2PBEA

Crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
263
Chain Sequence
b'LRSEQEMMDIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-adenylyltransferase
publication title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 82
structure length 263
sequence length 282
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2pbeA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2pbeA01
2L6GA 4KLHA 4RQ8A 3OVSA 1ZJNA 3TULA 4NLKA 4TUSA 3JPSA 4EP7A 2FMSA 2ZH5A 3HIYA 5J0TA 4NLNA 4X0AA 1ZQBA 4LVSA 4NXZA 5J2GA 1RZTA 4KLQA 4JWMA 4R64A 4E7XA 5J0XA 5DB6A 3C2MA 3RQGA 3S9OA 2NRKA 4NM2A 4Z6CA 4YMOA 5DBCA 4E80A 3GM2A 5HRHA 4X4QA 3UPQA 4MF2A 1NO5A 4ATBA 5J2IA 4XEKA 3HX0A 7ICGA 4X4VA 7ICPA 5J2JA 8ICWA 4FH5A 4FHPA 8ICJA 4QZIA 2I9GA 2DRBA 1RPLA 4I2GA 4WC0A 5DBBA 5IIMA 4X4RA 4X4PA 3RJHA 7ICIA 4P4OA 1ZQEA 4KLSA 5J2HA 4XRHA 2PFNA 8ICAA 4R66A 1FA0A 4YD2A 2BPFA 8ICHA 5DB9A 1ZQMA 4FHVA 4E8FA 1TFYA 4TURA 4MFFA 3AQKA 9ICBA 1XSPA 2ISPA 7ICEA 2BCQA 9ICLA 8ICVA 3GM1A 9ICFA 1ZQYA 1ZQLA 3AJMA 4WC7A 4UB5A 9ICQA 2JX0A 1BPEA 4RQ3A 4RWOA 1ZQZA 5IIOA 3V72A 5DKWA 4DOBA 5J0QA 2DR9A 3RJGA 9ICJA 1MQ3A 5IIJA 3GDXA 1JOGA 4AT7B 4I29A 2LK4A 1UETA 1VFGA 1KDHA 7ICTA 4DO9A 3LQCB 3C8GA 4AT9B 1JAJA 5HRKA 3GM3A 1R89A 4UD4A 4WCWA 5D49A 2ZH9A 1ZJMA 8ICQA 8ICNA 3C5GA 7ICMA 5J0RA 4R63A 4NQFA 4P4PA 3MDCA 4RQ7A 3TFRA 3RJEA 4NKUA 7ICHA 3HJ4A 1WTYA 3U0CA 3ISBA 4GXJA 1ZQVA 4X4NA 4KLDA 1BPZA 1ZQGA 5HRLA 4I2IA 5J29A 9ICVA 9ICOA 4PHAA 5F28E 2ZH1A 4X5VA 8ICXA 3JZ0A 1BPDA 4FHWA 4AT7A 3JPQA 1HUZA 3MFNA 3H3AA 4X4TA 2ZH7A 3HW8A 2L6FA 5CB1A 4UB3A 5HRDA 2DRAA 4WC5A 4DOCA 3RQFA 5D4BA 9ICEA 3JPPA 2VANA 4F5OA 9ICNA 4NM1A 4KLTA 2BPCA 4QZDA 4ATBB 4XEFA 4LT6A 3UXOA 4YCXA 4RT2A 2ID1A 4RWQA 4X4OA 7ICJA 1UFBA 5DDYA 4O9MA 2L6HA 4YMMA 5IINA 4KLUA 8ICBA 9ICWA 4RQ6A 5HR9A 9ICRA 1V4AA 2JPUA 1ZQRA 3UQ0A 2Q00A 1OW8A 1F5AA 4M9HA 4YMNA 5J2BA 4YD1A 7ICKA 9ICAA 4EBJA 4P4MA 4RPYA 3WFSC 1ZQDA 3JPTA 4MF8A 4NY8A 1TFWA 1R8AA 1JN3A 4DOAA 2RFFA 4F5PA 3OUYA 4RQ0A 5BOLA 9ICSA 3AQNA 4QZFA 4UB1A 5J2KA 3H37A 4M47A 8ICEA 4EBKA 4I2HA 7ICQA 3MGHA 4TUQA 1ZQFA 1VJ7A 1K40A 8ICGA 3C8GB 4F5NA 3ISCA 9ICMA 3RJKA 1PV3A 3JPNA 5BOMA 3AQMA 4UB2A 1WOLA 3B71A 3V7KA 4GXIA 2BCSA 2HSBA 2M2WA 2ZH4A 4M9LA 4KLLA 2BPGA 4X0BA 9ICUA 3AU6A 4TUPA 3B0YA 8ICCA 5HHIA 2M2TA 2PFOA 5J2FA 1OW7A 1Q79A 7ICRA 5D46A 8ICYA 3C2KA 3RQEA 4FO6A 5IILA 4QZGA 2O5AA 4FH3A 5DB7A 8ICMA 5J2DA 4LZDA 4I2BA 4MFAA 4KLMA 3PMNA 2YWAA 4NKTA 1UEVA 4M0AA 3OVBA 4QZCA 5TZVA 8ICFA 4WC3A 1ZQCA 4K4HA 5J0WA 4M04A 4RQ4A 4QZEA 1R8CA 9ICIA 5DEDA 8ICOA 5HRFA 4QZ9A 4QZ8A 2ISOA 9ICHA 4IQVA 9ICGA 2DR7A 7ICUA 2P66A 4IQTA 1ZQIA 3MBYA 1ZQQA 4R32A 5DDMA 4UD5A 1JMSA 2BCUA 3AUOA 9ICCA 3U3FA 4PHPA 4IG8A 9ICPA 3RJFA 2ZH8A 4MFCA 8ICRA 3H39A 5HRIA 4K4GA 4I28A 4PGQA 4LZGA 2DR5A 3PNCA 4F5QA 3NYBA 4R65A 1O3UA 3WFQE 3C18A 4Z6EA 5CHGA 4M9GA 4UAYA 8ICUA 4RQ2A 4UB4A 3OUYB 3RH6A 5J2EA 4QZBA 8ICPA 5J0OA 5HC9A 4WC6A 2FMQA 1XSLA 1ZQWA 3MGIA 2PXIA 2FMPA 1Q78A 5CP2A 5HREA 1BPYA 4KLFA 1ZQXA 4O5KA 3OVAA 4RWNA 4S3NA 7ICLA 3O10A 8ICTA 4M9JA 1UEUA 4UAWA 1TV9A 4I2AA 4RT3A 3UXNA 4X4UA 5CR0A 4PHEA 3TFSA 3AU2A 2PBEA 3HWTA 4JWNA 2BE3A 2PFPA 4WBZA 5J0SA 2KK1A 4AT8A 4PGXA 4FHXA 4KLEA 4QZHA 4UAZA 4WC4A 2ZH6A 4RPZA 2HHPA 2ZH2A 3WFRE 4XUSA 4I2FA 4PHDA 5J0UA 3MDAA 1WWPA 1R8BA 4UBCA 3RH4A 4FHYA 3B0XA 5J0YA 2W9MA 2GWSA 4I27A 2ZHAA 7ICNA 1BPBA 1KTMA 5CWRA 3RH5A 4YN4A 3RJIA 1NOMA 4XEVA 4O5CA 4Z6FA 2O1PA 5J2CA 4PH5A 3RJJA 1HUOA 2PFQA 4RQ5A 4M9NA 5HRBA 7ICSA 4M5DA 3H38A 4F5RA 4IQWA 4P2HA 4PPXA 4I2DA 5IIIA 4XQ7A 3UPSA 4XQ8A 4IQUA 4GXKA 1ZQPA 4M2YA 1ZQJA 8ICZA 4O5EA 3V7LA 1ZQUA 5J0PA 1WOTA 5CA7A 4NLZA 2DR8A 3C2LA 1XSNA 2Q66A 5J2AA 1ZQNA 1MIWA 4KLOA 2BCRA 1ZQOA 3K7DA 3ISDA 4WBYA 3WFPA 1JQRA 4UBBA 3OV7A 1ZZPA 2M2UA 5DB8A 1MIYA 7ICFA 3BRJA 4X4SA 1ZQKA 4RWPA 3C66A 1K05A 4QZAA 3OGUA 7ICOA 3L8IA 1ZQAA 1K04A 3HJ1A 3L8JA 1MIVA 2ZHBA 4KLGA 1PX5A 4WC1A 3UXPA 8ICKA 4Z6DA 1QVXA 5HHHA 3K75D 5F2VO 5DECA 5DBAA 3UQ2A 8ICSA 2ZH3A 7ICVA 8ICIA 1MQ2A 1OU5A 3LK9A 3V7JA 3AQLA 5BPCA 9ICKA 9ICTA 4AT8B 4I2JA 8ICLA 2M2VA 4XA5A 2IHMA 4I2EA 1ZQSA 1KEJA 1YLQA 3JPOA 1TVAA 5EOZA 4KLIA 1ZQHA 4WC2A 4KLJA 3JPRA 2BCVA 3L9DA 1ZQTA 1KNYA 5HRGA 9ICXA 4AT9A 3PMLA 4RQ1A 5CJ7A 1BPXA 3C8GD 3JYYA 4K4IA 4PGYA 3WFOA 1OW6A 4RPXA 4I2CA 2DVIA 3C5FA 5IIKA
chains in the Genus database with same CATH superfamily
1MMDA 2L6GA 2VCCA 2HUJA 3OVSA 3MX3A 3HJCA 3UGPA 4NLKA 2IXPA 4EP7A 3I4UA 5J0TA 3CAXA 2IXOA 3L0IA 4X0AA 2R7SA 4LVSA 4MW8A 2LFDA 4R64A 2Q3TA 2R7WA 5T1DB 2DYSC 4ZLDA 2NRKA 3DKAA 3MYIA 3SXYA 3GM2A 2B0HA 4ATBA 2XXAB 4AE4B 1YJGA 5A6AA 3GWLA 3E9VA 3EHMA 2H7OA 2Q9BA 4FH5A 4FHPA 2EIJC 3TK0A 5IIMA 4GYTA 2KJGA 3DMDA 1GGQA 2FCLA 2PFNA 4R66A 2R7VA 4BJTA 3DXJF 1ZQMA 1QZXA 2QE9A 3AQKA 2VH3A 4EEDA 1MNEA 1J8MF 3AJMA 9ICQA 4YT5A 2JX0A 4RQ3A 2E87A 9ICJA 3EGDA 3K1HA 2I15A 5CFUA 5DKWA 1MQ3A 5IIJA 3M4CA 4YL0A 3EPVA 3A11A 1ZU4A 1KDHA 3LQCB 4AT9B 1JAJA 4U5EE 3GM3A 2A1DD 1R89A 4UD4A 1UG7A 1ZJMA 3C5GA 7ICMA 2GDCA 3MDCA 3GORA 5B3QA 3RJEA 2J9UA 7ICHA 4EBBA 3HJ4A 3U0CA 3ISBA 3DE8A 1VLTA 4D4XA 1AUEA 1ZQGA 4I2IA 9ICVA 4N7RA 5F28E 3VRCA 2ZH1A 8ICXA 3ASOC 4AT7A 2HV6A 2Y3HA 1HMDA 5B1BC 2ZH7A 1CPRA 2AWCA 4WC5A 4DOCA 1VLSA 3RQFA 2Q9AA 1FR0A 3QW0A 4KLTA 1LE2A 4QZDA 4XEFA 3LEVA 4LEYA 4RWQA 2KNHA 2WZLA 4CS8A 1JAFA 1H9TA 1LI7A 1QLEC 5IINA 4KLUA 8ICBA 5F5HA 3M4BA 1LS4A 9ICRA 3L34A 1ZQRA 4AL0A 2Q00A 4Q7CA 2H7BA 4M9HA 3EG9A 4EEBA 2XLOA 4YD1A 9ICAA 1Z23A 4NTBA 3JPTA 4NY8A 3KYJA 1EI7A 1RKCA 4DOAA 2DGJA 5BOLA 3ATPA 3AQNA 4MTOA 2R25A 4WABA 4UB1A 5J2KA 3H37A 4EBKA 4I2HA 4O69A 2WVNA 4TUQA 2AWYA 3ZC4A 3U3BA 1VJ7A 2HN1A 8ICGA 3ISCA 4DRHB 1EQ1A 3JPNA 4UB2A 2WB7A 5AC5A 4GXIA 4K98A 4OD5A 2BPGA 3IQCA 2OQMA 3RW0A 8ICCA 2IXMA 1ZHWA 5HHIA 5D91A 5J2FA 1OW7A 7ICRA 3MYFA 3RQEA 2GFHA 4FO6A 3NMIA 2W4MA 2R7RA 1JPNA 8ICMA 4NXXA 4I2BA 4KLMA 4HX0A 1YZCA 4QZCA 5TZVA 4Q5SF 1V55C 2J8WA 4K4HA 4K99A 2MWQA 4U9DA 5HRFA 9ICHA 2P1AA 4IQVA 3EFOA 2BBHA 5L0DA 3L1MA 3DE9A 4IQTA 3BEHA 1AVOB 3V7OA 5B3PA 4YJWA 4R32A 1OCOC 1FMVA 4UD5A 