2PBEA

Crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
263
Chain Sequence
LRSEQEMMDIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-adenylyltransferase
publication title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 82
structure length 263
sequence length 282
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2pbeA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2pbeA01
9ICCA 3OUYA 4NM1A 1ZQWA 9ICGA 1UEUA 4I28A 3MGHA 4R65A 5J0PA 8ICAA 5DKWA 5J2GA 1ZQQA 7ICVA 3PNCA 3RJKA 2I9GA 2DR9A 4QZAA 4KLUA 4KLOA 5IIOA 4E8FA 5HRLA 9ICQA 2ZH9A 5IIMA 1JN3A 5J0XA 1MQ3A 4I29A 5J29A 4RQ2A 2M2UA 8ICMA 2YWAA 1YLQA 3B71A 5HRIA 4UAWA 4EBKA 1ZQSA 5BOLA 3O10A 4NKTA 3TULA 3HW8A 3RH5A 5CWRA 4RQ6A 3K7DA 4F5PA 2IHMA 2HHPA 4P4OA 7ICHA 1MIWA 5J2KA 2BCUA 4M2YA 4AT7A 3OVAA 4KLGA 5D46A 8ICJA 4MF2A 4AT9B 9ICLA 3LQCB 2ID1A 9ICIA 3RH6A 4XA5A 4LVSA 2PXIA 2DVIA 4Z6DA 5HREA 2BE3A 5HRGA 5CA7A 4X4NA 5DBCA 2NRKA 3H3AA 3V7LA 2ZH8A 5HHIA 4X4PA 1NOMA 4XQ7A 3C8GB 4F5RA 4QZGA 4TUPA 5DDYA 4NLZA 3WFSC 4M9NA 4TUSA 8ICZA 4RWNA 5J2JA 8ICLA 4QZ8A 1WWPA 2M2VA 5DB7A 2PFOA 2ZH6A 2BCQA 3GM3A 4PGXA 3C8GD 4FH5A 4AT8B 4X4RA 4XEKA 4DOAA 5EOZA 2ISPA 5HR9A 3H38A 4RQ5A 1ZQZA 4WC4A 4QZ9A 1ZQXA 5CJ7A 7ICQA 4F5NA 7ICRA 4X4UA 3OGUA 5J2EA 2ZH7A 4RWOA 5HRKA 4I2FA 2O5AA 1XSLA 1ZQJA 2W9MA 4UD4A 4QZHA 9ICHA 4FHXA 9ICJA 2DR5A 4FHPA 4RWQA 3MFNA 1F5AA 4M04A 5IINA 1BPEA 3UQ0A 3RH4A 3RQEA 4KLSA 1OW7A 1TFWA 4XQ8A 4M9JA 8ICXA 4RQ4A 1ZQOA 4MFFA 5J0SA 5J2AA 2BCRA 5DB8A 4KLMA 4NXZA 4XUSA 4YN4A 4QZCA 4QZDA 1XSNA 4FH3A 3OUYB 2M2TA 5CB1A 4QZIA 5J2IA 3MDCA 8ICCA 4UB3A 9ICFA 4R66A 3C18A 4RPZA 2ZHBA 3AQNA 4X4TA 3UXPA 4EP7A 2ZHAA 4I27A 4KLHA 4O5EA 4I2JA 3ISDA 4WCWA 4O9MA 1ZQCA 4PH5A 3UXNA 3WFPA 3C2KA 9ICMA 3AQLA 5J2CA 1KNYA 1ZQGA 2PFPA 4GXJA 1KEJA 3HIYA 4NM2A 3MGIA 2ZH4A 4RT3A 8ICNA 1JQRA 7ICLA 2PFNA 5HRDA 4I2IA 3JPRA 4TUQA 1ZQLA 1ZQDA 1PX5A 4RQ3A 4GXIA 5CR0A 4I2AA 3UQ2A 4KLJA 5DECA 5F2VO 8ICQA 3UPSA 4RPXA 4WC6A 3JPQA 4NY8A 4K4GA 3BRJA 4K4IA 4PHDA 4LT6A 5D49A 3JZ0A 3AU6A 2JPUA 4UBBA 4X5VA 3U0CA 2M2WA 4M9LA 4KLTA 1ZQAA 5J0UA 1JOGA 3TFSA 8ICHA 8ICWA 3WFRE 4X0BA 3AQMA 4M9HA 1ZJMA 4FHYA 5BPCA 3V7JA 5J0TA 1MIYA 1ZQVA 4E7XA 3OVSA 2BPFA 3AJMA 2LK4A 1JMSA 3TFRA 1ZQPA 5IIIA 9ICVA 4Z6CA 9ICOA 3L8IA 4WC5A 5DBBA 4AT9A 1ZQRA 2GWSA 7ICMA 4MFAA 4S3NA 3GM2A 9ICEA 7ICKA 8ICIA 2KK1A 2O1PA 8ICEA 4QZBA 1Q78A 2BCVA 4F5QA 3L9DA 3ISCA 1R8AA 4KLEA 4I2GA 1TV9A 4O5CA 1KTMA 4X4SA 7ICJA 2L6HA 8ICFA 4WC3A 3C8GA 1WOTA 3PMNA 4XRHA 1Q79A 2Q66A 9ICAA 4KLLA 4IQUA 3C5FA 8ICUA 3WFOA 2HSBA 4FHVA 2PBEA 4E80A 1BPDA 4NKUA 4KLIA 4DO9A 4X4OA 7ICOA 3JYYA 2VANA 4YMOA 4Z6EA 2DRBA 4NLNA 2P66A 4PPXA 4TURA 7ICGA 4UAYA 5HRBA 4MF8A 1ZZPA 2L6GA 4X0AA 4P2HA 3MBYA 4ATBB 4IQVA 5IIJA 9ICKA 4YMNA 5IILA 3JPSA 1MQ2A 1HUOA 3C66A 2BCSA 9ICTA 3AQKA 1K04A 4NQFA 3AUOA 1MIVA 4UD5A 5TZVA 4QZFA 4UB2A 1ZQNA 3RJHA 4I2BA 4LZGA 5HC9A 4WC0A 1ZJNA 1R8CA 4R64A 1K05A 4PGQA 5IIKA 3C2LA 4YCXA 3GM1A 1R89A 1V4AA 9ICBA 7ICSA 5J0WA 8ICOA 9ICUA 4KLFA 1ZQYA 8ICVA 5DDMA 3RJEA 5CHGA 4I2HA 1BPXA 1ZQHA 1RZTA 2JX0A 4AT7B 4FO6A 3U3FA 4I2EA 1BPBA 3WFQE 2PFQA 3JPPA 5J2BA 4YMMA 4Z6FA 5F28E 3JPOA 5J0QA 3HJ4A 1VFGA 3RQGA 4M5DA 3S9OA 4WC2A 2ISOA 1ZQMA 3H37A 2BPGA 2DR8A 8ICSA 4XEFA 1R8BA 1ZQKA 3RJGA 8ICYA 4RWPA 3RJJA 1OW6A 4M0AA 2RFFA 5DBAA 4RT2A 2ZH2A 9ICNA 4IG8A 4RQ8A 3C5GA 4JWMA 8ICRA 5J0OA 9ICXA 4R32A 3RQFA 4X4QA 4KLQA 3MDAA 7ICTA 2ZH3A 4PGYA 4O5KA 1PV3A 5DEDA 1WOLA 4DOBA 1WTYA 4UB5A 4GXKA 5D4BA 1ZQUA 3H39A 1RPLA 3JPTA 4EBJA 3V7KA 2ZH5A 8ICKA 1OW8A 1TFYA 4P4PA 3K75D 1JAJA 4DOCA 2ZH1A 1FA0A 4UB4A 1OU5A 2BPCA 3HJ1A 7ICIA 4YD2A 9ICSA 2FMQA 4WC1A 8ICTA 4WBYA 4P4MA 4UBCA 4PHAA 4RQ7A 5J0RA 1HUZA 1TVAA 7ICPA 3JPNA 7ICNA 4IQWA 4NLKA 3PMLA 5HRHA 5J2DA 1KDHA 4F5OA 5DB9A 3NYBA 4WBZA 3LK9A 3B0XA 4LZDA 4WC7A 7ICEA 4R63A 4YD1A 1QVXA 2Q00A 4X4VA 4RQ1A 4M47A 7ICUA 1UFBA 4M9GA 3RJIA 5J2FA 4AT8A 3B0YA 4RQ0A 4FHWA 1BPZA 4I2DA 3HX0A 8ICGA 1BPYA 3UXOA 4MFCA 5BOMA 3UPQA 8ICPA 1XSPA 4PHEA 1O3UA 2FMSA 5DB6A 3OV7A 3GDXA 3C2MA 4I2CA 5HHHA 4UAZA 3AU2A 1K40A 3ISBA 1UETA 4IQTA 9ICRA 3L8JA 2DR7A 2FMPA 1ZQEA 8ICBA 4UB1A 1ZQBA 7ICFA 4PHPA 3HWTA 4JWNA 2DRAA 5CP2A 4XEVA 4KLDA 4RPYA 1ZQFA 3OVBA 9ICPA 1ZQTA 5J2HA 4QZEA 1NO5A 2L6FA 3RJFA 5J0YA 1VJ7A 5HRFA 9ICWA 1ZQIA 4K4HA 4ATBA 1UEVA 3V72A
