2PBEA

Crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
263
Chain Sequence
LRSEQEMMDIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Aminoglycoside 6-adenylyltransferase
total genus 82
structure length 263
sequence length 282
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2pbeA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2pbeA01
4QZAA 2ZH3A 1WOTA 2ZH5A 1ZJNA 2BCRA 4YMNA 2FMPA 1R8BA 1UETA 5J29A 4RQ4A 9ICNA 5J0UA 4YMOA 2JPUA 4WC6A 4M9HA 8ICNA 4FH5A 3HWTA 1TVAA 2PXIA 7ICGA 4RWQA 4M0AA 3B0XA 5DBCA 1ZQIA 2BCUA 5DB7A 5J2GA 4YMMA 9ICWA 3HX0A 4X4NA 1WTYA 4PH5A 1TFWA 4O5EA 5DB9A 5J0QA 4O5KA 4KLFA 1UFBA 1BPYA 3HJ4A 2DRAA 3JZ0A 8ICVA 4LZDA 1ZQJA 2BE3A 4AT7B 4TUQA 2DRBA 7ICHA 8ICAA 4EBKA 5IIJA 3HIYA 4X0BA 1O3UA 4GXJA 4KLUA 2BPFA 4PPXA 2HSBA 3C66A 1ZQMA 3GM2A 4RPZA 4NLKA 3PMLA 3RH6A 1BPEA 3ISBA 9ICLA 3MFNA 5J0SA 4LT6A 2PFPA 5HRDA 5J2CA 4R64A 1FA0A 5DBAA 1PX5A 1ZQBA 4KLTA 3JYYA 8ICPA 1QVXA 4NM2A 4WC1A 2DR9A 1XSPA 4XEKA 5DBBA 4K4HA 4UBBA 4E80A 3U3FA 3BRJA 5J2HA 4K4IA 4PGYA 8ICUA 4Z6DA 9ICSA 7ICQA 4X4PA 3L9DA 4UAWA 1ZQOA 2FMQA 2ZH2A 4NM1A 4F5QA 2DVIA 4IQWA 9ICCA 4QZGA 1NO5A 2L6GA 1ZQLA 5J0OA 8ICGA 4Z6EA 4RQ6A 3WFOA 3H38A 1ZQQA 4X4TA 4WBZA 1ZQSA 3C8GA 4UAYA 4I2HA 4X4VA 5HRFA 4EP7A 4E8FA 4KLMA 3AQMA 9ICVA 5J0XA 4NXZA 4UBCA 4P4MA 1OW8A 5J2EA 7ICVA 1ZQGA 2ISPA 3V7JA 3K7DA 4AT8B 3C2LA 3UXOA 3RQFA 8ICXA 1ZQZA 4P4OA 5CR0A 3V7KA 3C8GD 9ICIA 7ICFA 3UPQA 5DDYA 3AU6A 4QZIA 4I2JA 1MIYA 5DB6A 1ZQRA 4NKTA 7ICOA 8ICEA 2ZH8A 1ZQPA 2Q66A 9ICQA 2YWAA 4R66A 1RPLA 5BOMA 4MF2A 4IQUA 4XEFA 3GM3A 3TULA 2BPCA 2BCQA 4XUSA 5CP2A 5J2IA 3AU2A 5J0YA 3MGIA 3UQ0A 4PHAA 4F5PA 1R89A 3H39A 4MFAA 3RJGA 7ICTA 2M2UA 7ICSA 3AQKA 4WC3A 1R8AA 5HRKA 1WWPA 4FO6A 3GM1A 3RJHA 1ZQVA 4AT8A 8ICMA 8ICOA 1ZQTA 4XA5A 1RZTA 3C18A 3JPNA 2DR5A 4QZ9A 3UQ2A 8ICSA 4UAZA 8ICIA 4I2FA 4XQ7A 4RPXA 5CHGA 4PHPA 4JWMA 4P2HA 3C8GB 1KEJA 4IQVA 3C2KA 4M9LA 1TFYA 8ICTA 5J0WA 7ICPA 4UB4A 3JPTA 4RWNA 5CB1A 5J2AA 3JPPA 4YD2A 2M2TA 1ZQEA 9ICBA 4TURA 2ZHAA 4P4PA 2ZH1A 2JX0A 2ZH9A 3RJFA 2ID1A 1R8CA 4KLSA 1ZQKA 4PGQA 4NLNA 1Q78A 5IIMA 4QZBA 4I28A 5HC9A 4JWNA 3RJJA 2PFOA 1F5AA 3OVBA 4R65A 5IIKA 5CWRA 3JPRA 4RT3A 4WC2A 4AT7A 2P66A 1OW6A 3L8IA 2ZH7A 4X4UA 4Z6CA 4I2EA 4M2YA 1TV9A 2DR7A 1UEVA 9ICOA 9ICUA 4WBYA 1HUOA 4QZDA 4F5OA 3OGUA 4NY8A 4R63A 9ICFA 2ISOA 3TFRA 2Q00A 3UPSA 4GXIA 1XSLA 4PHEA 3JPOA 2BCVA 4RQ0A 1ZQYA 4E7XA 1JN3A 4X4RA 1BPZA 9ICRA 3JPSA 3OVAA 3H37A 4DOAA 3B71A 3RJIA 4I2GA 4Z6FA 3O10A 1KNYA 4EBJA 4NKUA 3RQGA 5TZVA 8ICBA 4RPYA 1KDHA 4QZ8A 3TFSA 8ICQA 4I2IA 3RH5A 3GDXA 5J2KA 3K75D 4KLIA 1ZJMA 8ICLA 1MQ2A 4YD1A 1ZQDA 4F5NA 3AQLA 4YN4A 2VANA 4UB3A 5HRGA 4DOBA 4IG8A 3AJMA 4AT9A 2M2VA 4F5RA 3OUYA 3C5GA 4RWOA 3L8JA 3U0CA 1KTMA 9ICEA 5J2BA 7ICKA 1UEUA 4RQ8A 4KLGA 5HHHA 8ICCA 2L6FA 5DEDA 1ZQCA 2GWSA 5HRHA 4WC5A 1VJ7A 4X4SA 1BPBA 4UD4A 5F28E 5D49A 5HR9A 3MGHA 5DB8A 5J2JA 3V7LA 4FHXA 5IIIA 1OW7A 1MIWA 4WCWA 1BPDA 1ZQUA 2HHPA 5HRBA 4DO9A 8ICZA 2W9MA 3HJ1A 8ICRA 2PFNA 1PV3A 1JMSA 2ZHBA 3OV7A 9ICGA 4I2DA 2BPGA 5J2DA 4QZCA 2O1PA 4KLHA 1ZQFA 5CA7A 4UB1A 5IINA 7ICMA 2PFQA 1K40A 1Q79A 4GXKA 2FMSA 3AQNA 9ICHA 1WOLA 4FH3A 4X0AA 1HUZA 2ZH4A 9ICKA 1MIVA 5CJ7A 8ICHA 1ZQWA 7ICLA 4PGXA 1V4AA 4KLQA 5F2VO 4ATBB 4M04A 3RJKA 5J0PA 3WFQE 1JQRA 4XEVA 3JPQA 7ICIA 1BPXA 1NOMA 4X5VA 3MBYA 4RQ7A 4O5CA 1OU5A 4M9NA 1K04A 3WFPA 7ICNA 5J2FA 3ISCA 3PMNA 1XSNA 4X4OA 3C5FA 4I2CA 4XQ8A 4RT2A 5IILA 8ICJA 8ICWA 4K4GA 4KLLA 4KLEA 1JAJA 2DR8A 4MFFA 1ZQXA 5BOLA 2I9GA 2IHMA 2RFFA 3LQCB 1ZQHA 9ICPA 4XRHA 9ICMA 4MFCA 3V72A 1MQ3A 1ZZPA 2BCSA 4X4QA 9ICTA 4M9GA 2M2WA 5DECA 4IQTA 4PHDA 9ICJA 4I2AA 3C2MA 4TUPA 4QZEA 1VFGA 3UXNA 2L6HA 4WC0A 4NLZA 4I2BA 4WC4A 3OVSA 1YLQA 3RH4A 3B0YA 5D46A 3ISDA 5DDMA 5EOZA 4RQ2A 9ICXA 4WC7A 5BPCA 4YCXA 2O5AA 3AUOA 7ICJA 3NYBA 8ICYA 1ZQNA 4UB2A 4KLDA 4FHYA 3H3AA 4O9MA 4QZHA 4UB5A 4RQ3A 7ICUA 4M47A 4QZFA 2ZH6A 5HREA 5D4BA 5J0TA 3MDAA 1JOGA 4R32A 3UXPA 3PNCA 4FHVA 4RWPA 5IIOA 4LVSA 4M5DA 3HW8A 5DKWA 4TUSA 4I29A 4KLOA 2KK1A 3RJEA 9ICAA 1K05A 5HHIA 4DOCA 4FHWA 4NQFA 2LK4A 4UD5A 8ICKA 4I27A 4AT9B 1ZQAA 3LK9A 4FHPA 4KLJA 5HRLA 8ICFA 3OUYB 3WFRE 5HRIA 7ICRA 3RQEA 3WFSC 3S9OA 5J0RA 4RQ1A 4M9JA 4LZGA 2NRKA 4MF8A 7ICEA 4S3NA 4RQ5A 3MDCA 4ATBA 2PBEA
chains in the Genus database with same CATH superfamily
4QZAA 2FMPA 3M15A 5A6BD 5K0IA 3NYMA 3T9OA 2JPUA 4M9HA 8ICNA 3V5ZA 4PFPA 4AE4B 7ICGA 2EWRA 2WVOA 1XWJA 2EPKX 2BCUA 1YA9A 4NXXA 2H7OA 9ICWA 3LS1A 3V5XA 3JZ0A 5COFA 1Q0DA 1QZXA 4AT7B 1G4WR 4CDYA 2DRBA 7ICHA 4JVSA 8ICAA 4EBKA 1YLMA 2J9UA 2B0JA 5JUAA 4X0BA 1O3UA 4J7YA 3S0XA 2ZXOA 3X2QC 3C66A 3AOUA 4G0HA 3S84A 2XM4A 3EGXA 4XLPF 2VB6A 1JR8A 2NG1A 2AU5A 2W45A 2XL8A 4KLTA 3JYYA 1QVXA 4LDQA 1XSPA 4XEKA 5KYYB 3U3FA 3BRJA 5J2HA 2J46A 2WVQA 2D5RB 3FOPA 4NM1A 1ZQOA 2FMQA 5A69A 9ICCA 2XRHA 1OCZC 3S27A 5J0OA 4Z6EA 1LKXA 3B0UX 3CZ6A 4I2HA 4U5CE 4WABA 4EP7A 4O68A 4E8FA 5JT4A 4UBCA 3AQCA 3IQTA 5J2EA 1OR3A 2LCHA 4YT5A 4A2NB 3V7JA 3H2VA 3C2LA 3S90A 2Y39A 5DVWA 4D4NA 5CR0A 1IZMA 1C03A 7ICFA 3C7JA 3AU6A 3HJCA 2HJMA 1OKKD 4EEBA 2Q66A 1CPQA 3NYLA 1HE9A 5A6AA 4MF2A 1M2VB 3AG4C 2BCQA 5J2IA 4PHAA 1Y4CA 4MFAA 1Z7Qc 3AQKA 3HNJA 4WC3A 7ICSA 4FO6A 3VF0A 4AT8A 8ICMA 4MVQA 1FNTc 1ZQTA 4YWQA 1G5ZA 3EJNA 4C7OB 1NBBA 1I4YA 4C3BA 1BR1A 2NUPB 4QZ9A 3UQ2A 4UAZA 4ER9A 4RPXA 2QY9A 4P2HA 1BDJB 4IQVA 2NSFA 2R7XA 3DKAA 1GM5A 2J7PD 4UB4A 3JPTA 4JLZA 2ZHAA 4ULVA 3QVYA 4Z9HA 5BQGA 2G62A 3EFOA 2ZH9A 2FFHA 1Z63A 4IRUA 4X0RA 1A41A 2OOCA 2G3KA 4B6IA 4JWNA 2R9RB 3RJJA 4OINF 3OVBA 3ZIBA 1W2WA 5IIKA 3AG2C 1APCA 3JPRA 4WOYA 5KYXB 2ZPAA 4Z9JA 3UMHA 1M56C 2RD9A 4F4BA 4BJ1A 2KYHA 3PMRA 1HUOA 1M6TA 4MNDA 4OAGA 1Q0MA 3OGUA 2FCLA 4NY8A 9ICFA 3DJNB 4LLCA 1T9KA 4U5GA 4GXIA 2V3CC 3JPOA 5D92A 4CJOA 4RQ0A 1JN3A 3OVAA 4ZLCA 1MMDA 1YYXA 1ORJA 4WGZA 4BEMJ 4I2GA 1OR2A 3OA1A 4DVYP 3FHDA 3RQGA 4OIOF 4JLXA 2JD3A 3MYIA 2YL7A 3K6BA 2PFDA 1SYQA 3FDQA 2Q7RA 3LNMB 3AG3C 8ICLA 1Z6AA 2A68F 2GDCA 3AQLA 1VLSA 4OAHA 5HRGA 4IG8A 2M2VA 4LDRA 4PK4A 1QQ3A 1EQ1A 2ZD9A 5B1AC 1KTMA 