICGA 4KLDA 1OW7A 2HSBA 4O5CA 9ICNA 4F5RA 1ZQVA 4QZEA 4IQVA 3B71A 4NXZA 3C18A 1RPLA 3B0YA 1VJ7A 3NYBA 4XQ7A 2BCQA 5CA7A 5F2VO 2DR5A 5HRLA 5J2FA 1R8AA 1OW6A 5EOZA 4RQ6A 4RQ8A 4PPXA 1ZZPA 8ICSA 5HRBA 4R63A 4LZDA 4RT3A 4YMMA 2FMPA 5IILA 3MDAA 3V72A 5J0YA 4NY8A 1ZQZA 3C8GB 3S9OA 4XEVA 4UB3A 5HRIA 4UAYA 4KLSA 3JPTA 3OGUA 1WOTA 4EBKA 4PHAA 4KLGA 3AQMA 3GM2A 4R66A 2BCRA 4TUPA 5HC9A 3JPOA 3OVSA 7ICEA 9ICHA 4M5DA 1O3UA 4Z6DA 3V7JA 2PXIA 4M9HA 5J29A 4I2CA 5DB6A 2BPGA 4I2FA 4K4IA 2ZH7A 2YWAA 8ICUA 4PGQA 7ICKA 3L8IA 4JWNA 4KLMA 4DOCA 4KLHA 9ICEA 4WCWA 4EBJA 4IQTA 1NOMA 4WC2A 3JYYA 3V7KA 9ICLA 4X4TA 4AT7B 1ZQNA 3JPNA 2DR9A 4I28A 7ICTA 1WTYA 4TUSA 4KLOA 3OUYA 7ICMA 9ICPA 4GXKA 2KK1A 4X0BA 4UAZA 1ZQLA 2RFFA 5IIOA 5HRFA 4F5NA 4FHPA 4MFCA 4RQ2A 1OW8A 3GDXA 4FO6A 4FHVA 1OU5A 3RJJA 2ZHAA 4GXIA 5D49A 4PH5A 1HUZA 3H37A 2BCSA 4F5PA 5DBCA 5DBAA 1ZQDA 4Z6EA 5J2KA 1UEUA 3B0XA 2ISPA 7ICFA 8ICVA 4UB5A 1XSPA 3AJMA 1MIVA 3PMNA 4E8FA 5J0OA 2BCUA 1RZTA 2DR8A 4M47A 5HRKA 4QZDA 5DKWA 4KLFA 4M9JA 5DB7A 5TZVA 1JAJA 4RWNA 5F28E 3AQKA 4QZ8A 4KLTA 7ICRA 4NLNA 8ICYA 2PFQA 2ZH9A 4IQUA 5D4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW8 A;  8ICG A;  4AT9 A;  5J0S A;  2DRB A;  4X5V A;  2I9G A;  4IQW A;  7ICN A;  5HR9 A;  4NKT A;  2P66 A;  3LQC B;  4QZI A;  5J0R A;  5J2B A;  1Q79 A;  3RJK A;  4TUR A;  2W9M A;  5IIK A;  9ICB A;  4NM2 A;  5J0T A;  1ZQP A;  1MIY A;  3C66 A;  2L6F A;  1JN3 A;  1TFY A;  5J2A A;  5J2J A;  3C2L A;  4WC1 A;  4P2H A;  2ZHB A;  1YLQ A;  5HRG A;  3C2M A;  1HUO A;  2JPU A;  2O1P A;  5J0W A;  4X4R A;  4QZH A;  1K40 A;  4UB1 A;  3OUY B;  3MGI A;  2BPF A;  8ICR A;  4WBZ A;  3U0C A;  3RJE A;  8ICZ A;  4M9L A;  3OVB A;  3PML A;  2HHP A;  3JPP A;  7ICV A;  4UD4 A;  4M04 A;  5III A;  4XQ8 A;  1ZQH A;  4M2Y A;  1UET A;  7ICO A;  4QZF A;  9ICQ A;  3K7D A;  4FH3 A;  5HRH A;  4KLJ A;  4I2G A;  7ICH A;  1ZQW A;  4PHP A;  4UBC A;  1BPE A;  3WFO A;  8ICF A;  5J2I A;  5J0Q A;  2ZH3 A;  4NM1 A;  4LZG A;  4M9G A;  8ICJ A;  9ICJ A;  2Q00 A;  3AU2 A;  4P4O A;  9ICU A;  2BE3 A;  4R64 A;  4XA5 A;  2LK4 A;  4RQ5 A;  1FA0 A;  5IIJ A;  4UB2 A;  7ICL A;  3L9D A;  1UEV A;  4Z6F A;  3HX0 A;  1MQ2 A;  9ICF A;  4AT8 B;  4AT9 B;  3AUO A;  2FMQ A;  4KLE A;  8ICN A;  9ICK A;  4DOB A;  1BPY A;  4WC0 A;  3MBY A;  1V4A A;  4NQF A;  3RH4 A;  1QVX A;  4MFA A;  4KLI A;  5CB1 A;  2ZH5 A;  2ISO A;  5HRD A;  4PGX A;  3HWT A;  4FH5 A;  8ICT A;  4NLK A;  5BOL A;  3C5G A;  7ICI A;  7ICG A;  1ZQG A;  1ZQB A;  4WC5 A;  3WFP A;  5DBB A;  5J0U A;  3MFN A;  4K4G A;  1F5A A;  4WC7 A;  4JWM A;  4X4O A;  4K4H A;  2NRK A;  4R65 A;  3MGH A;  4FHX A;  1KEJ A;  3H38 A;  8ICK A;  4X4P A;  4KLL A;  1BPD A;  5DDM A;  4RPY A;  4DO9 A;  2PFN A;  8ICL A;  3OV7 A;  1XSL A;  3RJF A;  3RJH A;  2L6H A;  2DRA A;  9ICS A;  3PNC A;  2ZH8 A;  4E7X A;  2ZH4 A;  4I2B A;  4I2E A;  1UFB A;  4AT8 A;  1ZQQ A;  3GM1 A;  8ICO A;  7ICS A;  4XRH A;  9ICC A;  7ICP A;  4WC6 A;  4ATB B;  8ICI A;  4YN4 A;  3RQE A;  2DR7 A;  1ZQF A;  4I2I A;  4WC3 A;  4RQ1 A;  4MFF A;  1PV3 A;  3O10 A;  4YMO A;  4YD1 A;  4PHD A;  2M2U A;  3U3F A;  4S3N A;  1ZQS A;  1ZQX A;  4RPX A;  5DEC A;  1R89 A;  4FHW A;  4M9N A;  4P4M A;  5DED A;  3RH6 A;  1WWP A;  4RPZ A;  4RT2 A;  4LVS A;  3HJ1 A;  3UXO A;  2O5A A;  3JZ0 A;  4RQ0 A;  1KNY A;  4RQ3 A;  3RQF A;  1BPZ A;  4QZC A;  1ZQA A;  1XSN A;  4I2H A;  9ICO A;  4X4Q A;  9ICA A;  5CP2 A;  3JPQ A;  9ICW A;  5J2H A;  4GXJ A;  4QZB A;  5DB9 A;  3TUL A;  5J2G A;  4O9M A;  1ZQI A;  4RQ7 A;  4F5Q A;  4X0A A;  3V7L A;  3TFS A;  8ICW A;  2DVI A;  3TFR A;  3AU6 A;  4ATB A;  2ZH2 A;  4XUS A;  4E80 A;  4X4N A;  4RWQ A;  3UQ0 A;  4NKU A;  4LT6 A;  5DDY A;  