chains in the Genus database with same CATH superfamily
2EIMC 1IW7F 9ICGA 5J0PA 1NLXA 5CFUA 1ZQQA 5J2GA 8ICAA 3UGPA 4I44A 2DYRC 3C7JA 3DMDA 4KLOA 3PHZA 4E8FA 4EEDA 9ICQA 5IIMA 2TMVP 2D5RB 4I29A 3SXYA 5J29A 4RQ2A 1ZHWA 4ZLDA 4K1OA 2YLIA 3R7CA 1YLQA 3B71A 4NTAA 2GAQA 4RD9A 2ETSA 3O10A 2CYDA 4HFFB 8ICJA 2J45A 1NU9C 4RDAA 2B0HA 3EHNA 1YYJA 2DVIA 3UMIA 1MMNA 4IAOA 3TK0A 4DRIB 3IQ6A 1J8YF 1Q0FA 3H3AA 3TQOA 1ZHTA 2KNHA 4G7OF 4F5RA 4TUPA 1YJGA 3V7OA 2NUPA 1UG7A 2YL7A 8ICZA 3KKBA 4QZ8A 1VMAA 3SXKA 2OJQA 5L0FA 4O6AA 4C3BA 3H38A 3L34A 2ZH7A 4RWOA 1NFNA 2DI3A 2LP4A 1N1CA 3NKEA 2L7AA 2B56A 5A6BD 2FFHA 3A11A 4NCQA 4QZHA 2GDCA 4FESA 1RCPA 1BPEA 5AC4A 4OINF 1SZIA 3DZAA 4IRUA 1OW7A 3VM6A 1TWCA 4XQ8A 1A41A 1LKXA 3A9CA 4MFFA 5J2AA 2PF4E 3M1CB 4XUSA 1VYKA 4QZCA 2R7WA 2EIJC 1XSNA 1MQVA 3RVZA 4FH3A 1E83A 3OUYB 1J8MF 256BA 4KI2A 3EGXB 2R7OA 3B0UX 2IUBA 2Q9CA 9ICFA 4R66A 2IM8A 4U5CE 1ORJA 4I2JA 1EQ1A 4WCWA 4JVSA 2J8WA 4WOYA 4PH5A 2NPUA 3EG9A 1ZQGA 1BZ4A 4MVZA 3MGIA 4RT3A 2KC3A 5HRDA 4I2IA 1C17M 1YZAA 3FOOA 5KYYA 3ER9B 4KM5A 5F2VO 4RPXA 3SP1A 3JPQA 4NY8A 2FCLA 2HKVA 2IOQA 4K4IA 2J46A 3KMIA 3AU6A 4KNVA 3FAPB 1ZHYA 4M9LA 1ZQAA 4KLTA 1JOGA 3TFSA 2XLOA 3WFRE 2LIGA 3EH1A 4JEAA 4OIRF 5L0JA 3V7JA 3WHNA 4JJFA 2LK4A 2LCHA 3AG2C 5E2QA 4CSAC 5AGFA 1YA7O 2EPMX 3U8VA 2NUTB 1A7EA 1NSGB 7ICMA 4OD5A 5L3QA 3LS0A 4KNWA 3MCRA 9ICEA 2KK1A 3ASOC 4ZLCA 2XLDA 4QZBA 5EK0A 3L9DA 2W45A 4KLEA 4I2GA 4O68A 1TV9A 4X4SA 4EIYA 3C8GA 1WOTA 4QI0A 3JCFA 4BJ6A 1FMWA 2HFIA 9ICAA 1VYIA 4AE4B 5EHHA 3FVYA 4IWBA 3WFOA 2GWWA 2PBEA 4NKUA 4X4OA 3UGOA 7ICOA 3I5PA 2VCAA 4G7HF 3ABMC 2AP3A 1E86A 4NLNA 1ZW3A 4PPXA 1BR1A 1Z63A 2WL8A 4A2NB 4UAYA 4NC3A 3GWLA 5HRBA 1ZZPA 4X0AA 4P2HA 3MBYA 9ICKA 1HUOA 2J7PA 3DE8A 2GAFD 4U5GA 4UB2A 2MYSA 3RJHA 4I2BA 2Y3DA 3G4XA 4JE9A 1T6UA 2H7VC 1K05A 5IIKA 1HY5A 1AUEA 4DBRA 1R89A 9ICBA 2OU6A 2GA9D 3J06A 1F1MA 2ZXRA 4CS8C 4AT7B 2IXPA 3ABKC 3U3FA 3EFOA 1RXQA 1Y4CA 3K6BA 1BPBA 3WFQE 2PFQA 2XXAA 3E9VA 4YMMA 4K98A 1MMGA 1Q0MA 2OKUA 1G4WR 3AQCA 4GQHA 4XEFA 1R8BA 4XLNF 3NG1A 3RJJA 2RFFA 1JAFA 4IG8A 5J0OA 4N06A 4R32A 5F5HA 1FTSA 2ZH3A 4OAGA 4O5KA 5DEDA 1WOLA 4DOBA 3EQLF 1H9GA 5D4BA 1ZQUA 3ATPA 1RPLA 3NYMA 4EBJA 3V7KA 5DQZA 3LLKA 4MTOA 5B1AC 2XLMA 1FA0A 1M2VB 1MNDA 9ICSA 4NXXA 2FMQA 7ICPA 1MNEA 4I1MA 5J0RA 5E3CA 7ICNA 4PFPA 5D91A 3PMLA 3NYBA 3LK9A 4LZDA 1T6QA 4BPMA 1U89A 1GGQA 2WZGA 7ICUA 1LE2A 2J9BA 4AT8A 3B0YA 2BE5F 4FHWA 3C63A 8ICGA 5CFTA 3RYLA 2EPNA 4XPWA 5A6KA 1XSPA 2VASA 3NMJA 2FMSA 4AX2A 3FDQA 2Q9AA 3NYJA 5HHHA 4U5BE 3AU2A 4DVYP 2WVQA 3H65A 3L8JA 2DR7A 2XLWA 1ZQEA 2Y3BA 3NYLA 4DXWA 4XPYA 4KLDA 4QZEA 4YT4A 1T5OA 4K4HA 2A69F 3V72A 2A1DD 3JRTA 3JCUQ 4I28A 4R65A 1YLMA 5DKWA 3PNCA 4CX9A 5DS6A 4YT5A 5CHEA 3U2MA 2DR9A 4HX0A 3AG4C 1GPJA 1JPJA 4Z9IA 3TJ6A 2YWAA 1JMWA 4U9EA 3EGDA 5BOLA 3TULA 3K7DA 4XJEA 2HHPA 1MIWA 3S27A 5J2KA 2BCUA 4M2YA 1DOWA 3OVAA 5D46A 1NZEA 1T9KA 5B3PA 1HE1A 4Q4ZF 2ID1A 4XA5A 1G5ZA 2P6VA 4Z6DA 5KYUA 2BE3A 5CA7A 3K33A 1APCA 3V7LA 2ZH8A 1Q0KA 4EBBA 5DDYA 4NLZA 5L0IA 4M9NA 3T9OA 8ICLA 1I4ZA 1OKKA 4FX5A 4E7ZA 1WWPA 2M2VA 5DB7A 3HJCA 2ZH6A 2PFOA 3H2UA 3JTLO 1GS9A 4PGXA 5KYXA 4O69A 3QVZA 4DOAA 2BC5A 4K0DA 1ZQZA 4WC4A 4QZ9A 1ZQXA 7ICQA 3CAXA 4OAFA 3L0IA 3MLGA 3OWGA 1E85A 4YL3A 5HRKA 4WGZA 2R05A 4I2FA 1XSLA 1CPQA 4KBLA 