5J2BA 7ICKA 2YZSA 3GWNA 3L1MA 1T6QA 4JCZA 1LIHA 5HRHA 1VJ7A 4X4SA 1R4TA 5F28E 4JW1A 3SYNA 1ZHWA 5DB8A 3RVYA 4FHXA 4WCWA 1BPDA 2I15A 2W9MA 5AGFA 1Z5ZA 4IARA 1RJ9A 2Q9BA 4BG0A 4RBNA 3OV7A 2BPGA 4HE8D 3RFYA 2R05A 2O1PA 4EWCA 5CA7A 3HNLA 2A6EF 2PFQA 4WQKA 1AEPA 4EEDA 9ICHA 4FH3A 1MIVA 5CJ7A 4PGXA 2HN2A 4K9AA 3NKEA 2XS1A 3EGXB 3ZQYA 3UGOA 3JCUQ 3M1CB 3K1HA 3NMKA 2Q3TA 4GQHA 1D0XA 5E2QA 3JCFA 1BPXA 1NOMA 2AVKA 3MBYA 1RMVA 4O5CA 1OU5A 2YLIA 2GAFD 4E17A 3ER8C 1XSNA 4QI0A 1H7IA 1VYIA 2P61A 2HJ3A 4I2CA 2XLOA 8ICJA 2WVNA 2XLWA 1OCCC 4EIYA 3W8HA 1O5HA 3T6GB 5BOLA 3ER9B 4AL1A 4QI2A 3UNGC 4NXUA 4MFCA 2CYDA 1ZZPA 4FESA 2M2WA 3EHNA 3GANA 4I2AA 1MMAA 4N7RA 3RVZA 4DRIB 3FVYA 5DDMA 4YK5A 4RQ2A 9ICXA 5BPCA 2OU6A 1FFTC 1V54C 1VK5A 2VH3A 3L34A 3TK0A 3NG1A 3AUOA 7ICJA 1XZPA 5GPGB 2XXAA 4UB2A 4KLDA 4O9MA 4E7ZA 3RH3A 4A4AA 3E9VA 2XXAB 4QZFA 5KYUA 5HREA 2B0HA 4D4XA 2HSQA 3EQLF 3GEIA 5E3CA 2OEXA 1T5OA 3MX3A 4FHVA 2NUTA 4EKWA 4EUKB 4J32B 4N06A 4KLOA 1GGQA 5HHIA 1H9TA 3CSKA 4DOCA 4YL3A 4NQFA 4UD5A 2KQ9A 3DZAA 1ZQAA 2IHOA 3IQCA 1S05A 2KW3C 3WFRE 4YT4A 1U0BB 3RQEA 3DM5A 3TQOA 4RQ1A 2J8WA 4M9JA 2NRKA 2ZXWC 4MF8A 2ZH3A 1HW1A 3JSEO 3EGDA 4Q5SF 3NMIA 1UETA 1RKEA 4RQ4A 3JYHA 2L81A 3N0TA 2HZ8A 4WC6A 4OD4A 1TVAA 3F46A 4AX2A 2CCYA 5DBCA 4YMMA 4PH5A 2EINC 4O5EA 5DB9A 4O5KA 1BPYA 8ICVA 1WN0A 2IUBA 5IIJA 3HIYA 3T4RA 1IW7F 4GXJA 2W4MA 1U89A 3GM2A 4RPZA 4NLKA 2VCCA 3KKBA 3RH6A 1BPEA 2I8BA 9ICLA 5HRDA 5B1BC 4R64A 1HMOA 5DBAA 1ZQBA 4MTOA 4O6AA 4BJ5C 2R03A 8ICPA 4UBBA 4MVUA 1GS9A 3PCVA 4E80A 4U5FE 2YL0A 4XJEA 4L6RA 3KYJA 1C17M 3VAYA 1UG7A 1TWCA 1BBHA 1NO5A 2Z15A 8ICGA 3H38A 2EIMC 3C8GA 4UAYA 3EZIA 2YLDA 3EHMA 1SR2A 3NKDA 3AQMA 2PNOA 4P4MA 4CX9A 1OW8A 3W2WA 3IQ5A 2H8AA 7ICVA 1ZQGA 4CS8A 2ISPA 4GYTA 1NU7D 3QW1A 8ICXA 1LM3B 5CI8A 5T1DB 3C8GD 4O67A 3GEEA 3MCRA 3LS0A 2KC3A 4I2JA 1CPRA 2QUPA 1MIYA 5DB6A 3LEVA 4NKTA 8ICEA 9ICQA 1A7VA 4YN0B 5BOMA 4XEFA 4WGYA 5CP2A 5J0YA 1MNEA 4N6CA 3MGIA 4P9TA 3H39A 3RJGA 1YAUO 3WG7C 5DS6A 1QPUA 8ICOA 5D62A 3C18A 3JPNA 2DR5A 2HUJA 1YZCA 4I2FA 3SNHA 2VCBA 1KEJA 3C2KA 3AQBA 2A0UA 2IYLD 5CIVA 5J0WA 1H9GA 3QW0A 4MVSA 4RWNA 1NFOA 4K98A 5J2AA 3JPPA 1ZQEA 4TURA 4P4PA 4OD5A 3RJFA 2KNHA 4JIOA 4KLSA 1E83A 3CQZA 2HMZA 4PGQA 4NLNA 5IIMA 4QZBA 3G50A 1JMWA 4G7HF 1TR2A 4PJNA 1VB5A 1RCPA 5CWRA 3FXHA 4RT3A 4AK9A 4AT7A 2P66A 2LD6A 3S29A 3KH2A 2VC9A 5KYNA 4WJ0A 4CSAA 2DGJA 2XL4A 5KYYA 3ATPA 3TFRA 2Q00A 1D1AA 3F47A 1XSLA 4E7XA 4X4RA 2IXPA 3EGDB 4DVZA 1YZAA 3RJIA 2A6HF 3O10A 4MW3A 5TZVA 4LERA 2Y69C 4LEVA 3M4CA 5J2KA 2B51A 3K75D 1ZJMA 1ZQDA 4F5NA 3KL4A 2EIJC 4YN4A 2VANA 1L7CA 2P0NA 2GFHA 3ABMC 3UR3C 1A7EA 2J45A 4KC9A 4G78A 2C03A 3U0CA 3LJBA 4G7OF 1LS4A 3J06A 4KLGA 2HS5A 4LEYA 4EV6A 5DEDA 2AWCA 1ORSC 4UD4A 4K97A 4DRJB 2DYSC 4K0DA 3V7LA 5J2JA 3KMIA 4K96A 2QNLA 3IEEA 2FGYA 4XWJA 3JRMO 2WL8A 3NYJA 3B0VC 1FTSA 3HJ1A 8ICRA 2OQMA 4JURI 1V55C 4I3MA 4QZCA 2R7TA 4WH5A 7ICMA 1ZHZA 1Q79A 3AQNA 4X0AA 9ICKA 3WODF 1A0BA 2LFDA 2Q9CA 1V4AA 4KLQA 2YEVA 3B9QA 4M04A 3MBGA 5DQZA 3X1OA 4BJ6C 3NWIA 3WFQE 1JQRA 3JPQA 2VASA 2HV7A 2CDQA 1TKNA 2DYRC 4YL1A 4RQ7A 1OCOC 3N24A 2M64A 2WZGA 5B3PA 2HMQA 2R7SA 4MVZA 4NTAA 3K33A 3AG1C 3EZHA 4RT2A 2PX0A 2OKUA 4N6HA 2W4BA 4KLLA 3M4BA 4HFFB 1ZQXA 2IBFA 9ICPA 3VYWA 9ICMA 4ONSA 4DOZA 2BCSA 1MMGA 5T3TA 1G8XA 4M9GA 5L0IA 2YVKA 1M2OA 4PHDA 5COGA 5TJ5E 1VFGA 3UXNA 2F22A 4C3DA 3EG9A 4I2BA 3DE9A 1T6UA 4LEWA 3U8VA 3OVSA 1YLQA 1YA7O 3B0YA 5D46A 3ISDA 3FAPB 3LAYA 4WC7A 1CGME 4YCXA 5CFSA 3POVA 3Q7LA 3IPMO 3NYBA 3B29A 3SXKA 1ZQNA 3TJ6A 4QZHA 4MVOA 2AP3A 1PD0A 4M47A 4XPWA 2ZH6A 4IJJA 5L3VA 1MMNA 3JT1A 2XSEA 2HN1A 4BJTA 4LEZA 4LVSA 4M5DA 2QTVA 4JZAA 1K05A 4FHWA 4LLEA 2LK4A 3M79A 4AT9B 1HE1A 4JE9A 4KLJA 8ICFA 4J30B 1TFOB 3K66A 4HX0A 3HLZA 3WFSC 4E0HA 3TD7A 5J0RA 2ZXPA 2IOQA 3PHZA 7ICEA 4S3NA 4YD1A 1VMAA 1LI5A 4RDAA 2ZH5A 3KYIA 1ZJNA 2A1DD 1VYKA 3SXZA 9ICNA 5J0UA 1SF8A 3EF2A 3HWTA 1FMWA 4PJLA 4RWQA 5JLIA 4M0AA 3GEHA 1ZQIA 4Z9IA 2NUTB 5DB7A 5J2GA 1LVKA 4X4NA 1WTYA 1TFWA 3V7OA 3NDBB 5L0JA 1FAPB 3HJ4A 2YQYA 4LZDA 1ZQJA 1OXKA 4TUQA 3UMKA 2E87A 5KYXA 4IB4A 4KLUA 1HY5A 3CAXA 1HMDA 2BPFA 1ZQMA 1TQGA 2R7UA 3PMLA 4C3EA 4JJFA 5J0SA 2PFPA 2OCCC 5J2CA 5CFTA 1E86A 4NM2A 2DR9A 4NY3A 5DBBA 5B3IA 1ZHYA 4MTGA 8ICUA 9ICSA 3DMDA 4X4PA 3L9DA 4UAWA 4F5QA 2DVIA 4RD9A 3JSZA 1JPNA 1D0YA 4H4KC 2GAQA 4QZGA 1ZQLA 4RQ6A 3WFOA 4CDAA 4NTBA 1ZQSA 3ZQVA 4X4VA 5HRFA 4KLMA 3LNRA 4U9EA 1YJGA 5J0XA 4NXZA 1EI7A 4JEAA 2OJQA 4O7GA 3PDMP 3EG9B 4I0UA 2HFIA 3IHUA 3SEOA 1FR0A 3T6JA 2GA9D 3LLKA 3UXOA 1E2XA 4IGGA 3RQFA 1NU9C 1ZQZA 4CDVA 5JSLA 4P4OA 9ICIA 1AUEA 5DDYA 4QZIA 1ZQRA 7ICOA 2ZH8A 4JTCB 3K1IC 2YWAA 4R66A 1RPLA 1YARO 2G3VA 4EBBA 3ZWIA 1ZU5A 2IXMA 3TULA 4XUSA 5DLJA 3UQ0A 4PFOA 4EGWA 1OQCA 3UGPA 1TWAA 3KPHA 3DJUB 1ZU4A 2ASRA 1R8AA 5HRKA 1WWPA 3RJHA 1ZQVA 3VM6A 4OIRF 4U5HA 4XA5A 4JEBA 2YRFA 2EPLX 1S7ZA 8ICIA 1GPJA 4PR9A 5CHGA 4PHPA 3CK6A 4MQ9F 3FMSA 1TFYA 2BE5F 4Q7CA 2MWQA 3LLIA 3GODA 5L0GA 5CB1A 4H54A 9ICBA 2ZH1A 5E3AA 3ABLC 4JJGA 2ID1A 1R8CA 1ZQKA 4KNVA 3QTHA 2WZLA 5HV9A 4I28A 2PFOA 1F5AA 1YYJA 1NG1A 2J0XA 1LPEA 4GEHA 3H65A 3QMKA 4AL0A 1LE4A 2R25A 4X4UA 3N2ZB 2DR7A 2Y3GA 1UEVA 3O55A 4I44A 4O6YA 9ICOA 9ICUA 2P6VA 4QZDA 4F5OA 2KJGA 4R63A 1DOVA 2XLEA 4MW8A 2B4VA 3UPSA 4XLNF 2BCVA 1N1CA 5JS5A 1BPZA 2R7VA 4DOAA 2Q9AA 3B71A 4Z6FA 1KNYA 4EBJA 4NKUA 3LUTB 8ICBA 4RPYA 1KDHA 4QZ8A 2WB7A 4OIPF 2BBHA 1ZYRF 1C02A 5F5HA 3GDXA 4KNWA 2ETSA 1MQ2A 2B56A 3ERCC 5D91A 4UB3A 1AVOB 4DOBA 4F5RA 3OUYA 3C5GA 3L8JA 4LDKA 4JKVA 3SP1A 3SZRA 9ICEA 4U5DE 4G7ZF 1UEUA 4NTFA 4RQ8A 1TFKB 5HHHA 1WGWA 2L6FA 3NMJA 1ZQCA 2GWSA 2ICWG 1EA8A 1NLXA 1BPBA 3T6BA 5D49A 1QSPA 3HKKA 5IIIA 1OW7A 1ZQUA 2HHPA 2J9VA 4DO9A 2A69F 1OXBA 2PFNA 1PV3A 4K7BA 4CS7A 1JMSA 2ZHBA 4I2DA 1WASA 4C7OA 5DQTA 4OIQF 3I5PA 3Q6MA 4N4WA 1ZQFA 2LQGA 4CIPA 3B0PA 4GXKA 1Q0FA 1HUZA 8ICHA 4O79A 7ICLA 1ZQWA 4OAFA 4DBQA 2J9BA 2V26A 3AGUA 2LP4A 4FX5A 3C8ZA 1A7DA 2QE9A 2X51A 2NUPA 3U9JA 4DJ9A 5J0PA 4JRZA 3HTKC 2NPUA 1BZ4A 2J7PA 3MYFA 3ECSA 4M9NA 1K04A 5CFUA 5J2FA 