5CWR A;  3AQN A;  8ICA A;  5IIN A;  4QZA A;  4RWP A;  1JOG A;  1MQ3 A;  1K05 A;  1ZQE A;  4Z6C A;  4I2A A;  3K75 D;  4X4U A;  4KLQ A;  4PGY A;  3RH5 A;  5BPC A;  2ZH6 A;  1K04 A;  4I27 A;  3WFS C;  8ICC A;  2VAN A;  1TV9 A;  7ICQ A;  2M2T A;  3JPS A;  4P4P A;  5J2D A;  3UPS A;  4I2D A;  2JX0 A;  4RQ4 A;  5HHI A;  7ICJ A;  4R32 A;  3H3A A;  3LK9 A;  2Q66 A;  3WFR E;  1KTM A;  3C8G D;  5J2E A;  1ZQC A;  4F5O A;  8ICH A;  3H39 A;  1ZQY A;  4QZ9 A;  2M2V A;  2GWS A;  4YCX A;  1KDH A;  4XEF A;  3MDC A;  5CHG A;  3RJG A;  4DOA A;  1VFG A;  2M2W A;  4MF2 A;  4PHE A;  4MF8 A;  2BCV A;  9ICM A;  7ICU A;  3C8G A;  5J0X A;  4QZG A;  5J2C A;  5J0P A;  1JQR A;  5HRE A;  4UB4 A;  1ZQM A;  8ICE A;  4UAW A;  2L6G A;  3ISD A;  3BRJ A;  5DB8 A;  1ZJM A;  2PFO A;  2IHM A;  9ICR A;  4M0A A;  5BOM A;  1NO5 A;  4UD5 A;  4YMN A;  3OVA A;  4WC4 A;  5CJ7 A;  5IIM A;  4X4S A;  8ICB A;  3HJ4 A;  8ICX A;  5CR0 A;  1ZQU A;  1WOL A;  3UQ2 A;  2ZH1 A;  1ZQT A;  2PFP A;  9ICT A;  5D46 A;  8ICM A;  4RWO A;  1MIW A;  1Q78 A;  1TVA A;  2FMS A;  4O5E A;  3JPR A;  5HHH A;  8ICP A;  1BPX A;  4TUQ A;  3ISC A;  1ZQR A;  1PX5 A;  2ID1 A;  8ICQ A;  3UXN A;  3GM3 A;  9ICI A;  2PBE A;  3C2K A;  4O5K A;  3AQL A;  9ICV A;  4NLZ A;  1ZJN A;  4KLU A;  4UBB A;  4AT7 A;  1ZQJ A;  3C5F A;  4WBY A;  3UXP A;  2BPC A;  3RJI A;  3HIY A;  3UPQ A;  1BPB A;  9ICX A;  4YD2 A;  3L8J A;  1ZQO A;  4EP7 A;  1TFW A;  4FHY A;  3RQG A;  4I29 A;  3WFQ E;  1JMS A;  4I2J A;  1R8C A;  4X4V A;  3ISB A;  1R8B A;  4IG8 A;  4XEK A;  1ZQK A;  9ICG A;  4KLD A;  1OW7 A;  2HSB A;  4O5C A;  9ICN A;  4F5R A;  1ZQV A;  4QZE A;  4IQV A;  3B71 A;  4NXZ A;  3C18 A;  1RPL A;  3B0Y A;  1VJ7 A;  3NYB A;  4XQ7 A;  2BCQ A;  5CA7 A;  5F2V O;  2DR5 A;  5HRL A;  5J2F A;  1R8A A;  1OW6 A;  5EOZ A;  4RQ6 A;  4RQ8 A;  4PPX A;  1ZZP A;  8ICS A;  5HRB A;  4R63 A;  4LZD A;  4RT3 A;  4YMM A;  2FMP A;  5IIL A;  3MDA A;  3V72 A;  5J0Y A;  4NY8 A;  1ZQZ A;  3C8G B;  3S9O A;  4XEV A;  4UB3 A;  5HRI A;  4UAY A;  4KLS A;  3JPT A;  3OGU A;  1WOT A;  4EBK A;  4PHA A;  4KLG A;  3AQM A;  3GM2 A;  4R66 A;  2BCR A;  4TUP A;  5HC9 A;  3JPO A;  3OVS A;  7ICE A;  9ICH A;  4M5D A;  1O3U A;  4Z6D A;  3V7J A;  2PXI A;  4M9H A;  5J29 A;  4I2C A;  5DB6 A;  2BPG A;  4I2F A;  4K4I A;  2ZH7 A;  2YWA A;  8ICU A;  4PGQ A;  7ICK A;  3L8I A;  4JWN A;  4KLM A;  4DOC A;  4KLH A;  9ICE A;  4WCW A;  4EBJ A;  4IQT A;  1NOM A;  4WC2 A;  3JYY A;  3V7K A;  9ICL A;  4X4T A;  4AT7 B;  1ZQN A;  3JPN A;  2DR9 A;  4I28 A;  7ICT A;  1WTY A;  4TUS A;  4KLO A;  3OUY A;  7ICM A;  9ICP A;  4GXK A;  2KK1 A;  4X0B A;  4UAZ A;  1ZQL A;  2RFF A;  5IIO A;  5HRF A;  4F5N A;  4FHP A;  4MFC A;  4RQ2 A;  1OW8 A;  3GDX A;  4FO6 A;  4FHV A;  1OU5 A;  3RJJ A;  2ZHA A;  4GXI A;  5D49 A;  4PH5 A;  1HUZ A;  3H37 A;  2BCS A;  4F5P A;  5DBC A;  5DBA A;  1ZQD A;  4Z6E A;  5J2K A;  1UEU A;  3B0X A;  2ISP A;  7ICF A;  8ICV A;  4UB5 A;  1XSP A;  3AJM A;  1MIV A;  3PMN A;  4E8F A;  5J0O A;  2BCU A;  1RZT A;  2DR8 A;  4M47 A;  5HRK A;  4QZD A;  5DKW A;  4KLF A;  4M9J A;  5DB7 A;  5TZV A;  1JAJ A;  4RWN A;  5F28 E;  3AQK A;  4QZ8 A;  4KLT A;  7ICR A;  4NLN A;  8ICY A;  2PFQ A;  2ZH9 A;  4IQU A;  5D4B A; 
#chains in the Genus database with same CATH topology
