2PBEA

Crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
263
Chain Sequence
LRSEQEMMDIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Aminoglycoside 6-adenylyltransferase
total genus 82
structure length 263
sequence length 282
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2pbeA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2pbeA01
4EP7A 1R8AA 4ATBA 5CA7A 4X4UA 5IIKA 1BPBA 2W9MA 4WC2A 1RPLA 2ID1A 4UD5A 5CR0A 3RJIA 4M2YA 4M9GA 4I27A 7ICRA 4I2IA 8ICZA 3HIYA 2BPFA 1MIWA 4UAYA 4LVSA 1BPEA 8ICSA 3UXNA 5IINA 2L6FA 8ICWA 3MFNA 1UEUA 3JPNA 5D4BA 3V7JA 2YWAA 5HRLA 4FHYA 2Q66A 1R8BA 4X0AA 4K4IA 5IIJA 4R64A 9ICIA 4IQTA 5HRFA 3L8JA 5J0OA 4UD4A 8ICOA 4PHEA 4IQUA 3RJJA 5HRGA 3OGUA 5IIIA 4NLKA 3OVBA 5CJ7A 4RQ2A 3OUYA 1ZQCA 3RJFA 1ZQKA 9ICAA 4GXJA 8ICKA 4AT7A 3C8GB 3O10A 5J29A 2NRKA 2HSBA 4RQ5A 4WBZA 4RQ6A 9ICOA 4KLSA 1TFWA 7ICKA 4NKTA 4NM2A 4I2AA 4PGYA 1VJ7A 1ZJMA 5J0RA 4AT8A 1ZQXA 4YCXA 9ICBA 5J2JA 4QZFA 1ZQUA 1XSNA 2I9GA 4RQ1A 3C2LA 3RH4A 1VFGA 3B0XA 4PGQA 4K4HA 4KLUA 8ICUA 4XQ7A 4YMNA 5IIOA 5J2DA 2KK1A 3C2KA 1ZQJA 3TFRA 3H3AA 1JMSA 3AQMA 3UPSA 8ICJA 3MGHA 3JPOA 5IIMA 3C66A 1WTYA 3OVAA 4FHXA 4FHPA 1ZQPA 3RQGA 1KNYA 4P2HA 8ICRA 4DOBA 1WOLA 3V7KA 9ICSA 4WCWA 4IQWA 4I2FA 7ICUA 8ICHA 4E8FA 2FMPA 8ICGA 2ZH8A 7ICFA 4FHVA 3RJEA 5DDMA 3H37A 1OW8A 4I2CA 5HRKA 5TZVA 1ZQOA 2ISOA 2DR5A 3JPTA 2VANA 1ZQRA 1HUOA 2BPGA 4K4GA 4FHWA 9ICHA 4M9JA 4DO9A 4EBJA 4M9HA 4UB3A 2ZH5A 4RQ0A 1YLQA 4MFAA 9ICMA 1XSLA 3UXOA 9ICRA 1MIVA 3JPQA 1ZZPA 5CP2A 4UBBA 4I28A 5J0XA 1K40A 7ICMA 1R8CA 3GDXA 4KLMA 4RWQA 8ICBA 5J2EA 2ZH6A 4X4VA 4QZ8A 4F5NA 2DVIA 3ISCA 3MBYA 3JZ0A 4MFCA 3RQEA 4TURA 4UBCA 1Q78A 2HHPA 1ZQZA 4WC6A 2BCRA 2ZH2A 4X4NA 2DRBA 5HRBA 2M2TA 4RPYA 1UFBA 3JYYA 4QZDA 5DB9A 5J0PA 8ICYA 4QZBA 2GWSA 4X4TA 4WC1A 3C5GA 3UQ0A 3HWTA 1HUZA 5J0UA 5CWRA 3GM2A 4WC7A 7ICVA 2M2WA 9ICVA 4KLOA 3PMLA 4YN4A 5HHIA 4QZCA 5CB1A 1ZQDA 4RWNA 3RQFA 4MFFA 5DEDA 5HC9A 1ZQMA 2PFNA 1XSPA 4RQ7A 4RWOA 9ICFA 3OV7A 2PXIA 4PGXA 5J2FA 1BPZA 2ZHAA 5DBCA 5J2CA 1K04A 1TVAA 5F2VO 4QZAA 4LZDA 2BCSA 5J0QA 1ZQVA 4WC5A 4RT2A 3V7LA 2PFOA 4X4RA 5DB7A 1MQ2A 2M2UA 1ZJNA 1QVXA 3RJGA 4KLGA 2P66A 9ICEA 3V72A 2FMQA 1ZQLA 3UXPA 5J2IA 2IHMA 4RT3A 4R63A 3AQLA 1ZQAA 1ZQTA 8ICCA 5J0YA 4LT6A 2BE3A 4I2GA 3K7DA 4KLQA 2ZH1A 4WC4A 3RH5A 5DKWA 1PV3A 4RWPA 3HW8A 4KLJA 2JX0A 1KEJA 2BCVA 4PPXA 4XEFA 1FA0A 2PFQA 4M9LA 1ZQYA 3UQ2A 5F28E 4UB2A 3AQNA 3AUOA 9ICNA 4AT8B 4WBYA 1O3UA 8ICPA 1V4AA 4F5PA 9ICTA 5BPCA 4GXKA 4QZHA 4X5VA 4O5KA 4GXIA 3GM3A 1R89A 1ZQGA 4PHAA 3MDAA 2PFPA 4WC3A 4M47A 4RPZA 3JPPA 4R32A 3WFQE 4YMOA 1ZQSA 1F5AA 3ISDA 5DBAA 4RQ8A 4KLTA 8ICVA 5EOZA 2O1PA 4I2HA 5HRIA 2ZHBA 3AU2A 4DOAA 4M0AA 3GM1A 4P4MA 1ZQEA 4UAWA 8ICEA 7ICGA 5HREA 1JQRA 4JWMA 4MF2A 4IG8A 1TV9A 5J2BA 3B0YA 2ZH4A 4F5QA 2RFFA 1WOTA 4FH5A 1BPYA 4F5OA 3OVSA 4YD1A 4QZEA 8ICIA 1ZQWA 4UB5A 4AT9A 3TULA 4KLFA 7ICTA 4NKUA 3L9DA 3LK9A 4I2EA 1UEVA 4NY8A 4X4SA 3HJ1A 4UB1A 5J2GA 4KLHA 1OW6A 4ATBB 5J2KA 1UETA 1JN3A 5J0TA 3PNCA 1Q79A 4XQ8A 4P4PA 2L6HA 4NXZA 3MDCA 4Z6EA 5D46A 2JPUA 1PX5A 4Z6FA 3TFSA 3OUYB 1JAJA 1KTMA 4IQVA 2O5AA 4P4OA 3MGIA 3UPQA 4I2JA 7ICOA 2BPCA 8ICLA 4XA5A 3S9OA 3L8IA 3U3FA 1BPXA 3ISBA 1KDHA 8ICNA 1NOMA 3C18A 9ICGA 1MIYA 4YMMA 5J0SA 4WC0A 1BPDA 7ICHA 2M2VA 8ICTA 9ICUA 4E80A 8ICAA 9ICPA 3U0CA 5D49A 4I29A 4O9MA 4X4QA 4KLEA 4AT7B 8ICQA 5HRDA 4FO6A 1ZQNA 1OU5A 4M9NA 4KLLA 4I2DA 1NO5A 5HR9A 7ICIA 3PMNA 2Q00A 3C5FA 2ZH9A 3AU6A 4S3NA 3AQKA 5DECA 1JOGA 1TFYA 3WFRE 9ICKA 3WFOA 1ZQHA 9ICJA 7ICEA 4TUPA 2BCUA 4R66A 3HJ4A 1ZQBA 2L6GA 5HRHA 7ICJA 9ICWA 9ICQA 4X4PA 8ICXA 5DB8A 4FH3A 9ICXA 4AT9B 4QZIA 4YD2A 4I2BA 4X4OA 4R65A 2DR8A 4PHPA 1ZQIA 3AJMA 7ICNA 8ICFA 7ICQA 4M04A 1MQ3A 5J0WA 5DDYA 1K05A 2DRAA 5J2HA 5J2AA 3H38A 4RPXA 2ZH7A 4UAZA 9ICCA 4RQ4A 4XUSA 2FMSA 1RZTA 2BCQA 1WWPA 1ZQQA 9ICLA 2PBEA 4DOCA 3WFPA 5HHHA 1ZQFA 3NYBA 3H39A 4O5CA 3JPSA 3K75D 4XEKA 4KLIA 4QZGA 3JPRA 3RJKA 4RQ3A 4XRHA 4E7XA 4QZ9A 4TUSA 5IILA 3BRJA 3RH6A 5BOLA 4MF8A 4NLZA 3LQCB 5BOMA 4F5RA 4Z6CA 4TUQA 4KLDA 4Z6DA 4EBKA 4O5EA 4M5DA 3C2MA 5DB6A 5DBBA 3C8GD 2DR9A 2ISPA 4X0BA 3HX0A 3WFSC 3RJHA 2ZH3A 7ICPA 4NLNA 7ICSA 4UB4A 4JWNA 4PH5A 8ICMA 5CHGA 4PHDA 2LK4A 4NM1A 4LZGA 3C8GA 4NQFA 4XEVA 2DR7A 1OW7A 3B71A 7ICLA
chains in the Genus database with same CATH superfamily
3C62A 2OU6A 4X4UA 4MW8A 4E7SA 5CR0A 3RJIA 3L34A 4I2IA 1NLXA 3HIYA 1G5ZA 1ZYRF 2H7OA 1BPEA 5IINA 1U6HA 4FX5A 3M1CB 1FNTc 1NBBA 2W4MA 4JEBA 3W8HA 3JPNA 5BQIA 2MYSA 2MWQA 3V7JA 3VYWA 4X0AA 1PD0A 1D1CA 4U5HA 1W2WA 1NFOA 4HFKB 4UD4A 8ICOA 4PHEA 3RJJA 4WH5A 5HRGA 4U5GA 3LLIA 4MTOA 5EGYA 3PHZA 5CJ7A 3OUYA 9ICAA 4GXJA 5COMA 3C8GB 2XM0A 4AX2A 1HY5A 3SEOA 4RQ6A 1SMYF 4YT4A 3I5PA 4NM2A 4PGYA 3IQ5A 3IPMO 1VJ7A 5B3PA 4MVOA 3TD7A 1ZJMA 2FFHA 4IWBA 3W8IA 4PGQA 5CI9A 2CYDA 1NFNA 2QTVA 3LNRA 3H3AA 3AQMA 4WGYA 1MMAA 1NZEA 4NXVA 4J30B 4FHXA 4FHPA 1OR3A 3NMKA 2AWCA 8ICRA 3GWLA 3V7KA 4WCWA 4U5DE 4I2FA 8ICHA 2LP4A 3K1IA 1A7EA 2EPOA 4I2CA 5L0CA 2ISOA 3NDBB 1ZQRA 1HUOA 2BPGA 2KSFA 1LS1A 1LI7A 3UGPA 2ZH5A 1YLQA 9ICMA 9ICRA 2NUPB 4OAIZ 1NU7D 1ORSC 5CP2A 4CS8A 3KH2A 3GDXA 4KLMA 4U5FE 4CIHA 1LE2A 3CK6A 4X4VA 3HNIA 3OWTA 2WZGA 3MBGA 2VCCA 2X51A 1TWCA 5A6AA 1MNDA 3IEEA 3M4BA 4X4NA 3LUTB 2HV6A 4MNDA 4E7ZA 1IW7F 3JYYA 1E83A 5DB9A 3T9OA 2GWSA 3CZ6A 3ZC4A 3GM2A 3ECSA 3DJNB 5JUAA 2IM8A 1HE1A 4QZCA 5CB1A 1ZQDA 4RWNA 4MFFA 1U89A 1QZXA 2PFNA 3S29A 2BBJA 2HMQA 2HFIA 5J2FA 3RIPA 1BPZA 1MNEA 4JW1A 1TVAA 1K04A 3ER9B 5F2VO 2J0WA 3TQOA 1UG7A 2R7TA 4LZDA 3KMIA 4RT2A 1TQGA 4X4RA 3EGDA 1ZJNA 3RJGA 4JLXA 2FMQA 4HE8D 3S28A 3TOLA 1I4YA 3B29A 1MMGA 1ZQTA 3SXMA 4CS9A 4RD9A 1YYXA 4XLPF 4LT6A 2BE3A 3HNKA 2ZH1A 1VYKA 3EJNA 3RH5A 4RWPA 4KLJA 3HW8A 2J9WA 3KPHA 5A6JA 3HNLA 3LEVA 4M9LA 5KYXA 4DRIB 3UQ2A 5F28E 3ZVRA 3QTHA 5JP7A 2XLEA 3AUOA 5AGFA 2J0XA 3VAYA 1V4AA 4H4KC 9ICTA 3A11A 3OWGA 2WB7A 4M47A 4R32A 2R25A 4YMOA 4H54A 3RW0A 2Y3DA 5COFA 5EOZA 4I2HA 1Z23A 1ZQEA 1JPJA 1KU2A 3IQTA 1Z3IX 8ICEA 1JQRA 3KYIA 4IG8A 4FESA 5J2BA 3B0YA 1M56C 3UMKA 1WOTA 3QW1A 