3Q7LA 2HZ8A 4FHXA 2DR5A 3M15A 1JRAA 3RF3A 1F5AA 1RKEB 4M04A 2B0JA 5IINA 3RH4A 1ZVZA 2HMZA 3HKKA 2VC9A 2ZXWC 1TFWA 4LDQA 5J0SA 4WQLA 4NXZA 1YARO 3QW0A 3DM5A 2J9VA 4K9AA 5CB1A 3OWTA 4LDRA 4CJOA 4CIHA 8ICCA 1D1BA 3RKOF 1M56C 3BEHA 2XS8A 4XTKA 5BUOA 2ZHAA 4YT2A 1RJ9B 2A68F 1DOVA 3LLIA 2LD6A 1TWGA 9ICMA 3T6GB 2PFPA 4K99A 4GXJA 2Y39A 1KEJA 2QY9A 2OOCA 1GM5A 2ZH4A 4MQ9F 8ICNA 1JQRA 4U5HA 4Q7CA 3UNGC 3IQTA 3FMSA 1HMOA 3MYFA 4TUQA 1ZQLA 2LFFA 1I5NA 2J9UA 4GXIA 4I2AA 3UQ2A 2R03A 2ZPAA 4MS2A 4K4GA 2XS1A 5D49A 3JZ0A 3ZG1A 5A6AA 1OCCC 1ZJMA 4FHYA 5BPCA 5J0TA 2XLVA 2D4UA 3CZ6A 4UDVA 4E7XA 5K0IA 1AEPA 1OR2A 3AJMA 2A0BA 4MKPA 9ICVA 4Z6CA 2UUHA 3L8IA 4WC5A 1CPRA 4N6HA 1SR2A 3AQBA 1ZQRA 2HMQA 5EGYA 2W4BA 4MFAA 1JPNA 4D4NA 3GEIA 4N6CA 2LSEA 3K1IA 1LPEA 4F5QA 3DJNB 3EZHA 3AGTA 3U2LA 4BJ5A 1KTMA 4LLCA 8ICFA 2L6HA 1Z3IX 2P7VA 3PMNA 3C62A 4EHPA 1SMYF 1O87A 4JZAA 1H6GA 8ICUA 2XLHA 2HSBA 4FHVA 1D0ZA 3QMKA 1Z5ZA 3Q6NA 3ZQVA 1VLSA 2FGYA 3JRMO 4NTFA 1VOMA 2EWRA 1XZQA 3U9JA 3HNLA 3W4YA 2CNWD 4NXUA 1V74B 4IQVA 3QZCA 5IIJA 5IILA 1MQ2A 3GEHA 3AQKA 4PFOA 3N2ZB 3WAQA 5TZVA 1LM3B 4LZGA 2HN1A 1R8CA 4R64A 2J9WA 5BQGA 4Z9JA 4F4BA 4P6IC 4A4AA 2HN2A 4L6RA 1V4AA 3SYNA 2YVKA 4E7SA 5J0WA 2R25A 8ICOA 1FNTc 2ICWG 2V3CC 1ZQYA 3NDBB 4DVZA 1V54C 4DRHB 1MMDA 4I2HA 3KYIA 1TQGA 2R7XA 4KB6A 1ZW2A 3MYIA 5D92A 1C02A 4Z6FA 5F28E 3JPOA 4PJJA 4BG0A 3HJ4A 1TFKB 1VFGA 4M5DA 2ISOA 4EGWA 2BPGA 4WGYA 3DAFA 8ICYA 4M0AA 2YEVA 4RT2A 3PDMP 2ZH2A 4JWMA 8ICRA 3RQFA 4X4QA 5DQTA 3EHMA 1ORYA 4UB5A 1QLEC 5D62A 4GXKA 1H7IA 2BL2A 1TFYA 5HSWA 2MWQA 2CGEA 4MW3A 2OEXA 4DRJB 1OU5A 1C03A 2G3VA 4UB4A 7ICIA 3F47A 3KL4A 4PHAA 2ASRA 3JPNA 3VRCA 2VCCA 4IQWA 4NLKA 5J2DA 4WBZA 3B0XA 7ICEA 4DOZA 3ZVRA 4YD1A 1QVXA 2VCBA 4BJ6C 2Q00A 2NSGA 4X4VA 3ZWIA 1BR2A 1UFBA 4HEAJ 2XL4A 2WZFA 3HX0A 3RVYA 2EPLX 4PHEA 4ULWA 5DB6A 4OIOF 1BBHA 3C2MA 1CGME 4I2CA 4AE4A 1G4US 3LS1A 4UAZA 1UETA 1GQAA 4MVQA 8ICBA 4UB1A 4CIPA 4PHPA 2Q7RA 4JWNA 2EILC 4K9BA 2EINC 3OVBA 1ZQTA 3KYJA 1NO5A 2YQYA 3PHF2 2FAPB 4MVRA 2F22A 2YL3A 2R7VA 4N7RA 9ICWA 3LNMB 1LI5A 1OCRC 4MVOA 9ICCA 3EFOB 4NM1A 1UEUA 3MGHA 4JRZA 1JR8A 3RW0A 3RH3A 3I5QA 1ZHZA 3RJKA 2H7OA 2CCYA 4JW1A 2I9GA 2NG1A 4U9DA 4KLUA 2MHRA 4K7BA 2DGJA 1VLTA 5IIOA 2ZH9A 2M2UA 1EA8A 4C3EA 3M4BA 5HRIA 3N24A 1ZQSA 3H2VA 4NKTA 3HW8A 3RH5A 7ICHA 4RQ6A 2IHMA 5DLJA 2R02A 2BBJA 3DJUB 2A6EF 4AT7A 3VYWA 4MF2A 4AT9B 1U6HA 2CDQA 9ICLA 3LQCB 4MW8A 9ICIA 4MTGA 3O39A 2XSEA 2YL0A 3CQZA 5HREA 3M4CA 5B3SC 2UUIA 3OA1A 1NU7D 3L1MA 4X4NA 4G78A 4OAIZ 4U5EE 1NOMA 4XQ7A 3WG7C 4D4XA 2ZXOA 3SXMA 3X2QC 2AWYA 4RWNA 4MVMA 3ASNC 3U8PA 2QLAA 2WVOA 5GPGB 2Q3TA 3GORA 4JJGA 4AL0A 4W8KA 1YZCA 2DB4A 3EJNA 2BCQA 3JYHA 3C8GD 2H8AA 4AT8B 3HTKC 4X4RA 4XEKA 3DD7A 3G50A 2ISPA 4RQ5A 3IEEA 4F5NA 2IXNA 7ICRA 4X4UA 3E70C 5J2EA 3X1OA 2A0UA 4FO1A 3DM9B 2R7RA 1R4TA 2Z15A 4CS9A 4ANJA 2O5AA 2YKZA 3ECSA 3B29A 4C7OB 1ZQJA 3HLZA 2W9MA 2JD3A 4NXVA 9ICJA 4FHPA 4RWQA 3MFNA 2E87A 4O79A 1PD1A 4JKVA 2IXOA 3RQEA 4KLSA 1YYXA 1B68A 5COGA 2W4MA 4RQ4A 2J7PD 1FFHA 1ZQOA 3B9QA 2QTVA 5DB8A 2YL1A 2BCRA 2GFHA 3CEXA 4RBNA 5KYWB 1PD0A 5J2IA 2I15A 3W2WA 4UB3A 3LESA 4DJ9A 1HW2A 4RPZA 5TJ5E 4X4TA 3UXPA 4I27A 2YZSA 4KLHA 4O6NA 4O5EA 3EPVA 3ISDA 4O9MA 1TKNA 3JSEO 1VB5A 3WFPA 3C2KA 3POVA 1TWHA 3DE9A 3AQLA 1PCXA 3FAJA 5J2CA 1KNYA 3HIYA 1FFTC 4NM2A 2KJGA 2VH3A 3HNKA 4LEZA 5E33A 1LS4A 2PFNA 7ICLA 2XRHA 1ZU4A 3JPRA 1ZQDA 1PX5A 4RQ3A 5CR0A 1E2XA 8ICQA 3UPSA 5KYUB 3ER8C 3LUTB 2PFDA 4O67A 2JPUA 4UBBA 2M2WA 8ICWA 4E18A 2H7BA 3AQMA 2DYSC 2L9JA 4P9TA 3OVSA 1D1AA 3TFRA 1WGWA 9ICOA 5COFA 5KYXB 1V55C 4OIQF 5DBBA 3TOMA 3NMKA 3GM2A 3AG3C 7ICKA 8ICEA 2BCVA 4YL0A 1R8AA 3ZTZA 1EI7A 1BDJB 4O5CA 4BJTA 5JTGA 7ICJA 4WJ0A 1Q79A 2RSEB 2IXMA 3RIPA 4IGGA 3C5FA 4JLXA 4M63A 3LEOA 4J7YA 4E80A 3AGUA 1BPDA 5BQIA 5L3VA 