 8ICG A;  3TK0 A;  4U5B E;  5J0S A;  4X5V A;  4IQW A;  2Y3B A;  2F22 A;  4QZI A;  4BJT A;  5A6A A;  5J2B A;  3JT1 A;  3RJK A;  4BJ6 C;  3IQT A;  3UMK A;  4TUR A;  5IIK A;  4NM2 A;  5J0T A;  1Q0F A;  4XPX A;  3V7O A;  3C66 A;  2ZXR A;  1JN3 A;  4EED A;  1PCX A;  2VCC A;  2R7V A;  5DLJ A;  4HEA J;  1BDJ B;  1ZVZ A;  2J45 A;  2JPU A;  2O1P A;  3LNM B;  1M2V B;  1G8X A;  3OUY B;  3MGI A;  4NXU A;  4OAH A;  8ICR A;  3S90 A;  1R5I D;  2HN1 A;  3OVB A;  5IY5 C;  3PML A;  1G4W R;  3ZTZ A;  2M64 A;  4UD4 A;  2M4E A;  4XQ8 A;  3RKO F;  4EBB A;  2YL0 A;  2CW0 F;  5HRH A;  3US6 A;  2Y3H A;  4N6C A;  3I5Q A;  4DXW A;  2ZXO A;  4E7Z A;  4LZG A;  4M9G A;  8ICJ A;  2YKZ A;  3N24 A;  4KM5 A;  1TKN A;  3HLZ A;  5JP7 A;  4DVY P;  2XL6 A;  3KH2 A;  4XA5 A;  4BEM J;  5IIJ A;  7ICL A;  3L9D A;  2NSF A;  1LIH A;  1S7Z A;  1E83 A;  1ZW3 A;  2XL4 A;  3VAY A;  4MVR A;  3AUO A;  2FMQ A;  4RD9 A;  4KLE A;  4JEA A;  1XZQ A;  3ZQY A;  4U9E A;  1QVX A;  4MFA A;  4O67 A;  3GEI A;  1CPR A;  5HRD A;  4PGX A;  4FH5 A;  4NLK A;  3EFO A;  5JT4 A;  4WC5 A;  1FFT C;  4BEJ A;  1EA8 A;  1GGQ A;  1FTS A;  3LEV A;  2PFD A;  5DBB A;  4C3D A;  1YA9 A;  1F5A A;  4WC7 A;  4JWM A;  4X4O A;  3EQL F;  2OEX A;  5CI9 A;  5E3C A;  3Q6M A;  3X2Q C;  1LVK A;  4JTC B;  4X4P A;  2YQY A;  1BPD A;  5DDM A;  2A0B A;  8ICL A;  3HNL A;  3JRT A;  4W8K A;  2Q3T A;  4JTD B;  9ICS A;  4E7X A;  2EIM C;  1T6I A;  4XWJ A;  5BQG A;  4I2E A;  2XLE A;  1UFB A;  4AT8 A;  4ONS A;  4EHP A;  2FAP B;  5F5H A;  3JSE O;  2R9R B;  4WC6 A;  1BR4 A;  3C7J A;  3G50 A;  4JJG A;  2D5R B;  2YLG A;  1VLS A;  4RQ1 A;  4MFF A;  1PV3 A;  3O10 A;  3OEO A;  4YMO A;  4YD1 A;  3A11 A;  4L6R A;  4RPX A;  5CHE A;  4WGZ A;  4KNV A;  3U5S A;  3HTK C;  1MQV A;  4FO1 A;  3RQF A;  1BPZ A;  4PJL A;  4I2H A;  5CP2 A;  4WGY A;  1J8M F;  1CGM E;  2A6H F;  3JPQ A;  2IXO A;  4QZB A;  5DB9 A;  4GEH A;  4YK5 A;  2P61 A;  4RQ7 A;  3V7L A;  4DRI B;  8ICW A;  2DVI A;  3TFR A;  3UR3 C;  2XLH A;  4CS8 A;  4E80 A;  1MNE A;  5GPG B;  1ZHZ A;  4LT6 A;  2R03 A;  4RDA A;  2NUT A;  5A6B D;  3DI5 A;  1OKK A;  3S84 A;  1MQ3 A;  3M1C B;  3SXK A;  1APC A;  2H7O A;  1K04 A;  4I27 A;  2R05 A;  4PR9 A;  1QKR A;  3ABK C;  4P4P A;  5J2D A;  3UPS A;  4AK9 A;  4RQ4 A;  4K97 A;  5HHI A;  2P0N A;  7ICJ A;  3K1I C;  3H3A A;  3LK9 A;  4YJW A;  1NFN A;  2XM0 A;  1Y6D A;  4O69 A;  1YLM A;  1ZQY A;  4YCX A;  2XLO A;  2L81 A;  3MDC A;  5KYW A;  2QY9 A;  1VFG A;  4Q7C A;  4MF2 A;  2BCV A;  3NMI A;  4JZA A;  5J0P A;  2NPU A;  3ER8 C;  4KB6 A;  2L6G A;  3BRJ A;  5DB8 A;  3A9C A;  3TOM A;  5K0I A;  5BOM A;  2JD3 A;  3CEX A;  4YMN A;  3S0X A;  4WC4 A;  5IIM A;  3K66 A;  3FOP A;  2VB6 A;  8ICX A;  1ZQU A;  1WOL A;  3N2Z B;  1JMW A;  4RWO A;  1T01 A;  1Q78 A;  2Q9A A;  2YRF A;  2FMS A;  4O5E A;  1ZW2 A;  5HHH A;  1E85 A;  3TJ5 A;  5CFS A;  1PX5 A;  1LS1 A;  1WAT A;  4O5K A;  3ATP A;  1I5N A;  4K0D A;  2B4V A;  4JCZ A;  4JTA B;  1ZJN A;  1M57 C;  2NUT B;  4LDK A;  3RJI A;  2IOQ A;  2UUI A;  9ICX A;  2X51 A;  2HV7 A;  4YD2 A;  3ITF A;  4NXW A;  1GS9 A;  4WQL A;  4EP7 A;  1TFW A;  4FHY A;  3RQG A;  2LP4 A;  3WFQ E;  3GEH A;  4XQ1 A;  1Q0K A;  1R8C A;  4X4V A;  2MYS A;  5A69 A;  9ICG A;  3AG2 C;  4E17 A;  2HSB A;  3HKK A;  3RYL A;  3GWN A;  2HS5 A;  4QZE A;  3B71 A;  5COF A;  4NXZ A;  3B0Y A;  4JKV A;  3NYB A;  2BCQ A;  4XTK A;  3H65 A;  5HRL A;  5J2F A;  1YA7 O;  1OW6 A;  4PPX A;  1ZZP A;  5HRB A;  4LZD A;  4YMM A;  5KYW B;  2Y69 C;  3MDA A;  5J0Y A;  2HJM A;  2LQG A;  4XLN F;  2G3K A;  2ZD9 A;  4K9A A;  2XLV A;  2L9J A;  4O7G A;  3DD7 A;  4KLG A;  3AQM A;  4R66 A;  1VB5 A;  1G4U S;  2B0H A;  3W4Y A;  4LLE A;  3JPO A;  3EH2 A;  7ICE A;  3MBG A;  1O3U A;  4B6I A;  4I2C A;  4I2F A;  4I3M A;  4YT4 A;  2WL8 A;  1J8Y F;  4PGQ A;  7ICK A;  4KLH A;  3WOD F;  3ZC4 A;  4EWC A;  1HE9 A;  4WC2 A;  4YN0 B;  1GQA A;  1RKC A;  3V7K A;  9ICL A;  1SYQ A;  5B3I A;  3LAY A;  4I28 A;  2RD9 A;  4TUS A;  4ER9 A;  3VYW A;  2HMQ A;  4GXK A;  2QNL A;  2KK1 A;  3ZDL A;  5AC5 A;  2B56 A;  4JJF A;  3FAJ A;  3NYJ A;  