2B51A 4LEYA 2Y3HA 3EHNA 4N7RA 3SNHA 5F5FA 4UB5A 2WVNA 4CS9C 3TULA 4KLFA 3FXHA 3ZTMA 4GYTA 7ICTA 4O67A 3L9DA 1F1MA 1XWJA 1NSGB 5J2GA 2KQ9A 4KLHA 3X2QC 2J46A 1YZCA 3U3BA 3PNCA 2L6HA 4NXZA 2JPUA 2PF4E 3FHDA 3WAQA 1FMVA 1NU9C 3TFSA 5DVWA 1D0ZA 1JAJA 4DJ9A 3AG4C 4IQVA 2QLAA 4D4NA 3E70C 3DWWA 3L8IA 4KM5A 1BPXA 5JSLA 4IARA 3IHUA 4YJWA 5J0SA 3Q6NA 4PR9A 8ICTA 2RSEB 2W45A 3U2LA 4E80A 1OKKD 8ICAA 3G4ZA 4I29A 4O9MA 4J7YA 5HRDA 3G4XA 3EZHA 1BR4A 4JJGA 1OU5A 3DMDA 4G7OF 2AVKA 2KW3C 5E2QA 1OCRC 2LFDA 2IBFA 2XL6A 3PMNA 3K6BA 1OQCA 3C5FA 4KNWA 3LS0A 3WFRE 9ICKA 1Y6DA 3ZQVA 9ICJA 4TUPA 1ZQBA 4G7ZF 3R7CA 3ER8C 4LERA 4EEDA 2DYSC 2R7WA 4X4OA 3DM5A 5D61A 3ZIBA 3GANA 2P61A 2PX3A 3VF0A 3AG1C 5B3SC 2YLDA 3ZSUA 8ICFA 2MHRA 4IAOA 3H2UA 3B0UX 4RPXA 3U8VA 4RQ4A 2FMSA 1RZTA 1WWPA 1YJGA 4DOCA 4Z9IA 2O9XA 4ER9A 3PHF2 1ZHXA 4O5CA 2YKZA 4C3EA 3T6BA 1VTMP 4KLIA 4QZGA 3RJKA 2OG2A 4QZ9A 3BRJA 1Q0DA 4FWVA 4MF8A 4F5RA 2X0CA 4KLDA 4EBKA 4A2NB 4M5DA 1XZQA 5DBBA 1ORJA 2DR9A 4P9TA 4X0BA 3HX0A 5L0DA 3WFSC 3RJHA 1J8MF 4UB4A 4DVZA 2LK4A 4PHDA 1BBHA 1FR0A 4YN0B 4PFPA 3B71A 7ICLA 4EP7A 2EWRA 3K33A 5CA7A 2EIMC 1BPBA 5T3TA 2ID1A 2GAQA 2Q7RA 4AK9A 4I27A 8ICZA 4EBBA 4UAYA 3TOMA 4OD5A 2G3KA 8ICSA 2BC5A 2L6FA 4PJMA 4NCQA 3MFNA 1UEUA 2L7AA 3KL4A 5D4BA 1R8BA 2XSEA 1Q0MA 9ICIA 2Y69C 5HRFA 4EKWA 1HW1A 4E0HA 1BR2A 2VCBA 3OGUA 5IIIA 4NLKA 5EK0A 4L6RA 1ZQCA 1ZQKA 3SZRA 5BQGA 3T6JA 5L3QA 5J29A 4U5BE 4C3DA 4WBZA 1Q0FA 9ICOA 1ZHZA 3BEHA 7ICKA 1H9GA 1VYIA 2YLIA 2UUHA 1HW2A 3EH1A 1CPRA 4JCZA 4YCXA 1ZQXA 4K98A 1ZQUA 2I9GA 3C2LA 1VFGA 8ICUA 4KLUA 4XQ7A 5J2DA 2KK1A 3C2KA 4CX9A 1ZQJA 1JMSA 3UPSA 3DM9B 3JPOA 1ZU5A 3C66A 2WZFA 4WOYA 3OVAA 3SP1A 3JT1A 1ZQPA 4IB4A 3RQGA 1ZHTA 3U9MA 4P2HA 2BL2A 3DD7A 1WOLA 2A1DD 9ICSA 3NYLA 4IQWA 4BJTA 8ICGA 2ZH8A 7ICFA 3RJEA 4MVSA 4DBQA 3H37A 1GS9A 5HRKA 3VM6A 3QVYA 2HJMA 4O68A 2YEVA 3EH2A 5T3WA 2D4UA 4K4GA 2VH3A 4U9EA 3NMIA 4MTGA 4M9JA 4DO9A 5B1BC 4O6YA 3AGTA 3DZAA 2EIKC 3NG1A 1VMAA 4UBBA 2YL1A 3EF2A 7ICMA 1R8CA 1YVIA 5JVEA 1U0BB 1BDJB 2ZH6A 5TJ5E 5CIVA 4QZ8A 2ZPAA 4F5NA 4WQKA 3ISCA 2A68F 3ZWIA 1RKEB 3MBYA 4K96A 2XLWA 4TURA 4UBCA 3LAYA 3OEOA 4G78A 2PP4A 4XJEA 2J7PA 1I5NA 1UFBA 1WN0A 1YAUO 5J0PA 4QZBA 1M2VA 5KYYA 3C5GA 3UQ0A 2B0HA 5DLJA 3HWTA 5J0UA 1E85A 4WC7A 7ICVA 1WATA 2M2WA 4O6MA 4XWJA 4KLOA 3V7OA 1SR2A 3IQ6A 3RQFA 4BJ6C 1LPEA 2NUTB 5DS4A 1G8XA 4JEAA 3TJ6A 1OCZC 2PXIA 4PGXA 4ULWA 3KKBA 4XQ1A 2ZHAA 3SXYA 2H7BA 4YK5A 5DBCA 3DI5A 4QZAA 1FTSA 3JYHA 2FAPB 4WC5A 2DGJA 5JLIA 4NXWA 5DB7A 4ZLDA 2M2UA 1MQ2A 1GQAA 1GPJA 4HX0A 2P66A 2Y3BA 1ZQLA 3UXPA 1APCA 2OEXA 1RKEA 4RT3A 2VASA 2R7UA 1A41A 4J32B 1FAPB 5J0YA 3S27A 1H7IA 2XL4A 5JT4A 3K7DA 5E3AA 2XLMA 2J7PD 2IYLD 5DKWA 1PV3A 3N24A 2JX0A 4PACA 4PPXA 4MVZA 2B4VA 2PFQA 4XLNF 2NSGA 4UB2A 4U9DA 4DOZA 3K1IC 1ZW3A 1O3UA 3U2MA 4F5PA 3ABLC 4GXKA 4QZHA 4O5KA 3UMHA 3MYIA 4GXIA 1B68A 1ZQGA 5L0FA 2I15A 2W9YA 4WC3A 3JPPA 1V54C 3RF3A 1M2VB 5KYYB 4OIOF 3OA1A 5DBAA 4JVSA 4RQ8A 1RJ9A 4KLTA 8ICVA 1ZU4A 2R7RA 3NKUA 3AU2A 4M0AA 3GM1A 3EHMA 3T4RA 3C63A 2HS5A 4CIPA 4PJLA 4MF2A 1R5ID 1TV9A 4N4WA 4WJ0A 4F5QA 1LIHA 5IY5C 1ZVZA 4YL0A 1BPYA 4F5OA 4PJJA 3B0PA 4QZEA 3GORA 4AT9A 2H7VC 4WABA 1R4TA 3LK9A 4CSAA 2P0NA 1UEVA 4UB1A 1S7ZA 4UDVA 1OW6A 3ZTZA 3HKKA 2Y39A 5J0TA 4N6CA 1Q79A 2OQMA 4GEHA 3LJBA 4JTAB 2CNWD 5BUOA 4Z6FA 5K0IA 1N1CA 4Q4ZF 2ZXRA 2A6EF 3UPQA 2C03A 7ICOA 2BPCA 1VLTA 5DS6A 1LE4A 1NOMA 9ICGA 1MIYA 4WC0A 1BPDA 2A0UA 2M2VA 5E3CA 4YWQA 5L3VA 4E0IA 3JTLO 4OAGA 2IOQA 3S90A 4LEZA 4IAQA 4KLEA 3AOUA 8ICQA 2PNOA 3QVZA 4BEMJ 4JZAA 4KLLA 2CW0F 2ICWG 1NO5A 7ICIA 1H6GA 4DBRA 3CSKA 2ZH9A 4S3NA 3AQKA 1JOGA 1TFYA 3WFOA 3AG2C 2EPNA 3U9JA 2BCUA 1DOWA 7ICJA 9ICQA 8ICXA 1OXKA 2QE9A 4AT9B 1SZIA 4QZIA 4YD2A 4K97A 2DR8A 3LLKA 2Q9CA 1SYQA 2YL7A 3MLGA 4EV6A 4Q5SF 1OCCC 7ICNA 7ICQA 1FMWA 5D91A 4YT2A 5CFTA 2DRAA 4BG0A 1V74B 5J2AA 4DXWA 4PK4A 2DI3A 2HKVA 2VB6A 3C8ZA 3J06A 4K0DA 1ZQQA 3Q7GA 2OJQA 2YHSA 2GFHA 2QY9A 4U5CE 2ZXWC 1TWGA 3K75D 3EGXA 3EFOB 1LKXA 3JPRA 5IILA 1ZHYA 4MVUA 3JCUQ 2W4BA 3L1MA 1WASA 4P9FA 4LACB 3LQCB 2HJ3A 4Z6CA 4TUQA 1JR8A 4Z6DA 3NKEA 2V3CC 1NG1A 4K9AA 1Q0KA 3X1OA 4PH5A 2RD9A 5CHGA 4K99A 2ETSA 1OW7A 3AGUA 3FDQA 1R8AA 4ATBA 2LFFA 1ZW2A 2W9MA 1RPLA 4UD5A 4M2YA 2Q4FA 1Y4CA 4OAHA 1MIWA 4LVSA 5E33A 2P6VA 1XZPA 2ASRA 1J8YF 2OOCA 8ICWA 2UUIA 4WQLA 4B6IA 2YWAA 1QPUA 2Q66A 4JTDB 4JURI 5IIJA 1TFOB 4R64A 2B0JA 3L8JA 3HJCA 5J0OA 1ST6A 1CGNA 4I1OB 3OVBA 3RYLA 4RQ2A 3G50A 4O6NA 3NVOA 4AT7A 5KYXB 1AVOB 2NSFA 4BPMA 4P6IC 3UNGC 2YZSA 4F4BA 2HSBA 4RQ5A 2Q3TA 5GPGB 4KLSA 1TFWA 4NKTA 3POVA 1EQ1A 4I0UA 3I4UA 3M79A 4A4AA 2WL8A 5DQTA 3H65A 4I1MA 3U5SA 4AT8A 2CGEA 9ICBA 2GA0A 4K4HA 4RQ1A 3B0XA 5A6BA 2LD6A 1A7DA 3O39A 4YMNA 5IIOA 1M6TA 1T01A 4O79A 3TFRA 3EGDB 8ICJA 3MGHA 4LDQA 4JIOA 2Z15A 4DOBA 2LIGA 7ICUA 1T5OA 2V26A 2IHOA 4K1OA 4FHVA 2J9UA 2XLDA 4W8KA 1OW8A 4IJJA 1ZQOA 3O6XA 3JPTA 2VANA 2PFDA 2OEVA 9ICHA 2CNWA 1D0XA 4MFAA 2LQGA 1XSLA 5D63A 3UXOA 1MIVA 3ATPA 5J0XA 3NYMA 4JKVA 4CSAC 4RWQA 3PDMP 8ICBA 5J2EA 2KNHA 3RH3A 2J8WA 4MFCA 5A69A 3RQEA 2TMVP 1Q78A 5KYWB 2HHPA 4WC6A 2DRBA 5HRBA 2M2TA 4MVRA 3SYNA 3EPVA 4EEBA 3AQCA 1Z7Qc 2JD3A 2EINC 5T1DB 4WC1A 5CWRA 4I44A 3DE9A 9ICVA 4JJFA 4N6HA 3PMLA 2D5RB 4EWCA 5HHIA 3W2VA 1ZQMA 3JSEO 1XSPA 4NXUA 3PMRA 3OV7A 2I8BA 2OKUA 5L0IA 2CDQA 1H9TA 3V5YA 3NMJA 5J2CA 2WVQA 1M2OA 4BJ5A 3JRTA 5HV9A 2BCSA 3FOPA 1E86A 2PFOA 3V7LA 2XS1A 3LEOA 1QVXA 2ZD9A 4KLGA 3I5QA 4NTBA 9ICEA 5J2IA 2IHMA 1JAFA 4RBNA 4X0RA 3AQLA 1VK5A 5HSWA 4C7OB 2NPUA 1CPQA 2HUJA 4I2GA 1YLMA 5KYUB 3NWIA 2CCYA 4J7TA 5AC4A 1KEJA 2BCVA 4XEFA 1FA0A 4LDKA 1TWAA 4JE9A 3AQNA 4EGWA 9ICNA 4AT8B 1DOVA 8ICPA 1LVKA 2L9JA 4OD4A 1RMVA 4NY3A 4PHAA 3MDAA 4RPZA 3IQCA 3SXKA 5A6BD 1ZQSA 1F5AA 3ISDA 2QUPA 2R7QA 3GEEA 2ZHBA 1BR1A 4P4MA 4UAWA 3O55A 7ICGA 5HREA 1LM3B 2ZH4A 2RFFA 3DAGA 1MMNA 4FH5A 1EKYA 3OVSA 1YA7O 1LS4A 1ZQWA 2IXMA 3NKDA 2R7XA 2C04A 2G62A 2XXAB 4PJNA 4PFOA 4ATBB 1JN3A 2HMZA 4P4PA 2KJGA 3RKOF 3MDCA 4Z6EA 5D46A 3S84A 1PX5A 4QDLA 1S05A 4GQHA 1RJ9B 1TFKB 4C3BA 4HFFB 