4G0HA 3ERCC 4YMOA 4Z6EA 3KPHA 2KYHA 3ZDLA 5A6BA 2P66A 1Z6AA 2M64A 4K8VA 3F46A 2L6GA 4ATBB 3JPSA 3C66A 1LS1A 4ULVA 3OEOA 2X51A 3SEOA 1K04A 3S0XA 4NQFA 1RKEA 4CDVA 5E3AA 4QZFA 4ONSA 4MVUA 1ZQNA 4IB4A 1S05A 5HC9A 4MNDA 2P1AA 1Y6DA 4PGQA 3O6XA 3T6JA 2XM4A 4X0RA 3GM1A 3QVYA 2J0XA 4DBQA 3LAYA 5JVEA 4KLFA 8ICVA 3ZQYA 5DDMA 4LEWA 3T4RA 5A6JA 1RZTA 5JT4A 4J7TA 5FCLA 1ORSC 3JPPA 3LNRA 1RJ9A 1A7DA 3RQGA 1LE4A 1ZQMA 3ITFA 4XLPF 1RKCA 3W8HA 8ICSA 2B4VA 2KQ9A 1ZQKA 4W8PA 4B6IA 4CS7A 4RWPA 3NWIA 1OW6A 5DBAA 4IAQA 3AG1C 3C5GA 2RD9A 4O7GA 2NUPB 4JURI 3MDAA 1OCOC 4PGYA 1SF8A 2R7UA 2R7TA 4YT8A 1WTYA 4I1OB 3NVOA 4FWVA 3K1HA 3R2PA 5DS4A 3HNIA 3JPTA 2P61A 2WB7A 2ZH5A 8ICKA 4P4PA 3K75D 1FAPB 3T6BA 4DOCA 2ZH1A 3RFYA 1OKKD 3CSKA 2O9XA 3QTHA 1OCZC 4WC1A 5T3TA 4WBYA 4P4MA 4OIPF 4RQ7A 3K1IC 1HUZA 1TVAA 1HMDA 2P0NA 3CK6A 4JCZA 4WH5A 1S7ZA 1W2WA 1QSPA 5DB9A 4F5OA 1KDHA 4WC7A 4BJ5C 2VB6A 2HV7A 4R63A 2YHSA 5D61A 1H9TA 3S84A 4RQ1A 4M47A 5D63A 4OD4A 4M9GA 3RJIA 4LLEA 2LQGA 4NXTA 2AVKA 4RQ0A 4Q5SF 3TOLA 1FR0A 4I2DA 4NTBA 2XL6A 4MFCA 8ICPA 4P9FA 1IZMA 1O3UA 2HUJA 3DAGA 4O6MA 3OV7A 3GDXA 4LDKA 3NMIA 3ISBA 3EF2A 4IQTA 4PJLA 3PCVA 1ZQBA 7ICFA 1Z7Qc 3GWNA 3HNJA 3B0PA 3HWTA 4Z9HA 1QPUA 3UMHA 4XEVA 4RPYA 1ZQFA 3EG9B 3PMRA 3ZIBA 4LACB 4CDAA 5J2HA 2YRFA 2PNOA 2NSFA 2AU5A 2R9RB 2G3KA 1VJ7A 5HRFA 1BR4A 4NXWA 1ZQIA 2DRBA 3LJBA 1CGOA 3UMKA 5KYYB 4JTDB 3OUYA 1ZQWA 3EGXA 7ICVA 2IYLD 4LEVA 1CGNA 1WASA 2QE9A 1NG1A 4QZAA 3SNHA 2Q9BA 5DS5A 4K96A 2PP4A 3VAYA 5HRLA 5HV9A 1OQCA 1JN3A 5J0XA 1MQ3A 1FMVA 1R5ID 4PK4A 5F5FA 8ICMA 4EUKB 3UR3C 5A69A 2YLGA 4UAWA 4EBKA 1SYQA 4QDLA 5CWRA 4F5PA 2XLEA 4P4OA 2R7QA 4CBEA 4BJ1A 4KLGA 3RH6A 4LVSA 2PXIA 2Q4FA 4EEBA 4J30B 4CSAA 5HRGA 4JEBA 5DBCA 2NRKA 3NKDA 4MTFA 5HHIA 4LERA 4X4PA 3C8GB 1YAUO 4QZGA 3DI5A 1EKYA 1OXBA 2OQMA 2L81A 1WATA 4IJJA 4JC7A 3WFSC 4TUSA 3S29A 5J2JA 4MVSA 4HE8D 2NUTA 4YN0B 1QKRA 4BEJA 3GM3A 4G7ZF 1G8XA 1L7CA 3ZC4A 3WODF 4FH5A 4YL1A 4OAHA 5EOZA 5HR9A 5CJ7A 2HSQA 4EV6A 5B3IA 3OGUA 2Y3GA 4XWJA 3FXHA 3JSZA 3DWWA 2I8BA 3IHUA 3U5SA 4H4KC 4JCHA 4UD4A 2C03A 9ICHA 1ZU5A 5T3WA 3W2VA 3EZIA 2EPOA 3UQ0A 5JSLA 3MX3A 4JTCB 5T1DB 1LI7A 1U0BB 2PX3A 4WQKA 4M9JA 8ICXA 1M2OA 4I0UA 2EIKC 2HJ3A 4JIOA 5CIVA 1HW1A 4KLMA 3KH2A 1RMVA 1M57C 4YN4A 1T6IA 4AK9A 1YVIA 1WN0A 4QZDA 2X0CA 2KGOA 2M2TA 4QZIA 1HE9A 5KYNA 3MDCA 2BBHA 1L3PA 2Y69C 3C18A 2ZHBA 2XXAB 3AQNA 4GYTA 1TR2A 4EP7A 4CDYA 4CJGA 1ZQCA 3UXNA 3N0TA 5L0HA 4CS8A 3DXJF 3C8ZA 2CW0F 4E0HA 3DKAA 1T01A 2V26A 4KLJA 5DECA 2ZD9A 1TFOB 3VF0A 3TJ5A 1A7VA 1LIHA 4WC6A 3BRJA 3G4ZA 2OJED 4U5FE 4PHDA 4LT6A 4X5VA 3U0CA 2GA0A 5J0UA 8ICHA 3FHDA 2YLDA 4X0BA 2LFDA 4M9HA 4LEYA 1QZXA 1MIYA 1ZQVA 2BPFA 5B1BC 4WABA 1JMSA 4HFKB 4NY3A 1ZQPA 1YDIA 5IIIA 1YA9A 4IARA 2WVNA 3GODA 3GANA 5L0DA 3FOPA 4AT9A 2GWSA 4N4WA 4S3NA 3NRHA 8ICIA 5JRAA 2O1PA 2R7SA 1Q78A 4BEMJ 4E0IA 3ISCA 4KC9A 2PX0A 5JLIA 4YK5A 2IBFA 2XM0A 3B0VC 4WC3A 1M2VA 4XRHA 2Q66A 4KLLA 2HV6A 1XWJA 4IQUA 1TWAA 4GEHA 4E17A 4O6YA 4EKWA 4KLIA 3US6A 2C04A 4DO9A 5JS5A 4CS9C 2QNLA 3JYYA 1KU2A 2VANA 4U5DE 2KW3C 3IPMO 4TURA 7ICGA 4AL1A 2ZXPA 2OCCC 3Q6MA 1XZPA 3MBGA 1O5HA 3IQ5A 4MF8A 4PJMA 4PACA 4YMNA 4C7OA 2BCSA 9ICTA 3U3BA 1Q0DA 2G62A 1LVKA 2XL8A 3AUOA 1MIVA 2J0WA 4UD5A 1A0BA 2Y3HA 2B51A 5IY5C 4WC0A 1ZJNA 5CI9A 4YJWA 3U9MA 3C2LA 4YCXA 4J32B 5DVWA 1ZYRF 7ICSA 4JTAB 1I4YA 9ICUA 1D0YA 3EGDB 4JLZA 5KYWA 1Z23A 4YWQA 1NFOA 5L0GA 5B3QA 3RJEA 5CHGA 1BPXA 1ZQHA 2JX0A 4C3DA 4FO6A 4I2EA 1D1CA 4XPXA 5AC5A 4QI2A 5J2BA 1D0XA 1VK5A 3QW1A 5J0QA 1NBBA 4WC2A 3S9OA 3IQCA 3H37A 3K66A 5CI8A 2DR8A 3EH2A 2KSFA 3RJGA 4K97A 3Q7GA 1E84A 3TD7A 2M4EA 3O55A 1AVOB 9ICNA 4RQ8A 9ICXA 1MMAA 3S28A 5CFSA 4KLQA 2OG2A 7ICTA 2W9YA 1PV3A 3ABLC 5BQHA 3W8IA 3GEEA 3ZTMA 5JUAA 3H39A 1OW8A 1JAJA 3V5YA 1QQ3A 3SXZA 1M6TA 4FAPB 3HJ1A 2BPCA 5L0CA 4YD2A 2AWCA 8ICTA 2OEVA 3ZSUA 1Q0GA 4UBCA 2IHOA 1VTMP 2QUPA 5HRHA 5COMA 3JT1A 2EPKX 2A6HF 2HJMA 4PJNA 5J2FA 3LEVA 1BPZA 3V5XA 1OXKA 4EWCA 1BPYA 4XQ1A 3UXOA 4ER9A 5BOMA 3UPQA 5FZTA 3AOUA 1ZHXA 4PR9A 3NKUA 3V5ZA 1K40A 9ICRA 2CNWA 3I4UA 2FMPA 4I3MA 3M79A 3S90A 2HS5A 2DRAA 4H54A 5CP2A 9ICPA 2WZLA 1ST6A 3SZRA 2L6FA 3RJFA 5J0YA 5JP7A 1OR3A 4ATBA 1UEVA