5CFSA 2PFDA 4C3EA 3EQLF 2BCUA 2QTVA 1C17M 3RJFA 2ZH8A 2YL1A 4J30B 3ZQYA 2DR5A 5JSLA 4BJ1A 2BBJA 5CHGA 4K8VA 1M6TA 3OUYB 2J46A 2MHRA 4LACB 2R9RB 1A7EA 1LI5A 4IAQA 5J0OA 5HC9A 1Q0GA 4AK9A 3EGXB 1XSLA 3MGIA 1ZHXA 3NYLA 4CSAC 1V54C 1Q78A 4KLFA 4O5KA 4RWNA 3GODA 4M9JA 2J7PA 4PHEA 2L9JA 4JTDB 4IJJA 4JLXA 2PBEA 3HWTA 4JWNA 2HMZA 3RVYA 4FWVA 4ZLCA 5K0IA 4KLEA 1S7ZA 4RPZA 2HHPA 5JP7A 1NFOA 2A68F 4PHDA 1Q0MA 4G78A 2HFIA 1PD1A 2W9MA 2GWSA 1SMYF 2ZHAA 5COGA 5BUOA 1BPBA 1KTMA 1IW7F 3RH5A 3RJIA 4PJLA 1OR2A 1ST6A 5J2CA 3DM9B 2PFQA 4RQ5A 1HW1A 4F5RA 3FOOA 4P2HA 4I2DA 1T6UA 4M2YA 1YA7O 8ICZA 3ABKC 3US6A 4O67A 4JC7A 4K1OA 1GS9A 1TKNA 2X0CA 2AVKA 3WFPA 1ZZPA 3C8ZA 4CJOA 5DS5A 2XXAA 4JZAA 4AE4A 3C66A 1G8XA 2OKUA 4GEHA 3G4ZA 4QZAA 3L8IA 3DJUB 4Z9IA 2P61A 5EK0A 3R2PA 5KYXA 4IAOA 3PHZA 3UXPA 3N2ZB 3RF3A 2YHSA 1JMWA 5DBAA 3LNMB 4QI2A 1T01A 1YA9A 1HMOA 3LK9A 1OKKD 4IB4A 4J32B 2L7AA 3V7JA 3AQLA 2YKZA 4FESA 3MBGA 4I2JA 8ICLA 2IHMA 4I2EA 4O6MA 1TVAA 4MS2A 4WC2A 1S05A 2OG2A 2BCVA 1H7IA 9ICXA 4AT9A 1R5ID 1LE4A 1BR2A 2OJQA 5CJ7A 4WGYA 5EHHA 3O6XA 2YLDA 2TMVP 2C03A 4K4IA 3C5FA 3HIYA 4CIHA 1D1BA 4KLHA 2XL4A 1VYKA 3DM5A 1CGNA 3UMKA 3WAQA 3IQ5A 3SZRA 1J8YF 2PX3A 2XLDA 2VCAA 3JYHA 1ZQBA 3ER9B 2ICWG 4U5BE 4B6IA 2B56A 3S9OA 4NM2A 2CNWA 4K97A 5DBCA 2YEVA 4E80A 3UPQA 3CZ6A 1NO5A 2WZGA 3AOUA 4LERA 2IYLD 3HX0A 2VB6A 5J2JA 1R4TA 5B3IA 7ICPA 1RKEB 4EGWA 5L0JA 2I9GA 4O6NA 4DOZA 5CI9A 2ZXPA 4WC0A 2HV7A 4DVZA 4P4OA 2OEXA 1A0BA 4H54A 3R7CA 1VK5A 4E8FA 4TURA 4MFFA 2YLGA 2ISPA 1C02A 1T6QA 2BCQA 4MVMA 9ICFA 4WC7A 1M2OA 4W8PA 3RJGA 3V72A 5J0QA 3KKBA 4UDVA 1JOGA 2LK4A 1UETA 5B3SC 2HJMA 1LIHA 4DO9A 4JEAA 5HRKA 3B9QA 8ICNA 1PCXA 4HE8D 5J0RA 4R63A 2J0XA 4NQFA 4CS9A 4F4BA 1PD0A 3S27A 3V5XA 4GXJA 4EIYA 1APCA 4KLDA 2WVQA 4O6AA 9ICOA 1D1AA 4X5VA 1WGWA 1Y4CA 3JZ0A 1BPDA 3QMKA 3JPQA 4A4AA 2W9YA 2ZXOA 4WGZA 5DLJA 4X4TA 1HE9A 2L6FA 3QW1A 5HRDA 2DRAA 5D4BA 9ICEA 2VANA 4F5OA 4NM1A 2BPCA 2KW3C 4KBLA 4M63A 4RT2A 4X4OA 4JCZA 3QTHA 3NYJA 2L6HA 4O9MA 4QI0A 4YT8A 1DOWA 5KYYB 3C63A 2I8BA 3ERCC 9ICWA 4RQ6A 3ASNC 1EA8A 1Q0FA 2IUBA 4I44A 1U0BB 2WL8A 2Y3DA 4E17A 3M15A 4P4MA 3Q7LA 5DS6A 1ZQDA 2DI3A 3W4YA 3MCRA 1FFHA 2WVOA 3H65A 2Q7RA 4MVRA 5JVEA 4F5PA 1GQAA 3NWIA 3OUYA 2LIGA 5A6JA 1XZPA 4JJFA 3K6BA 3ZDLA 3H2UA 3EGXA 1WASA 3OEOA 7ICQA 1RCPA 4F5NA 5COMA 9ICMA 1PV3A 3TD7A 3JTLO 2A0BA 3B71A 3VF0A 4G7HF 3G50A 2ZH4A 1TR2A 4DBRA 1ZW2A 3B0YA 3ABLC 2M2TA 1Z7Qc 2A69F 1TQGA 4K7BA 5JS5A 2M4EA 1JPJA 5FCLA 1M2VB 5GPGB 4KM5A 2HN2A 3B0PA 1VYIA 2X51A 1RJ9B 3SP1A 2YWAA 4E7SA 4NKTA 1G5ZA 1YLMA 4YWQA 4M04A 1TWAA 1R8CA 5KYUA 8ICOA 1TFOB 2ISOA 1OCRC 9ICGA 3U8PA 1G4US 3OA1A 1MMAA 4NTAA 5HSWA 4KNVA 3CQZA 2KGOA 2GA0A 4JLZA 1JMSA 1OR3A 4LEZA 4J7YA 2EIKC 4G7ZF 3U3FA 4PHPA 4IG8A 8ICRA 3FAJA 4K4GA 1AEPA 4PJNA 4I28A 4Z9JA 4XLNF 4F5QA 2M64A 4R65A 1O3UA 3LLKA 4M9GA 3O39A 4RQ2A 4UB4A 2XL6A 4IWBA 5J2EA 4QZBA 8ICPA 3T6BA 3I5QA 4PJJA 5HREA 1BPYA 3OVAA 2YLIA 1HE1A 3O10A 2CGEA 5CIVA 5E33A 1TV9A 4IGGA 3K1IA 2F22A 4RT3A 3OWTA 1QKRA 4CS8C 3KH2A 1QPUA 3H2VA 2VC9A 4QZHA 1MQVA 3NMKA 2R02A 2ZH6A 5BQIA 1G4WR 2ZH2A 4XUSA 4ONSA 5J0UA 4UBCA 2L81A 2EPLX 1FTSA 1DOVA 4YN0B 7ICNA 5BQGA 4WQLA 5CWRA 1NOMA 2ZPAA 4OIRF 3VAYA 2XLEA 4PH5A 1VB5A 3NMJA 1NZEA 4L6RA 4IQWA 4PPXA 5IIIA 4XQ7A 3UPSA 4XQ8A 4GXKA 1H9GA 1ZQJA 3HKKA 4NLZA 1XSNA 2Q66A 4DRJB 5J2AA 3NKEA 1ZQOA 4LLEA 4UBBA 2WZFA 2YQYA 7ICFA 1D0YA 2CNWD 4BJ5A 1ZQKA 5T3WA 1YZAA 1ORSC 4RWPA 1RKEA 1YARO 1NBBA 2R7TA 3A9CA 3OGUA 7ICOA 4MVZA 4MVSA 4C3DA 3L8JA 1MIVA 1PX5A 4U5HA 2EINC 3ZTZA 5L0FA 2QY9A 3S29A 5F2VO 4DVYP 7ICVA 8ICIA 3T6GB 5D62A 3WHNA 9ICKA 4BG0A 5E3AA 4AT8B 2M2VA 4XA5A 2VASA 1LVKA 3GEIA 3JPOA 3RH3A 3X1OA 3W2VA 4N6HA 1RXQA 4KNWA 3W8HA 1ZHYA 3F47A 4CSAA 3AGTA 3PMLA 4RQ1A 1SR2A 5CI8A 5F5FA 2JD3A 3JYYA 1OW6A 2EIMC 2XL8A 4P9FA 5IIKA 4K9BA 4FAPB 3CK6A 4RQ8A 1ZJNA 3TULA 3ZSUA 1B68A 4TUSA 3JPSA 2FMSA 5A6KA 2ZH5A 2QUPA 4NLNA 3FMSA 1ZW3A 4ULVA 3UMHA 4KLQA 3UGOA 4E7XA 5J0XA 3RQGA 1VMAA 3W2WA 4X4QA 4MF2A 1ZHTA 2XM0A 4XEKA 5E2QA 2YL7A 4JIOA 7ICGA 8ICWA 3EHNA 4JTAB 4FX5A 5D92A 1YAUO 4QZIA 5KYYA 2HMQA 2YL0A 4I2GA 4X4RA 2IBFA 3NDBB 4X4PA 2HKVA 3RJHA 3RFYA 1ZQEA 8ICAA 3S0XA 3NRHA 3W8IA 1FA0A 4YD2A 8ICHA 5DB9A 4WJ0A 5DQZA 4FHVA 4BEMJ 3ITFA 4IARA 9ICBA 1MNDA 2D5RB 1YYJA 1XSPA 8ICVA 1ZQYA 2ZXRA 4RWOA 5IIOA 1ZQZA 1WN0A 1NFNA 4I29A 4AT7B 5D61A 1VFGA 3FXHA 4MTGA 1YVIA 3C7JA 5FZTA 4WCWA 1N1CA 4MVOA 5D49A 8ICQA 4D4NA 1E84A 4X0RA 5DVWA 4Z9HA 2YRFA 4KB6A 1Z63A 1TWCA 2XM4A 4OAHA 4NTFA 4NKUA 4OAIZ 4KC9A 4YL3A 2OEVA 1BPZA 1WATA 1BBHA 5HRLA 4I1OB 1M2VA 5JLIA 5DQTA 3VYWA 3N0TA 2MYSA 1L3PA 1HUZA 3MFNA 1RJ9A 1TFKB 3PHF2 3HW8A 3ZQVA 5CB1A 2QNLA 4UB3A 4EUKB 2PX0A 4N6CA 9ICNA 2XLMA 3UXOA 4YCXA 4PK4A 3EH1A 1UFBA 5DDYA 3WODF 4YMMA 2IOQA 4MKPA 2NSFA 2XLVA 4JEBA 3JSEO 2FAPB 5HR9A 5E3CA 2RD9A 4PR9A 4C7OB 3VM6A 1F5AA 2Y69C 1E86A 2NUPB 3ER8C 3WFSC 1T6IA 5A6BA 4MF8A 3JSZA 4PACA 2J45A 1JN3A 4O6YA 4RQ0A 9ICSA 1F1MA 2J9BA 3ZTMA 3MGHA 3ABMC 4YL1A 4AX2A 3C8GB 4E0HA 1A7DA 3RJKA 4HEAJ 2Q4FA 3G4XA 4I1MA 4CS7A 3AQMA 1WOLA 4Q4ZF 2BE5F 2XS8A 3V7KA 2HSBA 1U6HA 4M9LA 3PDMP 4KLLA 1YYXA 2CCYA 3AG4C 4TUPA 4YT2A 4BEJA 4CIPA 4XQ1A 4GQHA 1QQ3A 4EV6A 1Q79A 4I3MA 8ICYA 1CGME 1T9KA 4XWJA 4QDLA 5L0HA 5JT4A 2O5AA 4FH3A 3QVYA 2EWRA 5J2DA 2ASRA 2KSFA 4MFAA 4HFKB 3JRTA 4WC3A 1ZQCA 4O79A 1OXKA 3CSKA 4BJ6C 4QZEA 4C3BA 2NUTB 5DEDA 1U89A 2P6VA 4QZ9A 4QZ8A 4WH5A 4E0IA 3CEXA 4JURI 1I5NA 5CHEA 7ICUA 5EGYA 3Q7GA 2P66A 1ZQIA 1V74B 4JRZA 1ZQQA 1FNTc 5DDMA 1MMNA 3U9JA 4CJGA 1A7VA 9ICPA 2IM8A 4MFCA 2LP4A 3H39A 3C62A 5HRIA 3KYIA 4LZGA 1LS1A 1CPQA 4CS9C 2EPKX 1NSGB 2R7QA 1EKYA 1XZQA 3NYBA 3LJBA 2HSQA 3N24A 3WFQE 8ICUA 4UAYA 3OWGA 3RH6A 3HNLA 4U5CE 3WG7C 3SXKA 2R7XA 4PJMA 1YDIA 4WC6A 2DB4A 3V5YA 3Q6NA 2FMPA 2Y3BA 1ZQXA 4S3NA 2P7VA 8ICTA 3NYMA 4NY3A 4DJ9A 4MVQA 4UAWA 4JE9A 4H4KC 4I2AA 3SNHA 4X4UA 5L0CA 5CR0A 3TFSA 3AU2A 2BE3A 3QZCA 3AGUA 3GANA 4WBZA 5J0SA 3M79A 4CBEA 5A69A 4AT8A 2UUIA 4P6IC 4FHXA 4OD4A 2D4UA 4UAZA 4WC4A 3IQ6A 4CDVA 4NXTA 4I2FA 4JTCB 4BPMA 1D1CA 3V5ZA 3MDAA 