2WZLA 3MGIA 3S9OA 2HZ8A 1KDHA 4AL0A 1RCPA 4BJ6A 4YMMA 4ZLCA 1T6QA 7ICHA 2ZXOA 9ICUA 4ULVA 2YRFA 1RKCA 3HLZA 2L81A 3QW0A 3RVYA 4AT7B 1EI7A 3U8PA 4C7OA 4MW3A 1ZQNA 2XLVA 4M9NA 4I2DA 2A6HF 5A6KA 5HR9A 3H2VA 4NXTA 2Q00A 1D0YA 1IZMA 3AU6A 2FGYA 2J9VA 1ZQHA 3ZDLA 3HJ4A 3VRCA 4E18A 1QLEC 2L6GA 4Z9JA 5HRHA 9ICWA 4O7GA 9ICXA 2P1AA 4I2BA 4XTKA 1VLSA 3PCVA 4R65A 5DQZA 3ABKC 4MS2A 1L3PA 5KYNA 4M04A 1MQ3A 5J0WA 5DDYA 1K05A 4LLCA 5J2HA 4JC7A 2ZH7A 1E2XA 3T6GB 4UAZA 2EILC 1YDIA 4Q7CA 4XUSA 3K1HA 2BCQA 3DKAA 2PBEA 2J9BA 1TKNA 4IGGA 3H39A 3A9CA 4XEKA 4OAFA 4QI0A 4XRHA 2GWWA 1Z63A 5BOLA 3FVYA 4W8PA 4NLZA 2H8AA 2M4EA 3GODA 1E84A 2ZXPA 2J45A 4O5EA 1M57C 2IUBA 5L0JA 2R7VA 1JRAA 3MCRA 1CGOA 4CBEA 4N06A 2ZH3A 7ICPA 4NLNA 2NG1A 7ICSA 2IXOA 3C8GA 4NQFA 2DR7A 4DOAA 5IIKA 4KC9A 4WC2A 4M9GA 5JTGA 7ICRA 2NUPA 1VOMA 1Z6AA 2BPFA 1OCOC 3EZIA 4OIPF 3JSZA 2B56A 2YL0A 4EIYA 3UXNA 4JRZA 1QQ3A 3R2PA 1TWHA 4K8VA 5HRLA 4FHYA 4YL3A 3WHNA 4K4IA 3GEHA 1C02A 4IQTA 4G7HF 1L7CA 4IQUA 1PD1A 3S0XA 3RJFA 8ICKA 4LEVA 2R9RB 1MQVA 3O10A 2NRKA 3SXZA 2P7VA 1T6IA 5BQHA 4AL1A 1G4US 2LSEA 1QKRA 4I2AA 2GAFD 3N0TA 2YLGA 2BE5F 4NXXA 4QI2A 5J0RA 3Q7LA 5J2JA 4QZFA 1XSNA 1OXBA 3RH4A 3MYFA 4CDAA 4DRJB 4EHPA 1PCXA 2OCCC 3UMIA 2F22A 2G3VA 3EFOA 3EGXB 1BZ4A 4MVMA 5IIMA 1EA8A 1WTYA 4K9BA 4G0HA 1KNYA 3MX3A 4YT5A 4MTFA 4E17A 5CFUA 5D62A 1FFTC 4LEWA 1D1BA 4E8FA 2FMPA 5KYWA 3AQBA 5B1AC 3Q6MA 2AP3A 2Q9BA 4LLEA 5L0GA 5B3QA 5DDMA 2QNLA 1YARO 2DYRC 3LS1A 3TK0A 5TZVA 2DR5A 4ONSA 4FHWA 2FCLA 2YL3A 1O87A 5KYUA 4M63A 2WVOA 4EBJA 4M9HA 4UB3A 4RQ0A 3GEIA 3LNMB 1AUEA 3ASNC 3JPQA 1ZZPA 2HSQA 3F46A 4I28A 4WGZA 1K40A 1HE9A 4JTCB 2DVIA 3JZ0A 3HTKC 4ANJA 1SF8A 2R05A 1ZQZA 2BCRA 2ZH2A 2XXAA 3EG9B 3ITFA 3C7JA 4RPYA 2M64A 1I4ZA 4QZDA 2AWYA 8ICYA 2NUTA 1RXQA 4X4TA 1HUZA 3B0VC 5EHHA 1YA9A 3FAJA 5F5HA 4YN4A 2IXPA 5DEDA 5HC9A 4I3MA 2EPLX 4U5EE 2XLHA 1ZHWA 3CQZA 4CDVA 3ERCC 4RQ7A 4RWOA 9ICFA 4XPWA 4KNVA 3NYJA 3EG9A 5CFSA 5J0QA 1ZQVA 1HMOA 2VCAA 2E87A 3RVZA 4EUKB 5L0HA 3UGOA 3V72A 4OIRF 2DB4A 2GA9D 3KYJA 5B3IA 4R63A 3E9VA 1ZQAA 3AG3C 4OIQF 8ICCA 1MMDA 4D4XA 5CHEA 4KLQA 3V5ZA 4WC4A 4CJOA 2GDCA 3EQLF 5JS5A 4O6AA 3DAFA 1ZQYA 4XPXA 1A0BA 3QZCA 4O69A 5FCLA 3M15A 5DS5A 4WBYA 4IRUA 2LCHA 5BPCA 1QSPA 1JMWA 4X5VA 3FMSA 3GM3A 1R89A 4YT8A 2PFPA 4AE4A 2EPKX 3WFQE 3ZQYA 2Y3GA 2EIJC 2O1PA 5HRIA 3HNJA 4Z9HA 2R02A 3ZG1A 1TR2A 4XPYA 1VB5A 2KGOA 4JWMA 2XM4A 3JRMO 2OJED 4DRHB 1AEPA 1CGME 4FO1A 4NTAA 1YYJA 3CEXA 2R7OA 4YD1A 8ICIA 4CS7A 4BEJA 1D1AA 3LESA 4NKUA 5CI8A 4I2EA 2PX0A 2XS8A 1WGWA 4X4SA 4NY8A 3HJ1A 5J2KA 3UR3C 3K66A 1UETA 4XQ8A 2R7SA 4RDAA 2EPMX 2KC3A 3OUYB 1Q0GA 1KTMA 3CAXA 4OINF 2O5AA 2Q9AA 4P4OA 2A69F 4I2JA 8ICLA 4XA5A 3DJUB 3U3FA 3ISBA 4HEAJ 2AU5A 8ICNA 3C18A 3M4CA 3N2ZB 5FZTA 1OR2A 9ICPA 3U0CA 5D49A 4X4QA 1T6UA 4AE4B 4K7BA 2YVKA 4FO6A 2VC9A 3L0IA 3DE8A 3QMKA 1HMDA 1C17M 5AC5A 2XL8A 4YL1A 2HN2A 3FAPB 1G4WR 5DECA 3FOOA 4JCHA 4CDYA 1GGQA 7ICEA 3US6A 3ABMC 5JRAA 4R66A 3B9QA 2XRHA 4LDRA 2IXNA 3WODF 4X4PA 4CS8C 4DVYP 5DB8A 4FH3A 3ASOC 4CJGA 1ORYA 3W2WA 4JLZA 4KBLA 4PHPA 4NTFA 1ZQIA 1YZAA 3DXJF 3AJMA 2HN1A 4MQ9F 3WG7C 4MVQA 2XLOA 3H38A 4BJ5C 9ICCA 5D92A 3V5XA 256BA 1GM5A 4MKPA 3W4YA 1OKKA 9ICLA 3JCFA 3WFPA 5HHHA 1ZQFA 3F47A 3NYBA 4BJ1A 4KI2A 1Z5ZA 3JPSA 1JPNA 1C03A 4KB6A 2YQYA 4RQ3A 4E7XA 4TUSA 3RH6A 1V55C 4FAPB 1A7VA 5BOMA 2HV7A 3NRHA 3C2MA 3GWNA 5DB6A 3RFYA 1T9KA 4NC3A 3C8GD 2ISPA 2BBHA 1LI5A 1O5HA 4JWNA 8ICMA 4NM1A 2R03A 3TJ5A 4LZGA 2A0BA 4XEVA 5COGA 2KYHA 1FFHA
chains in the Genus database with same CATH topology
4EP7A 1R8AA 4ATBA 5CA7A 4X4UA 5IIKA 1BPBA 2W9MA 4WC2A 1RPLA 2ID1A 4UD5A 5CR0A 3RJIA 4M2YA 4M9GA 4I27A 7ICRA 4I2IA 8ICZA 3HIYA 2BPFA 1MIWA 4UAYA 4LVSA 1BPEA 8ICSA 3UXNA 5IINA 2L6FA 8ICWA 3MFNA 1UEUA 3JPNA 5D4BA 3V7JA 2YWAA 5HRLA 4FHYA 2Q66A 1R8BA 4X0AA 4K4IA 5IIJA 4R64A 9ICIA 4IQTA 5HRFA 3L8JA 5J0OA 4UD4A 8ICOA 4PHEA 4IQUA 3RJJA 5HRGA 3OGUA 5IIIA 4NLKA 3OVBA 5CJ7A 4RQ2A 3OUYA 1ZQCA 3RJFA 1ZQKA 9ICAA 4GXJA 8ICKA 4AT7A 3C8GB 3O10A 5J29A 2NRKA 2HSBA 4RQ5A 4WBZA 4RQ6A 9ICOA 4KLSA 1TFWA 7ICKA 4NKTA 4NM2A 4I2AA 4PGYA 1VJ7A 1ZJMA 5J0RA 4AT8A 1ZQXA 4YCXA 9ICBA 5J2JA 4QZFA 1ZQUA 1XSNA 2I9GA 4RQ1A 3C2LA 3RH4A 1VFGA 3B0XA 4PGQA 4K4HA 4KLUA 8ICUA 4XQ7A 4YMNA 5IIOA 5J2DA 2KK1A 3C2KA 1ZQJA 3TFRA 3H3AA 1JMSA 3AQMA 3UPSA 8ICJA 3MGHA 3JPOA 5IIMA 3C66A 1WTYA 3OVAA 4FHXA 4FHPA 1ZQPA 3RQGA 1KNYA 4P2HA 8ICRA 4DOBA 1WOLA 3V7KA 9ICSA 4WCWA 4IQWA 4I2FA 7ICUA 8ICHA 4E8FA 2FMPA 8ICGA 2ZH8A 7ICFA 4FHVA 3RJEA 5DDMA 3H37A 1OW8A 4I2CA 5HRKA 5TZVA 1ZQOA 2ISOA 2DR5A 3JPTA 2VANA 1ZQRA 1HUOA 2BPGA 4K4GA 4FHWA 9ICHA 4M9JA 4DO9A 4EBJA 4M9HA 4UB3A 2ZH5A 4RQ0A 1YLQA 4MFAA 9ICMA 1XSLA 3UXOA 9ICRA 1MIVA 3JPQA 1ZZPA 5CP2A 4UBBA 4I28A 5J0XA 1K40A 7ICMA 1R8CA 3GDXA 4KLMA 4RWQA 8ICBA 5J2EA 2ZH6A 4X4VA 4QZ8A 4F5NA 2DVIA 3ISCA 3MBYA 3JZ0A 4MFCA 3RQEA 4TURA 4UBCA 1Q78A 2HHPA 1ZQZA 4WC6A 2BCRA 2ZH2A 4X4NA 2DRBA 5HRBA 2M2TA 4RPYA 1UFBA 3JYYA 4QZDA 5DB9A 5J0PA 8ICYA 4QZBA 2GWSA 4X4TA 4WC1A 3C5GA 3UQ0A 3HWTA 1HUZA 5J0UA 5CWRA 3GM2A 4WC7A 7ICVA 2M2WA 9ICVA 4KLOA 3PMLA 4YN4A 5HHIA 4QZCA 5CB1A 1ZQDA 4RWNA 3RQFA 4MFFA 5DEDA 5HC9A 1ZQMA 2PFNA 1XSPA 4RQ7A 4RWOA 9ICFA 3OV7A 2PXIA 4PGXA 5J2FA 1BPZA 2ZHAA 5DBCA 5J2CA 1K04A 1TVAA 5F2VO 4QZAA 4LZDA 2BCSA 5J0QA 1ZQVA 4WC5A 4RT2A 3V7LA 2PFOA 4X4RA 5DB7A 1MQ2A 2M2UA 1ZJNA 1QVXA 3RJGA 4KLGA 2P66A 9ICEA 3V72A 2FMQA 1ZQLA 3UXPA 5J2IA 2IHMA 4RT3A 4R63A 3AQLA 1ZQAA 1ZQTA 8ICCA 5J0YA 4LT6A 2BE3A 4I2GA 3K7DA 4KLQA 2ZH1A 4WC4A 3RH5A 5DKWA 1PV3A 4RWPA 3HW8A 4KLJA 2JX0A 1KEJA 2BCVA 4PPXA 4XEFA 1FA0A 2PFQA 4M9LA 1ZQYA 3UQ2A 5F28E 4UB2A 3AQNA 3AUOA 9ICNA 4AT8B 4WBYA 1O3UA 8ICPA 1V4AA 4F5PA 9ICTA 5BPCA 4GXKA 4QZHA 4X5VA 4O5KA 4GXIA 3GM3A 1R89A 1ZQGA 4PHAA 3MDAA 2PFPA 4WC3A 4M47A 4RPZA 3JPPA 4R32A 3WFQE 4YMOA 1ZQSA 1F5AA 3ISDA 5DBAA 4RQ8A 4KLTA 8ICVA 5EOZA 2O1PA 4I2HA 5HRIA 2ZHBA 3AU2A 4DOAA 4M0AA 3GM1A 4P4MA 1ZQEA 4UAWA 8ICEA 7ICGA 5HREA 1JQRA 4JWMA 4MF2A 4IG8A 1TV9A 5J2BA 3B0YA 2ZH4A 4F5QA 2RFFA 1WOTA 4FH5A 1BPYA 4F5OA 3OVSA 