chains in the Genus database with same CATH topology
9ICCA 3OUYA 4NM1A 1ZQWA 9ICGA 1UEUA 4I28A 3MGHA 4R65A 5J0PA 8ICAA 5DKWA 5J2GA 1ZQQA 7ICVA 3PNCA 3RJKA 2I9GA 2DR9A 4QZAA 4KLUA 4KLOA 5IIOA 4E8FA 5HRLA 9ICQA 2ZH9A 5IIMA 1JN3A 5J0XA 1MQ3A 4I29A 5J29A 4RQ2A 2M2UA 8ICMA 2YWAA 1YLQA 3B71A 5HRIA 4UAWA 4EBKA 1ZQSA 5BOLA 3O10A 4NKTA 3TULA 3HW8A 3RH5A 5CWRA 4RQ6A 3K7DA 4F5PA 2IHMA 2HHPA 4P4OA 7ICHA 1MIWA 5J2KA 2BCUA 4M2YA 4AT7A 3OVAA 4KLGA 5D46A 8ICJA 4MF2A 4AT9B 9ICLA 3LQCB 2ID1A 9ICIA 3RH6A 4XA5A 4LVSA 2PXIA 2DVIA 4Z6DA 5HREA 2BE3A 5HRGA 5CA7A 4X4NA 5DBCA 2NRKA 3H3AA 3V7LA 2ZH8A 5HHIA 4X4PA 1NOMA 4XQ7A 3C8GB 4F5RA 4QZGA 4TUPA 5DDYA 4NLZA 3WFSC 4M9NA 4TUSA 8ICZA 4RWNA 5J2JA 8ICLA 4QZ8A 1WWPA 2M2VA 5DB7A 2PFOA 2ZH6A 2BCQA 3GM3A 4PGXA 3C8GD 4FH5A 4AT8B 4X4RA 4XEKA 4DOAA 5EOZA 2ISPA 5HR9A 3H38A 4RQ5A 1ZQZA 4WC4A 4QZ9A 1ZQXA 5CJ7A 7ICQA 4F5NA 7ICRA 4X4UA 3OGUA 5J2EA 2ZH7A 4RWOA 5HRKA 4I2FA 2O5AA 1XSLA 1ZQJA 2W9MA 4UD4A 4QZHA 9ICHA 4FHXA 9ICJA 2DR5A 4FHPA 4RWQA 3MFNA 1F5AA 4M04A 5IINA 1BPEA 3UQ0A 3RH4A 3RQEA 4KLSA 1OW7A 1TFWA 4XQ8A 4M9JA 8ICXA 4RQ4A 1ZQOA 4MFFA 5J0SA 5J2AA 2BCRA 5DB8A 4KLMA 4NXZA 4XUSA 4YN4A 4QZCA 4QZDA 1XSNA 4FH3A 3OUYB 2M2TA 5CB1A 4QZIA 5J2IA 3MDCA 8ICCA 4UB3A 9ICFA 4R66A 3C18A 4RPZA 2ZHBA 3AQNA 4X4TA 3UXPA 4EP7A 2ZHAA 4I27A 4KLHA 4O5EA 4I2JA 3ISDA 4WCWA 4O9MA 1ZQCA 4PH5A 3UXNA 3WFPA 3C2KA 9ICMA 3AQLA 5J2CA 1KNYA 1ZQGA 2PFPA 4GXJA 1KEJA 3HIYA 4NM2A 3MGIA 2ZH4A 4RT3A 8ICNA 1JQRA 7ICLA 2PFNA 5HRDA 4I2IA 3JPRA 4TUQA 1ZQLA 1ZQDA 1PX5A 4RQ3A 4GXIA 5CR0A 4I2AA 3UQ2A 4KLJA 5DECA 5F2VO 8ICQA 3UPSA 4RPXA 4WC6A 3JPQA 4NY8A 4K4GA 3BRJA 4K4IA 4PHDA 4LT6A 5D49A 3JZ0A 3AU6A 2JPUA 4UBBA 4X5VA 3U0CA 2M2WA 4M9LA 4KLTA 1ZQAA 5J0UA 1JOGA 3TFSA 8ICHA 8ICWA 3WFRE 4X0BA 3AQMA 4M9HA 1ZJMA 4FHYA 5BPCA 3V7JA 5J0TA 1MIYA 1ZQVA 4E7XA 3OVSA 2BPFA 3AJMA 2LK4A 1JMSA 3TFRA 1ZQPA 5IIIA 9ICVA 4Z6CA 9ICOA 3L8IA 4WC5A 5DBBA 4AT9A 1ZQRA 2GWSA 7ICMA 4MFAA 4S3NA 3GM2A 9ICEA 7ICKA 8ICIA 2KK1A 2O1PA 8ICEA 4QZBA 1Q78A 2BCVA 4F5QA 3L9DA 3ISCA 1R8AA 4KLEA 4I2GA 1TV9A 4O5CA 1KTMA 4X4SA 7ICJA 2L6HA 8ICFA 4WC3A 3C8GA 1WOTA 3PMNA 4XRHA 1Q79A 2Q66A 9ICAA 4KLLA 4IQUA 3C5FA 8ICUA 3WFOA 2HSBA 4FHVA 2PBEA 4E80A 1BPDA 4NKUA 4KLIA 4DO9A 4X4OA 7ICOA 3JYYA 2VANA 4YMOA 4Z6EA 2DRBA 4NLNA 2P66A 4PPXA 4TURA 7ICGA 4UAYA 5HRBA 4MF8A 1ZZPA 2L6GA 4X0AA 4P2HA 3MBYA 4ATBB 4IQVA 5IIJA 9ICKA 4YMNA 5IILA 3JPSA 1MQ2A 1HUOA 3C66A 2BCSA 9ICTA 3AQKA 1K04A 4NQFA 3AUOA 1MIVA 4UD5A 5TZVA 4QZFA 4UB2A 1ZQNA 3RJHA 4I2BA 4LZGA 5HC9A 4WC0A 1ZJNA 1R8CA 4R64A 1K05A 4PGQA 5IIKA 3C2LA 4YCXA 3GM1A 1R89A 1V4AA 9ICBA 7ICSA 5J0WA 8ICOA 9ICUA 4KLFA 1ZQYA 8ICVA 5DDMA 3RJEA 5CHGA 4I2HA 1BPXA 1ZQHA 1RZTA 2JX0A 4AT7B 4FO6A 3U3FA 4I2EA 1BPBA 3WFQE 2PFQA 3JPPA 5J2BA 4YMMA 4Z6FA 5F28E 3JPOA 5J0QA 3HJ4A 1VFGA 3RQGA 4M5DA 3S9OA 4WC2A 2ISOA 1ZQMA 3H37A 2BPGA 2DR8A 8ICSA 4XEFA 1R8BA 1ZQKA 3RJGA 8ICYA 4RWPA 3RJJA 1OW6A 4M0AA 2RFFA 5DBAA 4RT2A 2ZH2A 9ICNA 4IG8A 4RQ8A 3C5GA 4JWMA 8ICRA 5J0OA 9ICXA 4R32A 3RQFA 4X4QA 4KLQA 3MDAA 7ICTA 2ZH3A 4PGYA 4O5KA 1PV3A 5DEDA 1WOLA 4DOBA 1WTYA 4UB5A 4GXKA 5D4BA 1ZQUA 3H39A 1RPLA 3JPTA 4EBJA 3V7KA 2ZH5A 8ICKA 1OW8A 1TFYA 4P4PA 3K75D 1JAJA 4DOCA 2ZH1A 1FA0A 4UB4A 1OU5A 2BPCA 3HJ1A 7ICIA 4YD2A 9ICSA 2FMQA 4WC1A 8ICTA 4WBYA 4P4MA 4UBCA 4PHAA 4RQ7A 5J0RA 1HUZA 1TVAA 7ICPA 3JPNA 7ICNA 4IQWA 4NLKA 3PMLA 5HRHA 5J2DA 1KDHA 4F5OA 5DB9A 3NYBA 4WBZA 3LK9A 3B0XA 