1NG1A 3RH4A 3GEHA 5J0YA 4MNDA 1BDJB 2LCHA 4JW1A 1E85A 3KL4A 4XPWA 4RDAA 4YN4A 3IQTA 2R7UA 4XEVA 3TQOA 4DRIB 4YK5A 4O5CA 2J7PD 3JCUQ 2O1PA 2ETSA 2DYRC 1HUOA 2ZXWC 5TJ5E 3DD7A 4O68A 3EZIA 4M9NA 2B51A 5HRBA 3T4RA 7ICSA 4M5DA 2R03A 5KYXB 4DBQA 4IQUA 2OJED 1ZQPA 5KYWB 4O5EA 1OKKA 1ZQUA 5J0PA 4EHPA 4OAFA 5CA7A 3DAGA 3TOLA 3DI5A 1ZQNA 4KLOA 1MIWA 3K7DA 1Z3IX 3ISDA 3TJ5A 4OIOF 1JQRA 4E7ZA 3KMIA 2M2UA 1LM3B 4OIQF 5DB8A 1MIYA 3FHDA 3NG1A 3TOMA 3M1CB 3DZAA 3K66A 1K05A 2FGYA 3B0UX 1BZ4A 1K04A 3HJ1A 3DWWA 2Y39A 5L3VA 2ZHBA 4KLGA 4JVSA 4WC1A 3HNKA 5JTGA 3LS0A 8ICKA 1QVXA 2IHOA 3K75D 3UQ2A 5DECA 8ICSA 3PMRA 2ZH3A 1MQ2A 1OU5A 1OCCC 1Y6DA 2LQGA 1FAPB 4EWCA 3U9MA 3X2QC 9ICTA 3F46A 3B29A 4OINF 1E83A 1ZQSA 3LUTB 1KEJA 2HZ8A 5EOZA 4KLIA 1ZQHA 4KLJA 3U5SA 1ZQTA 5HRGA 1FMWA 2GAFD 1BPXA 3E70C 4LEVA 3EF2A 3UMIA 4I2CA 3ZVRA 2DVIA 1W2WA 1ZVZA 2CDQA 2NG1A 2V26A 4G0HA 1MMGA 1QSPA 1CGOA 4N06A 3K1IC 4NXZA 5J2GA 1RZTA 3Q6MA 4LEWA 4JWMA 1GPJA 5DB6A 2BC5A 3C2MA 4Z6CA 1NU9C 3ZG1A 4U9EA 4YMOA 5KYNA 3HNIA 5HRHA 5J2IA 3GEEA 1ORYA 4NXWA 4X4VA 2EPMX 4XJEA 4JCHA 5L0GA 4O7GA 8ICJA 2DRBA 1RPLA 1ZYRF 5DBBA 4HFFB 1OXBA 3LAYA 4K0DA 3JCFA 7ICIA 1O5HA 5JUAA 1M57C 4KLSA 4C7OA 3PCVA 5J2HA 4XRHA 3S84A 1SZIA 5IY5C 3JRMO 3U8VA 2NUPA 2OU6A 2BPFA 4ANJA 3B0VC 1TFYA 4AL1A 7ICEA 9ICLA 3GM1A 5A6BD 1ZQLA 4UB5A 1BPEA 4U5DE 4DOBA 2DR9A 1BR1A 2YZSA 3GDXA 2P0NA 7ICTA 3C8GA 4ULWA 3IPMO 3S28A 2ZH9A 4NC3A 4PFOA 4BJ5C 4IRUA 1TWHA 2FFHA 3GWNA 1D0XA 4P4PA 2XSEA 3IEEA 4RQ7A 3ZWIA 3TFRA 1WTYA 2OOCA 2LD6A 1ZQVA 4X4NA 5J29A 1A41A 1Z6AA 2HJ3A 4PHAA 4LLCA 5JRAA 1JR8A 4FHWA 4P9TA 2CW0F 3O55A 5L0IA 3H3AA 2EPNA 1Q0KA 3JPPA 3K33A 2A6HF 2NUTA 3T9OA 3LS1A 4ATBB 4YT4A 4LT6A 3UNGC 5B1AC 2ID1A 4LDRA 7ICJA 1E2XA 2BL2A 4G7OF 1I4YA 2EILC 1Z5ZA 4OIPF 4WQKA 3LEOA 2OCCC 5AC4A 3U2LA 1V4AA 2JPUA 3UQ0A 3EH2A 2LSEA 2W45A 1OW8A 5CFTA 4YMNA 5J2BA 7ICKA 2ZD9A 4EBJA 1RMVA 3J06A 3DAFA 4RPYA 2YVKA 3FVYA 1OCZC 1TFWA 1R8AA 2RFFA 2RSEB 2H8AA 4QZFA 3EGDB 2KC3A 4NXVA 4M47A 8ICEA 2W4BA 1ZQFA 1NLXA 2PF4E 1K40A 2NPUA 4MW3A 2V3CC 5BOMA 1M56C 4MVUA 5KYUB 2BCSA 2M2WA 4WOYA 3AG3C 4CDYA 4X0BA 9ICUA 3AU6A 3RIPA 2CYDA 3SXZA 2PFOA 3LNRA 2NSGA 1ZHZA 5D46A 5COFA 1XWJA 1T5OA 3C2KA 2GAQA 5IILA 4QZGA 3RYLA 5DB7A 3MLGA 2G62A 4LZDA 4PFPA 3PMNA 1UEVA 4NXUA 4M0AA 3OVBA 8ICFA 5J0WA 4RQ4A 2LFFA 9ICIA 4CDAA 3LESA 3SEOA 1JRAA 2DR7A 4MQ9F 2J9WA 2HS5A 3POVA 3MBYA 1ORJA 4ER9A 3NKUA 1KU2A 3AUOA 1LKXA 9ICCA 5KYWA 4XPYA 3FAPB 3EG9B 5HV9A 4PGQA 3PNCA 3TJ6A 3HTKC 2G3KA 2J0WA 1NU7D 4DXWA 3AQBA 3C18A 4Z6EA 1I4ZA 1VTMP 4EKWA 2O9XA 3KPHA 4U5FE 3EZHA 4I0UA 2R05A 1HY5A 2Q9CA 2FMQA 1ZQWA 2PXIA 3U2MA 2YL3A 1VOMA 5CP2A 4CX9A 2GWWA 5T3TA 2B4VA 7ICLA 2AP3A 1SF8A 5BQHA 3HNJA 1UEUA 3RVZA 2KQ9A 4RD9A 3HLZA 3UR3C 3UXNA 3NVOA 3SXMA 4XTKA 3ZIBA 2PFPA 3IHUA 2KK1A 4PGXA 4XLPF 2QLAA 4N4WA 5D63A 3SYNA 3ECSA 1C03A 2XRHA 5L3QA 3JT1A 3WFRE 4RBNA 1WWPA 1R8BA 3AG2C 4FHYA 3B0XA 2EPOA 4E18A 4LDKA 1SYQA 4I27A 4XPXA 1GM5A 3DJNB 1OQCA 2PNOA 4Z6FA 3EFOB 1HW2A 4MTFA 3RJJA 4A2NB 3LLIA 256BA 2B0JA 2GA9D 1L7CA 5DS4A 3H38A 4OAGA 4FO1A 3EJNA 3V7LA 1WOTA 4K9AA 2DR8A 2XS1A 2R7OA 3C2LA 3T6JA 2A6EF 2XLHA 2BCRA 3I5PA 4WBYA 2UUHA 3OV7A 4J7TA 4BJ6A 3BRJA 4X4SA 1IZMA 3QVZA 2H7VC 3NKDA 2J9VA 3FDQA 1ZQAA 5AGFA 2C04A 3FOPA 4U5GA 2G3VA 1TWGA 2XLWA 4Z6DA 1D0ZA 3RKOF 5HHHA 4LDQA 2Y3GA 1FFTC 1LPEA 1ZU5A 5BPCA 4K96A 2Z15A 2PP4A 3S90A 1YLQA 1Q0DA 3AG1C 2IXNA 3AQCA 4NCQA 3JPRA 2AU5A 3L9DA 1KNYA 2A0UA 1H6GA 1O87A 1BR4A 2KYHA 3C8GD 4W8KA 4PGYA 4JKVA 3WFOA 4RPXA 4JJGA 2VCBA 4KI2A
chains in the Genus database with same CATH topology
2L6GA 4KLHA 4RQ8A 3OVSA 1ZJNA 3TULA 4NLKA 4TUSA 3JPSA 4EP7A 2FMSA 2ZH5A 3HIYA 5J0TA 4NLNA 4X0AA 1ZQBA 4LVSA 4NXZA 5J2GA 1RZTA 4KLQA 4JWMA 4R64A 4E7XA 5J0XA 5DB6A 3C2MA 3RQGA 3S9OA 2NRKA 4NM2A 4Z6CA 4YMOA 5DBCA 4E80A 3GM2A 5HRHA 4X4QA 3UPQA 4MF2A 1NO5A 4ATBA 5J2IA 4XEKA 3HX0A 7ICGA 4X4VA 7ICPA 5J2JA 8ICWA 4FH5A 4FHPA 8ICJA 4QZIA 2I9GA 2DRBA 1RPLA 4I2GA 4WC0A 5DBBA 5IIMA 4X4RA 4X4PA 3RJHA 7ICIA 4P4OA 1ZQEA 4KLSA 5J2HA 4XRHA 2PFNA 8ICAA 4R66A 1FA0A 4YD2A 2BPFA 8ICHA 5DB9A 1ZQMA 4FHVA 4E8FA 1TFYA 4TURA 4MFFA 3AQKA 9ICBA 1XSPA 2ISPA 7ICEA 2BCQA 9ICLA 8ICVA 3GM1A 9ICFA 1ZQYA 1ZQLA 3AJMA 4WC7A 4UB5A 9ICQA 2JX0A 1BPEA 4RQ3A 4RWOA 1ZQZA 5IIOA 3V72A 5DKWA 4DOBA 5J0QA 2DR9A 3RJGA 9ICJA 1MQ3A 5IIJA 3GDXA 1JOGA 4AT7B 4I29A 2LK4A 1UETA 1VFGA 1KDHA 7ICTA 4DO9A 3LQCB 3C8GA 4AT9B 1JAJA 5HRKA 3GM3A 1R89A 4UD4A 4WCWA 5D49A 2ZH9A 1ZJMA 8ICQA 8ICNA 3C5GA 7ICMA 5J0RA 4R63A 4NQFA 4P4PA 3MDCA 4RQ7A 3TFRA 3RJEA 4NKUA 7ICHA 3HJ4A 1WTYA 3U0CA 3ISBA 4GXJA 1ZQVA 4X4NA 4KLDA 1BPZA 1ZQGA 5HRLA 4I2IA 5J29A 9ICVA 9ICOA 4PHAA 5F28E 2ZH1A 4X5VA 8ICXA 3JZ0A 1BPDA 4FHWA 4AT7A 3JPQA 1HUZA 3MFNA 3H3AA 4X4TA 2ZH7A 3HW8A 2L6FA 5CB1A 4UB3A 5HRDA 2DRAA 4WC5A 4DOCA 3RQFA 5D4BA 9ICEA 3JPPA 2VANA 4F5OA 9ICNA 4NM1A 4KLTA 2BPCA 4QZDA 4ATBB 4XEFA 4LT6A 3UXOA 4YCXA 4RT2A 2ID1A 4RWQA 4X4OA 7ICJA 1UFBA 5DDYA 4O9MA 2L6HA 4YMMA 5IINA 4KLUA 8ICBA 9ICWA 4RQ6A 5HR9A 9ICRA 1V4AA 2JPUA 1ZQRA 3UQ0A 2Q00A 1OW8A 1F5AA 4M9HA 4YMNA 5J2BA 4YD1A 7ICKA 9ICAA 4EBJA 4P4MA 4RPYA 3WFSC 1ZQDA 3JPTA 4MF8A 4NY8A 1TFWA 1R8AA 1JN3A 4DOAA 2RFFA 4F5PA 3OUYA 4RQ0A 5BOLA 9ICSA 3AQNA 4QZFA 4UB1A 5J2KA 3H37A 4M47A 8ICEA 4EBKA 4I2HA 7ICQA 3MGHA 4TUQA 1ZQFA 1VJ7A 1K40A 8ICGA 3C8GB 4F5NA 3ISCA 9ICMA 3RJKA 1PV3A 3JPNA 5BOMA 3AQMA 4UB2A 1WOLA 3B71A 3V7KA 4GXIA 2BCSA 2HSBA 2M2WA 2ZH4A 4M9LA 4KLLA 2BPGA 4X0BA 9ICUA 3AU6A 4TUPA 3B0YA 8ICCA 5HHIA 2M2TA 2PFOA 5J2FA 1OW7A 1Q79A 7ICRA 5D46A 8ICYA 3C2KA 3RQEA 4FO6A 5IILA 4QZGA 2O5AA 4FH3A 5DB7A 8ICMA 5J2DA 4LZDA 4I2BA 4MFAA 4KLMA 3PMNA 2YWAA 4NKTA 1UEVA 4M0AA 3OVBA 4QZCA 5TZVA 8ICFA 4WC3A 1ZQCA 4K4HA 5J0WA 4M04A 4RQ4A 4QZEA 1R8CA 9ICIA 5DEDA 8ICOA 5HRFA 4QZ9A 4QZ8A 2ISOA 9ICHA 4IQVA 9ICGA 2DR7A 7ICUA 2P66A 4IQTA 1ZQIA 3MBYA 1ZQQA 4R32A 5DDMA 4UD5A 1JMSA 2BCUA 3AUOA 9ICCA 3U3FA 4PHPA 4IG8A 9ICPA 3RJFA 2ZH8A 4MFCA 8ICRA 3H39A 5HRIA 4K4GA 4I28A 4PGQA 4LZGA 2DR5A 3PNCA 4F5QA 3NYBA 4R65A 1O3UA 3WFQE 3C18A 4Z6EA 5CHGA 