4FHP A;  3GDX A;  3F47 A;  5BUO A;  3RJJ A;  4GXI A;  5D49 A;  5DS6 A;  1HUZ A;  3H37 A;  2QUP A;  3O39 A;  3KMI A;  4IAO A;  4Z6E A;  2ISP A;  5L0D A;  3FDQ A;  1XSP A;  3AJM A;  2BC5 A;  4KLQ A;  1CGN A;  4E8F A;  3V5Z A;  2BCU A;  1RZT A;  4M47 A;  4NLN A;  3IPM O;  1B68 A;  5KYU A;  4YT2 A;  2FCL A;  3S27 A;  2XLD A;  2DRB A;  7ICN A;  5HR9 A;  2P66 A;  2NG1 A;  3FMS A;  4OAG A;  3OWG A;  4NXV A;  2W45 A;  1E84 A;  4WH5 A;  5J0R A;  4ZLD A;  3PHZ A;  5T3T A;  3NRH A;  1A41 A;  3DMD A;  1OCO C;  2D4U A;  1RMV A;  5J2J A;  2YEV A;  4P2H A;  1AUE A;  1IW7 F;  1YLQ A;  3DAG A;  1HUO A;  1OXB A;  4NY3 A;  4X4R A;  4DRH B;  3CK6 A;  2EIN C;  3RJE A;  5JLI A;  8ICZ A;  2CYD A;  4M9L A;  2HZ8 A;  2J9B A;  1EQ1 A;  2HHP A;  3JPP A;  1D0Y A;  4HFF B;  4M04 A;  3DZA A;  1L7C A;  2FFH A;  2KC3 A;  4I1O B;  4E7S A;  3JYH A;  4C7O A;  1VK5 A;  4KLJ A;  2AVK A;  3EHN A;  4GYT A;  4I2G A;  1ORJ A;  1DOW A;  4PHP A;  2PP4 A;  2GAQ A;  2HN2 A;  1BPE A;  5EK0 A;  3WFO A;  4IGG A;  2ZH3 A;  4NM1 A;  2Q00 A;  9ICU A;  2LK4 A;  4RQ5 A;  4UB2 A;  3H2U A;  2HFI A;  4JE9 A;  1NLX A;  4YL3 A;  4Q4Z F;  3PMR A;  4KBL A;  9ICK A;  3RH4 A;  5CB1 A;  1JAF A;  3VM6 A;  2LCH A;  5BOL A;  7ICI A;  4QDL A;  2ZXW C;  3WFP A;  2BBJ A;  2X0C A;  4NTB A;  3UMI A;  1T9K A;  2NRK A;  3DE8 A;  5D61 A;  5DQT A;  3QVZ A;  1RJ9 A;  3EG9 A;  8ICK A;  4KLL A;  2HV6 A;  2PFN A;  4K1O A;  1XSL A;  3RJF A;  2PX0 A;  3VRC A;  4M63 A;  3GM1 A;  4XRH A;  3CQZ A;  1Q0G A;  2DR7 A;  1ZQF A;  4C7O B;  4WC3 A;  4MTF A;  4D4X A;  4K96 A;  4Q5S F;  4PHD A;  4WJ0 A;  1JRA A;  1ST6 A;  2R7T A;  1ZQS A;  1ZQX A;  1W2W A;  3KPH A;  4P4M A;  1O87 A;  3RH6 A;  1VTM P;  1RKE A;  3CAX A;  3DJU B;  3LLI A;  1C03 A;  4RQ3 A;  4CSA A;  4OIN F;  2VH3 A;  2G3V A;  9ICA A;  2AU5 A;  2O9X A;  4GXJ A;  1XZP A;  4O9M A;  1ZQI A;  3TFS A;  4Z9I A;  1U89 A;  1GM5 A;  3AU6 A;  4K8V A;  4XUS A;  4I44 A;  1T5O A;  1YDI A;  3UQ0 A;  5T1D B;  4UDV A;  1ZHX A;  3MYI A;  2I15 A;  3MYF A;  3SXY A;  4MVO A;  3DWW A;  2C04 A;  2XLM A;  1RJ9 B;  3EG9 B;  4PGY A;  4HE8 D;  3RVY A;  3NWI A;  1OCC C;  3K1H A;  4JRZ A;  5DQZ A;  3NG1 A;  3ERC C;  1TWH A;  2EWR A;  4N06 A;  2R7S A;  4PJM A;  3ZG1 A;  1KTM A;  5J2E A;  1ZQC A;  2WZL A;  2DB4 A;  1BR1 A;  2GWS A;  3EHM A;  1KDH A;  4XEF A;  1NZE A;  3RJG A;  1NU7 D;  1YZC A;  3PDM P;  3RF3 A;  5KYX A;  1JQR A;  4UB4 A;  8ICE A;  4OD5 A;  3ISD A;  1A7V A;  3SNH A;  5E33 A;  9ICR A;  1RKE B;  2P7V A;  3AG3 C;  3LS1 A;  3MCR A;  4M0A A;  5KYY B;  2CNW D;  1CGO A;  3HJ4 A;  5CR0 A;  5D46 A;  8ICM A;  5B1A C;  2MWQ A;  1TVA A;  4MVM A;  5DS5 A;  5B3S C;  3JPR A;  4Z9H A;  3GWL A;  1BPX A;  4CS8 C;  1H7I A;  1ZQR A;  2ID1 A;  3CSK A;  8ICQ A;  3GM3 A;  2PBE A;  2GA0 A;  4OD4 A;  3ZIB A;  3QZC A;  4KLU A;  2R7Q A;  4UBB A;  1NG1 A;  2LFF A;  1ZQJ A;  4YT5 A;  3DM9 B;  5COM A;  2XSE A;  1O5H A;  4LAC B;  3GOR A;  4JC7 A;  2EIK C;  1HE1 A;  2V26 A;  4W8P A;  1JMS A;  4I2J A;  4IG8 A;  3SEO A;  3RW0 A;  2QTV A;  9ICN A;  1ZQV A;  4IQV A;  3NKE A;  1VJ7 A;  4XQ7 A;  5A6J A;  2GWW A;  1GPJ A;  1TWG A;  4X0R A;  1R8A A;  1WN0 A;  4LEY A;  2YL7 A;  1MMD A;  8ICS A;  4FX5 A;  2XS8 A;  1OQC A;  2WZF A;  3HJC A;  3RFY A;  2FMP A;  4NY8 A;  4ULV A;  4C3B A;  1YYJ A;  4CJO A;  3S9O A;  4XEV A;  5KYX B;  5HRI A;  3HNJ A;  4KLS A;  4YT8 A;  4KI2 A;  1WOT A;  1BBH A;  4U5H A;  2A69 F;  2BCR A;  5CI8 A;  4TUP A;  1VLT A;  4E0I A;  4FAP B;  3NKD A;  2Z15 A;  3EGX A;  3LJB A;  4M9H A;  5J29 A;  3QVY A;  4K4I A;  2YWA A;  3U2L A;  3MX3 A;  3L8I A;  1DOV A;  4DOC A;  9ICE A;  3TD7 A;  3EPV A;  3EZH A;  4EBJ A;  3JYY A;  4EIY A;  4X4T A;  