4YD1A 4QZEA 8ICIA 1ZQWA 4UB5A 4AT9A 3TULA 4KLFA 7ICTA 4NKUA 3L9DA 3LK9A 4I2EA 1UEVA 4NY8A 4X4SA 3HJ1A 4UB1A 5J2GA 4KLHA 1OW6A 4ATBB 5J2KA 1UETA 1JN3A 5J0TA 3PNCA 1Q79A 4XQ8A 4P4PA 2L6HA 4NXZA 3MDCA 4Z6EA 5D46A 2JPUA 1PX5A 4Z6FA 3TFSA 3OUYB 1JAJA 1KTMA 4IQVA 2O5AA 4P4OA 3MGIA 3UPQA 4I2JA 7ICOA 2BPCA 8ICLA 4XA5A 3S9OA 3L8IA 3U3FA 1BPXA 3ISBA 1KDHA 8ICNA 1NOMA 3C18A 9ICGA 1MIYA 4YMMA 5J0SA 4WC0A 1BPDA 7ICHA 2M2VA 8ICTA 9ICUA 4E80A 8ICAA 9ICPA 3U0CA 5D49A 4I29A 4O9MA 4X4QA 4KLEA 4AT7B 8ICQA 5HRDA 4FO6A 1ZQNA 1OU5A 4M9NA 4KLLA 4I2DA 1NO5A 5HR9A 7ICIA 3PMNA 2Q00A 3C5FA 2ZH9A 3AU6A 4S3NA 3AQKA 5DECA 1JOGA 1TFYA 3WFRE 9ICKA 3WFOA 1ZQHA 9ICJA 7ICEA 4TUPA 2BCUA 4R66A 3HJ4A 1ZQBA 2L6GA 5HRHA 7ICJA 9ICWA 9ICQA 4X4PA 8ICXA 5DB8A 4FH3A 9ICXA 4AT9B 4QZIA 4YD2A 4I2BA 4X4OA 4R65A 2DR8A 4PHPA 1ZQIA 3AJMA 7ICNA 8ICFA 7ICQA 4M04A 1MQ3A 5J0WA 5DDYA 1K05A 2DRAA 5J2HA 5J2AA 3H38A 4RPXA 2ZH7A 4UAZA 9ICCA 4RQ4A 4XUSA 2FMSA 1RZTA 2BCQA 1WWPA 1ZQQA 9ICLA 2PBEA 4DOCA 3WFPA 5HHHA 1ZQFA 3NYBA 3H39A 4O5CA 3JPSA 3K75D 4XEKA 4KLIA 4QZGA 3JPRA 3RJKA 4RQ3A 4XRHA 4E7XA 4QZ9A 4TUSA 5IILA 3BRJA 3RH6A 5BOLA 4MF8A 4NLZA 3LQCB 5BOMA 4F5RA 4Z6CA 4TUQA 4KLDA 4Z6DA 4EBKA 4O5EA 4M5DA 3C2MA 5DB6A 5DBBA 3C8GD 2DR9A 2ISPA 4X0BA 3HX0A 3WFSC 3RJHA 2ZH3A 7ICPA 4NLNA 7ICSA 4UB4A 4JWNA 4PH5A 8ICMA 5CHGA 4PHDA 2LK4A 4NM1A 4LZGA 3C8GA 4NQFA 4XEVA 2DR7A 1OW7A 3B71A 7ICLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EP7 A;  1R8A A;  4ATB A;  5CA7 A;  4X4U A;  5IIK A;  1BPB A;  2W9M A;  4WC2 A;  1RPL A;  2ID1 A;  4UD5 A;  5CR0 A;  3RJI A;  4M2Y A;  4M9G A;  4I27 A;  7ICR A;  4I2I A;  8ICZ A;  3HIY A;  2BPF A;  1MIW A;  4UAY A;  4LVS A;  1BPE A;  8ICS A;  3UXN A;  5IIN A;  2L6F A;  8ICW A;  3MFN A;  1UEU A;  3JPN A;  5D4B A;  3V7J A;  2YWA A;  5HRL A;  4FHY A;  2Q66 A;  1R8B A;  4X0A A;  4K4I A;  5IIJ A;  4R64 A;  9ICI A;  4IQT A;  5HRF A;  3L8J A;  5J0O A;  4UD4 A;  8ICO A;  4PHE A;  4IQU A;  3RJJ A;  5HRG A;  3OGU A;  5III A;  4NLK A;  3OVB A;  5CJ7 A;  4RQ2 A;  3OUY A;  1ZQC A;  3RJF A;  1ZQK A;  9ICA A;  4GXJ A;  8ICK A;  4AT7 A;  3C8G B;  3O10 A;  5J29 A;  2NRK A;  2HSB A;  4RQ5 A;  4WBZ A;  4RQ6 A;  9ICO A;  4KLS A;  1TFW A;  7ICK A;  4NKT A;  4NM2 A;  4I2A A;  4PGY A;  1VJ7 A;  1ZJM A;  5J0R A;  4AT8 A;  1ZQX A;  4YCX A;  9ICB A;  5J2J A;  4QZF A;  1ZQU A;  1XSN A;  2I9G A;  4RQ1 A;  3C2L A;  3RH4 A;  1VFG A;  3B0X A;  4PGQ A;  4K4H A;  4KLU A;  8ICU A;  4XQ7 A;  4YMN A;  5IIO A;  5J2D A;  2KK1 A;  3C2K A;  1ZQJ A;  3TFR A;  3H3A A;  1JMS A;  3AQM A;  3UPS A;  8ICJ A;  3MGH A;  3JPO A;  5IIM A;  3C66 A;  1WTY A;  3OVA A;  4FHX A;  4FHP A;  1ZQP A;  3RQG A;  1KNY A;  4P2H A;  8ICR A;  4DOB A;  1WOL A;  3V7K A;  9ICS A;  4WCW A;  4IQW A;  4I2F A;  7ICU A;  8ICH A;  4E8F A;  2FMP A;  8ICG A;  2ZH8 A;  7ICF A;  4FHV A;  3RJE A;  5DDM A;  3H37 A;  1OW8 A;  4I2C A;  5HRK A;  5TZV A;  1ZQO A;  2ISO A;  2DR5 A;  3JPT A;  2VAN A;  1ZQR A;  1HUO A;  2BPG A;  4K4G A;  4FHW A;  9ICH A;  4M9J A;  4DO9 A;  4EBJ A;  4M9H A;  4UB3 A;  2ZH5 A;  4RQ0 A;  1YLQ A;  4MFA A;  9ICM A;  1XSL A;  3UXO A;  9ICR A;  1MIV A;  3JPQ A;  1ZZP A;  5CP2 A;  4UBB A;  4I28 A;  5J0X A;  1K40 A;  7ICM A;  1R8C A;  3GDX A;  4KLM A;  4RWQ A;  8ICB A;  5J2E A;  2ZH6 A;  4X4V A;  4QZ8 A;  4F5N A;  2DVI A;  3ISC A;  3MBY A;  3JZ0 A;  4MFC A;  3RQE A;  4TUR A;  4UBC A;  1Q78 A;  2HHP A;  1ZQZ A;  4WC6 A;  2BCR A;  2ZH2 A;  4X4N A;  2DRB A;  5HRB A;  2M2T A;  4RPY A;  1UFB A;  3JYY A;  4QZD A;  5DB9 A;  5J0P A;  8ICY A;  4QZB A;  2GWS A;  4X4T A;  4WC1 A;  3C5G A;  3UQ0 A;  3HWT A;  1HUZ A;  5J0U A;  5CWR A;  3GM2 A;  4WC7 A;  7ICV A;  2M2W A;  9ICV A;  4KLO A;  3PML A;  4YN4 A;  5HHI A;  4QZC A;  5CB1 A;  1ZQD A;  4RWN A;  3RQF A;  4MFF A;  5DED A;  5HC9 A;  1ZQM A;  2PFN A;  1XSP A;  4RQ7 A;  4RWO A;  9ICF A;  3OV7 A;  2PXI A;  4PGX A;  5J2F A;  1BPZ A;  2ZHA A;  5DBC A;  5J2C A;  1K04 A;  1TVA A;  5F2V O;  4QZA A;  4LZD A;  2BCS A;  5J0Q A;  1ZQV A;  4WC5 A;  4RT2 A;  3V7L A;  2PFO A;  4X4R A;  5DB7 A;  1MQ2 A;  2M2U A;  1ZJN A;  1QVX A;  3RJG A;  4KLG A;  2P66 A;  9ICE A;  3V72 A;  2FMQ A;  1ZQL A;  3UXP A;  5J2I A;  2IHM A;  4RT3 A;  4R63 A;  3AQL A;  1ZQA A;  1ZQT A;  8ICC A;  5J0Y A;  4LT6 A;  2BE3 A;  4I2G A;  3K7D A;  4KLQ A;  2ZH1 A;  4WC4 A;  3RH5 A;  5DKW A;  1PV3 A;  4RWP A;  3HW8 A;  4KLJ A;  2JX0 A;  1KEJ A;  2BCV A;  4PPX A;  4XEF A;  1FA0 A;  2PFQ A;  4M9L A;  1ZQY A;  3UQ2 A;  5F28 E;  4UB2 A;  3AQN A;  3AUO A;  9ICN A;  4AT8 B;  4WBY A;  1O3U A;  8ICP A;  1V4A A;  4F5P A;  9ICT A;  5BPC A;  4GXK A;  4QZH A;  4X5V A;  4O5K A;  4GXI A;  3GM3 A;  1R89 A;  1ZQG A;  4PHA A;  3MDA A;  2PFP A;  4WC3 A;  4M47 A;  4RPZ A;  3JPP A;  4R32 A;  3WFQ E;  4YMO A;  1ZQS A;  1F5A A;  3ISD A;  5DBA A;  4RQ8 A;  4KLT A;  8ICV A;  5EOZ A;  2O1P A;  4I2H A;  5HRI A;  2ZHB A;  3AU2 A;  4DOA A;  4M0A A;  3GM1 A;  4P4M A;  1ZQE A;  4UAW A;  8ICE A;  7ICG A;  5HRE A;  1JQR A;  4JWM A;  4MF2 A;  4IG8 A;  1TV9 A;  5J2B A;  3B0Y A;  2ZH4 A;  4F5Q A;  2RFF A;  1WOT A;  4FH5 A;  1BPY A;  4F5O A;  3OVS A;  4YD1 A;  4QZE A;  8ICI A;  1ZQW A;  4UB5 A;  4AT9 A;  3TUL A;  4KLF A;  7ICT A;  4NKU A;  3L9D A;  3LK9 A;  4I2E A;  1UEV A;  4NY8 A;  4X4S A;  3HJ1 A;  4UB1 A;  5J2G A;  4KLH A;  1OW6 A;  4ATB B;  5J2K A;  1UET A;  1JN3 A;  5J0T A;  3PNC A;  1Q79 A;  4XQ8 A;  4P4P A;  2L6H A;  4NXZ A;  3MDC A;  4Z6E A;  5D46 A;  2JPU A;  1PX5 A;  4Z6F A;  3TFS A;  3OUY B;  1JAJ A;  1KTM A;  4IQV A;  2O5A A;  4P4O A;  3MGI A;  3UPQ A;  4I2J A;  7ICO A;  2BPC A;  8ICL A;  4XA5 A;  3S9O A;  3L8I A;  3U3F A;  1BPX A;  3ISB A;  1KDH A;  8ICN A;  1NOM A;  3C18 A;  9ICG A;  1MIY A;  4YMM A;  5J0S A;  4WC0 A;  1BPD A;  7ICH A;  2M2V A;  8ICT A;  9ICU A;  4E80 A;  8ICA A;  9ICP A;  3U0C A;  5D49 A;  4I29 A;  4O9M A;  4X4Q A;  4KLE A;  4AT7 B;  8ICQ A;  5HRD A;  4FO6 A;  1ZQN A;  1OU5 A;  4M9N A;  4KLL A;  4I2D A;  1NO5 A;  