4LZDA 4WC7A 7ICEA 4R63A 4YD1A 1QVXA 2Q00A 4X4VA 4RQ1A 4M47A 7ICUA 1UFBA 4M9GA 3RJIA 5J2FA 4AT8A 3B0YA 4RQ0A 4FHWA 1BPZA 4I2DA 3HX0A 8ICGA 1BPYA 3UXOA 4MFCA 5BOMA 3UPQA 8ICPA 1XSPA 4PHEA 1O3UA 2FMSA 5DB6A 3OV7A 3GDXA 3C2MA 4I2CA 5HHHA 4UAZA 3AU2A 1K40A 3ISBA 1UETA 4IQTA 9ICRA 3L8JA 2DR7A 2FMPA 1ZQEA 8ICBA 4UB1A 1ZQBA 7ICFA 4PHPA 3HWTA 4JWNA 2DRAA 5CP2A 4XEVA 4KLDA 4RPYA 1ZQFA 3OVBA 9ICPA 1ZQTA 5J2HA 4QZEA 1NO5A 2L6FA 3RJFA 5J0YA 1VJ7A 5HRFA 9ICWA 1ZQIA 4K4HA 4ATBA 1UEVA 3V72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICC A;  3OUY A;  4NM1 A;  1ZQW A;  9ICG A;  1UEU A;  4I28 A;  3MGH A;  4R65 A;  5J0P A;  8ICA A;  5DKW A;  5J2G A;  1ZQQ A;  7ICV A;  3PNC A;  3RJK A;  2I9G A;  2DR9 A;  4QZA A;  4KLU A;  4KLO A;  5IIO A;  4E8F A;  5HRL A;  9ICQ A;  2ZH9 A;  5IIM A;  1JN3 A;  5J0X A;  1MQ3 A;  4I29 A;  5J29 A;  4RQ2 A;  2M2U A;  8ICM A;  2YWA A;  1YLQ A;  3B71 A;  5HRI A;  4UAW A;  4EBK A;  1ZQS A;  5BOL A;  3O10 A;  4NKT A;  3TUL A;  3HW8 A;  3RH5 A;  5CWR A;  4RQ6 A;  3K7D A;  4F5P A;  2IHM A;  2HHP A;  4P4O A;  7ICH A;  1MIW A;  5J2K A;  2BCU A;  4M2Y A;  4AT7 A;  3OVA A;  4KLG A;  5D46 A;  8ICJ A;  4MF2 A;  4AT9 B;  9ICL A;  3LQC B;  2ID1 A;  9ICI A;  3RH6 A;  4XA5 A;  4LVS A;  2PXI A;  2DVI A;  4Z6D A;  5HRE A;  2BE3 A;  5HRG A;  5CA7 A;  4X4N A;  5DBC A;  2NRK A;  3H3A A;  3V7L A;  2ZH8 A;  5HHI A;  4X4P A;  1NOM A;  4XQ7 A;  3C8G B;  4F5R A;  4QZG A;  4TUP A;  5DDY A;  4NLZ A;  3WFS C;  4M9N A;  4TUS A;  8ICZ A;  4RWN A;  5J2J A;  8ICL A;  4QZ8 A;  1WWP A;  2M2V A;  5DB7 A;  2PFO A;  2ZH6 A;  2BCQ A;  3GM3 A;  4PGX A;  3C8G D;  4FH5 A;  4AT8 B;  4X4R A;  4XEK A;  4DOA A;  5EOZ A;  2ISP A;  5HR9 A;  3H38 A;  4RQ5 A;  1ZQZ A;  4WC4 A;  4QZ9 A;  1ZQX A;  5CJ7 A;  7ICQ A;  4F5N A;  7ICR A;  4X4U A;  3OGU A;  5J2E A;  2ZH7 A;  4RWO A;  5HRK A;  4I2F A;  2O5A A;  1XSL A;  1ZQJ A;  2W9M A;  4UD4 A;  4QZH A;  9ICH A;  4FHX A;  9ICJ A;  2DR5 A;  4FHP A;  4RWQ A;  3MFN A;  1F5A A;  4M04 A;  5IIN A;  1BPE A;  3UQ0 A;  3RH4 A;  3RQE A;  4KLS A;  1OW7 A;  1TFW A;  4XQ8 A;  4M9J A;  8ICX A;  4RQ4 A;  1ZQO A;  4MFF A;  5J0S A;  5J2A A;  2BCR A;  5DB8 A;  4KLM A;  4NXZ A;  4XUS A;  4YN4 A;  4QZC A;  4QZD A;  1XSN A;  4FH3 A;  3OUY B;  2M2T A;  5CB1 A;  4QZI A;  5J2I A;  3MDC A;  8ICC A;  4UB3 A;  9ICF A;  4R66 A;  3C18 A;  4RPZ A;  2ZHB A;  3AQN A;  4X4T A;  3UXP A;  4EP7 A;  2ZHA A;  4I27 A;  4KLH A;  4O5E A;  4I2J A;  3ISD A;  4WCW A;  4O9M A;  1ZQC A;  4PH5 A;  3UXN A;  3WFP A;  3C2K A;  9ICM A;  3AQL A;  5J2C A;  1KNY A;  1ZQG A;  2PFP A;  4GXJ A;  1KEJ A;  3HIY A;  4NM2 A;  3MGI A;  2ZH4 A;  4RT3 A;  8ICN A;  1JQR A;  7ICL A;  2PFN A;  5HRD A;  4I2I A;  3JPR A;  4TUQ A;  1ZQL A;  1ZQD A;  1PX5 A;  4RQ3 A;  4GXI A;  5CR0 A;  4I2A A;  3UQ2 A;  4KLJ A;  5DEC A;  5F2V O;  8ICQ A;  3UPS A;  4RPX A;  4WC6 A;  3JPQ A;  4NY8 A;  4K4G A;  3BRJ A;  4K4I A;  4PHD A;  4LT6 A;  5D49 A;  3JZ0 A;  3AU6 A;  2JPU A;  4UBB A;  4X5V A;  3U0C A;  2M2W A;  4M9L A;  4KLT A;  1ZQA A;  5J0U A;  1JOG A;  3TFS A;  8ICH A;  8ICW A;  3WFR E;  4X0B A;  3AQM A;  4M9H A;  1ZJM A;  4FHY A;  5BPC A;  3V7J A;  5J0T A;  1MIY A;  1ZQV A;  4E7X A;  3OVS A;  2BPF A;  3AJM A;  2LK4 A;  1JMS A;  3TFR A;  1ZQP A;  5III A;  9ICV A;  4Z6C A;  9ICO A;  3L8I A;  4WC5 A;  5DBB A;  4AT9 A;  1ZQR A;  2GWS A;  7ICM A;  4MFA A;  4S3N A;  3GM2 A;  9ICE A;  7ICK A;  8ICI A;  2KK1 A;  2O1P A;  8ICE A;  4QZB A;  1Q78 A;  2BCV A;  4F5Q A;  3L9D A;  3ISC A;  1R8A A;  4KLE A;  4I2G A;  1TV9 A;  4O5C A;  1KTM A;  4X4S A;  7ICJ A;  2L6H A;  8ICF A;  4WC3 A;  3C8G A;  1WOT A;  3PMN A;  4XRH A;  1Q79 A;  2Q66 A;  9ICA A;  4KLL A;  4IQU A;  3C5F A;  8ICU A;  3WFO A;  2HSB A;  4FHV A;  2PBE A;  4E80 