3K33 A;  1RCP A;  1WTY A;  9ICP A;  4X0B A;  4LDQ A;  3NDB B;  1ZQL A;  3OWT A;  3DAF A;  4U5C E;  3QMK A;  1VYI A;  1I4Y A;  4MFC A;  2IHO A;  3JSZ A;  3GEE A;  4FO6 A;  3RVZ A;  5D63 A;  1OU5 A;  4RBN A;  2ZHA A;  4O68 A;  1Z23 A;  5DBC A;  1ZQD A;  5J2K A;  1UEU A;  1V55 C;  7ICF A;  2Q7R A;  2GDC A;  3PMN A;  5J0O A;  2WVO A;  5HRK A;  4M9J A;  5DB7 A;  2ETS A;  5TZV A;  5F28 E;  4YL0 A;  1ZU5 A;  3O6X A;  1M2O A;  3HW8 A;  2Q9B A;  3U3B A;  4AT9 A;  1QZX A;  4LER A;  1FAP B;  1HY5 A;  2OCC C;  3EGX B;  3W2V A;  2R7W A;  1HMD A;  3T4R A;  2G62 A;  5EGY A;  1Q79 A;  1R4T A;  1JR8 A;  1SMY F;  1VMA A;  3B29 A;  4MND A;  3ABL C;  4OIR F;  4Z9J A;  4CDV A;  1OCZ C;  4LEV A;  5CFT A;  1ZQP A;  1MIY A;  4CS9 A;  5L0J A;  1A7D A;  3EF2 A;  2A1D D;  3C2L A;  2DI3 A;  2EPM X;  1LKX A;  3C2M A;  4P9T A;  2KGO A;  1WGW A;  3RIP A;  4QZH A;  1YJG A;  4KNW A;  4XJE A;  3M4B A;  2NUP A;  2ASR A;  2LSE A;  4NCQ A;  3M79 A;  7ICV A;  3U9M A;  1Q0M A;  3MLG A;  1ZQH A;  4BG0 A;  1UET A;  1TWC A;  7ICO A;  2R7X A;  2IYL D;  2OU6 A;  4JW1 A;  4UBC A;  3T6J A;  5DVW A;  4WQK A;  1LI5 A;  3SYN A;  5L3Q A;  4BPM A;  2FGY A;  2B0J A;  2QE9 A;  9ICJ A;  2A0U A;  2BE3 A;  3AGT A;  2IXM A;  2XXA A;  1PD0 A;  1FA0 A;  1ZHT A;  2AWY A;  4PK4 A;  4JEB A;  1UEV A;  4Z6F A;  3HX0 A;  1MQ2 A;  9ICF A;  4AT9 B;  1Z63 A;  256B A;  2IBF A;  8ICN A;  4U5F E;  4DOB A;  4WC0 A;  3JRM O;  4CX9 A;  1V4A A;  4KLI A;  2ISO A;  2PNO A;  1H9G A;  3UNG C;  8ICT A;  3L0I A;  1ZQB A;  3ABM C;  4J7Y A;  2AWC A;  2LIG A;  4IAR A;  3ZVR A;  3B0U X;  1Z7Q c;  3VF0 A;  5JVE A;  1Z5Z A;  4K4H A;  3C63 A;  4R65 A;  3MGH A;  4FHX A;  1LE4 A;  2YL1 A;  3JCF A;  4PJN A;  3J06 A;  2L6H A;  3B9Q A;  1LE2 A;  2DRA A;  3PNC A;  2ZH8 A;  2NUP B;  1EI7 A;  2ZH4 A;  3AQC A;  4CIH A;  2IXN A;  4OIP F;  4EKW A;  2J9U A;  8ICO A;  3I4U A;  9ICC A;  4ATB B;  8ICI A;  4YN4 A;  4K99 A;  3RQE A;  2P6V A;  3U2M A;  2J0X A;  3KYI A;  2W9Y A;  1OR3 A;  3WG7 C;  4N7R A;  4K9B A;  2M2U A;  1CPQ A;  4G7O F;  2XXA B;  2AP3 A;  4FHW A;  4N4W A;  5BQH A;  4U5G A;  4RT2 A;  4LVS A;  2O5A A;  3V5X A;  4RQ0 A;  3AGU A;  1HW1 A;  2B51 A;  2XLW A;  1KNY A;  5KYN A;  1ZQA A;  9ICO A;  4X4Q A;  4JUR I;  5HSW A;  4NTF A;  9ICW A;  3B0P A;  2WZG A;  3AOU A;  2HSQ A;  4YWQ A;  5J2G A;  4X0A A;  3M4C A;  5COG A;  2XL8 A;  3JCU Q;  4X4N A;  4RWQ A;  4NKU A;  5DDY A;  5CWR A;  3AQN A;  1NBB A;  3SP1 A;  2OG2 A;  5IIN A;  3LEO A;  1MND A;  4ULW A;  4RWP A;  3JTL O;  2PF4 E;  4Z6C A;  4I2A A;  2Y39 A;  4X4U A;  4A2N B;  1OR2 A;  3RH5 A;  4MW8 A;  4JLX A;  2VAN A;  4MVS A;  2M2T A;  3EJN A;  3JPS A;  3ZWI A;  4BJ5 A;  4I2D A;  2JX0 A;  2HMZ A;  1OXK A;  4R32 A;  2Q66 A;  1M56 C;  3WFR E;  3C8G D;  3B0V C;  4LDR A;  4EUK B;  2M2V A;  4QZ9 A;  2OQM A;  4AE4 A;  1A0B A;  5AGF A;  3V5Y A;  2IUB A;  2TMV P;  4QZG A;  1WAS A;  5J2C A;  1TWA A;  3SZR A;  2J7P D;  4WOY A;  2YVK A;  4CIP A;  3EGD A;  2R7U A;  4CSA C;  1IZM A;  3K6B A;  2GFH A;  1ZHY A;  3UGO A;  4UD5 A;  1VYK A;  3OVA A;  5CJ7 A;  1LM3 B;  3UQ2 A;  4IRU A;  2VC9 A;  3LLK A;  1ZQT A;  2PFP A;  1D1C A;  1MIW A;  2H8A A;  2KQ9 A;  4E0H A;  1U0B B;  8ICP A;  4NXT A;  4OAI Z;  2CNW A;  4O6M A;  2WVQ A;  3UXN A;  3C2K A;  5BQI A;  3CZ6 A;  9ICV A;  1FFH A;  4NLZ A;  1SZI A;  3IEE A;  1HW2 A;  4AT7 A;  1F1M A;  4WBY A;  3UXP A;  3O55 A;  1Z3I X;  3HIY A;  4HX0 A;  3L8J A;  1LS4 A;  4I29 A;  3POV A;  3SXM A;  4YL1 A;  1R8B A;  4XEK A;  4MTG A;  5KYY A;  5FCL A;  3M15 A;  4F5R A;  2OJQ A;  3PCV A;  3C18 A;  1RPL A;  2Y3D A;  5CA7 A;  4BJ1 A;  1LPE A;  2DYR C;  3C62 A;  5D62 A;  5EOZ A;  4RQ6 A;  5B1B C;  4AE4 