5HR9 A;  7ICI A;  3PMN A;  2Q00 A;  3C5F A;  2ZH9 A;  3AU6 A;  4S3N A;  3AQK A;  5DEC A;  1JOG A;  1TFY A;  3WFR E;  9ICK A;  3WFO A;  1ZQH A;  9ICJ A;  7ICE A;  4TUP A;  2BCU A;  4R66 A;  3HJ4 A;  1ZQB A;  2L6G A;  5HRH A;  7ICJ A;  9ICW A;  9ICQ A;  4X4P A;  8ICX A;  5DB8 A;  4FH3 A;  9ICX A;  4AT9 B;  4QZI A;  4YD2 A;  4I2B A;  4X4O A;  4R65 A;  2DR8 A;  4PHP A;  1ZQI A;  3AJM A;  7ICN A;  8ICF A;  7ICQ A;  4M04 A;  1MQ3 A;  5J0W A;  5DDY A;  1K05 A;  2DRA A;  5J2H A;  5J2A A;  3H38 A;  4RPX A;  2ZH7 A;  4UAZ A;  9ICC A;  4RQ4 A;  4XUS A;  2FMS A;  1RZT A;  2BCQ A;  1WWP A;  1ZQQ A;  9ICL A;  2PBE A;  4DOC A;  3WFP A;  5HHH A;  1ZQF A;  3NYB A;  3H39 A;  4O5C A;  3JPS A;  3K75 D;  4XEK A;  4KLI A;  4QZG A;  3JPR A;  3RJK A;  4RQ3 A;  4XRH A;  4E7X A;  4QZ9 A;  4TUS A;  5IIL A;  3BRJ A;  3RH6 A;  5BOL A;  4MF8 A;  4NLZ A;  3LQC B;  5BOM A;  4F5R A;  4Z6C A;  4TUQ A;  4KLD A;  4Z6D A;  4EBK A;  4O5E A;  4M5D A;  3C2M A;  5DB6 A;  5DBB A;  3C8G D;  2DR9 A;  2ISP A;  4X0B A;  3HX0 A;  3WFS C;  3RJH A;  2ZH3 A;  7ICP A;  4NLN A;  7ICS A;  4UB4 A;  4JWN A;  4PH5 A;  8ICM A;  5CHG A;  4PHD A;  2LK4 A;  4NM1 A;  4LZG A;  3C8G A;  4NQF A;  4XEV A;  2DR7 A;  1OW7 A;  3B71 A;  7ICL A; 
#chains in the Genus database with same CATH topology
 3C62 A;  2OU6 A;  4X4U A;  4MW8 A;  4E7S A;  5CR0 A;  3RJI A;  3L34 A;  4I2I A;  1NLX A;  3HIY A;  1G5Z A;  1ZYR F;  2H7O A;  1BPE A;  5IIN A;  1U6H A;  4FX5 A;  3M1C B;  1FNT c;  1NBB A;  2W4M A;  4JEB A;  3W8H A;  3JPN A;  5BQI A;  2MYS A;  2MWQ A;  3V7J A;  3VYW A;  4X0A A;  1PD0 A;  1D1C A;  4U5H A;  1W2W A;  1NFO A;  4HFK B;  4UD4 A;  8ICO A;  4PHE A;  3RJJ A;  4WH5 A;  5HRG A;  4U5G A;  3LLI A;  4MTO A;  5EGY A;  3PHZ A;  5CJ7 A;  3OUY A;  9ICA A;  4GXJ A;  5COM A;  3C8G B;  2XM0 A;  4AX2 A;  1HY5 A;  3SEO A;  4RQ6 A;  1SMY F;  4YT4 A;  3I5P A;  4NM2 A;  4PGY A;  3IQ5 A;  3IPM O;  1VJ7 A;  5B3P A;  4MVO A;  3TD7 A;  1ZJM A;  2FFH A;  4IWB A;  3W8I A;  4PGQ A;  5CI9 A;  2CYD A;  1NFN A;  2QTV A;  3LNR A;  3H3A A;  3AQM A;  4WGY A;  1MMA A;  1NZE A;  4NXV A;  4J30 B;  4FHX A;  4FHP A;  1OR3 A;  3NMK A;  2AWC A;  8ICR A;  3GWL A;  3V7K A;  4WCW A;  4U5D E;  4I2F A;  8ICH A;  2LP4 A;  3K1I A;  1A7E A;  2EPO A;  4I2C A;  5L0C A;  2ISO A;  3NDB B;  1ZQR A;  1HUO A;  2BPG A;  2KSF A;  1LS1 A;  1LI7 A;  3UGP A;  2ZH5 A;  1YLQ A;  9ICM A;  9ICR A;  2NUP B;  4OAI Z;  1NU7 D;  1ORS C;  5CP2 A;  4CS8 A;  3KH2 A;  3GDX A;  4KLM A;  4U5F E;  4CIH A;  1LE2 A;  3CK6 A;  4X4V A;  3HNI A;  3OWT A;  2WZG A;  3MBG A;  2VCC A;  2X51 A;  1TWC A;  5A6A A;  1MND A;  3IEE A;  3M4B A;  4X4N A;  3LUT B;  2HV6 A;  4MND A;  4E7Z A;  1IW7 F;  3JYY A;  1E83 A;  5DB9 A;  3T9O A;  2GWS A;  3CZ6 A;  3ZC4 A;  3GM2 A;  3ECS A;  3DJN B;  5JUA A;  2IM8 A;  1HE1 A;  4QZC A;  5CB1 A;  1ZQD A;  4RWN A;  4MFF A;  1U89 A;  1QZX A;  2PFN A;  3S29 A;  2BBJ A;  2HMQ A;  2HFI A;  5J2F A;  3RIP A;  1BPZ A;  1MNE A;  4JW1 A;  1TVA A;  1K04 A;  3ER9 B;  5F2V O;  2J0W A;  3TQO A;  1UG7 A;  2R7T A;  4LZD A;  3KMI A;  4RT2 A;  1TQG A;  4X4R A;  3EGD A;  1ZJN A;  3RJG A;  4JLX A;  2FMQ A;  4HE8 D;  3S28 A;  3TOL A;  1I4Y A;  3B29 A;  1MMG A;  1ZQT A;  3SXM A;  4CS9 A;  4RD9 A;  1YYX A;  4XLP F;  4LT6 A;  2BE3 A;  3HNK A;  2ZH1 A;  1VYK A;  3EJN A;  3RH5 A;  4RWP A;  4KLJ A;  3HW8 A;  2J9W A;  3KPH A;  5A6J A;  3HNL A;  3LEV A;  4M9L A;  5KYX A;  4DRI B;  3UQ2 A;  5F28 E;  3ZVR A;  3QTH A;  5JP7 A;  2XLE A;  3AUO A;  5AGF A;  2J0X A;  3VAY A;  1V4A A;  4H4K C;  9ICT A;  3A11 A;  3OWG A;  2WB7 A;  4M47 A;  4R32 A;  2R25 A;  4YMO A;  4H54 A;  3RW0 A;  2Y3D A;  5COF A;  5EOZ A;  4I2H A;  1Z23 A;  1ZQE A;  1JPJ A;  1KU2 A;  3IQT A;  1Z3I X;  8ICE A;  1JQR A;  3KYI A;  4IG8 A;  4FES A;  5J2B A;  3B0Y A;  1M56 C;  3UMK A;  1WOT A;  3QW1 A;  2B51 A;  4LEY A;  2Y3H A;  3EHN A;  4N7R A;  3SNH A;  5F5F A;  4UB5 A;  2WVN A;  4CS9 C;  3TUL A;  4KLF A;  3FXH A;  3ZTM A;  4GYT A;  7ICT A;  4O67 A;  3L9D A;  1F1M A;  1XWJ A;  1NSG B;  5J2G A;  2KQ9 A;  4KLH A;  3X2Q C;  2J46 A;  1YZC A;  3U3B A;  3PNC A;  2L6H A;  4NXZ A;  2JPU A;  2PF4 E;  3FHD A;  3WAQ A;  1FMV A;  1NU9 C;  3TFS A;  5DVW A;  1D0Z A;  1JAJ A;  4DJ9 A;  3AG4 C;  4IQV A;  2QLA A;  4D4N A;  3E70 C;  3DWW A;  3L8I A;  4KM5 A;  1BPX A;  5JSL A;  4IAR A;  3IHU A;  4YJW A;  5J0S A;  3Q6N A;  4PR9 A;  8ICT A;  2RSE B;  2W45 A;  3U2L A;  4E80 A;  1OKK D;  8ICA A;  3G4Z A;  4I29 A;  4O9M A;  4J7Y A;  5HRD A;  3G4X A;  3EZH A;  1BR4 A;  4JJG A;  1OU5 A;  3DMD A;  4G7O F;  2AVK A;  2KW3 C;  5E2Q A;  1OCR C;  2LFD A;  2IBF A;  2XL6 A;  3PMN A;  3K6B A;  1OQC A;  3C5F A;  4KNW A;  3LS0 A;  3WFR E;  9ICK A;  1Y6D A;  3ZQV A;  9ICJ A;  4TUP A;  1ZQB A;  4G7Z F;  3R7C A;  3ER8 C;  4LER A;  4EED A;  2DYS C;  2R7W A;  4X4O A;  3DM5 A;  5D61 A;  3ZIB A;  3GAN A;  2P61 A;  2PX3 A;  3VF0 A;  3AG1 C;  5B3S C;  2YLD A;  3ZSU A;  8ICF A;  2MHR A;  4IAO A;  3H2U A;  3B0U X;  4RPX A;  3U8V A;  4RQ4 A;  2FMS A;  1RZT A;  1WWP A;  1YJG A;  4DOC A;  4Z9I A;  2O9X A;  4ER9 A;  3PHF 2;  1ZHX A;  4O5C A;  2YKZ A;  4C3E A;  3T6B A;  1VTM P;  4KLI A;  4QZG A;  3RJK A;  2OG2 A;  4QZ9 A;  3BRJ A;  1Q0D A;  4FWV A;  4MF8 A;  4F5R A;  2X0C A;  4KLD A;  4EBK A;  4A2N B;  4M5D A;  1XZQ A;  5DBB A;  1ORJ A;  2DR9 A;  4P9T A;  4X0B A;  3HX0 A;  5L0D A;  3WFS C;  3RJH A;  1J8M F;  4UB4 A;  4DVZ A;  2LK4 A;  4PHD A;  1BBH A;  1FR0 A;  4YN0 B;  4PFP A;  3B71 A;  7ICL A;  4EP7 A;  2EWR A;  3K33 A;  5CA7 A;  2EIM C;  1BPB A;  5T3T A;  2ID1 A;  2GAQ A;  2Q7R A;  4AK9 A;  4I27 A;  8ICZ A;  4EBB A;  4UAY A;  3TOM A;  4OD5 A;  2G3K A;  8ICS A;  2BC5 A;  2L6F A;  4PJM A;  4NCQ A;  3MFN A;  1UEU A;  2L7A A;  3KL4 A;  5D4B A;  1R8B A;  2XSE A;  1Q0M A;  9ICI A;  2Y69 C;  5HRF A;  4EKW A;  1HW1 A;  4E0H A;  1BR2 A;  2VCB A;  3OGU A;  5III A;  4NLK A;  5EK0 A;  4L6R A;  1ZQC A;  1ZQK A;  3SZR A;  5BQG A;  3T6J A;  5L3Q A;  5J29 