4M9GA 4UAYA 8ICUA 4RQ2A 4UB4A 3OUYB 3RH6A 5J2EA 4QZBA 8ICPA 5J0OA 5HC9A 4WC6A 2FMQA 1XSLA 1ZQWA 3MGIA 2PXIA 2FMPA 1Q78A 5CP2A 5HREA 1BPYA 4KLFA 1ZQXA 4O5KA 3OVAA 4RWNA 4S3NA 7ICLA 3O10A 8ICTA 4M9JA 1UEUA 4UAWA 1TV9A 4I2AA 4RT3A 3UXNA 4X4UA 5CR0A 4PHEA 3TFSA 3AU2A 2PBEA 3HWTA 4JWNA 2BE3A 2PFPA 4WBZA 5J0SA 2KK1A 4AT8A 4PGXA 4FHXA 4KLEA 4QZHA 4UAZA 4WC4A 2ZH6A 4RPZA 2HHPA 2ZH2A 3WFRE 4XUSA 4I2FA 4PHDA 5J0UA 3MDAA 1WWPA 1R8BA 4UBCA 3RH4A 4FHYA 3B0XA 5J0YA 2W9MA 2GWSA 4I27A 2ZHAA 7ICNA 1BPBA 1KTMA 5CWRA 3RH5A 4YN4A 3RJIA 1NOMA 4XEVA 4O5CA 4Z6FA 2O1PA 5J2CA 4PH5A 3RJJA 1HUOA 2PFQA 4RQ5A 4M9NA 5HRBA 7ICSA 4M5DA 3H38A 4F5RA 4IQWA 4P2HA 4PPXA 4I2DA 5IIIA 4XQ7A 3UPSA 4XQ8A 4IQUA 4GXKA 1ZQPA 4M2YA 1ZQJA 8ICZA 4O5EA 3V7LA 1ZQUA 5J0PA 1WOTA 5CA7A 4NLZA 2DR8A 3C2LA 1XSNA 2Q66A 5J2AA 1ZQNA 1MIWA 4KLOA 2BCRA 1ZQOA 3K7DA 3ISDA 4WBYA 3WFPA 1JQRA 4UBBA 3OV7A 1ZZPA 2M2UA 5DB8A 1MIYA 7ICFA 3BRJA 4X4SA 1ZQKA 4RWPA 3C66A 1K05A 4QZAA 3OGUA 7ICOA 3L8IA 1ZQAA 1K04A 3HJ1A 3L8JA 1MIVA 2ZHBA 4KLGA 1PX5A 4WC1A 3UXPA 8ICKA 4Z6DA 1QVXA 5HHHA 3K75D 5F2VO 5DECA 5DBAA 3UQ2A 8ICSA 2ZH3A 7ICVA 8ICIA 1MQ2A 1OU5A 3LK9A 3V7JA 3AQLA 5BPCA 9ICKA 9ICTA 4AT8B 4I2JA 8ICLA 2M2VA 4XA5A 2IHMA 4I2EA 1ZQSA 1KEJA 1YLQA 3JPOA 1TVAA 5EOZA 4KLIA 1ZQHA 4WC2A 4KLJA 3JPRA 2BCVA 3L9DA 1ZQTA 1KNYA 5HRGA 9ICXA 4AT9A 3PMLA 4RQ1A 5CJ7A 1BPXA 3C8GD 3JYYA 4K4IA 4PGYA 3WFOA 1OW6A 4RPXA 4I2CA 2DVIA 3C5FA 5IIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6G A;  4KLH A;  4RQ8 A;  3OVS A;  1ZJN A;  3TUL A;  4NLK A;  4TUS A;  3JPS A;  4EP7 A;  2FMS A;  2ZH5 A;  3HIY A;  5J0T A;  4NLN A;  4X0A A;  1ZQB A;  4LVS A;  4NXZ A;  5J2G A;  1RZT A;  4KLQ A;  4JWM A;  4R64 A;  4E7X A;  5J0X A;  5DB6 A;  3C2M A;  3RQG A;  3S9O A;  2NRK A;  4NM2 A;  4Z6C A;  4YMO A;  5DBC A;  4E80 A;  3GM2 A;  5HRH A;  4X4Q A;  3UPQ A;  4MF2 A;  1NO5 A;  4ATB A;  5J2I A;  4XEK A;  3HX0 A;  7ICG A;  4X4V A;  7ICP A;  5J2J A;  8ICW A;  4FH5 A;  4FHP A;  8ICJ A;  4QZI A;  2I9G A;  2DRB A;  1RPL A;  4I2G A;  4WC0 A;  5DBB A;  5IIM A;  4X4R A;  4X4P A;  3RJH A;  7ICI A;  4P4O A;  1ZQE A;  4KLS A;  5J2H A;  4XRH A;  2PFN A;  8ICA A;  4R66 A;  1FA0 A;  4YD2 A;  2BPF A;  8ICH A;  5DB9 A;  1ZQM A;  4FHV A;  4E8F A;  1TFY A;  4TUR A;  4MFF A;  3AQK A;  9ICB A;  1XSP A;  2ISP A;  7ICE A;  2BCQ A;  9ICL A;  8ICV A;  3GM1 A;  9ICF A;  1ZQY A;  1ZQL A;  3AJM A;  4WC7 A;  4UB5 A;  9ICQ A;  2JX0 A;  1BPE A;  4RQ3 A;  4RWO A;  1ZQZ A;  5IIO A;  3V72 A;  5DKW A;  4DOB A;  5J0Q A;  2DR9 A;  3RJG A;  9ICJ A;  1MQ3 A;  5IIJ A;  3GDX A;  1JOG A;  4AT7 B;  4I29 A;  2LK4 A;  1UET A;  1VFG A;  1KDH A;  7ICT A;  4DO9 A;  3LQC B;  3C8G A;  4AT9 B;  1JAJ A;  5HRK A;  3GM3 A;  1R89 A;  4UD4 A;  4WCW A;  5D49 A;  2ZH9 A;  1ZJM A;  8ICQ A;  8ICN A;  3C5G A;  7ICM A;  5J0R A;  4R63 A;  4NQF A;  4P4P A;  3MDC A;  4RQ7 A;  3TFR A;  3RJE A;  4NKU A;  7ICH A;  3HJ4 A;  1WTY A;  3U0C A;  3ISB A;  4GXJ A;  1ZQV A;  4X4N A;  4KLD A;  1BPZ A;  1ZQG A;  5HRL A;  4I2I A;  5J29 A;  9ICV A;  9ICO A;  4PHA A;  5F28 E;  2ZH1 A;  4X5V A;  8ICX A;  3JZ0 A;  1BPD A;  4FHW A;  4AT7 A;  3JPQ A;  1HUZ A;  3MFN A;  3H3A A;  4X4T A;  2ZH7 A;  3HW8 A;  2L6F A;  5CB1 A;  4UB3 A;  5HRD A;  2DRA A;  4WC5 A;  4DOC A;  3RQF A;  5D4B A;  9ICE A;  3JPP A;  2VAN A;  4F5O A;  9ICN A;  4NM1 A;  4KLT A;  2BPC A;  4QZD A;  4ATB B;  4XEF A;  4LT6 A;  3UXO A;  4YCX A;  4RT2 A;  2ID1 A;  4RWQ A;  4X4O A;  7ICJ A;  1UFB A;  5DDY A;  4O9M A;  2L6H A;  4YMM A;  5IIN A;  4KLU A;  8ICB A;  9ICW A;  4RQ6 A;  5HR9 A;  9ICR A;  1V4A A;  2JPU A;  1ZQR A;  3UQ0 A;  2Q00 A;  1OW8 A;  1F5A A;  4M9H A;  4YMN A;  5J2B A;  4YD1 A;  7ICK A;  9ICA A;  4EBJ A;  4P4M A;  4RPY A;  3WFS C;  1ZQD A;  3JPT A;  4MF8 A;  4NY8 A;  1TFW A;  1R8A A;  1JN3 A;  4DOA A;  2RFF A;  4F5P A;  3OUY A;  4RQ0 A;  5BOL A;  9ICS A;  3AQN A;  4QZF A;  4UB1 A;  5J2K A;  3H37 A;  4M47 A;  8ICE A;  4EBK A;  4I2H A;  7ICQ A;  3MGH A;  4TUQ A;  1ZQF A;  1VJ7 A;  1K40 A;  8ICG A;  3C8G B;  4F5N A;  3ISC A;  9ICM A;  3RJK A;  1PV3 A;  3JPN A;  5BOM A;  3AQM A;  4UB2 A;  1WOL A;  3B71 A;  3V7K A;  4GXI A;  2BCS A;  2HSB A;  2M2W A;  2ZH4 A;  4M9L A;  4KLL A;  2BPG A;  4X0B A;  9ICU A;  3AU6 A;  4TUP A;  3B0Y A;  8ICC A;  5HHI A;  2M2T A;  2PFO A;  5J2F A;  1OW7 A;  1Q79 A;  7ICR A;  5D46 A;  8ICY A;  3C2K A;  3RQE A;  4FO6 A;  5IIL A;  4QZG A;  2O5A A;  4FH3 A;  5DB7 A;  8ICM A;  5J2D A;  4LZD A;  4I2B A;  4MFA A;  4KLM A;  3PMN A;  2YWA A;  4NKT A;  1UEV A;  4M0A A;  3OVB A;  4QZC A;  5TZV A;  8ICF A;  4WC3 A;  1ZQC A;  4K4H A;  5J0W A;  4M04 A;  4RQ4 A;  4QZE A;  1R8C A;  9ICI A;  5DED A;  8ICO A;  5HRF A;  4QZ9 A;  4QZ8 A;  2ISO A;  9ICH A;  4IQV A;  9ICG A;  2DR7 A;  7ICU A;  2P66 A;  4IQT A;  1ZQI A;  3MBY A;  1ZQQ A;  4R32 A;  5DDM A;  4UD5 A;  1JMS A;  2BCU A;  3AUO A;  9ICC A;  3U3F A;  4PHP A;  4IG8 A;  9ICP A;  3RJF A;  2ZH8 A;  4MFC A;  8ICR A;  3H39 A;  5HRI A;  4K4G A;  4I28 A;  4PGQ A;  4LZG A;  2DR5 A;  3PNC A;  4F5Q A;  3NYB A;  4R65 A;  1O3U A;  3WFQ E;  3C18 A;  4Z6E A;  5CHG A;  4M9G A;  4UAY A;  8ICU A;  4RQ2 A;  4UB4 A;  3OUY B;  3RH6 A;  5J2E A;  4QZB A;  8ICP A;  5J0O A;  5HC9 A;  4WC6 A;  2FMQ A;  1XSL A;  1ZQW A;  3MGI A;  2PXI A;  2FMP A;  1Q78 A;  5CP2 A;  5HRE A;  1BPY A;  4KLF A;  1ZQX A;  4O5K A;  3OVA A;  4RWN A;  4S3N A;  7ICL A;  3O10 A;  8ICT A;  4M9J A;  1UEU A;  4UAW A;  1TV9 A;  4I2A A;  4RT3 A;  3UXN A;  4X4U A;  5CR0 A;  4PHE A;  3TFS A;  3AU2 A;  2PBE A;  3HWT A;  4JWN A;  2BE3 A;  2PFP A;  4WBZ A;  5J0S A;  2KK1 A;  4AT8 A;  4PGX A;  4FHX A;  4KLE A;  4QZH A;  4UAZ A;  4WC4 A;  2ZH6 A;  4RPZ A;  2HHP A;  2ZH2 A;  3WFR E;  4XUS A;  4I2F A;  4PHD A;  5J0U A;  3MDA A;  1WWP A;  1R8B A;  4UBC A;  3RH4 A;  4FHY A;  3B0X A;  5J0Y A;  2W9M A;  2GWS A;  4I27 A;  2ZHA A;  7ICN A;  1BPB A;  1KTM A;  5CWR A;  3RH5 A;  4YN4 A;  3RJI A;  1NOM A;  4XEV A;  4O5C A;  4Z6F A;  2O1P A;  5J2C A;  