B;  3L34 A;  4DOZ A;  4RT3 A;  1FMV A;  3H2V A;  2YHS A;  1A7E A;  1FR0 A;  5L0I A;  1M6T A;  5IIL A;  5JTG A;  3V72 A;  4PFO A;  5E2Q A;  1TFO B;  2ZXP A;  4JLZ A;  4UAY A;  3T6G B;  3JPT A;  5JUA A;  3OGU A;  4XPW A;  3EGD B;  4PHA A;  1ORS C;  2CDQ A;  2MHR A;  3GM2 A;  4C3E A;  3WHN A;  3KKB A;  4U5D E;  9ICH A;  3X1O A;  1I4Z A;  2Y3G A;  3U8V A;  3V7J A;  1QQ3 A;  2PXI A;  5DB6 A;  2BPG A;  2W4B A;  5A6B A;  4DJ9 A;  3DE9 A;  8ICU A;  4BJ6 A;  2E87 A;  4KLM A;  1KU2 A;  4WCW A;  1NOM A;  3BEH A;  4P6I C;  3U8P A;  4AT7 B;  2R7R A;  3JPN A;  2DR9 A;  5L3V A;  7ICT A;  4KLO A;  3U9J A;  3EZI A;  3PHF 2;  4MW3 A;  1VOM A;  2RFF A;  2L7A A;  3DKA A;  3S28 A;  1JPJ A;  2H7B A;  4RQ2 A;  4QI2 A;  4I0U A;  2BL2 A;  1D0Z A;  3LES A;  2A68 F;  4PH5 A;  1H6G A;  2BCS A;  3DJN B;  4F5P A;  3NYM A;  5A6K A;  1NU9 C;  2HKV A;  3B0X A;  2KW3 C;  3G4Z A;  1TQG A;  3LUT B;  4G78 A;  5D92 A;  2OOC A;  1JAJ A;  4KLF A;  4E18 A;  4O6A A;  4DRJ B;  4QZ8 A;  2YLI A;  8ICY A;  3S29 A;  1YAU O;  2PFQ A;  4WAB A;  5D4B A;  4N6H A;  2W4M A;  3ZQV A;  2I9G A;  3QW0 A;  4NKT A;  4AL1 A;  4MVU A;  3LQC B;  1C02 A;  1ZHW A;  2H7V C;  5T3W A;  2GA9 D;  3G4X A;  3Q7G A;  2W9M A;  3NMK A;  1ORY A;  9ICB A;  5AC4 A;  3UMH A;  1HMO A;  3DXJ F;  1G5Z A;  2L6F A;  1TFY A;  5E3A A;  5J2A A;  4WC1 A;  4J32 B;  1L3P A;  4LLC A;  2EPL X;  5DS4 A;  1QPU A;  2ZHB A;  5HRG A;  4DBQ A;  5JS5 A;  2KYH A;  5J0W A;  1K40 A;  4UB1 A;  2BPF A;  4WBZ A;  3U0C A;  1SF8 A;  3OA1 A;  3FVY A;  3EFO B;  2ICW G;  5III A;  3W8H A;  4O6Y A;  5L0F A;  4M2Y A;  3FAP B;  9ICQ A;  4QZF A;  1U6H A;  3K7D A;  4FH3 A;  4JIO A;  1S05 A;  7ICH A;  4QI0 A;  4DBR A;  1ZQW A;  3GAN A;  4CDY A;  5J0Q A;  5J2I A;  8ICF A;  3TJ6 A;  1T6U A;  4K98 A;  1LI7 A;  3AG4 C;  2IM8 A;  3AU2 A;  4P4O A;  5B3Q A;  4R64 A;  1MMG A;  4OIQ F;  4AT8 B;  3DM5 A;  3NKU A;  3EH1 A;  2VCA A;  1BPY A;  1ZU4 A;  4F4B A;  3MBY A;  3QW1 A;  4NQF A;  5HV9 A;  2ZH5 A;  3HWT A;  2EPO A;  2J46 A;  4U5E E;  3C5G A;  7ICG A;  1ZQG A;  1C17 M;  2XRH A;  5D91 A;  4G7Z F;  1YVI A;  2XM4 A;  5J0U A;  4CS9 C;  3LS0 A;  1PD1 A;  3KYJ A;  4O79 A;  3HNK A;  3I5P A;  3MFN A;  4K4G A;  1RXQ A;  4NC3 A;  3UGP A;  5L0G A;  2P1A A;  1YAR O;  1NSG B;  1KEJ A;  3T9O A;  4ANJ A;  3NMJ A;  3H38 A;  4JCH A;  2DYS C;  2RSE B;  4RPY A;  4DO9 A;  3OV7 A;  3RJH A;  2J9V A;  1Z6A A;  4I2B A;  4GQH A;  1JPN A;  1ZQQ A;  4A4A A;  1OCR C;  1T6Q A;  5JSL A;  3NVO A;  7ICS A;  7ICP A;  3K1I A;  2VAS A;  3FOO A;  3QTH A;  4PJJ A;  1YZA A;  4H4K C;  3C8Z A;  4I2I A;  1QSP A;  2Q4F A;  4LEW A;  2I8B A;  3U3F A;  4S3N A;  2IXP A;  2YL3 A;  1XWJ A;  1Q0D A;  5DEC A;  1R89 A;  1ZYR F;  4M9N A;  5DED A;  1WWP A;  3L1M A;  4RPZ A;  3KL4 A;  2DGJ A;  3HJ1 A;  3UXO A;  3JZ0 A;  2OEV A;  2HUJ A;  4J7T A;  3Q6N A;  2CCY A;  4QZC A;  2LFD A;  1MMA A;  4CJG A;  1XSN A;  4MKP A;  5J2H A;  2R25 A;  4OIO F;  5FZT A;  2R02 A;  1QLE C;  4DVZ A;  3TUL A;  4OAF A;  1OKK D;  4F5Q A;  1Y4C A;  4ATB A;  2ZH2 A;  4PAC A;  3IQ6 A;  4KC9 A;  8ICA A;  4QZA A;  5B3P A;  1D1B A;  2A6E F;  1JOG A;  5F5F A;  2NSG A;  1K05 A;  1ZQE A;  3K75 D;  4AX2 A;  3FXH A;  2YZS A;  5BPC A;  2ZH6 A;  8ICC A;  3WFS C;  1TFK B;  1H9T A;  3AQB A;  1TV9 A;  7ICQ A;  3HNI A;  3IQC A;  4MVZ A;  3ZTM A;  4JVS A;  5TJ5 E;  2WVN A;  4CDA A;  3FHD A;  3GOD A;  4NXX A;  2VCB A;  4F5O A;  8ICH A;  3E70 C;  3H39 A;  5L0C A;  5L0H A;  2KJG A;  4CBE A;  5CHG A;  5CFU A;  4DOA A;  2M2W A;  4PHE A;  4MF8 A;  9ICM A;  4MTO A;  7ICU A;  3C8G A;  5J0X A;  4D4N A;  5HRE A;  3IHU A;  3N0T A;  4UAW A;  1ZQM A;  4P9F A;  1D0X A;  3IQ5 A;  1ZJM A;  4MVQ A;  