A;  4U5B E;  4C3D A;  4WBZ A;  1Q0F A;  9ICO A;  1ZHZ A;  3BEH A;  7ICK A;  1H9G A;  1VYI A;  2YLI A;  2UUH A;  1HW2 A;  3EH1 A;  1CPR A;  4JCZ A;  4YCX A;  1ZQX A;  4K98 A;  1ZQU A;  2I9G A;  3C2L A;  1VFG A;  8ICU A;  4KLU A;  4XQ7 A;  5J2D A;  2KK1 A;  3C2K A;  4CX9 A;  1ZQJ A;  1JMS A;  3UPS A;  3DM9 B;  3JPO A;  1ZU5 A;  3C66 A;  2WZF A;  4WOY A;  3OVA A;  3SP1 A;  3JT1 A;  1ZQP A;  4IB4 A;  3RQG A;  1ZHT A;  3U9M A;  4P2H A;  2BL2 A;  3DD7 A;  1WOL A;  2A1D D;  9ICS A;  3NYL A;  4IQW A;  4BJT A;  8ICG A;  2ZH8 A;  7ICF A;  3RJE A;  4MVS A;  4DBQ A;  3H37 A;  1GS9 A;  5HRK A;  3VM6 A;  3QVY A;  2HJM A;  4O68 A;  2YEV A;  3EH2 A;  5T3W A;  2D4U A;  4K4G A;  2VH3 A;  4U9E A;  3NMI A;  4MTG A;  4M9J A;  4DO9 A;  5B1B C;  4O6Y A;  3AGT A;  3DZA A;  2EIK C;  3NG1 A;  1VMA A;  4UBB A;  2YL1 A;  3EF2 A;  7ICM A;  1R8C A;  1YVI A;  5JVE A;  1U0B B;  1BDJ B;  2ZH6 A;  5TJ5 E;  5CIV A;  4QZ8 A;  2ZPA A;  4F5N A;  4WQK A;  3ISC A;  2A68 F;  3ZWI A;  1RKE B;  3MBY A;  4K96 A;  2XLW A;  4TUR A;  4UBC A;  3LAY A;  3OEO A;  4G78 A;  2PP4 A;  4XJE A;  2J7P A;  1I5N A;  1UFB A;  1WN0 A;  1YAU O;  5J0P A;  4QZB A;  1M2V A;  5KYY A;  3C5G A;  3UQ0 A;  2B0H A;  5DLJ A;  3HWT A;  5J0U A;  1E85 A;  4WC7 A;  7ICV A;  1WAT A;  2M2W A;  4O6M A;  4XWJ A;  4KLO A;  3V7O A;  1SR2 A;  3IQ6 A;  3RQF A;  4BJ6 C;  1LPE A;  2NUT B;  5DS4 A;  1G8X A;  4JEA A;  3TJ6 A;  1OCZ C;  2PXI A;  4PGX A;  4ULW A;  3KKB A;  4XQ1 A;  2ZHA A;  3SXY A;  2H7B A;  4YK5 A;  5DBC A;  3DI5 A;  4QZA A;  1FTS A;  3JYH A;  2FAP B;  4WC5 A;  2DGJ A;  5JLI A;  4NXW A;  5DB7 A;  4ZLD A;  2M2U A;  1MQ2 A;  1GQA A;  1GPJ A;  4HX0 A;  2P66 A;  2Y3B A;  1ZQL A;  3UXP A;  1APC A;  2OEX A;  1RKE A;  4RT3 A;  2VAS A;  2R7U A;  1A41 A;  4J32 B;  1FAP B;  5J0Y A;  3S27 A;  1H7I A;  2XL4 A;  5JT4 A;  3K7D A;  5E3A A;  2XLM A;  2J7P D;  2IYL D;  5DKW A;  1PV3 A;  3N24 A;  2JX0 A;  4PAC A;  4PPX A;  4MVZ A;  2B4V A;  2PFQ A;  4XLN F;  2NSG A;  4UB2 A;  4U9D A;  4DOZ A;  3K1I C;  1ZW3 A;  1O3U A;  3U2M A;  4F5P A;  3ABL C;  4GXK A;  4QZH A;  4O5K A;  3UMH A;  3MYI A;  4GXI A;  1B68 A;  1ZQG A;  5L0F A;  2I15 A;  2W9Y A;  4WC3 A;  3JPP A;  1V54 C;  3RF3 A;  1M2V B;  5KYY B;  4OIO F;  3OA1 A;  5DBA A;  4JVS A;  4RQ8 A;  1RJ9 A;  4KLT A;  8ICV A;  1ZU4 A;  2R7R A;  3NKU A;  3AU2 A;  4M0A A;  3GM1 A;  3EHM A;  3T4R A;  3C63 A;  2HS5 A;  4CIP A;  4PJL A;  4MF2 A;  1R5I D;  1TV9 A;  4N4W A;  4WJ0 A;  4F5Q A;  1LIH A;  5IY5 C;  1ZVZ A;  4YL0 A;  1BPY A;  4F5O A;  4PJJ A;  3B0P A;  4QZE A;  3GOR A;  4AT9 A;  2H7V C;  4WAB A;  1R4T A;  3LK9 A;  4CSA A;  2P0N A;  1UEV A;  4UB1 A;  1S7Z A;  4UDV A;  1OW6 A;  3ZTZ A;  3HKK A;  2Y39 A;  5J0T A;  4N6C A;  1Q79 A;  2OQM A;  4GEH A;  3LJB A;  4JTA B;  2CNW D;  5BUO A;  4Z6F A;  5K0I A;  1N1C A;  4Q4Z F;  2ZXR A;  2A6E F;  3UPQ A;  2C03 A;  7ICO A;  2BPC A;  1VLT A;  5DS6 A;  1LE4 A;  1NOM A;  9ICG A;  1MIY A;  4WC0 A;  1BPD A;  2A0U A;  2M2V A;  5E3C A;  4YWQ A;  5L3V A;  4E0I A;  3JTL O;  4OAG A;  2IOQ A;  3S90 A;  4LEZ A;  4IAQ A;  4KLE A;  3AOU A;  8ICQ A;  2PNO A;  3QVZ A;  4BEM J;  4JZA A;  4KLL A;  2CW0 F;  2ICW G;  1NO5 A;  7ICI A;  1H6G A;  4DBR A;  3CSK A;  2ZH9 A;  4S3N A;  3AQK A;  1JOG A;  1TFY A;  3WFO A;  3AG2 C;  2EPN A;  3U9J A;  2BCU A;  1DOW A;  7ICJ A;  9ICQ A;  8ICX A;  1OXK A;  2QE9 A;  4AT9 B;  1SZI A;  4QZI A;  4YD2 A;  4K97 A;  2DR8 A;  3LLK A;  2Q9C A;  1SYQ A;  2YL7 A;  3MLG A;  4EV6 A;  4Q5S F;  1OCC C;  7ICN A;  7ICQ A;  1FMW A;  5D91 A;  4YT2 A;  5CFT A;  2DRA A;  4BG0 A;  1V74 B;  5J2A A;  4DXW A;  4PK4 A;  2DI3 A;  2HKV A;  2VB6 A;  3C8Z A;  3J06 A;  4K0D A;  1ZQQ A;  3Q7G A;  2OJQ A;  2YHS A;  2GFH A;  2QY9 A;  4U5C E;  2ZXW C;  1TWG A;  3K75 D;  3EGX A;  3EFO B;  1LKX A;  3JPR A;  5IIL A;  1ZHY A;  4MVU A;  3JCU Q;  2W4B A;  3L1M A;  1WAS A;  4P9F A;  4LAC B;  3LQC B;  2HJ3 A;  4Z6C A;  4TUQ A;  1JR8 A;  4Z6D A;  3NKE A;  2V3C C;  1NG1 A;  4K9A A;  1Q0K A;  3X1O A;  4PH5 A;  2RD9 A;  5CHG A;  4K99 A;  2ETS A;  1OW7 A;  3AGU A;  3FDQ A;  1R8A A;  4ATB A;  2LFF A;  1ZW2 A;  2W9M A;  1RPL A;  4UD5 A;  4M2Y A;  2Q4F A;  1Y4C A;  4OAH A;  1MIW A;  4LVS A;  5E33 A;  2P6V A;  1XZP A;  2ASR A;  1J8Y F;  2OOC A;  8ICW A;  2UUI A;  4WQL A;  4B6I A;  2YWA A;  1QPU A;  2Q66 A;  4JTD B;  4JUR I;  5IIJ A;  1TFO B;  4R64 A;  2B0J A;  3L8J A;  3HJC A;  5J0O A;  1ST6 A;  1CGN A;  4I1O B;  3OVB A;  3RYL A;  4RQ2 A;  3G50 A;  4O6N A;  3NVO A;  4AT7 A;  5KYX B;  1AVO B;  2NSF A;  4BPM A;  4P6I C;  3UNG C;  2YZS A;  4F4B A;  2HSB A;  4RQ5 A;  2Q3T A;  5GPG B;  4KLS A;  1TFW A;  4NKT A;  3POV A;  1EQ1 A;  4I0U A;  3I4U A;  3M79 A;  4A4A A;  2WL8 A;  5DQT A;  3H65 A;  4I1M A;  3U5S A;  4AT8 A;  2CGE A;  9ICB A;  2GA0 A;  4K4H A;  4RQ1 A;  3B0X A;  5A6B A;  2LD6 A;  1A7D A;  3O39 A;  4YMN A;  5IIO A;  1M6T A;  1T01 A;  4O79 A;  3TFR A;  3EGD B;  8ICJ A;  3MGH A;  4LDQ A;  4JIO A;  2Z15 A;  4DOB A;  2LIG A;  7ICU A;  1T5O A;  2V26 A;  2IHO A;  4K1O A;  4FHV A;  2J9U A;  2XLD A;  4W8K A;  1OW8 A;  4IJJ A;  1ZQO A;  3O6X A;  3JPT A;  2VAN A;  2PFD A;  2OEV A;  9ICH A;  2CNW A;  1D0X A;  4MFA A;  2LQG A;  1XSL A;  5D63 A;  3UXO A;  1MIV A;  3ATP A;  5J0X A;  3NYM A;  4JKV A;  4CSA C;  4RWQ A;  3PDM P;  8ICB A;  5J2E A;  2KNH A;  3RH3 A;  2J8W A;  4MFC A;  5A69 A;  3RQE A;  2TMV P;  1Q78 A;  5KYW B;  2HHP A;  4WC6 A;  2DRB A;  5HRB A;  2M2T A;  4MVR A;  3SYN A;  3EPV A;  4EEB A;  3AQC A;  1Z7Q c;  2JD3 A;  2EIN C;  5T1D B;  4WC1 A;  5CWR A;  4I44 A;  3DE9 A;  9ICV A;  4JJF A;  4N6H A;  3PML A;  2D5R B;  4EWC A;  5HHI A;  3W2V A;  1ZQM A;  3JSE O;  1XSP A;  4NXU A;  3PMR A;  3OV7 A;  2I8B A;  2OKU A;  5L0I A;  2CDQ A;  1H9T A;  3V5Y A;  3NMJ A;  5J2C A;  2WVQ A;  1M2O A;  4BJ5 A;  3JRT A;  5HV9 A;  2BCS A;  3FOP A;  1E86 A;  2PFO A;  3V7L A;  2XS1 A;  3LEO A;  1QVX A;  2ZD9 A;  4KLG A;  3I5Q A;  4NTB A;  9ICE A;  5J2I A;  2IHM A;  