3PMNA 4JTAB 1B68A 4X4OA 2KGOA 4XQ8A 4K4GA 1GQAA 2Y3DA 4MFFA 2I9GA 2IHMA 2RFFA 3U3BA 4XRHA 5JRAA 1CGOA 4IQTA 3SXYA 256BA 9ICJA 3R2PA 5KYWB 1ZW2A 4QZEA 4TUPA 4ANJA 4WC0A 4NLZA 1SZIA 3U2LA 4WC4A 2XLDA 4YT8A 3H2UA 4O69A 3AGTA 3ZG1A 4NC3A 1PD1A 2O5AA 4EHPA 2OG2A 2FAPB 3I4UA 4XQ1A 4ULWA 1HW2A 1NZEA 5EGYA 8ICYA 4FHYA 3H3AA 4ZLDA 5FZTA 3ZSUA 4IAQA 3QZCA 4RQ3A 7ICUA 2ZXRA 5J0TA 3TOMA 4R32A 5AC5A 4Q4ZF 3PNCA 1XZQA 4J7TA 4RWPA 5IIOA 4I29A 2CNWD 9ICAA 4DBRA 4BPMA 5KYWA 3TOLA 3U5SA 3LK9A 5F5FA 2R7QA 3CEXA 5B3SC 4BJ5A 5D61A 3LEOA 4UDVA 2R7RA 4BEJA 4MS2A 4LZGA 4JTDB 5JVEA 4JC7A 5EK0A 5DS4A 4RQ5A 3MDCA 2NSGA 2PBEA 4P9FA 4K9BA 1WOTA 2BCRA 1JPJA 4YMNA 1JAFA 2J0WA 1R8BA 1R5ID 5J29A 4O6NA 4YMOA 4KI2A 4CS9A 1VLTA 4FH5A 3ZC4A 2PXIA 4HFKB 2HKVA 3B0XA 3O39A 2XLMA 2HV6A 2OEVA 3HX0A 5D63A 5J0QA 2Y3BA 2R7WA 4KLFA 1UFBA 3I5QA 2DRAA 1VOMA 3JTLO 2BE3A 2RSEB 5L0FA 3C63A 1M57C 3C62A 1KU2A 3ABKC 1CGNA 1SMYF 3W4YA 4PPXA 4IAOA 2HSBA 2XL6A 1O87A 3VRCA 5BQIA 3ISBA 4U5BE 2YL1A 3MFNA 4LT6A 1FFHA 1FA0A 3GWLA 1PX5A 1ZHTA 3Q7GA 4WC1A 4K4HA 1Q0KA 3DD7A 2A0BA 3R7CA 2CGEA 4LACB 4PGYA 4K4IA 5JTGA 1RJ9B 4Z6DA 7ICQA 2W9YA 4FO1A 2ZH2A 4IQWA 3EFOB 4XTKA 4P6IC 3RYLA 1LE2A 2L6GA 2LSEA 5KYUB 1I5NA 1G4US 1ZQQA 3DAGA 4WBZA 4X4TA 5A6KA 4W8KA 1E85A 5CHEA 5A6BA 9ICVA 3EPVA 2EIKC 4W8PA 2XLVA 1YDIA 1J8MF 3W8IA 4O6MA 4M63A 3RF3A 4U9DA 3K7DA 4AT8B 1I4ZA 4K1OA 2CW0F 2MYSA 3EH1A 4MVRA 1LS1A 2LFFA 3ZTMA 3V7KA 1E84A 3DM9B 3UPQA 2EILC 4YJWA 3GORA 1ZQPA 4IQUA 4OAIZ 3GM3A 2BPCA 3AU2A 3V5YA 5B3QA 3L0IA 4CS9C 1WATA 1ZVZA 4F5PA 3LESA 1R89A 3DXJF 7ICTA 4KBLA 2YLGA 2M2UA 5DS5A 3DAFA 2R7OA 1NFNA 2BC5A 3TJ5A 3GM1A 4NXVA 3FAJA 1J8YF 1ST6A 5IY5C 1LI7A 2J9WA 1RZTA 1Y6DA 2O9XA 8ICSA 5L3QA 3RIPA 1U6HA 4XQ7A 4JWMA 3C8GB 4M9LA 8ICTA 4CBEA 2L9JA 7ICPA 1RXQA 2XM0A 1V74B 3WAQA 4MKPA 4YD2A 2M2TA 1VTMP 2L7AA 3G4ZA 3US6A 2JX0A 4CS8C 2PP4A 3DE8A 3DWWA 2H7BA 4DXWA 2GA0A 1Q78A 5HC9A 4R65A 4KB6A 1ORYA 3ASOC 2CNWA 4WC2A 1OW6A 3L8IA 2ZH7A 3NRHA 4Z6CA 3NKUA 4I2EA 1YVIA 4M2YA 4PJMA 1TV9A 5COMA 5BUOA 4WBYA 2ISOA 2X0CA 3ITFA 2PX3A 1MQVA 5HSWA 1EKYA 4PHEA 1T01A 3K1IA 1ZQYA 4YL0A 5L0HA 9ICRA 3JPSA 5FCLA 3H37A 1DOWA 4MVMA 2R02A 2AWYA 8ICQA 3TFSA 3HNKA 5L0CA 4I2IA 3RH5A 2LIGA 4KLIA 1ZHXA 2EPOA 1JRAA 2XLHA 3AJMA 4AT9A 4RWOA 4NXTA 4NXWA 2YKZA 4YT2A 4E7SA 5AC4A 8ICCA 2VCAA 4QDLA 4WC5A 5BQHA 3W2VA 1OKKA 4FWVA 5HR9A 3O6XA 3MGHA 1D1BA 2BL2A 3FOOA 3OEOA 2MHRA 4JCHA 2XS8A 1MIWA 4CSAC 5HRBA 8ICZA 3RKOF 1BR2A 1L3PA 9ICGA 1M2VA 5J2DA 4AE4A 4KLHA 1D0ZA 2TMVP 5L0DA 4UB1A 5IINA 5CI9A 4E18A 1TWHA 3A11A 1K40A 2FMSA 1WOLA 2ZH4A 4K99A 4PACA 4CJGA 1FMVA 1QLEC 4MTFA 4KM5A 4WQLA 5F2VO 4ATBB 2P1AA 1Z3IX 2EPNA 1Z23A 4K8VA 1NSGB 3RJKA 4I1MA 3E70C 4U5EE 4XEVA 7ICIA 2H7VC 3IQ6A 3WHNA 4X5VA 5A6JA 2UUHA 2QLAA 1RKEB 2OJED 3G4XA 1RKCA 3QVZA 3U8PA 3WFPA 2DB4A 3ISCA 7ICNA 4XPXA 2KSFA 3C5FA 1OCRC 2Q4FA 2DI3A 3DI5A 5IILA 8ICWA 4KLEA 1Q0GA 1JAJA 2DR8A 2D4UA 2P7VA 2M4EA 4NCQA 3LQCB 1ZQHA 2IXNA 3U9MA 3V72A 1MQ3A 4CIHA 4X4QA 9ICTA 2IM8A 2WZFA 5DECA 5JP7A 3C2MA 3HNIA 2L6HA 2BBJA 4PJJA 5T3WA 3EH2A 3MLGA 3RH4A 3BEHA 4XPYA 5EOZA 3ZDLA 2PF4E 1TWGA 1H6GA 2EPMX 2Y3HA 4DRHB 3PHF2 3UMIA 5EHHA 2YL3A 4UB5A 1T6IA 4HEAJ 4BJ6A 5D4BA 3JRTA 3MDAA 1JOGA 3ZTZA 3UXPA 3RW0A 3NVOA 1MNDA 4E0IA 3HW8A 5DKWA 3OWGA 4TUSA 5E33A 2KK1A 3RJEA 1QKRA 3A9CA 4IWBA 1D1CA 4FAPB 2C04A 3ASNC 8ICKA 4I27A 3Q6NA 3OWTA 1ZW3A 4FHPA 4I1OB 2IXOA 1PCXA 5HRLA 3U2MA 3OUYB 3ZVRA 3SXMA 5HRIA 1BR4A 7ICRA 2UUIA 3S28A 2YHSA 3S9OA 1F1MA 2GWWA 4ATBA
chains in the Genus database with same CATH topology
4QZAA 2ZH3A 1WOTA 2ZH5A 1ZJNA 2BCRA 4YMNA 2FMPA 1R8BA 1UETA 5J29A 4RQ4A 9ICNA 5J0UA 4YMOA 2JPUA 4WC6A 4M9HA 8ICNA 4FH5A 3HWTA 1TVAA 2PXIA 7ICGA 4RWQA 4M0AA 3B0XA 5DBCA 1ZQIA 2BCUA 5DB7A 5J2GA 4YMMA 9ICWA 3HX0A 4X4NA 1WTYA 4PH5A 1TFWA 4O5EA 5DB9A 5J0QA 4O5KA 4KLFA 1UFBA 1BPYA 3HJ4A 2DRAA 3JZ0A 8ICVA 4LZDA 1ZQJA 2BE3A 4AT7B 4TUQA 2DRBA 7ICHA 8ICAA 4EBKA 5IIJA 3HIYA 4X0BA 1O3UA 4GXJA 4KLUA 2BPFA 4PPXA 2HSBA 3C66A 1ZQMA 3GM2A 4RPZA 4NLKA 3PMLA 3RH6A 1BPEA 3ISBA 9ICLA 3MFNA 5J0SA 4LT6A 2PFPA 5HRDA 5J2CA 4R64A 1FA0A 5DBAA 1PX5A 1ZQBA 4KLTA 3JYYA 8ICPA 1QVXA 4NM2A 4WC1A 2DR9A 1XSPA 4XEKA 5DBBA 4K4HA 4UBBA 4E80A 3U3FA 3BRJA 5J2HA 4K4IA 4PGYA 8ICUA 4Z6DA 9ICSA 7ICQA 4X4PA 3L9DA 4UAWA 1ZQOA 2FMQA 2ZH2A 4NM1A 4F5QA 2DVIA 4IQWA 9ICCA 4QZGA 1NO5A 2L6GA 1ZQLA 5J0OA 8ICGA 4Z6EA 4RQ6A 3WFOA 3H38A 1ZQQA 4X4TA 4WBZA 1ZQSA 3C8GA 4UAYA 4I2HA 4X4VA 5HRFA 4EP7A 4E8FA 4KLMA 3AQMA 9ICVA 5J0XA 4NXZA 4UBCA 4P4MA 1OW8A 5J2EA 7ICVA 1ZQGA 2ISPA 3V7JA 3K7DA 4AT8B 3C2LA 3UXOA 3RQFA 8ICXA 1ZQZA 4P4OA 5CR0A 3V7KA 3C8GD 9ICIA 7ICFA 3UPQA 5DDYA 3AU6A 4QZIA 4I2JA 1MIYA 5DB6A 1ZQRA 4NKTA 7ICOA 8ICEA 2ZH8A 1ZQPA 2Q66A 9ICQA 2YWAA 4R66A 1RPLA 5BOMA 4MF2A 4IQUA 4XEFA 3GM3A 3TULA 2BPCA 2BCQA 4XUSA 5CP2A 5J2IA 3AU2A 5J0YA 3MGIA 3UQ0A 4PHAA 4F5PA 1R89A 3H39A 4MFAA 3RJGA 7ICTA 2M2UA 7ICSA 3AQKA 4WC3A 1R8AA 5HRKA 1WWPA 4FO6A 3GM1A 3RJHA 1ZQVA 4AT8A 8ICMA 8ICOA 1ZQTA 4XA5A 1RZTA 3C18A 3JPNA 2DR5A 4QZ9A 3UQ2A 8ICSA 4UAZA 8ICIA 4I2FA 4XQ7A 4RPXA 5CHGA 4PHPA 4JWMA 4P2HA 3C8GB 1KEJA 4IQVA 3C2KA 4M9LA 1TFYA 8ICTA 5J0WA 7ICPA 4UB4A 3JPTA 4RWNA 5CB1A 5J2AA 3JPPA 4YD2A 2M2TA 1ZQEA 9ICBA 4TURA 2ZHAA 4P4PA 2ZH1A 2JX0A 2ZH9A 3RJFA 2ID1A 1R8CA 4KLSA 1ZQKA 4PGQA 4NLNA 1Q78A 5IIMA 4QZBA 4I28A 5HC9A 4JWNA 3RJJA 2PFOA 1F5AA 3OVBA 4R65A 5IIKA 5CWRA 3JPRA 4RT3A 4WC2A 4AT7A 2P66A 1OW6A 3L8IA 2ZH7A 4X4UA 4Z6CA 4I2EA 4M2YA 1TV9A 2DR7A 1UEVA 9ICOA 9ICUA 4WBYA 1HUOA 4QZDA 4F5OA 3OGUA 4NY8A 4R63A 9ICFA 2ISOA 3TFRA 2Q00A 3UPSA 4GXIA 1XSLA 4PHEA 3JPOA 2BCVA 4RQ0A 1ZQYA 4E7XA 1JN3A 4X4RA 1BPZA 9ICRA 3JPSA 3OVAA 3H37A 4DOAA 3B71A 3RJIA 4I2GA 4Z6FA 3O10A 1KNYA 4EBJA 4NKUA 3RQGA 5TZVA 8ICBA 4RPYA 1KDHA 4QZ8A 3TFSA 8ICQA 4I2IA 3RH5A 3GDXA 5J2KA 3K75D 4KLIA 1ZJMA 8ICLA 1MQ2A 4YD1A 1ZQDA 4F5NA 3AQLA 4YN4A 2VANA 4UB3A 5HRGA 4DOBA 4IG8A 3AJMA 4AT9A 2M2VA 4F5RA 3OUYA 3C5GA 4RWOA 3L8JA 3U0CA 1KTMA 9ICEA 5J2BA 7ICKA 1UEUA 4RQ8A 4KLGA 5HHHA 8ICCA 2L6FA 5DEDA 1ZQCA 2GWSA 5HRHA 4WC5A 