2PFO A;  2IHM A;  1V74 B;  1UG7 A;  2BBH A;  1NO5 A;  5CIV A;  2C03 A;  4EEB A;  4X4S A;  8ICB A;  4MS2 A;  4ZLC A;  2UUH A;  2ZH1 A;  2J7P A;  4G7H F;  9ICT A;  1E86 A;  3LNR A;  4U9D A;  1BZ4 A;  3SXZ A;  4TUQ A;  3ISC A;  9ICI A;  4EGW A;  3AQL A;  3E9V A;  4FES A;  4IB4 A;  3C5F A;  2BPC A;  2EPK X;  3UPQ A;  1BPB A;  1SR2 A;  2PX3 A;  1ZQO A;  4BJ5 C;  4CS7 A;  3T6B A;  3ISB A;  3ECS A;  1ZQK A;  4KLD A;  1OW7 A;  4IJJ A;  4O5C A;  3W2W A;  5F2V O;  2J9W A;  4EV6 A;  2DR5 A;  2WB7 A;  4XPY A;  3R7C A;  4MQ9 F;  4RQ8 A;  1AVO B;  1E2X A;  4R63 A;  3W8I A;  3WAQ A;  4PFP A;  2J0W A;  1ZQZ A;  3F46 A;  3C8G B;  4UB3 A;  4LEZ A;  2KNH A;  2KSF A;  2Q9C A;  1AEP A;  3NYL A;  2ZPA A;  4EBK A;  4J30 B;  4G0H A;  3ZSU A;  5HC9 A;  3OVS A;  4M5D A;  4O6N A;  4Z6D A;  1TR2 A;  2EIJ C;  2ZH7 A;  1BR2 A;  1V54 C;  2J8W A;  2OKU A;  3TQO A;  1YYX A;  4JWN A;  2YLD A;  1FNT c;  4IQT A;  5JRA A;  3ASN C;  1ZQN A;  1D1A A;  5KYU B;  1M2V A;  4XLP F;  3OUY A;  7ICM A;  2OJE D;  4HFK B;  2EIL C;  4UAZ A;  4NTA A;  5IIO A;  5HRF A;  4AL0 A;  3AG1 C;  2V3C C;  4FWV A;  4F5N A;  2QLA A;  1EKY A;  1OW8 A;  2EPN A;  2HJ3 A;  4FHV A;  2LD6 A;  4K7B A;  2R7O A;  1MMN A;  5DBA A;  2XS1 A;  4H54 A;  3Q7L A;  1NFO A;  2CGE A;  3ASO C;  2BE5 F;  4IWB A;  1FMW A;  5EHH A;  8ICV A;  3RH3 A;  4UB5 A;  1MIV A;  4IAQ A;  2DR8 A;  4QZD A;  5DKW A;  3R2P A;  4RWN A;  4I1M A;  3AQK A;  4KLT A;  7ICR A;  2GAF D;  3ER9 B;  2ZH9 A;  4IQU A;  1N1C A;  3TOL A; 
#chains in the Genus database with same CATH homology
 3HW8 A;  8ICG A;  4AT9 A;  5J0S A;  2DRB A;  4X5V A;  2I9G A;  4IQW A;  7ICN A;  5HR9 A;  4NKT A;  2P66 A;  3LQC B;  4QZI A;  5J0R A;  5J2B A;  1Q79 A;  3RJK A;  4TUR A;  2W9M A;  5IIK A;  9ICB A;  4NM2 A;  5J0T A;  1ZQP A;  1MIY A;  3C66 A;  2L6F A;  1JN3 A;  1TFY A;  5J2A A;  5J2J A;  3C2L A;  4WC1 A;  4P2H A;  2ZHB A;  1YLQ A;  5HRG A;  3C2M A;  1HUO A;  2JPU A;  2O1P A;  5J0W A;  4X4R A;  4QZH A;  1K40 A;  4UB1 A;  3OUY B;  3MGI A;  2BPF A;  8ICR A;  4WBZ A;  3U0C A;  3RJE A;  8ICZ A;  4M9L A;  3OVB A;  3PML A;  2HHP A;  3JPP A;  7ICV A;  4UD4 A;  4M04 A;  5III A;  4XQ8 A;  1ZQH A;  4M2Y A;  1UET A;  7ICO A;  4QZF A;  9ICQ A;  3K7D A;  4FH3 A;  5HRH A;  4KLJ A;  4I2G A;  7ICH A;  1ZQW A;  4PHP A;  4UBC A;  1BPE A;  3WFO A;  8ICF A;  5J2I A;  5J0Q A;  2ZH3 A;  4NM1 A;  4LZG A;  4M9G A;  8ICJ A;  9ICJ A;  2Q00 A;  3AU2 A;  4P4O A;  9ICU A;  2BE3 A;  4R64 A;  4XA5 A;  2LK4 A;  4RQ5 A;  1FA0 A;  5IIJ A;  4UB2 A;  7ICL A;  3L9D A;  1UEV A;  4Z6F A;  3HX0 A;  1MQ2 A;  9ICF A;  4AT8 B;  4AT9 B;  3AUO A;  2FMQ A;  4KLE A;  8ICN A;  9ICK A;  4DOB A;  1BPY A;  4WC0 A;  3MBY A;  1V4A A;  4NQF A;  3RH4 A;  1QVX A;  4MFA A;  4KLI A;  5CB1 A;  2ZH5 A;  2ISO A;  5HRD A;  4PGX A;  3HWT A;  4FH5 A;  8ICT A;  4NLK A;  5BOL A;  3C5G A;  7ICI A;  7ICG A;  1ZQG A;  1ZQB A;  4WC5 A;  3WFP A;  5DBB A;  5J0U A;  3MFN A;  4K4G A;  1F5A A;  4WC7 A;  4JWM A;  4X4O A;  4K4H A;  2NRK A;  4R65 A;  3MGH A;  4FHX A;  1KEJ A;  3H38 A;  8ICK A;  4X4P A;  4KLL A;  1BPD A;  5DDM A;  4RPY A;  4DO9 A;  2PFN A;  8ICL A;  3OV7 A;  1XSL A;  3RJF A;  3RJH A;  2L6H A;  2DRA A;  9ICS A;  3PNC A;  2ZH8 A;  4E7X A;  2ZH4 A;  4I2B A;  4I2E A;  1UFB A;  4AT8 A;  1ZQQ A;  3GM1 A;  8ICO A;  7ICS A;  4XRH A;  9ICC A;  7ICP A;  4WC6 A;  4ATB B;  8ICI A;  4YN4 A;  3RQE A;  2DR7 A;  1ZQF A;  4I2I A;  4WC3 A;  4RQ1 A;  4MFF A;  1PV3 A;  3O10 A;  4YMO A;  4YD1 A;  4PHD A;  2M2U A;  3U3F A;  4S3N A;  1ZQS A;  1ZQX A;  4RPX A;  5DEC A;  1R89 A;  4FHW A;  4M9N A;  4P4M A;  5DED A;  3RH6 A;  1WWP A;  4RPZ A;  4RT2 A;  4LVS A;  3HJ1 A;  3UXO A;  2O5A A;  