A;  1BPD A;  4NKU A;  4KLI A;  4DO9 A;  4X4O A;  7ICO A;  3JYY A;  2VAN A;  4YMO A;  4Z6E A;  2DRB A;  4NLN A;  2P66 A;  4PPX A;  4TUR A;  7ICG A;  4UAY A;  5HRB A;  4MF8 A;  1ZZP A;  2L6G A;  4X0A A;  4P2H A;  3MBY A;  4ATB B;  4IQV A;  5IIJ A;  9ICK A;  4YMN A;  5IIL A;  3JPS A;  1MQ2 A;  1HUO A;  3C66 A;  2BCS A;  9ICT A;  3AQK A;  1K04 A;  4NQF A;  3AUO A;  1MIV A;  4UD5 A;  5TZV A;  4QZF A;  4UB2 A;  1ZQN A;  3RJH A;  4I2B A;  4LZG A;  5HC9 A;  4WC0 A;  1ZJN A;  1R8C A;  4R64 A;  1K05 A;  4PGQ A;  5IIK A;  3C2L A;  4YCX A;  3GM1 A;  1R89 A;  1V4A A;  9ICB A;  7ICS A;  5J0W A;  8ICO A;  9ICU A;  4KLF A;  1ZQY A;  8ICV A;  5DDM A;  3RJE A;  5CHG A;  4I2H A;  1BPX A;  1ZQH A;  1RZT A;  2JX0 A;  4AT7 B;  4FO6 A;  3U3F A;  4I2E A;  1BPB A;  3WFQ E;  2PFQ A;  3JPP A;  5J2B A;  4YMM A;  4Z6F A;  5F28 E;  3JPO A;  5J0Q A;  3HJ4 A;  1VFG A;  3RQG A;  4M5D A;  3S9O A;  4WC2 A;  2ISO A;  1ZQM A;  3H37 A;  2BPG A;  2DR8 A;  8ICS A;  4XEF A;  1R8B A;  1ZQK A;  3RJG A;  8ICY A;  4RWP A;  3RJJ A;  1OW6 A;  4M0A A;  2RFF A;  5DBA A;  4RT2 A;  2ZH2 A;  9ICN A;  4IG8 A;  4RQ8 A;  3C5G A;  4JWM A;  8ICR A;  5J0O A;  9ICX A;  4R32 A;  3RQF A;  4X4Q A;  4KLQ A;  3MDA A;  7ICT A;  2ZH3 A;  4PGY A;  4O5K A;  1PV3 A;  5DED A;  1WOL A;  4DOB A;  1WTY A;  4UB5 A;  4GXK A;  5D4B A;  1ZQU A;  3H39 A;  1RPL A;  3JPT A;  4EBJ A;  3V7K A;  2ZH5 A;  8ICK A;  1OW8 A;  1TFY A;  4P4P A;  3K75 D;  1JAJ A;  4DOC A;  2ZH1 A;  1FA0 A;  4UB4 A;  1OU5 A;  2BPC A;  3HJ1 A;  7ICI A;  4YD2 A;  9ICS A;  2FMQ A;  4WC1 A;  8ICT A;  4WBY A;  4P4M A;  4UBC A;  4PHA A;  4RQ7 A;  5J0R A;  1HUZ A;  1TVA A;  7ICP A;  3JPN A;  7ICN A;  4IQW A;  4NLK A;  3PML A;  5HRH A;  5J2D A;  1KDH A;  4F5O A;  5DB9 A;  3NYB A;  4WBZ A;  3LK9 A;  3B0X A;  4LZD A;  4WC7 A;  7ICE A;  4R63 A;  4YD1 A;  1QVX A;  2Q00 A;  4X4V A;  4RQ1 A;  4M47 A;  7ICU A;  1UFB A;  4M9G A;  3RJI A;  5J2F A;  4AT8 A;  3B0Y A;  4RQ0 A;  4FHW A;  1BPZ A;  4I2D A;  3HX0 A;  8ICG A;  1BPY A;  3UXO A;  4MFC A;  5BOM A;  3UPQ A;  8ICP A;  1XSP A;  4PHE A;  1O3U A;  2FMS A;  5DB6 A;  3OV7 A;  3GDX A;  3C2M A;  4I2C A;  5HHH A;  4UAZ A;  3AU2 A;  1K40 A;  3ISB A;  1UET A;  4IQT A;  9ICR A;  3L8J A;  2DR7 A;  2FMP A;  1ZQE A;  8ICB A;  4UB1 A;  1ZQB A;  7ICF A;  4PHP A;  3HWT A;  4JWN A;  2DRA A;  5CP2 A;  4XEV A;  4KLD A;  4RPY A;  1ZQF A;  3OVB A;  9ICP A;  1ZQT A;  5J2H A;  4QZE A;  1NO5 A;  2L6F A;  3RJF A;  5J0Y A;  1VJ7 A;  5HRF A;  9ICW A;  1ZQI A;  4K4H A;  4ATB A;  1UEV A;  3V72 A; 
#chains in the Genus database with same CATH topology
 2EIM C;  1IW7 F;  9ICG A;  5J0P A;  1NLX A;  5CFU A;  1ZQQ A;  5J2G A;  8ICA A;  3UGP A;  4I44 A;  2DYR C;  3C7J A;  3DMD A;  4KLO A;  3PHZ A;  4E8F A;  4EED A;  9ICQ A;  5IIM A;  2TMV P;  2D5R B;  4I29 A;  3SXY A;  5J29 A;  4RQ2 A;  1ZHW A;  4ZLD A;  4K1O A;  2YLI A;  3R7C A;  1YLQ A;  3B71 A;  4NTA A;  2GAQ A;  4RD9 A;  2ETS A;  3O10 A;  2CYD A;  4HFF B;  8ICJ A;  2J45 A;  1NU9 C;  4RDA A;  2B0H A;  3EHN A;  1YYJ A;  2DVI A;  3UMI A;  1MMN A;  4IAO A;  3TK0 A;  4DRI B;  3IQ6 A;  1J8Y F;  1Q0F A;  3H3A A;  3TQO A;  1ZHT A;  2KNH A;  4G7O F;  4F5R A;  4TUP A;  1YJG A;  3V7O A;  2NUP A;  1UG7 A;  2YL7 A;  8ICZ A;  3KKB A;  4QZ8 A;  1VMA A;  3SXK A;  2OJQ A;  5L0F A;  4O6A A;  4C3B A;  3H38 A;  3L34 A;  2ZH7 A;  4RWO A;  1NFN A;  2DI3 A;  2LP4 A;  1N1C A;  3NKE A;  2L7A A;  2B56 A;  5A6B D;  2FFH A;  3A11 A;  4NCQ A;  4QZH A;  2GDC A;  4FES A;  1RCP A;  1BPE A;  5AC4 A;  4OIN F;  1SZI A;  3DZA A;  4IRU A;  1OW7 A;  3VM6 A;  1TWC A;  4XQ8 A;  1A41 A;  1LKX A;  3A9C A;  4MFF A;  5J2A A;  2PF4 E;  3M1C B;  4XUS A;  1VYK A;  4QZC A;  2R7W A;  2EIJ C;  1XSN A;  1MQV A;  3RVZ A;  4FH3 A;  1E83 A;  