1VJ7A 4X4SA 1BPBA 4UD4A 5F28E 5D49A 5HR9A 3MGHA 5DB8A 5J2JA 3V7LA 4FHXA 5IIIA 1OW7A 1MIWA 4WCWA 1BPDA 1ZQUA 2HHPA 5HRBA 4DO9A 8ICZA 2W9MA 3HJ1A 8ICRA 2PFNA 1PV3A 1JMSA 2ZHBA 3OV7A 9ICGA 4I2DA 2BPGA 5J2DA 4QZCA 2O1PA 4KLHA 1ZQFA 5CA7A 4UB1A 5IINA 7ICMA 2PFQA 1K40A 1Q79A 4GXKA 2FMSA 3AQNA 9ICHA 1WOLA 4FH3A 4X0AA 1HUZA 2ZH4A 9ICKA 1MIVA 5CJ7A 8ICHA 1ZQWA 7ICLA 4PGXA 1V4AA 4KLQA 5F2VO 4ATBB 4M04A 3RJKA 5J0PA 3WFQE 1JQRA 4XEVA 3JPQA 7ICIA 1BPXA 1NOMA 4X5VA 3MBYA 4RQ7A 4O5CA 1OU5A 4M9NA 1K04A 3WFPA 7ICNA 5J2FA 3ISCA 3PMNA 1XSNA 4X4OA 3C5FA 4I2CA 4XQ8A 4RT2A 5IILA 8ICJA 8ICWA 4K4GA 4KLLA 4KLEA 1JAJA 2DR8A 4MFFA 1ZQXA 5BOLA 2I9GA 2IHMA 2RFFA 3LQCB 1ZQHA 9ICPA 4XRHA 9ICMA 4MFCA 3V72A 1MQ3A 1ZZPA 2BCSA 4X4QA 9ICTA 4M9GA 2M2WA 5DECA 4IQTA 4PHDA 9ICJA 4I2AA 3C2MA 4TUPA 4QZEA 1VFGA 3UXNA 2L6HA 4WC0A 4NLZA 4I2BA 4WC4A 3OVSA 1YLQA 3RH4A 3B0YA 5D46A 3ISDA 5DDMA 5EOZA 4RQ2A 9ICXA 4WC7A 5BPCA 4YCXA 2O5AA 3AUOA 7ICJA 3NYBA 8ICYA 1ZQNA 4UB2A 4KLDA 4FHYA 3H3AA 4O9MA 4QZHA 4UB5A 4RQ3A 7ICUA 4M47A 4QZFA 2ZH6A 5HREA 5D4BA 5J0TA 3MDAA 1JOGA 4R32A 3UXPA 3PNCA 4FHVA 4RWPA 5IIOA 4LVSA 4M5DA 3HW8A 5DKWA 4TUSA 4I29A 4KLOA 2KK1A 3RJEA 9ICAA 1K05A 5HHIA 4DOCA 4FHWA 4NQFA 2LK4A 4UD5A 8ICKA 4I27A 4AT9B 1ZQAA 3LK9A 4FHPA 4KLJA 5HRLA 8ICFA 3OUYB 3WFRE 5HRIA 7ICRA 3RQEA 3WFSC 3S9OA 5J0RA 4RQ1A 4M9JA 4LZGA 2NRKA 4MF8A 7ICEA 4S3NA 4RQ5A 3MDCA 4ATBA 2PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZA A;  2ZH3 A;  1WOT A;  2ZH5 A;  1ZJN A;  2BCR A;  4YMN A;  2FMP A;  1R8B A;  1UET A;  5J29 A;  4RQ4 A;  9ICN A;  5J0U A;  4YMO A;  2JPU A;  4WC6 A;  4M9H A;  8ICN A;  4FH5 A;  3HWT A;  1TVA A;  2PXI A;  7ICG A;  4RWQ A;  4M0A A;  3B0X A;  5DBC A;  1ZQI A;  2BCU A;  5DB7 A;  5J2G A;  4YMM A;  9ICW A;  3HX0 A;  4X4N A;  1WTY A;  4PH5 A;  1TFW A;  4O5E A;  5DB9 A;  5J0Q A;  4O5K A;  4KLF A;  1UFB A;  1BPY A;  3HJ4 A;  2DRA A;  3JZ0 A;  8ICV A;  4LZD A;  1ZQJ A;  2BE3 A;  4AT7 B;  4TUQ A;  2DRB A;  7ICH A;  8ICA A;  4EBK A;  5IIJ A;  3HIY A;  4X0B A;  1O3U A;  4GXJ A;  4KLU A;  2BPF A;  4PPX A;  2HSB A;  3C66 A;  1ZQM A;  3GM2 A;  4RPZ A;  4NLK A;  3PML A;  3RH6 A;  1BPE A;  3ISB A;  9ICL A;  3MFN A;  5J0S A;  4LT6 A;  2PFP A;  5HRD A;  5J2C A;  4R64 A;  1FA0 A;  5DBA A;  1PX5 A;  1ZQB A;  4KLT A;  3JYY A;  8ICP A;  1QVX A;  4NM2 A;  4WC1 A;  2DR9 A;  1XSP A;  4XEK A;  5DBB A;  4K4H A;  4UBB A;  4E80 A;  3U3F A;  3BRJ A;  5J2H A;  4K4I A;  4PGY A;  8ICU A;  4Z6D A;  9ICS A;  7ICQ A;  4X4P A;  3L9D A;  4UAW A;  1ZQO A;  2FMQ A;  2ZH2 A;  4NM1 A;  4F5Q A;  2DVI A;  4IQW A;  9ICC A;  4QZG A;  1NO5 A;  2L6G A;  1ZQL A;  5J0O A;  8ICG A;  4Z6E A;  4RQ6 A;  3WFO A;  3H38 A;  1ZQQ A;  4X4T A;  4WBZ A;  1ZQS A;  3C8G A;  4UAY A;  4I2H A;  4X4V A;  5HRF A;  4EP7 A;  4E8F A;  4KLM A;  3AQM A;  9ICV A;  5J0X A;  4NXZ A;  4UBC A;  4P4M A;  1OW8 A;  5J2E A;  7ICV A;  1ZQG A;  2ISP A;  3V7J A;  3K7D A;  4AT8 B;  3C2L A;  3UXO A;  3RQF A;  8ICX A;  1ZQZ A;  4P4O A;  5CR0 A;  3V7K A;  3C8G D;  9ICI A;  7ICF A;  3UPQ A;  5DDY A;  3AU6 A;  4QZI A;  4I2J A;  1MIY A;  5DB6 A;  1ZQR A;  4NKT A;  7ICO A;  8ICE A;  2ZH8 A;  1ZQP A;  2Q66 A;  9ICQ A;  2YWA A;  4R66 A;  1RPL A;  5BOM A;  4MF2 A;  4IQU A;  4XEF A;  3GM3 A;  3TUL A;  2BPC A;  2BCQ A;  4XUS A;  5CP2 A;  5J2I A;  3AU2 A;  5J0Y A;  3MGI A;  3UQ0 A;  4PHA A;  4F5P A;  1R89 A;  3H39 A;  4MFA A;  3RJG A;  7ICT A;  2M2U A;  7ICS A;  3AQK A;  4WC3 A;  1R8A A;  5HRK A;  1WWP A;  4FO6 A;  3GM1 A;  3RJH A;  1ZQV A;  4AT8 A;  8ICM A;  8ICO A;  1ZQT A;  4XA5 A;  1RZT A;  3C18 A;  3JPN A;  2DR5 A;  4QZ9 A;  3UQ2 A;  8ICS A;  4UAZ A;  8ICI A;  4I2F A;  4XQ7 A;  4RPX A;  5CHG A;  4PHP A;  4JWM A;  4P2H A;  3C8G B;  1KEJ A;  4IQV A;  3C2K A;  4M9L A;  1TFY A;  8ICT A;  5J0W A;  7ICP A;  4UB4 A;  3JPT A;  4RWN A;  5CB1 A;  5J2A A;  3JPP A;  4YD2 A;  2M2T A;  1ZQE A;  9ICB A;  4TUR A;  2ZHA A;  4P4P A;  2ZH1 A;  2JX0 A;  2ZH9 A;  3RJF A;  2ID1 A;  1R8C A;  4KLS A;  1ZQK A;  4PGQ A;  4NLN A;  1Q78 A;  5IIM A;  4QZB A;  4I28 A;  5HC9 A;  4JWN A;  3RJJ A;  2PFO A;  1F5A A;  3OVB A;  4R65 A;  5IIK A;  5CWR A;  3JPR A;  4RT3 A;  4WC2 A;  4AT7 A;  2P66 A;  1OW6 A;  3L8I A;  2ZH7 A;  4X4U A;  4Z6C A;  4I2E A;  4M2Y A;  1TV9 A;  2DR7 A;  1UEV A;  9ICO A;  9ICU A;  4WBY A;  1HUO A;  4QZD A;  4F5O A;  3OGU A;  4NY8 A;  4R63 A;  9ICF A;  2ISO A;  3TFR A;  2Q00 A;  3UPS A;  4GXI A;  1XSL A;  4PHE A;  3JPO A;  2BCV A;  4RQ0 A;  1ZQY A;  4E7X A;  1JN3 A;  4X4R A;  1BPZ A;  9ICR A;  3JPS A;  3OVA A;  3H37 A;  4DOA A;  3B71 A;  3RJI A;  4I2G A;  4Z6F A;  3O10 A;  1KNY A;  4EBJ A;  4NKU A;  3RQG A;  5TZV A;  8ICB A;  4RPY A;  1KDH A;  4QZ8 A;  3TFS A;  8ICQ A;  4I2I A;  3RH5 A;  3GDX A;  5J2K A;  3K75 D;  4KLI A;  1ZJM A;  8ICL A;  1MQ2 A;  4YD1 A;  1ZQD A;  4F5N A;  3AQL A;  4YN4 A;  2VAN A;  4UB3 A;  5HRG A;  4DOB A;  4IG8 A;  3AJM A;  4AT9 A;  2M2V A;  4F5R A;  3OUY A;  3C5G A;  4RWO A;  3L8J A;  3U0C A;  1KTM A;  9ICE A;  5J2B A;  7ICK A;  1UEU A;  4RQ8 A;  4KLG A;  5HHH A;  8ICC A;  2L6F A;  5DED A;  1ZQC A;  2GWS A;  5HRH A;  4WC5 A;  1VJ7 A;  4X4S A;  1BPB A;  4UD4 A;  5F28 E;  5D49 A;  5HR9 A;  3MGH A;  5DB8 A;  5J2J A;  3V7L A;  4FHX A;  5III A;  1OW7 A;  1MIW A;  4WCW A;  1BPD A;  1ZQU A;  2HHP A;  5HRB A;  4DO9 A;  8ICZ A;  2W9M A;  3HJ1 A;  8ICR A;  2PFN A;  1PV3 A;  1JMS A;  2ZHB A;  3OV7 A;  9ICG A;  4I2D A;  2BPG A;  5J2D A;  4QZC A;  2O1P A;  4KLH A;  1ZQF A;  5CA7 A;  4UB1 A;  5IIN A;  7ICM A;  2PFQ A;  1K40 A;  1Q79 A;  4GXK A;  2FMS A;  3AQN A;  9ICH A;  1WOL A;  4FH3 A;  4X0A A;  1HUZ A;  2ZH4 A;  9ICK A;  1MIV A;  5CJ7 A;  8ICH A;  1ZQW A;  7ICL A;  4PGX A;  1V4A A;  4KLQ A;  5F2V O;  4ATB B;  4M04 A;  3RJK A;  5J0P A;  3WFQ E;  1JQR A;  4XEV A;  3JPQ A;  7ICI A;  1BPX A;  1NOM A;  4X5V A;  3MBY A;  4RQ7 A;  4O5C A;  1OU5 A;  4M9N A;  1K04 A;  3WFP A;  7ICN A;  5J2F A;  3ISC A;  3PMN A;  1XSN A;  4X4O A;  3C5F A;  4I2C