4PH5 A;  3RJJ A;  1HUO A;  2PFQ A;  4RQ5 A;  4M9N A;  5HRB A;  7ICS A;  4M5D A;  3H38 A;  4F5R A;  4IQW A;  4P2H A;  4PPX A;  4I2D A;  5III A;  4XQ7 A;  3UPS A;  4XQ8 A;  4IQU A;  4GXK A;  1ZQP A;  4M2Y A;  1ZQJ A;  8ICZ A;  4O5E A;  3V7L A;  1ZQU A;  5J0P A;  1WOT A;  5CA7 A;  4NLZ A;  2DR8 A;  3C2L A;  1XSN A;  2Q66 A;  5J2A A;  1ZQN A;  1MIW A;  4KLO A;  2BCR A;  1ZQO A;  3K7D A;  3ISD A;  4WBY A;  3WFP A;  1JQR A;  4UBB A;  3OV7 A;  1ZZP A;  2M2U A;  5DB8 A;  1MIY A;  7ICF A;  3BRJ A;  4X4S A;  1ZQK A;  4RWP A;  3C66 A;  1K05 A;  4QZA A;  3OGU A;  7ICO A;  3L8I A;  1ZQA A;  1K04 A;  3HJ1 A;  3L8J A;  1MIV A;  2ZHB A;  4KLG A;  1PX5 A;  4WC1 A;  3UXP A;  8ICK A;  4Z6D A;  1QVX A;  5HHH A;  3K75 D;  5F2V O;  5DEC A;  5DBA A;  3UQ2 A;  8ICS A;  2ZH3 A;  7ICV A;  8ICI A;  1MQ2 A;  1OU5 A;  3LK9 A;  3V7J A;  3AQL A;  5BPC A;  9ICK A;  9ICT A;  4AT8 B;  4I2J A;  8ICL A;  2M2V A;  4XA5 A;  2IHM A;  4I2E A;  1ZQS A;  1KEJ A;  1YLQ A;  3JPO A;  1TVA A;  5EOZ A;  4KLI A;  1ZQH A;  4WC2 A;  4KLJ A;  3JPR A;  2BCV A;  3L9D A;  1ZQT A;  1KNY A;  5HRG A;  9ICX A;  4AT9 A;  3PML A;  4RQ1 A;  5CJ7 A;  1BPX A;  3C8G D;  3JYY A;  4K4I A;  4PGY A;  3WFO A;  1OW6 A;  4RPX A;  4I2C A;  2DVI A;  3C5F A;  5IIK A; 
#chains in the Genus database with same CATH topology
 1MMD A;  2L6G A;  2VCC A;  2HUJ A;  3OVS A;  3MX3 A;  3HJC A;  3UGP A;  4NLK A;  2IXP A;  4EP7 A;  3I4U A;  5J0T A;  3CAX A;  2IXO A;  3L0I A;  4X0A A;  2R7S A;  4LVS A;  4MW8 A;  2LFD A;  4R64 A;  2Q3T A;  2R7W A;  5T1D B;  2DYS C;  4ZLD A;  2NRK A;  3DKA A;  3MYI A;  3SXY A;  3GM2 A;  2B0H A;  4ATB A;  2XXA B;  4AE4 B;  1YJG A;  5A6A A;  3GWL A;  3E9V A;  3EHM A;  2H7O A;  2Q9B A;  4FH5 A;  4FHP A;  2EIJ C;  3TK0 A;  5IIM A;  4GYT A;  2KJG A;  3DMD A;  1GGQ A;  2FCL A;  2PFN A;  4R66 A;  2R7V A;  4BJT A;  3DXJ F;  1ZQM A;  1QZX A;  2QE9 A;  3AQK A;  2VH3 A;  4EED A;  1MNE A;  1J8M F;  3AJM A;  9ICQ A;  4YT5 A;  2JX0 A;  4RQ3 A;  2E87 A;  9ICJ A;  3EGD A;  3K1H A;  2I15 A;  5CFU A;  5DKW A;  1MQ3 A;  5IIJ A;  3M4C A;  4YL0 A;  3EPV A;  3A11 A;  1ZU4 A;  1KDH A;  3LQC B;  4AT9 B;  1JAJ A;  4U5E E;  3GM3 A;  2A1D D;  1R89 A;  4UD4 A;  1UG7 A;  1ZJM A;  3C5G A;  7ICM A;  2GDC A;  3MDC A;  3GOR A;  5B3Q A;  3RJE A;  2J9U A;  7ICH A;  4EBB A;  3HJ4 A;  3U0C A;  3ISB A;  3DE8 A;  1VLT A;  4D4X A;  1AUE A;  1ZQG A;  4I2I A;  9ICV A;  4N7R A;  5F28 E;  3VRC A;  2ZH1 A;  8ICX A;  3ASO C;  4AT7 A;  2HV6 A;  2Y3H A;  1HMD A;  5B1B C;  2ZH7 A;  1CPR A;  2AWC A;  4WC5 A;  4DOC A;  1VLS A;  3RQF A;  2Q9A A;  1FR0 A;  3QW0 A;  4KLT A;  1LE2 A;  4QZD A;  4XEF A;  3LEV A;  4LEY A;  4RWQ A;  2KNH A;  2WZL A;  4CS8 A;  1JAF A;  1H9T A;  1LI7 A;  1QLE C;  5IIN A;  4KLU A;  8ICB A;  5F5H A;  3M4B A;  1LS4 A;  9ICR A;  3L34 A;  1ZQR A;  4AL0 A;  2Q00 A;  4Q7C A;  2H7B A;  4M9H A;  3EG9 A;  4EEB A;  2XLO A;  4YD1 A;  9ICA A;  1Z23 A;  4NTB A;  3JPT A;  4NY8 A;  3KYJ A;  1EI7 A;  1RKC A;  4DOA A;  2DGJ A;  5BOL A;  3ATP A;  3AQN A;  4MTO A;  2R25 A;  4WAB A;  4UB1 A;  5J2K A;  3H37 A;  4EBK A;  4I2H A;  4O69 A;  2WVN A;  4TUQ A;  2AWY A;  3ZC4 A;  3U3B A;  1VJ7 A;  2HN1 A;  8ICG A;  3ISC A;  4DRH B;  1EQ1 A;  3JPN A;  4UB2 A;  2WB7 A;  5AC5 A;  4GXI A;  4K98 A;  4OD5 A;  2BPG A;  3IQC A;  2OQM A;  3RW0 A;  8ICC A;  2IXM A;  1ZHW A;  5HHI A;  5D91 A;  5J2F A;  1OW7 A;  7ICR A;  3MYF A;  3RQE A;  2GFH A;  4FO6 A;  3NMI A;  2W4M A;  2R7R A;  1JPN A;  8ICM A;  4NXX A;  4I2B A;  4KLM A;  4HX0 A;  1YZC A;  4QZC A;  5TZV A;  4Q5S F;  1V55 C;  2J8W A;  4K4H A;  4K99 A;  2MWQ A;  4U9D A;  5HRF A;  9ICH A;  2P1A A;  4IQV A;  3EFO A;  2BBH A;  5L0D A;  3L1M A;  3DE9 A;  4IQT A;  3BEH A;  1AVO B;  3V7O A;  5B3P A;  4YJW A;  4R32 A;  1OCO C;  1FMV A;  4UD5 A;  5CFS A;  2PFD A;  4C3E A;  3EQL F;  2BCU A;  2QTV A;  1C17 M;  3RJF A;  2ZH8 A;  2YL1 A;  4J30 B;  3ZQY A;  2DR5 A;  5JSL A;  4BJ1 A;  2BBJ A;  5CHG A;  4K8V A;  1M6T A;  3OUY B;  2J46 A;  2MHR A;  4LAC B;  2R9R B;  1A7E A;  1LI5 A;  4IAQ A;  5J0O A;  5HC9 A;  1Q0G A;  4AK9 A;  3EGX B;  1XSL A;  3MGI A;  1ZHX A;  3NYL A;  4CSA C;  1V54 C;  1Q78 A;  4KLF A;  4O5K A;  4RWN A;  3GOD A;  4M9J A;  2J7P A;  4PHE A;  2L9J A;  4JTD B;  4IJJ A;  4JLX A;  2PBE A;  3HWT A;  4JWN A;  2HMZ A;  3RVY A;  4FWV A;  4ZLC A;  5K0I A;  4KLE A;  1S7Z A;  4RPZ A;  2HHP A;  5JP7 A;  1NFO A;  2A68 F;  4PHD A;  1Q0M A;  4G78 A;  2HFI A;  1PD1 A;  2W9M A;  2GWS A;  1SMY F;  2ZHA A;  5COG A;  5BUO A;  1BPB A;  1KTM A;  1IW7 F;  3RH5 A;  3RJI A;  4PJL A;  1OR2 A;  1ST6 A;  5J2C A;  3DM9 B;  2PFQ A;  4RQ5 A;  1HW1 A;  4F5R A;  3FOO A;  4P2H A;  4I2D A;  1T6U A;  4M2Y A;  1YA7 O;  8ICZ A;  3ABK C;  3US6 A;  4O67 A;  4JC7 A;  4K1O A;  1GS9 A;  1TKN A;  2X0C A;  2AVK A;  3WFP A;  1ZZP A;  3C8Z A;  4CJO A;  5DS5 A;  2XXA A;  4JZA A;  4AE4 A;  3C66 A;  1G8X A;  2OKU A;  4GEH A;  3G4Z A;  4QZA A;  3L8I A;  3DJU B;  4Z9I A;  2P61 A;  5EK0 A;  3R2P A;  5KYX A;  4IAO A;  3PHZ A;  3UXP A;  3N2Z B;  3RF3 A;  2YHS A;  1JMW A;  5DBA A;  3LNM B;  4QI2 A;  1T01 A;  1YA9 A;  1HMO A;  3LK9 A;  1OKK D;  4IB4 A;  4J32 B;  2L7A A;  3V7J A;  3AQL A;  2YKZ A;  4FES A;  3MBG A;  4I2J A;  8ICL A;  2IHM A;  4I2E A;  4O6M A;  1TVA A;  4MS2 A;  4WC2 A;  1S05 A;  2OG2 A;  2BCV A;  1H7I A;  9ICX A;  4AT9 A;  1R5I D;  1LE4 A;  1BR2 A;  2OJQ A;  5CJ7 A;  4WGY A;  5EHH A;  3O6X A;  2YLD A;  2TMV P;  2C03 A;  4K4I A;  3C5F A;  3HIY A;  4CIH A;  1D1B A;  4KLH A;  2XL4 A;  1VYK A;  3DM5 A;  1CGN A;  3UMK A;  3WAQ A;  3IQ5 A;  3SZR A;  1J8Y F;  2PX3 A;  2XLD A;  2VCA A;  3JYH A;  1ZQB A;  3ER9 B;  2ICW G;  4U5B E;  4B6I A;  2B56 A;  3S9O A;  4NM2 A;  2CNW A;  4K97 A;  5DBC A;  2YEV A;  4E80 A;  3UPQ A;  3CZ6 A;  1NO5 A;  2WZG A;  3AOU A;  4LER A;  2IYL D;  3HX0 A;  2VB6 A;  5J2J A;  1R4T A;  5B3I A;  7ICP A;  1RKE B;  4EGW A;  5L0J A;  2I9G A;  4O6N A;  4DOZ A;  5CI9 A;  2ZXP A;  4WC0 A;  2HV7 A;  4DVZ A;  4P4O A;  2OEX A;  1A0B A;  4H54 A;  3R7C A;  1VK5 A;  4E8F A;  4TUR A;  4MFF A;  2YLG A;  2ISP A;  1C02 A;  1T6Q A;  2BCQ A;  4MVM A;  9ICF A;  4WC7 A;  1M2O A;  4W8P A;  3RJG A;  3V72 A;  5J0Q A;  3KKB A;  4UDV A;  1JOG A;  2LK4 A;  1UET A;  5B3S C;  2HJM A;  1LIH A;  4DO9 A;  4JEA A;  5HRK A;  3B9Q A;  8ICN A;  1PCX A;  4HE8 D;  5J0R A;  4R63 A;  2J0X A;  4NQF A;  4CS9 A;  4F4B A;  1PD0 A;  3S27 A;  3V5X A;  4GXJ A;  4EIY A;  1APC A;  4KLD A;  2WVQ A;  4O6A A;  9ICO A;  1D1A A;  4X5V A;  1WGW A;  1Y4C A;  3JZ0 A;  1BPD A;  3QMK A;  3JPQ A;  4A4A A;  2W9Y A;  2ZXO A;  4WGZ A;  5DLJ A;  4X4T A;  1HE9 A;  2L6F A;  3QW1 A;  5HRD A;  2DRA A;  5D4B A;  9ICE A;  2VAN A;  4F5O A;  4NM1 A;  2BPC A;  2KW3 C;  4KBL A;  4M63 A;  4RT2 A;  4X4O A;  4JCZ A;  3QTH A;  3NYJ A;  2L6H A;  4O9M A;  4QI0 A;  4YT8 A;  1DOW A;  5KYY B;  3C63 A;  2I8B A;  3ERC C;  9ICW A;  4RQ6 A;  3ASN C;  1EA8 A;  1Q0F A;  2IUB A;  4I44 A;  1U0B B;  2WL8 A;  2Y3D A;  4E17 A;  3M15 A;  4P4M A;  3Q7L A;  5DS6 A;  1ZQD A;  2DI3 A;  3W4Y A;  3MCR A;  1FFH A;  2WVO A;  3H65 A;  2Q7R A;  4MVR A;  5JVE A;  4F5P A;  1GQA A;  3NWI A;  3OUY A;  2LIG A;  5A6J A;  1XZP A;  4JJF A;  3K6B A;  3ZDL A;  3H2U A;  3EGX A;  1WAS A;  3OEO A;  7ICQ A;  1RCP A;  4F5N A;  5COM A;  9ICM A;  1PV3 A;  3TD7 A;  3JTL O;  2A0B A;  3B71 A;  3VF0 A;  4G7H F;  3G50 A;  2ZH4 A;  1TR2 A;  4DBR A;  1ZW2 A;  3B0Y A;  3ABL C;  2M2T A;  1Z7Q c;  2A69 F;  1TQG A;  4K7B A;  5JS5 A;  2M4E A;  1JPJ A;  5FCL A;  1M2V B;  5GPG B;  4KM5 A;  2HN2 A;  3B0P A;  1VYI A;  2X51 A;  1RJ9 B;  3SP1 A;  2YWA A;  4E7S A;  4NKT A;  1G5Z A;  1YLM A;  4YWQ A;  4M04 A;  1TWA A;  1R8C A;  5KYU A;  8ICO A;  1TFO B;  2ISO A;  1OCR C;  9ICG A;  3U8P A;  1G4U S;  3OA1 A;  1MMA A;  4NTA A;  5HSW A;  4KNV A;  3CQZ A;  2KGO A;  2GA0 A;  4JLZ A;  1JMS A;  1OR3 A;  4LEZ A;  4J7Y A;  2EIK C;  4G7Z F;  3U3F A;  4PHP A;  4IG8 A;  8ICR A;  3FAJ A;  4K4G A;  1AEP A;  4PJN A;  4I28 A;  4Z9J A;  4XLN F;  4F5Q A;  2M64 A;  4R65 A;  1O3U A;  3LLK A;  4M9G A;  3O39 A;  4RQ2 A;  4UB4 A;  2XL6 A;  4IWB A;  5J2E A;  4QZB A;  8ICP A;  3T6B A;  3I5Q A;  4PJJ A;  5HRE A;  1BPY A;  3OVA A;  2YLI A;  1HE1 A;  3O10 A;  2CGE A;  5CIV A;  5E33 A;  1TV9 A;  4IGG A;  3K1I A;  2F22 A;  4RT3 A;  3OWT A;  1QKR A;  4CS8 C;  3KH2 A;  1QPU A;  3H2V A;  2VC9 A;  4QZH A;  1MQV A;  3NMK A;  2R02 A;  2ZH6 A;  5BQI A;  1G4W R;  2ZH2 A;  4XUS A;  4ONS A;  5J0U A;  4UBC A;  2L81 A;  2EPL X;  1FTS A;  1DOV A;  4YN0 B;  7ICN A;  5BQG A;  4WQL A;  5CWR A;  1NOM A;  2ZPA A;  4OIR F;  3VAY A;  2XLE A;  4PH5 A;  1VB5 A;  3NMJ A;  1NZE A;  4L6R A;  4IQW A;  4PPX A;  5III A;  4XQ7 A;  3UPS A;  4XQ8 A;  4GXK A;  1H9G A;  1ZQJ A;  3HKK A;  4NLZ A;  1XSN A;  2Q66 A;  4DRJ B;  5J2A A;  3NKE A;  1ZQO A;  4LLE A;  4UBB A;  2WZF A;  2YQY A;  7ICF A;  1D0Y A;  2CNW D;  4BJ5 A;  1ZQK A;  5T3W A;  1YZA A;  1ORS C;  4RWP A;  1RKE A;  1YAR O;  1NBB A;  2R7T A;  3A9C A;  3OGU A;  7ICO A;  4MVZ A;  4MVS A;  4C3D A;  3L8J A;  1MIV A;  1PX5 A;  4U5H A;  2EIN C;  3ZTZ A;  5L0F A;  2QY9 A;  3S29 A;  5F2V O;  4DVY P;  7ICV A;  8ICI A;  3T6G B;  5D62 A;  3WHN A;  9ICK A;  4BG0 A;  5E3A A;  4AT8 B;  2M2V A;  4XA5 A;  2VAS A;  1LVK A;  3GEI A;  3JPO A;  3RH3 A;  3X1O A;  3W2V A;  4N6H A;  1RXQ A;  4KNW A;  3W8H A;  1ZHY A;  3F47 A;  4CSA A;  3AGT A;  3PML A;  4RQ1 A;  1SR2 A;  5CI8 A;  5F5F A;  2JD3 A;  3JYY A;  1OW6 A;  2EIM C;  2XL8 A;  4P9F A;  5IIK A;  4K9B A;  4FAP B;  3CK6 A;  4RQ8 A;  1ZJN A;  3TUL A;  3ZSU A;  1B68 A;  4TUS A;  3JPS A;  2FMS A;  5A6K A;  2ZH5 A;  2QUP A;  4NLN A;  3FMS A;  1ZW3 A;  4ULV A;  3UMH A;  4KLQ A;  3UGO A;  4E7X A;  5J0X A;  3RQG A;  1VMA A;  3W2W A;  4X4Q A;  4MF2 A;  1ZHT A;  2XM0 A;  4XEK A;  5E2Q A;  2YL7 A;  4JIO A;  7ICG A;  8ICW A;  3EHN A;  4JTA B;  4FX5 A;  5D92 A;  1YAU O;  4QZI A;  5KYY A;  2HMQ A;  2YL0 A;  4I2G A;  4X4R A;  2IBF A;  3NDB B;  4X4P A;  2HKV A;  3RJH A;  3RFY A;  1ZQE A;  8ICA A;  3S0X A;  3NRH A;  3W8I A;  1FA0 A;  4YD2 A;  8ICH A;  5DB9 A;  4WJ0 A;  5DQZ A;  4FHV A;  4BEM J;  3ITF A;  4IAR A;  9ICB A;  1MND A;  2D5R B;  1YYJ A;  1XSP A;  8ICV A;  1ZQY A;  2ZXR A;  4RWO A;  5IIO A;  1ZQZ A;  1WN0 A;  1NFN A;  4I29 A;  4AT7 B;  5D61 A;  1VFG A;  3FXH A;  4MTG A;  1YVI A;  3C7J A;  5FZT A;  4WCW A;  1N1C A;  4MVO A;  5D49 A;  8ICQ A;  4D4N A;  1E84 A;  4X0R A;  5DVW A;  4Z9H A;  2YRF A;  4KB6 A;  1Z63 A;  1TWC A;  2XM4 A;  4OAH A;  4NTF A;  4NKU A;  4OAI Z;  4KC9 A;  4YL3 A;  2OEV A;  1BPZ A;  1WAT A;  1BBH A;  5HRL A;  4I1O B;  1M2V A;  5JLI A;  5DQT A;  3VYW A;  3N0T A;  2MYS A;  1L3P A;  1HUZ A;  3MFN A;  1RJ9 A;  1TFK B;  3PHF 2;  3HW8 A;  3ZQV A;  5CB1 A;  2QNL A;  4UB3 A;  4EUK B;  2PX0 A;  4N6C A;  9ICN A;  2XLM A;  3UXO A;  4YCX A;  4PK4 A;  3EH1 A;  1UFB A;  5DDY A;  3WOD F;  4YMM A;  2IOQ A;  4MKP A;  2NSF A;  2XLV A;  4JEB A;  3JSE O;  2FAP B;  5HR9 A;  5E3C A;  2RD9 A;  4PR9 A;  4C7O B;  3VM6 A;  1F5A A;  2Y69 C;  1E86 A;  2NUP B;  3ER8 C;  3WFS C;  1T6I A;  5A6B A;  4MF8 A;  3JSZ A;  4PAC A;  2J45 A;  1JN3 A;  4O6Y A;  4RQ0 A;  9ICS A;  1F1M A;  2J9B A;  3ZTM A;  3MGH A;  3ABM C;  4YL1 A;  4AX2 A;  3C8G B;  4E0H A;  1A7D A;  3RJK A;  4HEA J;  2Q4F A;  3G4X A;  4I1M A;  4CS7 A;  3AQM A;  1WOL A;  4Q4Z F;  2BE5 F;  2XS8 A;  3V7K A;  2HSB A;  1U6H A;  4M9L A;  3PDM P;  4KLL A;  1YYX A;  2CCY A;  3AG4 C;  4TUP A;  4YT2 A;  4BEJ A;  4CIP A;  4XQ1 A;  4GQH A;  1QQ3 A;  4EV6 A;  1Q79 A;  4I3M A;  8ICY A;  1CGM E;  1T9K A;  4XWJ A;  4QDL A;  5L0H A;  5JT4 A;  2O5A A;  4FH3 A;  3QVY A;  2EWR A;  5J2D A;  2ASR A;  2KSF A;  4MFA A;  4HFK B;  3JRT A;  4WC3 A;  1ZQC A;  4O79 A;  1OXK A;  3CSK A;  4BJ6 C;  4QZE A;  4C3B A;  2NUT B;  5DED A;  1U89 A;  2P6V A;  4QZ9 A;  4QZ8 A;  4WH5 A;  4E0I A;  3CEX A;  4JUR I;  1I5N A;  5CHE A;  7ICU A;  5EGY A;  3Q7G A;  2P66 A;  1ZQI A;  1V74 B;  4JRZ A;  1ZQQ A;  1FNT c;  5DDM