1JAF A;  4RBN A;  4X0R A;  3AQL A;  1VK5 A;  5HSW A;  4C7O B;  2NPU A;  1CPQ A;  2HUJ A;  4I2G A;  1YLM A;  5KYU B;  3NWI A;  2CCY A;  4J7T A;  5AC4 A;  1KEJ A;  2BCV A;  4XEF A;  1FA0 A;  4LDK A;  1TWA A;  4JE9 A;  3AQN A;  4EGW A;  9ICN A;  4AT8 B;  1DOV A;  8ICP A;  1LVK A;  2L9J A;  4OD4 A;  1RMV A;  4NY3 A;  4PHA A;  3MDA A;  4RPZ A;  3IQC A;  3SXK A;  5A6B D;  1ZQS A;  1F5A A;  3ISD A;  2QUP A;  2R7Q A;  3GEE A;  2ZHB A;  1BR1 A;  4P4M A;  4UAW A;  3O55 A;  7ICG A;  5HRE A;  1LM3 B;  2ZH4 A;  2RFF A;  3DAG A;  1MMN A;  4FH5 A;  1EKY A;  3OVS A;  1YA7 O;  1LS4 A;  1ZQW A;  2IXM A;  3NKD A;  2R7X A;  2C04 A;  2G62 A;  2XXA B;  4PJN A;  4PFO A;  4ATB B;  1JN3 A;  2HMZ A;  4P4P A;  2KJG A;  3RKO F;  3MDC A;  4Z6E A;  5D46 A;  3S84 A;  1PX5 A;  4QDL A;  1S05 A;  4GQH A;  1RJ9 B;  1TFK B;  4C3B A;  4HFF B;  2WZL A;  3MGI A;  3S9O A;  2HZ8 A;  1KDH A;  4AL0 A;  1RCP A;  4BJ6 A;  4YMM A;  4ZLC A;  1T6Q A;  7ICH A;  2ZXO A;  9ICU A;  4ULV A;  2YRF A;  1RKC A;  3HLZ A;  2L81 A;  3QW0 A;  3RVY A;  4AT7 B;  1EI7 A;  3U8P A;  4C7O A;  4MW3 A;  1ZQN A;  2XLV A;  4M9N A;  4I2D A;  2A6H F;  5A6K A;  5HR9 A;  3H2V A;  4NXT A;  2Q00 A;  1D0Y A;  1IZM A;  3AU6 A;  2FGY A;  2J9V A;  1ZQH A;  3ZDL A;  3HJ4 A;  3VRC A;  4E18 A;  1QLE C;  2L6G A;  4Z9J A;  5HRH A;  9ICW A;  4O7G A;  9ICX A;  2P1A A;  4I2B A;  4XTK A;  1VLS A;  3PCV A;  4R65 A;  5DQZ A;  3ABK C;  4MS2 A;  1L3P A;  5KYN A;  4M04 A;  1MQ3 A;  5J0W A;  5DDY A;  1K05 A;  4LLC A;  5J2H A;  4JC7 A;  2ZH7 A;  1E2X A;  3T6G B;  4UAZ A;  2EIL C;  1YDI A;  4Q7C A;  4XUS A;  3K1H A;  2BCQ A;  3DKA A;  2PBE A;  2J9B A;  1TKN A;  4IGG A;  3H39 A;  3A9C A;  4XEK A;  4OAF A;  4QI0 A;  4XRH A;  2GWW A;  1Z63 A;  5BOL A;  3FVY A;  4W8P A;  4NLZ A;  2H8A A;  2M4E A;  3GOD A;  1E84 A;  2ZXP A;  2J45 A;  4O5E A;  1M57 C;  2IUB A;  5L0J A;  2R7V A;  1JRA A;  3MCR A;  1CGO A;  4CBE A;  4N06 A;  2ZH3 A;  7ICP A;  4NLN A;  2NG1 A;  7ICS A;  2IXO A;  3C8G A;  4NQF A;  2DR7 A;  4DOA A;  5IIK A;  4KC9 A;  4WC2 A;  4M9G A;  5JTG A;  7ICR A;  2NUP A;  1VOM A;  1Z6A A;  2BPF A;  1OCO C;  3EZI A;  4OIP F;  3JSZ A;  2B56 A;  2YL0 A;  4EIY A;  3UXN A;  4JRZ A;  1QQ3 A;  3R2P A;  1TWH A;  4K8V A;  5HRL A;  4FHY A;  4YL3 A;  3WHN A;  4K4I A;  3GEH A;  1C02 A;  4IQT A;  4G7H F;  1L7C A;  4IQU A;  1PD1 A;  3S0X A;  3RJF A;  8ICK A;  4LEV A;  2R9R B;  1MQV A;  3O10 A;  2NRK A;  3SXZ A;  2P7V A;  1T6I A;  5BQH A;  4AL1 A;  1G4U S;  2LSE A;  1QKR A;  4I2A A;  2GAF D;  3N0T A;  2YLG A;  2BE5 F;  4NXX A;  4QI2 A;  5J0R A;  3Q7L A;  5J2J A;  4QZF A;  1XSN A;  1OXB A;  3RH4 A;  3MYF A;  4CDA A;  4DRJ B;  4EHP A;  1PCX A;  2OCC C;  3UMI A;  2F22 A;  2G3V A;  3EFO A;  3EGX B;  1BZ4 A;  4MVM A;  5IIM A;  1EA8 A;  1WTY A;  4K9B A;  4G0H A;  1KNY A;  3MX3 A;  4YT5 A;  4MTF A;  4E17 A;  5CFU A;  5D62 A;  1FFT C;  4LEW A;  1D1B A;  4E8F A;  2FMP A;  5KYW A;  3AQB A;  5B1A C;  3Q6M A;  2AP3 A;  2Q9B A;  4LLE A;  5L0G A;  5B3Q A;  5DDM A;  2QNL A;  1YAR O;  2DYR C;  3LS1 A;  3TK0 A;  5TZV A;  2DR5 A;  4ONS A;  4FHW A;  2FCL A;  2YL3 A;  1O87 A;  5KYU A;  4M63 A;  2WVO A;  4EBJ A;  4M9H A;  4UB3 A;  4RQ0 A;  3GEI A;  3LNM B;  1AUE A;  3ASN C;  3JPQ A;  1ZZP A;  2HSQ A;  3F46 A;  4I28 A;  4WGZ A;  1K40 A;  1HE9 A;  4JTC B;  2DVI A;  3JZ0 A;  3HTK C;  4ANJ A;  1SF8 A;  2R05 A;  1ZQZ A;  2BCR A;  2ZH2 A;  2XXA A;  3EG9 B;  3ITF A;  3C7J A;  4RPY A;  2M64 A;  1I4Z A;  4QZD A;  2AWY A;  8ICY A;  2NUT A;  1RXQ A;  4X4T A;  1HUZ A;  3B0V C;  5EHH A;  1YA9 A;  3FAJ A;  5F5H A;  4YN4 A;  2IXP A;  5DED A;  5HC9 A;  4I3M A;  2EPL X;  4U5E E;  2XLH A;  1ZHW A;  3CQZ A;  4CDV A;  3ERC C;  4RQ7 A;  4RWO A;  9ICF A;  4XPW A;  4KNV A;  3NYJ A;  3EG9 A;  5CFS A;  5J0Q A;  1ZQV A;  1HMO A;  2VCA A;  2E87 A;  3RVZ A;  4EUK B;  5L0H A;  3UGO A;  3V72 A;  4OIR F;  2DB4 A;  2GA9 D;  3KYJ A;  5B3I A;  4R63 A;  3E9V A;  1ZQA A;  3AG3 C;  4OIQ F;  8ICC A;  1MMD A;  4D4X A;  5CHE A;  4KLQ A;  3V5Z A;  4WC4 A;  4CJO A;  2GDC A;  3EQL F;  5JS5 A;  4O6A A;  3DAF A;  1ZQY A;  4XPX A;  1A0B A;  3QZC A;  4O69 A;  5FCL A;  3M15 A;  5DS5 A;  4WBY A;  4IRU A;  2LCH A;  5BPC A;  1QSP A;  1JMW A;  4X5V A;  3FMS A;  3GM3 A;  1R89 A;  4YT8 A;  2PFP A;  4AE4 A;  2EPK X;  3WFQ E;  3ZQY A;  2Y3G A;  2EIJ C;  2O1P A;  5HRI A;  3HNJ A;  4Z9H A;  2R02 A;  3ZG1 A;  1TR2 A;  4XPY A;  1VB5 A;  2KGO A;  4JWM A;  2XM4 A;  3JRM O;  2OJE D;  4DRH B;  1AEP A;  1CGM E;  4FO1 A;  4NTA A;  1YYJ A;  3CEX A;  2R7O A;  4YD1 A;  8ICI A;  4CS7 A;  4BEJ A;  1D1A A;  3LES A;  4NKU A;  5CI8 A;  4I2E A;  2PX0 A;  2XS8 A;  1WGW A;  4X4S A;  4NY8 A;  3HJ1 A;  5J2K A;  3UR3 C;  3K66 A;  1UET A;  4XQ8 A;  2R7S A;  4RDA A;  2EPM X;  2KC3 A;  3OUY B;  1Q0G A;  1KTM A;  3CAX A;  4OIN F;  2O5A A;  2Q9A A;  4P4O A;  2A69 F;  4I2J A;  8ICL A;  4XA5 A;  3DJU B;  3U3F A;  3ISB A;  4HEA J;  2AU5 A;  8ICN A;  3C18 A;  3M4C A;  3N2Z B;  5FZT A;  1OR2 A;  9ICP A;  3U0C A;  5D49 A;  4X4Q A;  1T6U A;  4AE4 B;  4K7B A;  2YVK A;  4FO6 A;  2VC9 A;  3L0I A;  3DE8 A;  3QMK A;  1HMD A;  1C17 M;  5AC5 A;  2XL8 A;  4YL1 A;  2HN2 A;  3FAP B;  1G4W R;  5DEC A;  3FOO A;  4JCH A;  4CDY A;  1GGQ A;  7ICE A;  3US6 A;  3ABM C;  5JRA A;  4R66 A;  3B9Q A;  2XRH A;  4LDR A;  2IXN A;  3WOD F;  4X4P A;  4CS8 C;  4DVY P;  5DB8 A;  4FH3 A;  3ASO C;  4CJG A;  1ORY A;  3W2W A;  4JLZ A;  4KBL A;  4PHP A;  4NTF A;  1ZQI A;  1YZA A;  3DXJ F;  3AJM A;  2HN1 A;  4MQ9 F;  3WG7 C;  4MVQ A;  2XLO A;  3H38 A;  4BJ5 C;  9ICC A;  5D92 A;  3V5X A;  256B A;  1GM5 A;  4MKP A;  3W4Y A;  1OKK A;  9ICL A;  3JCF A;  3WFP A;  5HHH A;  1ZQF A;  3F47 A;  3NYB A;  4BJ1 A;  4KI2 A;  1Z5Z A;  3JPS A;  1JPN A;  1C03 A;  4KB6 A;  2YQY A;  4RQ3 A;  4E7X A;  4TUS A;  3RH6 A;  1V55 C;  4FAP B;  1A7V A;  5BOM A;  2HV7 A;  3NRH A;  3C2M A;  3GWN A;  5DB6 A;  3RFY A;  1T9K A;  4NC3 A;  3C8G D;  2ISP A;  2BBH A;  1LI5 A;  1O5H A;  4JWN A;  8ICM A;  4NM1 A;  2R03 A;  3TJ5 A;  4LZG A;  2A0B A;  4XEV A;  5COG A;  2KYH A;  1FFH A; 