A;  4XQ8 A;  4RT2 A;  5IIL A;  8ICJ A;  8ICW A;  4K4G A;  4KLL A;  4KLE A;  1JAJ A;  2DR8 A;  4MFF A;  1ZQX A;  5BOL A;  2I9G A;  2IHM A;  2RFF A;  3LQC B;  1ZQH A;  9ICP A;  4XRH A;  9ICM A;  4MFC A;  3V72 A;  1MQ3 A;  1ZZP A;  2BCS A;  4X4Q A;  9ICT A;  4M9G A;  2M2W A;  5DEC A;  4IQT A;  4PHD A;  9ICJ A;  4I2A A;  3C2M A;  4TUP A;  4QZE A;  1VFG A;  3UXN A;  2L6H A;  4WC0 A;  4NLZ A;  4I2B A;  4WC4 A;  3OVS A;  1YLQ A;  3RH4 A;  3B0Y A;  5D46 A;  3ISD A;  5DDM A;  5EOZ A;  4RQ2 A;  9ICX A;  4WC7 A;  5BPC A;  4YCX A;  2O5A A;  3AUO A;  7ICJ A;  3NYB A;  8ICY A;  1ZQN A;  4UB2 A;  4KLD A;  4FHY A;  3H3A A;  4O9M A;  4QZH A;  4UB5 A;  4RQ3 A;  7ICU A;  4M47 A;  4QZF A;  2ZH6 A;  5HRE A;  5D4B A;  5J0T A;  3MDA A;  1JOG A;  4R32 A;  3UXP A;  3PNC A;  4FHV A;  4RWP A;  5IIO A;  4LVS A;  4M5D A;  3HW8 A;  5DKW A;  4TUS A;  4I29 A;  4KLO A;  2KK1 A;  3RJE A;  9ICA A;  1K05 A;  5HHI A;  4DOC A;  4FHW A;  4NQF A;  2LK4 A;  4UD5 A;  8ICK A;  4I27 A;  4AT9 B;  1ZQA A;  3LK9 A;  4FHP A;  4KLJ A;  5HRL A;  8ICF A;  3OUY B;  3WFR E;  5HRI A;  7ICR A;  3RQE A;  3WFS C;  3S9O A;  5J0R A;  4RQ1 A;  4M9J A;  4LZG A;  2NRK A;  4MF8 A;  7ICE A;  4S3N A;  4RQ5 A;  3MDC A;  4ATB A;  2PBE A; 
#chains in the Genus database with same CATH topology
 4QZA A;  2FMP A;  3M15 A;  5A6B D;  5K0I A;  3NYM A;  3T9O A;  2JPU A;  4M9H A;  8ICN A;  3V5Z A;  4PFP A;  4AE4 B;  7ICG A;  2EWR A;  2WVO A;  1XWJ A;  2EPK X;  2BCU A;  1YA9 A;  4NXX A;  2H7O A;  9ICW A;  3LS1 A;  3V5X A;  3JZ0 A;  5COF A;  1Q0D A;  1QZX A;  4AT7 B;  1G4W R;  4CDY A;  2DRB A;  7ICH A;  4JVS A;  8ICA A;  4EBK A;  1YLM A;  2J9U A;  2B0J A;  5JUA A;  4X0B A;  1O3U A;  4J7Y A;  3S0X A;  2ZXO A;  3X2Q C;  3C66 A;  3AOU A;  4G0H A;  3S84 A;  2XM4 A;  3EGX A;  4XLP F;  2VB6 A;  1JR8 A;  2NG1 A;  2AU5 A;  2W45 A;  2XL8 A;  4KLT A;  3JYY A;  1QVX A;  4LDQ A;  1XSP A;  4XEK A;  5KYY B;  3U3F A;  3BRJ A;  5J2H A;  2J46 A;  2WVQ A;  2D5R B;  3FOP A;  4NM1 A;  1ZQO A;  2FMQ A;  5A69 A;  9ICC A;  2XRH A;  1OCZ C;  3S27 A;  5J0O A;  4Z6E A;  1LKX A;  3B0U X;  3CZ6 A;  4I2H A;  4U5C E;  4WAB A;  4EP7 A;  4O68 A;  4E8F A;  5JT4 A;  4UBC A;  3AQC A;  3IQT A;  5J2E A;  1OR3 A;  2LCH A;  4YT5 A;  4A2N B;  3V7J A;  3H2V A;  3C2L A;  3S90 A;  2Y39 A;  5DVW A;  4D4N A;  5CR0 A;  1IZM A;  1C03 A;  7ICF A;  3C7J A;  3AU6 A;  3HJC A;  2HJM A;  1OKK D;  4EEB A;  2Q66 A;  1CPQ A;  3NYL A;  1HE9 A;  5A6A A;  4MF2 A;  1M2V B;  3AG4 C;  2BCQ A;  5J2I A;  4PHA A;  1Y4C A;  4MFA A;  1Z7Q c;  3AQK A;  3HNJ A;  4WC3 A;  7ICS A;  4FO6 A;  3VF0 A;  4AT8 A;  8ICM A;  4MVQ A;  1FNT c;  1ZQT A;  4YWQ A;  1G5Z A;  3EJN A;  4C7O B;  1NBB A;  1I4Y A;  4C3B A;  1BR1 A;  2NUP B;  4QZ9 A;  3UQ2 A;  4UAZ A;  4ER9 A;  4RPX A;  2QY9 A;  4P2H A;  1BDJ B;  4IQV A;  2NSF A;  2R7X A;  3DKA A;  1GM5 A;  2J7P D;  4UB4 A;  3JPT A;  4JLZ A;  2ZHA A;  4ULV A;  3QVY A;  4Z9H A;  5BQG A;  2G62 A;  3EFO A;  2ZH9 A;  2FFH A;  1Z63 A;  4IRU A;  4X0R A;  1A41 A;  2OOC A;  2G3K A;  4B6I A;  4JWN A;  2R9R B;  3RJJ A;  4OIN F;  3OVB A;  3ZIB A;  1W2W A;  5IIK A;  3AG2 C;  1APC A;  3JPR A;  4WOY A;  5KYX B;  2ZPA A;  4Z9J A;  3UMH A;  1M56 C;  2RD9 A;  4F4B A;  4BJ1 A;  2KYH A;  3PMR A;  1HUO A;  1M6T A;  4MND A;  4OAG A;  1Q0M A;  3OGU A;  2FCL A;  4NY8 A;  9ICF A;  3DJN B;  4LLC A;  1T9K A;  4U5G A;  4GXI A;  2V3C C;  3JPO A;  5D92 A;  4CJO A;  4RQ0 A;  1JN3 A;  3OVA A;  4ZLC A;  1MMD A;  1YYX A;  1ORJ A;  4WGZ A;  4BEM J;  4I2G A;  1OR2 A;  3OA1 A;  4DVY P;  3FHD A;  3RQG A;  4OIO F;  4JLX A;  2JD3 A;  3MYI A;  2YL7 A;  3K6B A;  2PFD A;  1SYQ A;  3FDQ A;  2Q7R A;  3LNM B;  3AG3 C;  8ICL A;  1Z6A A;  2A68 F;  2GDC A;  3AQL A;  1VLS A;  4OAH A;  5HRG A;  4IG8 A;  2M2V A;  4LDR A;  4PK4 A;  1QQ3 A;  1EQ1 A;  2ZD9 A;  5B1A C;  1KTM A;  5J2B A;  7ICK A;  2YZS A;  3GWN A;  3L1M A;  1T6Q A;  4JCZ A;  1LIH A;  5HRH A;  1VJ7 A;  4X4S A;  1R4T A;  5F28 E;  4JW1 A;  3SYN A;  1ZHW A;  5DB8 A;  3RVY A;  4FHX A;  4WCW A;  1BPD A;  2I15 A;  2W9M A;  5AGF A;  1Z5Z A;  4IAR A;  1RJ9 A;  2Q9B A;  4BG0 A;  4RBN A;  3OV7 A;  2BPG A;  4HE8 D;  3RFY A;  2R05 A;  2O1P A;  4EWC A;  5CA7 A;  3HNL A;  2A6E F;  2PFQ A;  4WQK A;  1AEP A;  4EED A;  9ICH A;  4FH3 A;  1MIV A;  5CJ7 A;  4PGX A;  2HN2 A;  4K9A A;  3NKE A;  2XS1 A;  3EGX B;  3ZQY A;  3UGO A;  3JCU Q;  3M1C B;  3K1H A;  3NMK A;  2Q3T A;  4GQH A;  1D0X A;  5E2Q A;  3JCF A;  1BPX A;  1NOM A;  2AVK A;  3MBY A;  1RMV A;  4O5C A;  1OU5 A;  2YLI A;  2GAF D;  4E17 A;  3ER8 C;  1XSN A;  4QI0 A;  1H7I A;  1VYI A;  2P61 A;  2HJ3 A;  4I2C A;  2XLO A;  8ICJ A;  2WVN A;  2XLW A;  1OCC C;  4EIY A;  3W8H A;  1O5H A;  3T6G B;  5BOL A;  3ER9 B;  4AL1 A;  4QI2 A;  3UNG C;  4NXU A;  4MFC A;  2CYD A;  1ZZP A;  4FES A;  2M2W A;  3EHN A;  3GAN A;  4I2A A;  1MMA A;  4N7R A;  3RVZ A;  4DRI B;  3FVY A;  5DDM A;  4YK5 A;  4RQ2 A;  9ICX A;  5BPC A;  2OU6 A;  1FFT C;  1V54 C;  1VK5 A;  2VH3 A;  3L34 A;  3TK0 A;  3NG1 A;  3AUO A;  7ICJ A;  1XZP A;  5GPG B;  2XXA A;  4UB2 A;  4KLD A;  4O9M A;  4E7Z A;  3RH3 A;  4A4A A;  3E9V A;  2XXA B;  4QZF A;  5KYU A;  5HRE A;  2B0H A;  4D4X A;  2HSQ A;  3EQL F;  3GEI A;  5E3C A;  2OEX A;  1T5O A;  3MX3 A;  4FHV A;  2NUT A;  4EKW A;  4EUK B;  4J32 B;  4N06 A;  4KLO A;  1GGQ A;  5HHI A;  1H9T A;  3CSK A;  4DOC A;  4YL3 A;  4NQF A;  4UD5 A;  2KQ9 A;  3DZA A;  1ZQA A;  2IHO A;  3IQC A;  1S05 A;  2KW3 C;  3WFR E;  4YT4 A;  1U0B B;  3RQE A;  3DM5 A;  3TQO A;  4RQ1 A;  2J8W A;  4M9J A;  2NRK A;  2ZXW C;  4MF8 A;  2ZH3 A;  1HW1 A;  3JSE O;  3EGD A;  4Q5S F;  3NMI A;  1UET A;  1RKE A;  4RQ4 A;  3JYH A;  2L81 A;  3N0T A;  2HZ8 A;  4WC6 A;  4OD4 A;  1TVA A;  3F46 A;  4AX2 A;  2CCY A;  5DBC A;  4YMM A;  4PH5 A;  2EIN C;  4O5E A;  5DB9 A;  4O5K A;  1BPY A;  8ICV A;  1WN0 A;  2IUB A;  5IIJ A;  3HIY A;  3T4R A;  1IW7 F;  4GXJ A;  2W4M A;  1U89 A;  3GM2 A;  4RPZ A;  4NLK A;  2VCC A;  3KKB A;  3RH6 A;  1BPE A;  2I8B A;  9ICL A;  5HRD A;  5B1B C;  4R64 A;  1HMO A;  5DBA A;  1ZQB A;  4MTO A;  4O6A A;  4BJ5 C;  2R03 A;  8ICP A;  4UBB A;  4MVU A;  1GS9 A;  3PCV A;  4E80 A;  4U5F E;  2YL0 A;  4XJE A;  4L6R A;  3KYJ A;  1C17 M;  3VAY A;  1UG7 A;  1TWC A;  1BBH A;  1NO5 A;  2Z15 A;  8ICG A;  3H38 A;  2EIM C;  3C8G A;  4UAY A;  3EZI A;  2YLD A;  3EHM A;  1SR2 A;  3NKD A;  3AQM A;  2PNO A;  4P4M A;  4CX9 A;  1OW8 A;  3W2W A;  3IQ5 A;  2H8A A;  7ICV A;  1ZQG A;  4CS8 A;  2ISP A;  4GYT A;  1NU7 D;  3QW1 A;  8ICX A;  1LM3 B;  5CI8 A;  5T1D B;  3C8G D;  4O67 A;  3GEE A;  3MCR A;  3LS0 A;  2KC3 A;  4I2J A;  1CPR A;  2QUP A;  1MIY A;  5DB6 A;  3LEV A;  4NKT A;  8ICE A;  9ICQ A;  1A7V A;  4YN0 B;  5BOM A;  4XEF A;  4WGY A;  5CP2 A;  5J0Y A;  1MNE A;  4N6C A;  3MGI A;  4P9T A;  3H39 A;  3RJG A;  1YAU O;  3WG7 C;  5DS6 A;  1QPU A;  8ICO A;  5D62 A;  3C18 A;  3JPN A;  2DR5 A;  2HUJ A;  1YZC A;  4I2F A;  3SNH A;  2VCB A;  1KEJ A;  3C2K A;  3AQB A;  2A0U A;  2IYL D;  5CIV A;  5J0W A;  1H9G A;  3QW0 A;  4MVS A;  4RWN A;  1NFO A;  4K98 A;  5J2A A;  3JPP A;  1ZQE A;  4TUR A;  4P4P A;  4OD5 A;  3RJF A;  2KNH A;  4JIO A;  4KLS A;  1E83 A;  3CQZ A;  2HMZ A;  4PGQ A;  4NLN A;  5IIM A;  4QZB A;  3G50 A;  1JMW A;  4G7H F;  1TR2 A;  4PJN A;  1VB5 A;  1RCP A;  5CWR A;  3FXH A;  4RT3 A;  4AK9 A;  4AT7 A;  2P66 A;  2LD6 A;  3S29 A;  3KH2 A;  2VC9 A;  5KYN A;  4WJ0 A;  4CSA A;  2DGJ A;  2XL4 A;  5KYY A;  3ATP A;  3TFR A;  2Q00 A;  1D1A A;  3F47 A;  1XSL A;  4E7X A;  4X4R A;  2IXP A;  3EGD B;  4DVZ A;  1YZA A;  3RJI A;  2A6H F;  3O10 A;  4MW3 A;  5TZV A;  4LER A;  2Y69 C;  4LEV A;  3M4C A;  5J2K A;  2B51 A;  3K75 D;  1ZJM A;  1ZQD A;  4F5N A;  3KL4 A;  2EIJ C;  4YN4 A;  2VAN A;  1L7C A;  2P0N A;  2GFH A;  3ABM C;  3UR3 C;  1A7E A;  2J45 A;  4KC9 A;  4G78 A;  2C03 A;  3U0C A;  3LJB A;  4G7O F;  1LS4 A;  3J06 A;  4KLG A;  2HS5 A;  4LEY A;  4EV6 A;  5DED A;  2AWC A;  1ORS C;  4UD4 A;  4K97 A;  4DRJ B;  2DYS C;  4K0D A;  3V7L A;  5J2J A;  3KMI A;  4K96 A;  2QNL A;  3IEE A;  2FGY A;  4XWJ A;  3JRM O;  2WL8 A;  3NYJ A;  3B0V C;  1FTS A;  3HJ1 A;  8ICR A;  2OQM A;  4JUR I;  1V55 C;  4I3M A;  4QZC A;  2R7T A;  4WH5 A;  7ICM A;  1ZHZ A;  1Q79 A;  3AQN A;  4X0A A;  9ICK A;  3WOD F;  1A0B A;  2LFD A;  2Q9C A;  1V4A A;  4KLQ A;  2YEV A;  3B9Q A;  4M04 A;  3MBG A;  5DQZ A;  3X1O A;  4BJ6 C;  3NWI A;  3WFQ E;  1JQR A;  3JPQ A;  2VAS A;  2HV7 A;  2CDQ A;  1TKN A;  2DYR C;  4YL1 A;  4RQ7 A;  1OCO C;  3N24 A;  2M64 A;  2WZG A;  5B3P A;  2HMQ A;  2R7S A;  4MVZ A;  4NTA A;  3K33 A;  3AG1 C;  3EZH A;  4RT2 A;  2PX0 A;  2OKU A;  4N6H A;  2W4B A;  4KLL A;  3M4B A;  4HFF B;  1ZQX A;  2IBF A;  9ICP A;  3VYW A;  9ICM A;  4ONS A;  4DOZ A;  2BCS A;  1MMG A;  5T3T A;  1G8X A;  4M9G A;  5L0I A;  2YVK A;  1M2O A;  4PHD A;  5COG A;  5TJ5 E;  1VFG A;  3UXN A;  2F22 A;  4C3D A;  3EG9 A;  4I2B A;  3DE9 A;  1T6U A;  4LEW A;  3U8V A;  3OVS A;  1YLQ A;  1YA7 O;  3B0Y A;  5D46 A;  3ISD A;  3FAP B;  3LAY A;  4WC7 A;  1CGM E;  4YCX A;  5CFS A;  3POV A;  3Q7L A;  3IPM O;  3NYB A;  3B29 A;  3SXK A;  1ZQN A;  3TJ6 A;  4QZH A;  4MVO A;  2AP3 A;  1PD0 A;  4M47 A;  4XPW A;  2ZH6 A;  4IJJ A;  5L3V A;  1MMN A;  3JT1 A;  2XSE A;  2HN1 A;  4BJT A;  4LEZ A;  4LVS A;  4M5D A;  2QTV A;  4JZA A;  1K05 A;  4FHW A;  4LLE A;  2LK4 A;  3M79 A;  4AT9 B;  1HE1 A;  4JE9 A;  4KLJ A;  8ICF A;  4J30 B;  1TFO B;  3K66 A;  4HX0 A;  3HLZ A;  3WFS C;  4E0H A;  3TD7 A;  5J0R A;  2ZXP A;  2IOQ A;  3PHZ A;  7ICE A;  4S3N A;  4YD1 A;  1VMA A;  1LI5 A;  4RDA A;  2ZH5 A;  3KYI A;  1ZJN A;  2A1D D;  1VYK A;  3SXZ A;  9ICN A;  5J0U A;  1SF8 A;  3EF2 A;  3HWT A;  1FMW A;  4PJL A;  4RWQ A;  5JLI A;  4M0A A;  3GEH A;  1ZQI A;  4Z9I A;  2NUT B;  5DB7 A;  5J2G A;  1LVK A;  4X4N A;  1WTY A;  1TFW A;  3V7O A;  3NDB B;  5L0J A;  1FAP B;  3HJ4 A;  2YQY A;  4LZD A;  1ZQJ A;  1OXK A;  4TUQ A;  3UMK A;  2E87 A;  5KYX A;  4IB4 A;  4KLU A;  1HY5 A;  3CAX A;  1HMD A;  2BPF A;  1ZQM A;  1TQG A;  2R7U A;  3PML A;  4C3E A;  4JJF A;  5J0S A;  2PFP A;  2OCC C;  5J2C A;  5CFT A;  1E86 A;  4NM2 A;  2DR9 A;  4NY3 A;  5DBB A;  5B3I A;  1ZHY A;  4MTG A;  8ICU A;  9ICS A;  3DMD A;  4X4P A;  3L9D A;  4UAW A;  4F5Q A;  2DVI A;  4RD9 A;  3JSZ A;  1JPN A;  1D0Y A;  4H4K C;  2GAQ A;  4QZG A;  1ZQL A;  4RQ6 A;  3WFO A;  4CDA A;  4NTB A;  1ZQS A;  3ZQV A;  4X4V A;  5HRF A;  4KLM A;  3LNR A;  4U9E A;  1YJG A;  5J0X A;  4NXZ A;  1EI7 A;  4JEA A;  2OJQ A;  4O7G A;  3PDM P;  3EG9 B;  4I0U A;  2HFI A;  3IHU A;  3SEO A;  1FR0 A;  3T6J A;  2GA9 D;  3LLK A;  3UXO A;  1E2X A;  4IGG A;  3RQF A;  1NU9 C;  1ZQZ A;  4CDV A;  5JSL A;  4P4O A;  9ICI A;  1AUE A;  5DDY A;  4QZI A;  1ZQR A;  7ICO A;  2ZH8 A;  4JTC B;  3K1I C;  2YWA A;  4R66 A;  1RPL A;  1YAR O;  2G3V A;  4EBB A;  3ZWI A;  1ZU5 A;  2IXM A;  3TUL A;  4XUS A;  5DLJ A;  3UQ0 A;  4PFO A;  4EGW A;  1OQC A;  3UGP A;  1TWA A;  3KPH A;  3DJU B;  1ZU4 A;  2ASR A;  1R8A A;  5HRK A;  1WWP A;  3RJH A;  1ZQV A;  3VM6 A;  4OIR F;  4U5H A;  4XA5 A;  4JEB A;  2YRF A;  2EPL X;  1S7Z A;  8ICI A;  1GPJ A;  4PR9 A;  5CHG A;  4PHP A;  3CK6 A;  4MQ9 F;  3FMS A;  1TFY A;  2BE5 F;  4Q7C A;  2MWQ A;  3LLI A;  3GOD A;  5L0G A;  5CB1 A;  4H54 A;  9ICB A;  2ZH1 A;  5E3A A;  3ABL C;  4JJG A;  2ID1 A;  1R8C A;  1ZQK A;  4KNV A;  3QTH A;  2WZL A;  5HV9 A;  4I28 A;  2PFO A;  1F5A A;  1YYJ A;  1NG1 A;  2J0X A;  1LPE A;  4GEH A;  3H65 A;  3QMK A;  4AL0 A;  1LE4 A;  2R25 A;  4X4U A;  3N2Z B;  2DR7 A;  2Y3G A;  1UEV A;  3O55 A;  4I44 A;  4O6Y A;  9ICO A;  9ICU A;  2P6V A;  4QZD A;  4F5O A;  2KJG A;  4R63 A;  1DOV A;  2XLE A;  4MW8 A;  2B4V A;  3UPS A;  4XLN F;  2BCV A;  1N1C A;  5JS5 A;  1BPZ A;  2R7V A;  4DOA A;  2Q9A A;  3B71 A;  4Z6F A;  1KNY A;  4EBJ A;  4NKU A;  3LUT B;  8ICB A;  4RPY A;  1KDH A;  4QZ8 A;  2WB7 A;  4OIP F;  2BBH A;  1ZYR F;  1C02 A;  5F5H A;  3GDX A;  4KNW A;  2ETS A;  1MQ2 A;  2B56 A;  3ERC C;  5D91 A;  