3JZ0 A;  4RQ0 A;  1KNY A;  4RQ3 A;  3RQF A;  1BPZ A;  4QZC A;  1ZQA A;  1XSN A;  4I2H A;  9ICO A;  4X4Q A;  9ICA A;  5CP2 A;  3JPQ A;  9ICW A;  5J2H A;  4GXJ A;  4QZB A;  5DB9 A;  3TUL A;  5J2G A;  4O9M A;  1ZQI A;  4RQ7 A;  4F5Q A;  4X0A A;  3V7L A;  3TFS A;  8ICW A;  2DVI A;  3TFR A;  3AU6 A;  4ATB A;  2ZH2 A;  4XUS A;  4E80 A;  4X4N A;  4RWQ A;  3UQ0 A;  4NKU A;  4LT6 A;  5DDY A;  5CWR A;  3AQN A;  8ICA A;  5IIN A;  4QZA A;  4RWP A;  1JOG A;  1MQ3 A;  1K05 A;  1ZQE A;  4Z6C A;  4I2A A;  3K75 D;  4X4U A;  4KLQ A;  4PGY A;  3RH5 A;  5BPC A;  2ZH6 A;  1K04 A;  4I27 A;  3WFS C;  8ICC A;  2VAN A;  1TV9 A;  7ICQ A;  2M2T A;  3JPS A;  4P4P A;  5J2D A;  3UPS A;  4I2D A;  2JX0 A;  4RQ4 A;  5HHI A;  7ICJ A;  4R32 A;  3H3A A;  3LK9 A;  2Q66 A;  3WFR E;  1KTM A;  3C8G D;  5J2E A;  1ZQC A;  4F5O A;  8ICH A;  3H39 A;  1ZQY A;  4QZ9 A;  2M2V A;  2GWS A;  4YCX A;  1KDH A;  4XEF A;  3MDC A;  5CHG A;  3RJG A;  4DOA A;  1VFG A;  2M2W A;  4MF2 A;  4PHE A;  4MF8 A;  2BCV A;  9ICM A;  7ICU A;  3C8G A;  5J0X A;  4QZG A;  5J2C A;  5J0P A;  1JQR A;  5HRE A;  4UB4 A;  1ZQM A;  8ICE A;  4UAW A;  2L6G A;  3ISD A;  3BRJ A;  5DB8 A;  1ZJM A;  2PFO A;  2IHM A;  9ICR A;  4M0A A;  5BOM A;  1NO5 A;  4UD5 A;  4YMN A;  3OVA A;  4WC4 A;  5CJ7 A;  5IIM A;  4X4S A;  8ICB A;  3HJ4 A;  8ICX A;  5CR0 A;  1ZQU A;  1WOL A;  3UQ2 A;  2ZH1 A;  1ZQT A;  2PFP A;  9ICT A;  5D46 A;  8ICM A;  4RWO A;  1MIW A;  1Q78 A;  1TVA A;  2FMS A;  4O5E A;  3JPR A;  5HHH A;  8ICP A;  1BPX A;  4TUQ A;  3ISC A;  1ZQR A;  1PX5 A;  2ID1 A;  8ICQ A;  3UXN A;  3GM3 A;  9ICI A;  2PBE A;  3C2K A;  4O5K A;  3AQL A;  9ICV A;  4NLZ A;  1ZJN A;  4KLU A;  4UBB A;  4AT7 A;  1ZQJ A;  3C5F A;  4WBY A;  3UXP A;  2BPC A;  3RJI A;  3HIY A;  3UPQ A;  1BPB A;  9ICX A;  4YD2 A;  3L8J A;  1ZQO A;  4EP7 A;  1TFW A;  4FHY A;  3RQG A;  4I29 A;  3WFQ E;  1JMS A;  4I2J A;  1R8C A;  4X4V A;  3ISB A;  1R8B A;  4IG8 A;  4XEK A;  1ZQK A;  9ICG A;  4KLD A;  1OW7 A;  2HSB A;  4O5C A;  9ICN A;  4F5R A;  1ZQV A;  4QZE A;  4IQV A;  3B71 A;  4NXZ A;  3C18 A;  1RPL A;  3B0Y A;  1VJ7 A;  3NYB A;  4XQ7 A;  2BCQ A;  5CA7 A;  5F2V O;  2DR5 A;  5HRL A;  5J2F A;  1R8A A;  1OW6 A;  5EOZ A;  4RQ6 A;  4RQ8 A;  4PPX A;  1ZZP A;  8ICS A;  5HRB A;  4R63 A;  4LZD A;  4RT3 A;  4YMM A;  2FMP A;  5IIL A;  3MDA A;  3V72 A;  5J0Y A;  4NY8 A;  1ZQZ A;  3C8G B;  3S9O A;  4XEV A;  4UB3 A;  5HRI A;  4UAY A;  4KLS A;  3JPT A;  3OGU A;  1WOT A;  4EBK A;  4PHA A;  4KLG A;  3AQM A;  3GM2 A;  4R66 A;  2BCR A;  4TUP A;  5HC9 A;  3JPO A;  3OVS A;  7ICE A;  9ICH A;  4M5D A;  1O3U A;  4Z6D A;  3V7J A;  2PXI A;  4M9H A;  5J29 A;  4I2C A;  5DB6 A;  2BPG A;  4I2F A;  4K4I A;  2ZH7 A;  2YWA A;  8ICU A;  4PGQ A;  7ICK A;  3L8I A;  4JWN A;  4KLM A;  4DOC A;  4KLH A;  9ICE A;  4WCW A;  4EBJ A;  4IQT A;  1NOM A;  4WC2 A;  3JYY A;  3V7K A;  9ICL A;  4X4T A;  4AT7 B;  1ZQN A;  3JPN A;  2DR9 A;  4I28 A;  7ICT A;  1WTY A;  4TUS A;  4KLO A;  3OUY A;  7ICM A;  9ICP A;  4GXK A;  2KK1 A;  4X0B A;  4UAZ A;  1ZQL A;  2RFF A;  5IIO A;  5HRF A;  4F5N A;  4FHP A;  4MFC A;  4RQ2 A;  1OW8 A;  3GDX A;  4FO6 A;  4FHV A;  1OU5 A;  3RJJ A;  2ZHA A;  4GXI A;  5D49 A;  4PH5 A;  1HUZ A;  3H37 A;  2BCS A;  4F5P A;  5DBC A;  5DBA A;  1ZQD A;  4Z6E A;  5J2K A;  1UEU A;  3B0X A;  2ISP A;  7ICF A;  8ICV A;  4UB5 A;  1XSP A;  3AJM A;  1MIV A;  3PMN A;  4E8F A;  5J0O A;  2BCU A;  1RZT A;  2DR8 A;  4M47 A;  5HRK A;  4QZD A;  5DKW A;  4KLF A;  4M9J A;  5DB7 A;  5TZV A;  1JAJ A;  4RWN A;  5F28 E;  3AQK A;  4QZ8 A;  4KLT A;  7ICR A;  4NLN A;  8ICY A;  2PFQ A;  2ZH9 A;  4IQU A;  5D4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...