#chains in the Genus database with same CATH homology
 4EP7 A;  1R8A A;  4ATB A;  5CA7 A;  4X4U A;  5IIK A;  1BPB A;  2W9M A;  4WC2 A;  1RPL A;  2ID1 A;  4UD5 A;  5CR0 A;  3RJI A;  4M2Y A;  4M9G A;  4I27 A;  7ICR A;  4I2I A;  8ICZ A;  3HIY A;  2BPF A;  1MIW A;  4UAY A;  4LVS A;  1BPE A;  8ICS A;  3UXN A;  5IIN A;  2L6F A;  8ICW A;  3MFN A;  1UEU A;  3JPN A;  5D4B A;  3V7J A;  2YWA A;  5HRL A;  4FHY A;  2Q66 A;  1R8B A;  4X0A A;  4K4I A;  5IIJ A;  4R64 A;  9ICI A;  4IQT A;  5HRF A;  3L8J A;  5J0O A;  4UD4 A;  8ICO A;  4PHE A;  4IQU A;  3RJJ A;  5HRG A;  3OGU A;  5III A;  4NLK A;  3OVB A;  5CJ7 A;  4RQ2 A;  3OUY A;  1ZQC A;  3RJF A;  1ZQK A;  9ICA A;  4GXJ A;  8ICK A;  4AT7 A;  3C8G B;  3O10 A;  5J29 A;  2NRK A;  2HSB A;  4RQ5 A;  4WBZ A;  4RQ6 A;  9ICO A;  4KLS A;  1TFW A;  7ICK A;  4NKT A;  4NM2 A;  4I2A A;  4PGY A;  1VJ7 A;  1ZJM A;  5J0R A;  4AT8 A;  1ZQX A;  4YCX A;  9ICB A;  5J2J A;  4QZF A;  1ZQU A;  1XSN A;  2I9G A;  4RQ1 A;  3C2L A;  3RH4 A;  1VFG A;  3B0X A;  4PGQ A;  4K4H A;  4KLU A;  8ICU A;  4XQ7 A;  4YMN A;  5IIO A;  5J2D A;  2KK1 A;  3C2K A;  1ZQJ A;  3TFR A;  3H3A A;  1JMS A;  3AQM A;  3UPS A;  8ICJ A;  3MGH A;  3JPO A;  5IIM A;  3C66 A;  1WTY A;  3OVA A;  4FHX A;  4FHP A;  1ZQP A;  3RQG A;  1KNY A;  4P2H A;  8ICR A;  4DOB A;  1WOL A;  3V7K A;  9ICS A;  4WCW A;  4IQW A;  4I2F A;  7ICU A;  8ICH A;  4E8F A;  2FMP A;  8ICG A;  2ZH8 A;  7ICF A;  4FHV A;  3RJE A;  5DDM A;  3H37 A;  1OW8 A;  4I2C A;  5HRK A;  5TZV A;  1ZQO A;  2ISO A;  2DR5 A;  3JPT A;  2VAN A;  1ZQR A;  1HUO A;  2BPG A;  4K4G A;  4FHW A;  9ICH A;  4M9J A;  4DO9 A;  4EBJ A;  4M9H A;  4UB3 A;  2ZH5 A;  4RQ0 A;  1YLQ A;  4MFA A;  9ICM A;  1XSL A;  3UXO A;  9ICR A;  1MIV A;  3JPQ A;  1ZZP A;  5CP2 A;  4UBB A;  4I28 A;  5J0X A;  1K40 A;  7ICM A;  1R8C A;  3GDX A;  4KLM A;  4RWQ A;  8ICB A;  5J2E A;  2ZH6 A;  4X4V A;  4QZ8 A;  4F5N A;  2DVI A;  3ISC A;  3MBY A;  3JZ0 A;  4MFC A;  3RQE A;  4TUR A;  4UBC A;  1Q78 A;  2HHP A;  1ZQZ A;  4WC6 A;  2BCR A;  2ZH2 A;  4X4N A;  2DRB A;  5HRB A;  2M2T A;  4RPY A;  1UFB A;  3JYY A;  4QZD A;  5DB9 A;  5J0P A;  8ICY A;  4QZB A;  2GWS A;  4X4T A;  4WC1 A;  3C5G A;  3UQ0 A;  3HWT A;  1HUZ A;  5J0U A;  5CWR A;  3GM2 A;  4WC7 A;  7ICV A;  2M2W A;  9ICV A;  4KLO A;  3PML A;  4YN4 A;  5HHI A;  4QZC A;  5CB1 A;  1ZQD A;  4RWN A;  3RQF A;  4MFF A;  5DED A;  5HC9 A;  1ZQM A;  2PFN A;  1XSP A;  4RQ7 A;  4RWO A;  9ICF A;  3OV7 A;  2PXI A;  4PGX A;  5J2F A;  1BPZ A;  2ZHA A;  5DBC A;  5J2C A;  1K04 A;  1TVA A;  5F2V O;  4QZA A;  4LZD A;  2BCS A;  5J0Q A;  1ZQV A;  4WC5 A;  4RT2 A;  3V7L A;  2PFO A;  4X4R A;  5DB7 A;  1MQ2 A;  2M2U A;  1ZJN A;  1QVX A;  3RJG A;  4KLG A;  2P66 A;  9ICE A;  3V72 A;  2FMQ A;  1ZQL A;  3UXP A;  5J2I A;  2IHM A;  4RT3 A;  4R63 A;  3AQL A;  1ZQA A;  1ZQT A;  8ICC A;  5J0Y A;  4LT6 A;  2BE3 A;  4I2G A;  3K7D A;  4KLQ A;  2ZH1 A;  4WC4 A;  3RH5 A;  5DKW A;  1PV3 A;  4RWP A;  3HW8 A;  4KLJ A;  2JX0 A;  1KEJ A;  2BCV A;  4PPX A;  4XEF A;  1FA0 A;  2PFQ A;  4M9L A;  1ZQY A;  3UQ2 A;  5F28 E;  4UB2 A;  3AQN A;  3AUO A;  9ICN A;  4AT8 B;  4WBY A;  1O3U A;  8ICP A;  1V4A A;  4F5P A;  9ICT A;  5BPC A;  4GXK A;  4QZH A;  4X5V A;  4O5K A;  4GXI A;  3GM3 A;  1R89 A;  1ZQG A;  4PHA A;  3MDA A;  2PFP A;  4WC3 A;  4M47 A;  4RPZ A;  3JPP A;  4R32 A;  3WFQ E;  4YMO A;  1ZQS A;  1F5A A;  3ISD A;  5DBA A;  4RQ8 A;  4KLT A;  8ICV A;  5EOZ A;  2O1P A;  4I2H A;  5HRI A;  2ZHB A;  3AU2 A;  4DOA A;  4M0A A;  3GM1 A;  4P4M A;  1ZQE A;  4UAW A;  8ICE A;  7ICG A;  5HRE A;  1JQR A;  4JWM A;  4MF2 A;  4IG8 A;  1TV9 A;  5J2B A;  3B0Y A;  2ZH4 A;  4F5Q A;  2RFF A;  1WOT A;  4FH5 A;  1BPY A;  4F5O A;  3OVS A;  4YD1 A;  4QZE A;  8ICI A;  1ZQW A;  4UB5 A;  4AT9 A;  3TUL A;  4KLF A;  7ICT A;  4NKU A;  3L9D A;  3LK9 A;  4I2E A;  1UEV A;  4NY8 A;  4X4S A;  3HJ1 A;  4UB1 A;  5J2G A;  4KLH A;  1OW6 A;  4ATB B;  5J2K A;  1UET A;  1JN3 A;  5J0T A;  3PNC A;  1Q79 A;  4XQ8 A;  4P4P A;  2L6H A;  4NXZ A;  3MDC A;  4Z6E A;  5D46 A;  2JPU A;  1PX5 A;  4Z6F A;  3TFS A;  3OUY B;  1JAJ A;  1KTM A;  4IQV A;  2O5A A;  4P4O A;  3MGI A;  3UPQ A;  4I2J A;  7ICO A;  2BPC A;  8ICL A;  4XA5 A;  3S9O A;  3L8I A;  3U3F A;  1BPX A;  3ISB A;  1KDH A;  8ICN A;  1NOM A;  3C18 A;  9ICG A;  1MIY A;  4YMM A;  5J0S A;  4WC0 A;  1BPD A;  7ICH A;  2M2V A;  8ICT A;  9ICU A;  4E80 A;  8ICA A;  9ICP A;  3U0C A;  5D49 A;  4I29 A;  4O9M A;  4X4Q A;  4KLE A;  4AT7 B;  8ICQ A;  5HRD A;  4FO6 A;  1ZQN A;  1OU5 A;  4M9N A;  4KLL A;  4I2D A;  1NO5 A;  5HR9 A;  7ICI A;  3PMN A;  2Q00 A;  3C5F A;  2ZH9 A;  3AU6 A;  4S3N A;  3AQK A;  5DEC A;  1JOG A;  1TFY A;  3WFR E;  9ICK A;  3WFO A;  1ZQH A;  9ICJ A;  7ICE A;  4TUP A;  2BCU A;  4R66 A;  3HJ4 A;  1ZQB A;  2L6G A;  5HRH A;  7ICJ A;  9ICW A;  9ICQ A;  4X4P A;  8ICX A;  5DB8 A;  4FH3 A;  9ICX A;  4AT9 B;  4QZI A;  4YD2 A;  4I2B A;  4X4O A;  4R65 A;  2DR8 A;  4PHP A;  1ZQI A;  3AJM A;  7ICN A;  8ICF A;  7ICQ A;  4M04 A;  1MQ3 A;  5J0W A;  5DDY A;  1K05 A;  2DRA A;  5J2H A;  5J2A A;  3H38 A;  4RPX A;  2ZH7 A;  4UAZ A;  9ICC A;  4RQ4 A;  4XUS A;  2FMS A;  1RZT A;  2BCQ A;  1WWP A;  1ZQQ A;  9ICL A;  2PBE A;  4DOC A;  3WFP A;  5HHH A;  1ZQF A;  3NYB A;  3H39 A;  4O5C A;  3JPS A;  3K75 D;  4XEK A;  4KLI A;  4QZG A;  3JPR A;  3RJK A;  4RQ3 A;  4XRH A;  4E7X A;  4QZ9 A;  4TUS A;  5IIL A;  3BRJ A;  3RH6 A;  5BOL A;  4MF8 A;  4NLZ A;  3LQC B;  5BOM A;  4F5R A;  4Z6C A;  4TUQ A;  4KLD A;  4Z6D A;  4EBK A;  4O5E A;  4M5D A;  3C2M A;  5DB6 A;  5DBB A;  3C8G D;  2DR9 A;  2ISP A;  4X0B A;  3HX0 A;  3WFS C;  3RJH A;  2ZH3 A;  7ICP A;  4NLN A;  7ICS A;  4UB4 A;  4JWN A;  4PH5 A;  8ICM A;  5CHG A;  4PHD A;  2LK4 A;  4NM1 A;  4LZG A;  3C8G A;  4NQF A;  4XEV A;  2DR7 A;  1OW7 A;  3B71 A;  7ICL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...