4UB3 A;  1AVO B;  4DOB A;  4F5R A;  3OUY A;  3C5G A;  3L8J A;  4LDK A;  4JKV A;  3SP1 A;  3SZR A;  9ICE A;  4U5D E;  4G7Z F;  1UEU A;  4NTF A;  4RQ8 A;  1TFK B;  5HHH A;  1WGW A;  2L6F A;  3NMJ A;  1ZQC A;  2GWS A;  2ICW G;  1EA8 A;  1NLX A;  1BPB A;  3T6B A;  5D49 A;  1QSP A;  3HKK A;  5III A;  1OW7 A;  1ZQU A;  2HHP A;  2J9V A;  4DO9 A;  2A69 F;  1OXB A;  2PFN A;  1PV3 A;  4K7B A;  4CS7 A;  1JMS A;  2ZHB A;  4I2D A;  1WAS A;  4C7O A;  5DQT A;  4OIQ F;  3I5P A;  3Q6M A;  4N4W A;  1ZQF A;  2LQG A;  4CIP A;  3B0P A;  4GXK A;  1Q0F A;  1HUZ A;  8ICH A;  4O79 A;  7ICL A;  1ZQW A;  4OAF A;  4DBQ A;  2J9B A;  2V26 A;  3AGU A;  2LP4 A;  4FX5 A;  3C8Z A;  1A7D A;  2QE9 A;  2X51 A;  2NUP A;  3U9J A;  4DJ9 A;  5J0P A;  4JRZ A;  3HTK C;  2NPU A;  1BZ4 A;  2J7P A;  3MYF A;  3ECS A;  4M9N A;  1K04 A;  5CFU A;  5J2F A;  3PMN A;  4JTA B;  1B68 A;  4X4O A;  2KGO A;  4XQ8 A;  4K4G A;  1GQA A;  2Y3D A;  4MFF A;  2I9G A;  2IHM A;  2RFF A;  3U3B A;  4XRH A;  5JRA A;  1CGO A;  4IQT A;  3SXY A;  256B A;  9ICJ A;  3R2P A;  5KYW B;  1ZW2 A;  4QZE A;  4TUP A;  4ANJ A;  4WC0 A;  4NLZ A;  1SZI A;  3U2L A;  4WC4 A;  2XLD A;  4YT8 A;  3H2U A;  4O69 A;  3AGT A;  3ZG1 A;  4NC3 A;  1PD1 A;  2O5A A;  4EHP A;  2OG2 A;  2FAP B;  3I4U A;  4XQ1 A;  4ULW A;  1HW2 A;  1NZE A;  5EGY A;  8ICY A;  4FHY A;  3H3A A;  4ZLD A;  5FZT A;  3ZSU A;  4IAQ A;  3QZC A;  4RQ3 A;  7ICU A;  2ZXR A;  5J0T A;  3TOM A;  4R32 A;  5AC5 A;  4Q4Z F;  3PNC A;  1XZQ A;  4J7T A;  4RWP A;  5IIO A;  4I29 A;  2CNW D;  9ICA A;  4DBR A;  4BPM A;  5KYW A;  3TOL A;  3U5S A;  3LK9 A;  5F5F A;  2R7Q A;  3CEX A;  5B3S C;  4BJ5 A;  5D61 A;  3LEO A;  4UDV A;  2R7R A;  4BEJ A;  4MS2 A;  4LZG A;  4JTD B;  5JVE A;  4JC7 A;  5EK0 A;  5DS4 A;  4RQ5 A;  3MDC A;  2NSG A;  2PBE A;  4P9F A;  4K9B A;  1WOT A;  2BCR A;  1JPJ A;  4YMN A;  1JAF A;  2J0W A;  1R8B A;  1R5I D;  5J29 A;  4O6N A;  4YMO A;  4KI2 A;  4CS9 A;  1VLT A;  4FH5 A;  3ZC4 A;  2PXI A;  4HFK B;  2HKV A;  3B0X A;  3O39 A;  2XLM A;  2HV6 A;  2OEV A;  3HX0 A;  5D63 A;  5J0Q A;  2Y3B A;  2R7W A;  4KLF A;  1UFB A;  3I5Q A;  2DRA A;  1VOM A;  3JTL O;  2BE3 A;  2RSE B;  5L0F A;  3C63 A;  1M57 C;  3C62 A;  1KU2 A;  3ABK C;  1CGN A;  1SMY F;  3W4Y A;  4PPX A;  4IAO A;  2HSB A;  2XL6 A;  1O87 A;  3VRC A;  5BQI A;  3ISB A;  4U5B E;  2YL1 A;  3MFN A;  4LT6 A;  1FFH A;  1FA0 A;  3GWL A;  1PX5 A;  1ZHT A;  3Q7G A;  4WC1 A;  4K4H A;  1Q0K A;  3DD7 A;  2A0B A;  3R7C A;  2CGE A;  4LAC B;  4PGY A;  4K4I A;  5JTG A;  1RJ9 B;  4Z6D A;  7ICQ A;  2W9Y A;  4FO1 A;  2ZH2 A;  4IQW A;  3EFO B;  4XTK A;  4P6I C;  3RYL A;  1LE2 A;  2L6G A;  2LSE A;  5KYU B;  1I5N A;  1G4U S;  1ZQQ A;  3DAG A;  4WBZ A;  4X4T A;  5A6K A;  4W8K A;  1E85 A;  5CHE A;  5A6B A;  9ICV A;  3EPV A;  2EIK C;  4W8P A;  2XLV A;  1YDI A;  1J8M F;  3W8I A;  4O6M A;  4M63 A;  3RF3 A;  4U9D A;  3K7D A;  4AT8 B;  1I4Z A;  4K1O A;  2CW0 F;  2MYS A;  3EH1 A;  4MVR A;  1LS1 A;  2LFF A;  3ZTM A;  3V7K A;  1E84 A;  3DM9 B;  3UPQ A;  2EIL C;  4YJW A;  3GOR A;  1ZQP A;  4IQU A;  4OAI Z;  3GM3 A;  2BPC A;  3AU2 A;  3V5Y A;  5B3Q A;  3L0I A;  4CS9 C;  1WAT A;  1ZVZ A;  4F5P A;  3LES A;  1R89 A;  3DXJ F;  7ICT A;  4KBL A;  2YLG A;  2M2U A;  5DS5 A;  3DAF A;  2R7O A;  1NFN A;  2BC5 A;  3TJ5 A;  3GM1 A;  4NXV A;  3FAJ A;  1J8Y F;  1ST6 A;  5IY5 C;  1LI7 A;  2J9W A;  1RZT A;  1Y6D A;  2O9X A;  8ICS A;  5L3Q A;  3RIP A;  1U6H A;  4XQ7 A;  4JWM A;  3C8G B;  4M9L A;  8ICT A;  4CBE A;  2L9J A;  7ICP A;  1RXQ A;  2XM0 A;  1V74 B;  3WAQ A;  4MKP A;  4YD2 A;  2M2T A;  1VTM P;  2L7A A;  3G4Z A;  3US6 A;  2JX0 A;  4CS8 C;  2PP4 A;  3DE8 A;  3DWW A;  2H7B A;  4DXW A;  2GA0 A;  1Q78 A;  5HC9 A;  4R65 A;  4KB6 A;  1ORY A;  3ASO C;  2CNW A;  4WC2 A;  1OW6 A;  3L8I A;  2ZH7 A;  3NRH A;  4Z6C A;  3NKU A;  4I2E A;  1YVI A;  4M2Y A;  4PJM A;  1TV9 A;  5COM A;  5BUO A;  4WBY A;  2ISO A;  2X0C A;  3ITF A;  2PX3 A;  1MQV A;  5HSW A;  1EKY A;  4PHE A;  1T01 A;  3K1I A;  1ZQY A;  4YL0 A;  5L0H A;  9ICR A;  3JPS A;  5FCL A;  3H37 A;  1DOW A;  4MVM A;  2R02 A;  2AWY A;  8ICQ A;  3TFS A;  3HNK A;  5L0C A;  4I2I A;  3RH5 A;  2LIG A;  4KLI A;  1ZHX A;  2EPO A;  1JRA A;  2XLH A;  3AJM A;  4AT9 A;  4RWO A;  4NXT A;  4NXW A;  2YKZ A;  4YT2 A;  4E7S A;  5AC4 A;  8ICC A;  2VCA A;  4QDL A;  4WC5 A;  5BQH A;  3W2V A;  1OKK A;  4FWV A;  5HR9 A;  3O6X A;  3MGH A;  1D1B A;  2BL2 A;  3FOO A;  3OEO A;  2MHR A;  4JCH A;  2XS8 A;  1MIW A;  4CSA C;  5HRB A;  8ICZ A;  3RKO F;  1BR2 A;  1L3P A;  9ICG A;  1M2V A;  5J2D A;  4AE4 A;  4KLH A;  1D0Z A;  2TMV P;  5L0D A;  4UB1 A;  5IIN A;  5CI9 A;  4E18 A;  1TWH A;  3A11 A;  1K40 A;  2FMS A;  1WOL A;  2ZH4 A;  4K99 A;  4PAC A;  4CJG A;  1FMV A;  1QLE C;  4MTF A;  4KM5 A;  4WQL A;  5F2V O;  4ATB B;  2P1A A;  1Z3I X;  2EPN A;  1Z23 A;  4K8V A;  1NSG B;  3RJK A;  4I1M A;  3E70 C;  4U5E E;  4XEV A;  7ICI A;  2H7V C;  3IQ6 A;  3WHN A;  4X5V A;  5A6J A;  2UUH A;  2QLA A;  1RKE B;  2OJE D;  3G4X A;  1RKC A;  3QVZ A;  3U8P A;  3WFP A;  2DB4 A;  3ISC A;  7ICN A;  4XPX A;  2KSF A;  3C5F A;  1OCR C;  2Q4F A;  2DI3 A;  3DI5 A;  5IIL A;  8ICW A;  4KLE A;  1Q0G A;  1JAJ A;  2DR8 A;  2D4U A;  2P7V A;  2M4E A;  4NCQ A;  3LQC B;  1ZQH A;  2IXN A;  3U9M A;  3V72 A;  1MQ3 A;  4CIH A;  4X4Q A;  9ICT A;  2IM8 A;  2WZF A;  5DEC A;  5JP7 A;  3C2M A;  3HNI A;  2L6H A;  2BBJ A;  4PJJ A;  5T3W A;  3EH2 A;  3MLG A;  3RH4 A;  3BEH A;  4XPY A;  5EOZ A;  3ZDL A;  2PF4 E;  1TWG A;  1H6G A;  2EPM X;  2Y3H A;  4DRH B;  3PHF 2;  3UMI A;  5EHH A;  2YL3 A;  4UB5 A;  1T6I A;  4HEA J;  4BJ6 A;  5D4B A;  3JRT A;  3MDA A;  1JOG A;  3ZTZ A;  3UXP A;  3RW0 A;  3NVO A;  1MND A;  4E0I A;  3HW8 A;  5DKW A;  3OWG A;  4TUS A;  5E33 A;  2KK1 A;  3RJE A;  1QKR A;  3A9C A;  4IWB A;  1D1C A;  4FAP B;  2C04 A;  3ASN C;  8ICK A;  4I27 A;  3Q6N A;  3OWT A;  1ZW3 A;  4FHP A;  4I1O B;  2IXO A;  1PCX A;  5HRL A;  3U2M A;  3OUY B;  3ZVR A;  3SXM A;  5HRI A;  1BR4 A;  7ICR A;  2UUI A;  3S28 A;  2YHS A;  3S9O A;  1F1M A;  2GWW A;  4ATB A; 