A;  1MMN A;  3U9J A;  4CJG A;  1A7V A;  9ICP A;  2IM8 A;  4MFC A;  2LP4 A;  3H39 A;  3C62 A;  5HRI A;  3KYI A;  4LZG A;  1LS1 A;  1CPQ A;  4CS9 C;  2EPK X;  1NSG B;  2R7Q A;  1EKY A;  1XZQ A;  3NYB A;  3LJB A;  2HSQ A;  3N24 A;  3WFQ E;  8ICU A;  4UAY A;  3OWG A;  3RH6 A;  3HNL A;  4U5C E;  3WG7 C;  3SXK A;  2R7X A;  4PJM A;  1YDI A;  4WC6 A;  2DB4 A;  3V5Y A;  3Q6N A;  2FMP A;  2Y3B A;  1ZQX A;  4S3N A;  2P7V A;  8ICT A;  3NYM A;  4NY3 A;  4DJ9 A;  4MVQ A;  4UAW A;  4JE9 A;  4H4K C;  4I2A A;  3SNH A;  4X4U A;  5L0C A;  5CR0 A;  3TFS A;  3AU2 A;  2BE3 A;  3QZC A;  3AGU A;  3GAN A;  4WBZ A;  5J0S A;  3M79 A;  4CBE A;  5A69 A;  4AT8 A;  2UUI A;  4P6I C;  4FHX A;  4OD4 A;  2D4U A;  4UAZ A;  4WC4 A;  3IQ6 A;  4CDV A;  4NXT A;  4I2F A;  4JTC B;  4BPM A;  1D1C A;  3V5Z A;  3MDA A;  1NG1 A;  3RH4 A;  3GEH A;  5J0Y A;  4MND A;  1BDJ B;  2LCH A;  4JW1 A;  1E85 A;  3KL4 A;  4XPW A;  4RDA A;  4YN4 A;  3IQT A;  2R7U A;  4XEV A;  3TQO A;  4DRI B;  4YK5 A;  4O5C A;  2J7P D;  3JCU Q;  2O1P A;  2ETS A;  2DYR C;  1HUO A;  2ZXW C;  5TJ5 E;  3DD7 A;  4O68 A;  3EZI A;  4M9N A;  2B51 A;  5HRB A;  3T4R A;  7ICS A;  4M5D A;  2R03 A;  5KYX B;  4DBQ A;  4IQU A;  2OJE D;  1ZQP A;  5KYW B;  4O5E A;  1OKK A;  1ZQU A;  5J0P A;  4EHP A;  4OAF A;  5CA7 A;  3DAG A;  3TOL A;  3DI5 A;  1ZQN A;  4KLO A;  1MIW A;  3K7D A;  1Z3I X;  3ISD A;  3TJ5 A;  4OIO F;  1JQR A;  4E7Z A;  3KMI A;  2M2U A;  1LM3 B;  4OIQ F;  5DB8 A;  1MIY A;  3FHD A;  3NG1 A;  3TOM A;  3M1C B;  3DZA A;  3K66 A;  1K05 A;  2FGY A;  3B0U X;  1BZ4 A;  1K04 A;  3HJ1 A;  3DWW A;  2Y39 A;  5L3V A;  2ZHB A;  4KLG A;  4JVS A;  4WC1 A;  3HNK A;  5JTG A;  3LS0 A;  8ICK A;  1QVX A;  2IHO A;  3K75 D;  3UQ2 A;  5DEC A;  8ICS A;  3PMR A;  2ZH3 A;  1MQ2 A;  1OU5 A;  1OCC C;  1Y6D A;  2LQG A;  1FAP B;  4EWC A;  3U9M A;  3X2Q C;  9ICT A;  3F46 A;  3B29 A;  4OIN F;  1E83 A;  1ZQS A;  3LUT B;  1KEJ A;  2HZ8 A;  5EOZ A;  4KLI A;  1ZQH A;  4KLJ A;  3U5S A;  1ZQT A;  5HRG A;  1FMW A;  2GAF D;  1BPX A;  3E70 C;  4LEV A;  3EF2 A;  3UMI A;  4I2C A;  3ZVR A;  2DVI A;  1W2W A;  1ZVZ A;  2CDQ A;  2NG1 A;  2V26 A;  4G0H A;  1MMG A;  1QSP A;  1CGO A;  4N06 A;  3K1I C;  4NXZ A;  5J2G A;  1RZT A;  3Q6M A;  4LEW A;  4JWM A;  1GPJ A;  5DB6 A;  2BC5 A;  3C2M A;  4Z6C A;  1NU9 C;  3ZG1 A;  4U9E A;  4YMO A;  5KYN A;  3HNI A;  5HRH A;  5J2I A;  3GEE A;  1ORY A;  4NXW A;  4X4V A;  2EPM X;  4XJE A;  4JCH A;  5L0G A;  4O7G A;  8ICJ A;  2DRB A;  1RPL A;  1ZYR F;  5DBB A;  4HFF B;  1OXB A;  3LAY A;  4K0D A;  3JCF A;  7ICI A;  1O5H A;  5JUA A;  1M57 C;  4KLS A;  4C7O A;  3PCV A;  5J2H A;  4XRH A;  3S84 A;  1SZI A;  5IY5 C;  3JRM O;  3U8V A;  2NUP A;  2OU6 A;  2BPF A;  4ANJ A;  3B0V C;  1TFY A;  4AL1 A;  7ICE A;  9ICL A;  3GM1 A;  5A6B D;  1ZQL A;  4UB5 A;  1BPE A;  4U5D E;  4DOB A;  2DR9 A;  1BR1 A;  2YZS A;  3GDX A;  2P0N A;  7ICT A;  3C8G A;  4ULW A;  3IPM O;  3S28 A;  2ZH9 A;  4NC3 A;  4PFO A;  4BJ5 C;  4IRU A;  1TWH A;  2FFH A;  3GWN A;  1D0X A;  4P4P A;  2XSE A;  3IEE A;  4RQ7 A;  3ZWI A;  3TFR A;  1WTY A;  2OOC A;  2LD6 A;  1ZQV A;  4X4N A;  5J29 A;  1A41 A;  1Z6A A;  2HJ3 A;  4PHA A;  4LLC A;  5JRA A;  1JR8 A;  4FHW A;  4P9T A;  2CW0 F;  3O55 A;  5L0I A;  3H3A A;  2EPN A;  1Q0K A;  3JPP A;  3K33 A;  2A6H F;  2NUT A;  3T9O A;  3LS1 A;  4ATB B;  4YT4 A;  4LT6 A;  3UNG C;  5B1A C;  2ID1 A;  4LDR A;  7ICJ A;  1E2X A;  2BL2 A;  4G7O F;  1I4Y A;  2EIL C;  1Z5Z A;  4OIP F;  4WQK A;  3LEO A;  2OCC C;  5AC4 A;  3U2L A;  1V4A A;  2JPU A;  3UQ0 A;  3EH2 A;  2LSE A;  2W45 A;  1OW8 A;  5CFT A;  4YMN A;  5J2B A;  7ICK A;  2ZD9 A;  4EBJ A;  1RMV A;  3J06 A;  3DAF A;  4RPY A;  2YVK A;  3FVY A;  1OCZ C;  1TFW A;  1R8A A;  2RFF A;  2RSE B;  2H8A A;  4QZF A;  3EGD B;  2KC3 A;  4NXV A;  4M47 A;  8ICE A;  2W4B A;  1ZQF A;  1NLX A;  2PF4 E;  1K40 A;  2NPU A;  4MW3 A;  2V3C C;  5BOM A;  1M56 C;  4MVU A;  5KYU B;  2BCS A;  2M2W A;  4WOY A;  3AG3 C;  4CDY A;  4X0B A;  9ICU A;  3AU6 A;  3RIP A;  2CYD A;  3SXZ A;  2PFO A;  3LNR A;  2NSG A;  1ZHZ A;  5D46 A;  5COF A;  1XWJ A;  1T5O A;  3C2K A;  2GAQ A;  5IIL A;  4QZG A;  3RYL A;  5DB7 A;  3MLG A;  2G62 A;  4LZD A;  4PFP A;  3PMN A;  1UEV A;  4NXU A;  4M0A A;  3OVB A;  8ICF A;  5J0W A;  4RQ4 A;  2LFF A;  9ICI A;  4CDA A;  3LES A;  3SEO A;  1JRA A;  2DR7 A;  4MQ9 F;  2J9W A;  2HS5 A;  3POV A;  3MBY A;  1ORJ A;  4ER9 A;  3NKU A;  1KU2 A;  3AUO A;  1LKX A;  9ICC A;  5KYW A;  4XPY A;  3FAP B;  3EG9 B;  5HV9 A;  4PGQ A;  3PNC A;  3TJ6 A;  3HTK C;  2G3K A;  2J0W A;  1NU7 D;  4DXW A;  3AQB A;  3C18 A;  4Z6E A;  1I4Z A;  1VTM P;  4EKW A;  2O9X A;  3KPH A;  4U5F E;  3EZH A;  4I0U A;  2R05 A;  1HY5 A;  2Q9C A;  2FMQ A;  1ZQW A;  2PXI A;  3U2M A;  2YL3 A;  1VOM A;  5CP2 A;  4CX9 A;  2GWW A;  5T3T A;  2B4V A;  7ICL A;  2AP3 A;  1SF8 A;  5BQH A;  3HNJ A;  1UEU A;  3RVZ A;  2KQ9 A;  4RD9 A;  3HLZ A;  3UR3 C;  3UXN A;  3NVO A;  3SXM A;  4XTK A;  3ZIB A;  2PFP A;  3IHU A;  2KK1 A;  4PGX A;  4XLP F;  2QLA A;  4N4W A;  5D63 A;  3SYN A;  3ECS A;  1C03 A;  2XRH A;  5L3Q A;  3JT1 A;  3WFR E;  4RBN A;  1WWP A;  1R8B A;  3AG2 C;  4FHY A;  3B0X A;  2EPO A;  4E18 A;  4LDK A;  1SYQ A;  4I27 A;  4XPX A;  1GM5 A;  3DJN B;  1OQC A;  2PNO A;  4Z6F A;  3EFO B;  1HW2 A;  4MTF A;  3RJJ A;  4A2N B;  3LLI A;  256B A;  2B0J A;  2GA9 D;  1L7C A;  5DS4 A;  3H38 A;  4OAG A;  4FO1 A;  3EJN A;  3V7L A;  1WOT A;  4K9A A;  2DR8 A;  2XS1 A;  2R7O A;  3C2L A;  3T6J A;  2A6E F;  2XLH A;  2BCR A;  3I5P A;  4WBY A;  2UUH A;  3OV7 A;  4J7T A;  4BJ6 A;  3BRJ A;  4X4S A;  1IZM A;  3QVZ A;  2H7V C;  3NKD A;  2J9V A;  3FDQ A;  1ZQA A;  5AGF A;  2C04 A;  3FOP A;  4U5G A;  2G3V A;  1TWG A;  2XLW A;  4Z6D A;  1D0Z A;  3RKO F;  5HHH A;  4LDQ A;  2Y3G A;  1FFT C;  1LPE A;  1ZU5 A;  5BPC A;  4K96 A;  2Z15 A;  2PP4 A;  3S90 A;  1YLQ A;  1Q0D A;  3AG1 C;  2IXN A;  3AQC A;  4NCQ A;  3JPR A;  2AU5 A;  3L9D A;  1KNY A;  2A0U A;  1H6G A;  1O87 A;  1BR4 A;  2KYH A;  3C8G D;  4W8K A;  4PGY A;  4JKV A;  3WFO A;  4RPX A;  4JJG A;  2VCB A;  4KI2 A; 