#chains in the Genus database with same CATH homology
 4QZA A;  2ZH3 A;  1WOT A;  2ZH5 A;  1ZJN A;  2BCR A;  4YMN A;  2FMP A;  1R8B A;  1UET A;  5J29 A;  4RQ4 A;  9ICN A;  5J0U A;  4YMO A;  2JPU A;  4WC6 A;  4M9H A;  8ICN A;  4FH5 A;  3HWT A;  1TVA A;  2PXI A;  7ICG A;  4RWQ A;  4M0A A;  3B0X A;  5DBC A;  1ZQI A;  2BCU A;  5DB7 A;  5J2G A;  4YMM A;  9ICW A;  3HX0 A;  4X4N A;  1WTY A;  4PH5 A;  1TFW A;  4O5E A;  5DB9 A;  5J0Q A;  4O5K A;  4KLF A;  1UFB A;  1BPY A;  3HJ4 A;  2DRA A;  3JZ0 A;  8ICV A;  4LZD A;  1ZQJ A;  2BE3 A;  4AT7 B;  4TUQ A;  2DRB A;  7ICH A;  8ICA A;  4EBK A;  5IIJ A;  3HIY A;  4X0B A;  1O3U A;  4GXJ A;  4KLU A;  2BPF A;  4PPX A;  2HSB A;  3C66 A;  1ZQM A;  3GM2 A;  4RPZ A;  4NLK A;  3PML A;  3RH6 A;  1BPE A;  3ISB A;  9ICL A;  3MFN A;  5J0S A;  4LT6 A;  2PFP A;  5HRD A;  5J2C A;  4R64 A;  1FA0 A;  5DBA A;  1PX5 A;  1ZQB A;  4KLT A;  3JYY A;  8ICP A;  1QVX A;  4NM2 A;  4WC1 A;  2DR9 A;  1XSP A;  4XEK A;  5DBB A;  4K4H A;  4UBB A;  4E80 A;  3U3F A;  3BRJ A;  5J2H A;  4K4I A;  4PGY A;  8ICU A;  4Z6D A;  9ICS A;  7ICQ A;  4X4P A;  3L9D A;  4UAW A;  1ZQO A;  2FMQ A;  2ZH2 A;  4NM1 A;  4F5Q A;  2DVI A;  4IQW A;  9ICC A;  4QZG A;  1NO5 A;  2L6G A;  1ZQL A;  5J0O A;  8ICG A;  4Z6E A;  4RQ6 A;  3WFO A;  3H38 A;  1ZQQ A;  4X4T A;  4WBZ A;  1ZQS A;  3C8G A;  4UAY A;  4I2H A;  4X4V A;  5HRF A;  4EP7 A;  4E8F A;  4KLM A;  3AQM A;  9ICV A;  5J0X A;  4NXZ A;  4UBC A;  4P4M A;  1OW8 A;  5J2E A;  7ICV A;  1ZQG A;  2ISP A;  3V7J A;  3K7D A;  4AT8 B;  3C2L A;  3UXO A;  3RQF A;  8ICX A;  1ZQZ A;  4P4O A;  5CR0 A;  3V7K A;  3C8G D;  9ICI A;  7ICF A;  3UPQ A;  5DDY A;  3AU6 A;  4QZI A;  4I2J A;  1MIY A;  5DB6 A;  1ZQR A;  4NKT A;  7ICO A;  8ICE A;  2ZH8 A;  1ZQP A;  2Q66 A;  9ICQ A;  2YWA A;  4R66 A;  1RPL A;  5BOM A;  4MF2 A;  4IQU A;  4XEF A;  3GM3 A;  3TUL A;  2BPC A;  2BCQ A;  4XUS A;  5CP2 A;  5J2I A;  3AU2 A;  5J0Y A;  3MGI A;  3UQ0 A;  4PHA A;  4F5P A;  1R89 A;  3H39 A;  4MFA A;  3RJG A;  7ICT A;  2M2U A;  7ICS A;  3AQK A;  4WC3 A;  1R8A A;  5HRK A;  1WWP A;  4FO6 A;  3GM1 A;  3RJH A;  1ZQV A;  4AT8 A;  8ICM A;  8ICO A;  1ZQT A;  4XA5 A;  1RZT A;  3C18 A;  3JPN A;  2DR5 A;  4QZ9 A;  3UQ2 A;  8ICS A;  4UAZ A;  8ICI A;  4I2F A;  4XQ7 A;  4RPX A;  5CHG A;  4PHP A;  4JWM A;  4P2H A;  3C8G B;  1KEJ A;  4IQV A;  3C2K A;  4M9L A;  1TFY A;  8ICT A;  5J0W A;  7ICP A;  4UB4 A;  3JPT A;  4RWN A;  5CB1 A;  5J2A A;  3JPP A;  4YD2 A;  2M2T A;  1ZQE A;  9ICB A;  4TUR A;  2ZHA A;  4P4P A;  2ZH1 A;  2JX0 A;  2ZH9 A;  3RJF A;  2ID1 A;  1R8C A;  4KLS A;  1ZQK A;  4PGQ A;  4NLN A;  1Q78 A;  5IIM A;  4QZB A;  4I28 A;  5HC9 A;  4JWN A;  3RJJ A;  2PFO A;  1F5A A;  3OVB A;  4R65 A;  5IIK A;  5CWR A;  3JPR A;  4RT3 A;  4WC2 A;  4AT7 A;  2P66 A;  1OW6 A;  3L8I A;  2ZH7 A;  4X4U A;  4Z6C A;  4I2E A;  4M2Y A;  1TV9 A;  2DR7 A;  1UEV A;  9ICO A;  9ICU A;  4WBY A;  1HUO A;  4QZD A;  4F5O A;  3OGU A;  4NY8 A;  4R63 A;  9ICF A;  2ISO A;  3TFR A;  2Q00 A;  3UPS A;  4GXI A;  1XSL A;  4PHE A;  3JPO A;  2BCV A;  4RQ0 A;  1ZQY A;  4E7X A;  1JN3 A;  4X4R A;  1BPZ A;  9ICR A;  3JPS A;  3OVA A;  3H37 A;  4DOA A;  3B71 A;  3RJI A;  4I2G A;  4Z6F A;  3O10 A;  1KNY A;  4EBJ A;  4NKU A;  3RQG A;  5TZV A;  8ICB A;  4RPY A;  1KDH A;  4QZ8 A;  3TFS A;  8ICQ A;  4I2I A;  3RH5 A;  3GDX A;  5J2K A;  3K75 D;  4KLI A;  1ZJM A;  8ICL A;  1MQ2 A;  4YD1 A;  1ZQD A;  4F5N A;  3AQL A;  4YN4 A;  2VAN A;  4UB3 A;  5HRG A;  4DOB A;  4IG8 A;  3AJM A;  4AT9 A;  2M2V A;  4F5R A;  3OUY A;  3C5G A;  4RWO A;  3L8J A;  3U0C A;  1KTM A;  9ICE A;  5J2B A;  7ICK A;  1UEU A;  4RQ8 A;  4KLG A;  5HHH A;  8ICC A;  2L6F A;  5DED A;  1ZQC A;  2GWS A;  5HRH A;  4WC5 A;  1VJ7 A;  4X4S A;  1BPB A;  4UD4 A;  5F28 E;  5D49 A;  5HR9 A;  3MGH A;  5DB8 A;  5J2J A;  3V7L A;  4FHX A;  5III A;  1OW7 A;  1MIW A;  4WCW A;  1BPD A;  1ZQU A;  2HHP A;  5HRB A;  4DO9 A;  8ICZ A;  2W9M A;  3HJ1 A;  8ICR A;  2PFN A;  1PV3 A;  1JMS A;  2ZHB A;  3OV7 A;  9ICG A;  4I2D A;  2BPG A;  5J2D A;  4QZC A;  2O1P A;  4KLH A;  1ZQF A;  5CA7 A;  4UB1 A;  5IIN A;  7ICM A;  2PFQ A;  1K40 A;  1Q79 A;  4GXK A;  2FMS A;  3AQN A;  9ICH A;  1WOL A;  4FH3 A;  4X0A A;  1HUZ A;  2ZH4 A;  9ICK A;  1MIV A;  5CJ7 A;  8ICH A;  1ZQW A;  7ICL A;  4PGX A;  1V4A A;  4KLQ A;  5F2V O;  4ATB B;  4M04 A;  3RJK A;  5J0P A;  3WFQ E;  1JQR A;  4XEV A;  3JPQ A;  7ICI A;  1BPX A;  1NOM A;  4X5V A;  3MBY A;  4RQ7 A;  4O5C A;  1OU5 A;  4M9N A;  1K04 A;  3WFP A;  7ICN A;  5J2F A;  3ISC A;  3PMN A;  1XSN A;  4X4O A;  3C5F A;  4I2C A;  4XQ8 A;  4RT2 A;  5IIL A;  8ICJ A;  8ICW A;  4K4G A;  4KLL A;  4KLE A;  1JAJ A;  2DR8 A;  4MFF A;  1ZQX A;  5BOL A;  2I9G A;  2IHM A;  2RFF A;  3LQC B;  1ZQH A;  9ICP A;  4XRH A;  9ICM A;  4MFC A;  3V72 A;  1MQ3 A;  1ZZP A;  2BCS A;  4X4Q A;  9ICT A;  4M9G A;  2M2W A;  5DEC A;  4IQT A;  4PHD A;  9ICJ A;  4I2A A;  3C2M A;  4TUP A;  4QZE A;  1VFG A;  3UXN A;  2L6H A;  4WC0 A;  4NLZ A;  4I2B A;  4WC4 A;  3OVS A;  1YLQ A;  3RH4 A;  3B0Y A;  5D46 A;  3ISD A;  5DDM A;  5EOZ A;  4RQ2 A;  9ICX A;  4WC7 A;  5BPC A;  4YCX A;  2O5A A;  3AUO A;  7ICJ A;  3NYB A;  8ICY A;  1ZQN A;  4UB2 A;  4KLD A;  4FHY A;  3H3A A;  4O9M A;  4QZH A;  4UB5 A;  4RQ3 A;  7ICU A;  4M47 A;  4QZF A;  2ZH6 A;  5HRE A;  5D4B A;  5J0T A;  3MDA A;  1JOG A;  4R32 A;  3UXP A;  3PNC A;  4FHV A;  4RWP A;  5IIO A;  4LVS A;  4M5D A;  3HW8 A;  5DKW A;  4TUS A;  4I29 A;  4KLO A;  2KK1 A;  3RJE A;  9ICA A;  1K05 A;  5HHI A;  4DOC A;  4FHW A;  4NQF A;  2LK4 A;  4UD5 A;  8ICK A;  4I27 A;  4AT9 B;  1ZQA A;  3LK9 A;  4FHP A;  4KLJ A;  5HRL A;  8ICF A;  3OUY B;  3WFR E;  5HRI A;  7ICR A;  3RQE A;  3WFS C;  3S9O A;  5J0R A;  4RQ1 A;  4M9J A;  4LZG A;  2NRK A;  4MF8 A;  7ICE A;  4S3N A;  4RQ5 A;  3MDC A;  4ATB A;  2PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...