#chains in the Genus database with same CATH homology
 2L6G A;  4KLH A;  4RQ8 A;  3OVS A;  1ZJN A;  3TUL A;  4NLK A;  4TUS A;  3JPS A;  4EP7 A;  2FMS A;  2ZH5 A;  3HIY A;  5J0T A;  4NLN A;  4X0A A;  1ZQB A;  4LVS A;  4NXZ A;  5J2G A;  1RZT A;  4KLQ A;  4JWM A;  4R64 A;  4E7X A;  5J0X A;  5DB6 A;  3C2M A;  3RQG A;  3S9O A;  2NRK A;  4NM2 A;  4Z6C A;  4YMO A;  5DBC A;  4E80 A;  3GM2 A;  5HRH A;  4X4Q A;  3UPQ A;  4MF2 A;  1NO5 A;  4ATB A;  5J2I A;  4XEK A;  3HX0 A;  7ICG A;  4X4V A;  7ICP A;  5J2J A;  8ICW A;  4FH5 A;  4FHP A;  8ICJ A;  4QZI A;  2I9G A;  2DRB A;  1RPL A;  4I2G A;  4WC0 A;  5DBB A;  5IIM A;  4X4R A;  4X4P A;  3RJH A;  7ICI A;  4P4O A;  1ZQE A;  4KLS A;  5J2H A;  4XRH A;  2PFN A;  8ICA A;  4R66 A;  1FA0 A;  4YD2 A;  2BPF A;  8ICH A;  5DB9 A;  1ZQM A;  4FHV A;  4E8F A;  1TFY A;  4TUR A;  4MFF A;  3AQK A;  9ICB A;  1XSP A;  2ISP A;  7ICE A;  2BCQ A;  9ICL A;  8ICV A;  3GM1 A;  9ICF A;  1ZQY A;  1ZQL A;  3AJM A;  4WC7 A;  4UB5 A;  9ICQ A;  2JX0 A;  1BPE A;  4RQ3 A;  4RWO A;  1ZQZ A;  5IIO A;  3V72 A;  5DKW A;  4DOB A;  5J0Q A;  2DR9 A;  3RJG A;  9ICJ A;  1MQ3 A;  5IIJ A;  3GDX A;  1JOG A;  4AT7 B;  4I29 A;  2LK4 A;  1UET A;  1VFG A;  1KDH A;  7ICT A;  4DO9 A;  3LQC B;  3C8G A;  4AT9 B;  1JAJ A;  5HRK A;  3GM3 A;  1R89 A;  4UD4 A;  4WCW A;  5D49 A;  2ZH9 A;  1ZJM A;  8ICQ A;  8ICN A;  3C5G A;  7ICM A;  5J0R A;  4R63 A;  4NQF A;  4P4P A;  3MDC A;  4RQ7 A;  3TFR A;  3RJE A;  4NKU A;  7ICH A;  3HJ4 A;  1WTY A;  3U0C A;  3ISB A;  4GXJ A;  1ZQV A;  4X4N A;  4KLD A;  1BPZ A;  1ZQG A;  5HRL A;  4I2I A;  5J29 A;  9ICV A;  9ICO A;  4PHA A;  5F28 E;  2ZH1 A;  4X5V A;  8ICX A;  3JZ0 A;  1BPD A;  4FHW A;  4AT7 A;  3JPQ A;  1HUZ A;  3MFN A;  3H3A A;  4X4T A;  2ZH7 A;  3HW8 A;  2L6F A;  5CB1 A;  4UB3 A;  5HRD A;  2DRA A;  4WC5 A;  4DOC A;  3RQF A;  5D4B A;  9ICE A;  3JPP A;  2VAN A;  4F5O A;  9ICN A;  4NM1 A;  4KLT A;  2BPC A;  4QZD A;  4ATB B;  4XEF A;  4LT6 A;  3UXO A;  4YCX A;  4RT2 A;  2ID1 A;  4RWQ A;  4X4O A;  7ICJ A;  1UFB A;  5DDY A;  4O9M A;  2L6H A;  4YMM A;  5IIN A;  4KLU A;  8ICB A;  9ICW A;  4RQ6 A;  5HR9 A;  9ICR A;  1V4A A;  2JPU A;  1ZQR A;  3UQ0 A;  2Q00 A;  1OW8 A;  1F5A A;  4M9H A;  4YMN A;  5J2B A;  4YD1 A;  7ICK A;  9ICA A;  4EBJ A;  4P4M A;  4RPY A;  3WFS C;  1ZQD A;  3JPT A;  4MF8 A;  4NY8 A;  1TFW A;  1R8A A;  1JN3 A;  4DOA A;  2RFF A;  4F5P A;  3OUY A;  4RQ0 A;  5BOL A;  9ICS A;  3AQN A;  4QZF A;  4UB1 A;  5J2K A;  3H37 A;  4M47 A;  8ICE A;  4EBK A;  4I2H A;  7ICQ A;  3MGH A;  4TUQ A;  1ZQF A;  1VJ7 A;  1K40 A;  8ICG A;  3C8G B;  4F5N A;  3ISC A;  9ICM A;  3RJK A;  1PV3 A;  3JPN A;  5BOM A;  3AQM A;  4UB2 A;  1WOL A;  3B71 A;  3V7K A;  4GXI A;  2BCS A;  2HSB A;  2M2W A;  2ZH4 A;  4M9L A;  4KLL A;  2BPG A;  4X0B A;  9ICU A;  3AU6 A;  4TUP A;  3B0Y A;  8ICC A;  5HHI A;  2M2T A;  2PFO A;  5J2F A;  1OW7 A;  1Q79 A;  7ICR A;  5D46 A;  8ICY A;  3C2K A;  3RQE A;  4FO6 A;  5IIL A;  4QZG A;  2O5A A;  4FH3 A;  5DB7 A;  8ICM A;  5J2D A;  4LZD A;  4I2B A;  4MFA A;  4KLM A;  3PMN A;  2YWA A;  4NKT A;  1UEV A;  4M0A A;  3OVB A;  4QZC A;  5TZV A;  8ICF A;  4WC3 A;  1ZQC A;  4K4H A;  5J0W A;  4M04 A;  4RQ4 A;  4QZE A;  1R8C A;  9ICI A;  5DED A;  8ICO A;  5HRF A;  4QZ9 A;  4QZ8 A;  2ISO A;  9ICH A;  4IQV A;  9ICG A;  2DR7 A;  7ICU A;  2P66 A;  4IQT A;  1ZQI A;  3MBY A;  1ZQQ A;  4R32 A;  5DDM A;  4UD5 A;  1JMS A;  2BCU A;  3AUO A;  9ICC A;  3U3F A;  4PHP A;  4IG8 A;  9ICP A;  3RJF A;  2ZH8 A;  4MFC A;  8ICR A;  3H39 A;  5HRI A;  4K4G A;  4I28 A;  4PGQ A;  4LZG A;  2DR5 A;  3PNC A;  4F5Q A;  3NYB A;  4R65 A;  1O3U A;  3WFQ E;  3C18 A;  4Z6E A;  5CHG A;  4M9G A;  4UAY A;  8ICU A;  4RQ2 A;  4UB4 A;  3OUY B;  3RH6 A;  5J2E A;  4QZB A;  8ICP A;  5J0O A;  5HC9 A;  4WC6 A;  2FMQ A;  1XSL A;  1ZQW A;  3MGI A;  2PXI A;  2FMP A;  1Q78 A;  5CP2 A;  5HRE A;  1BPY A;  4KLF A;  1ZQX A;  4O5K A;  3OVA A;  4RWN A;  4S3N A;  7ICL A;  3O10 A;  8ICT A;  4M9J A;  1UEU A;  4UAW A;  1TV9 A;  4I2A A;  4RT3 A;  3UXN A;  4X4U A;  5CR0 A;  4PHE A;  3TFS A;  3AU2 A;  2PBE A;  3HWT A;  4JWN A;  2BE3 A;  2PFP A;  4WBZ A;  5J0S A;  2KK1 A;  4AT8 A;  4PGX A;  4FHX A;  4KLE A;  4QZH A;  4UAZ A;  4WC4 A;  2ZH6 A;  4RPZ A;  2HHP A;  2ZH2 A;  3WFR E;  4XUS A;  4I2F A;  4PHD A;  5J0U A;  3MDA A;  1WWP A;  1R8B A;  4UBC A;  3RH4 A;  4FHY A;  3B0X A;  5J0Y A;  2W9M A;  2GWS A;  4I27 A;  2ZHA A;  7ICN A;  1BPB A;  1KTM A;  5CWR A;  3RH5 A;  4YN4 A;  3RJI A;  1NOM A;  4XEV A;  4O5C A;  4Z6F A;  2O1P A;  5J2C A;  4PH5 A;  3RJJ A;  1HUO A;  2PFQ A;  4RQ5 A;  4M9N A;  5HRB A;  7ICS A;  4M5D A;  3H38 A;  4F5R A;  4IQW A;  4P2H A;  4PPX A;  4I2D A;  5III A;  4XQ7 A;  3UPS A;  4XQ8 A;  4IQU A;  4GXK A;  1ZQP A;  4M2Y A;  1ZQJ A;  8ICZ A;  4O5E A;  3V7L A;  1ZQU A;  5J0P A;  1WOT A;  5CA7 A;  4NLZ A;  2DR8 A;  3C2L A;  1XSN A;  2Q66 A;  5J2A A;  1ZQN A;  1MIW A;  4KLO A;  2BCR A;  1ZQO A;  3K7D A;  3ISD A;  4WBY A;  3WFP A;  1JQR A;  4UBB A;  3OV7 A;  1ZZP A;  2M2U A;  5DB8 A;  1MIY A;  7ICF A;  3BRJ A;  4X4S A;  1ZQK A;  4RWP A;  3C66 A;  1K05 A;  4QZA A;  3OGU A;  7ICO A;  3L8I A;  1ZQA A;  1K04 A;  3HJ1 A;  3L8J A;  1MIV A;  2ZHB A;  4KLG A;  1PX5 A;  4WC1 A;  3UXP A;  8ICK A;  4Z6D A;  1QVX A;  5HHH A;  3K75 D;  5F2V O;  5DEC A;  5DBA A;  3UQ2 A;  8ICS A;  2ZH3 A;  7ICV A;  8ICI A;  1MQ2 A;  1OU5 A;  3LK9 A;  3V7J A;  3AQL A;  5BPC A;  9ICK A;  9ICT A;  4AT8 B;  4I2J A;  8ICL A;  2M2V A;  4XA5 A;  2IHM A;  4I2E A;  1ZQS A;  1KEJ A;  1YLQ A;  3JPO A;  1TVA A;  5EOZ A;  4KLI A;  1ZQH A;  4WC2 A;  4KLJ A;  3JPR A;  2BCV A;  3L9D A;  1ZQT A;  1KNY A;  5HRG A;  9ICX A;  4AT9 A;  3PML A;  4RQ1 A;  5CJ7 A;  1BPX A;  3C8G D;  3JYY A;  4K4I A;  4PGY A;  3WFO A;  1OW6 A;  4RPX A;  4I2C A;  2DVI A;  3C5F A;  5IIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...