3OUY B;  1J8M F;  256B A;  4KI2 A;  3EGX B;  2R7O A;  3B0U X;  2IUB A;  2Q9C A;  9ICF A;  4R66 A;  2IM8 A;  4U5C E;  1ORJ A;  4I2J A;  1EQ1 A;  4WCW A;  4JVS A;  2J8W A;  4WOY A;  4PH5 A;  2NPU A;  3EG9 A;  1ZQG A;  1BZ4 A;  4MVZ A;  3MGI A;  4RT3 A;  2KC3 A;  5HRD A;  4I2I A;  1C17 M;  1YZA A;  3FOO A;  5KYY A;  3ER9 B;  4KM5 A;  5F2V O;  4RPX A;  3SP1 A;  3JPQ A;  4NY8 A;  2FCL A;  2HKV A;  2IOQ A;  4K4I A;  2J46 A;  3KMI A;  3AU6 A;  4KNV A;  3FAP B;  1ZHY A;  4M9L A;  1ZQA A;  4KLT A;  1JOG A;  3TFS A;  2XLO A;  3WFR E;  2LIG A;  3EH1 A;  4JEA A;  4OIR F;  5L0J A;  3V7J A;  3WHN A;  4JJF A;  2LK4 A;  2LCH A;  3AG2 C;  5E2Q A;  4CSA C;  5AGF A;  1YA7 O;  2EPM X;  3U8V A;  2NUT B;  1A7E A;  1NSG B;  7ICM A;  4OD5 A;  5L3Q A;  3LS0 A;  4KNW A;  3MCR A;  9ICE A;  2KK1 A;  3ASO C;  4ZLC A;  2XLD A;  4QZB A;  5EK0 A;  3L9D A;  2W45 A;  4KLE A;  4I2G A;  4O68 A;  1TV9 A;  4X4S A;  4EIY A;  3C8G A;  1WOT A;  4QI0 A;  3JCF A;  4BJ6 A;  1FMW A;  2HFI A;  9ICA A;  1VYI A;  4AE4 B;  5EHH A;  3FVY A;  4IWB A;  3WFO A;  2GWW A;  2PBE A;  4NKU A;  4X4O A;  3UGO A;  7ICO A;  3I5P A;  2VCA A;  4G7H F;  3ABM C;  2AP3 A;  1E86 A;  4NLN A;  1ZW3 A;  4PPX A;  1BR1 A;  1Z63 A;  2WL8 A;  4A2N B;  4UAY A;  4NC3 A;  3GWL A;  5HRB A;  1ZZP A;  4X0A A;  4P2H A;  3MBY A;  9ICK A;  1HUO A;  2J7P A;  3DE8 A;  2GAF D;  4U5G A;  4UB2 A;  2MYS A;  3RJH A;  4I2B A;  2Y3D A;  3G4X A;  4JE9 A;  1T6U A;  2H7V C;  1K05 A;  5IIK A;  1HY5 A;  1AUE A;  4DBR A;  1R89 A;  9ICB A;  2OU6 A;  2GA9 D;  3J06 A;  1F1M A;  2ZXR A;  4CS8 C;  4AT7 B;  2IXP A;  3ABK C;  3U3F A;  3EFO A;  1RXQ A;  1Y4C A;  3K6B A;  1BPB A;  3WFQ E;  2PFQ A;  2XXA A;  3E9V A;  4YMM A;  4K98 A;  1MMG A;  1Q0M A;  2OKU A;  1G4W R;  3AQC A;  4GQH A;  4XEF A;  1R8B A;  4XLN F;  3NG1 A;  3RJJ A;  2RFF A;  1JAF A;  4IG8 A;  5J0O A;  4N06 A;  4R32 A;  5F5H A;  1FTS A;  2ZH3 A;  4OAG A;  4O5K A;  5DED A;  1WOL A;  4DOB A;  3EQL F;  1H9G A;  5D4B A;  1ZQU A;  3ATP A;  1RPL A;  3NYM A;  4EBJ A;  3V7K A;  5DQZ A;  3LLK A;  4MTO A;  5B1A C;  2XLM A;  1FA0 A;  1M2V B;  1MND A;  9ICS A;  4NXX A;  2FMQ A;  7ICP A;  1MNE A;  4I1M A;  5J0R A;  5E3C A;  7ICN A;  4PFP A;  5D91 A;  3PML A;  3NYB A;  3LK9 A;  4LZD A;  1T6Q A;  4BPM A;  1U89 A;  1GGQ A;  2WZG A;  7ICU A;  1LE2 A;  2J9B A;  4AT8 A;  3B0Y A;  2BE5 F;  4FHW A;  3C63 A;  8ICG A;  5CFT A;  3RYL A;  2EPN A;  4XPW A;  5A6K A;  1XSP A;  2VAS A;  3NMJ A;  2FMS A;  4AX2 A;  3FDQ A;  2Q9A A;  3NYJ A;  5HHH A;  4U5B E;  3AU2 A;  4DVY P;  2WVQ A;  3H65 A;  3L8J A;  2DR7 A;  2XLW A;  1ZQE A;  2Y3B A;  3NYL A;  4DXW A;  4XPY A;  4KLD A;  4QZE A;  4YT4 A;  1T5O A;  4K4H A;  2A69 F;  3V72 A;  2A1D D;  3JRT A;  3JCU Q;  4I28 A;  4R65 A;  1YLM A;  5DKW A;  3PNC A;  4CX9 A;  5DS6 A;  4YT5 A;  5CHE A;  3U2M A;  2DR9 A;  4HX0 A;  3AG4 C;  1GPJ A;  1JPJ A;  4Z9I A;  3TJ6 A;  2YWA A;  1JMW A;  4U9E A;  3EGD A;  5BOL A;  3TUL A;  3K7D A;  4XJE A;  2HHP A;  1MIW A;  3S27 A;  5J2K A;  2BCU A;  4M2Y A;  1DOW A;  3OVA A;  5D46 A;  1NZE A;  1T9K A;  5B3P A;  1HE1 A;  4Q4Z F;  2ID1 A;  4XA5 A;  1G5Z A;  2P6V A;  4Z6D A;  5KYU A;  2BE3 A;  5CA7 A;  3K33 A;  1APC A;  3V7L A;  2ZH8 A;  1Q0K A;  4EBB A;  5DDY A;  4NLZ A;  5L0I A;  4M9N A;  3T9O A;  8ICL A;  1I4Z A;  1OKK A;  4FX5 A;  4E7Z A;  1WWP A;  2M2V A;  5DB7 A;  3HJC A;  2ZH6 A;  2PFO A;  3H2U A;  3JTL O;  1GS9 A;  4PGX A;  5KYX A;  4O69 A;  3QVZ A;  4DOA A;  2BC5 A;  4K0D A;  1ZQZ A;  4WC4 A;  4QZ9 A;  1ZQX A;  7ICQ A;  3CAX A;  4OAF A;  3L0I A;  3MLG A;  3OWG A;  1E85 A;  4YL3 A;  5HRK A;  4WGZ A;  2R05 A;  4I2F A;  1XSL A;  1CPQ A;  4KBL A;  3Q7L A;  2HZ8 A;  4FHX A;  2DR5 A;  3M15 A;  1JRA A;  3RF3 A;  1F5A A;  1RKE B;  4M04 A;  2B0J A;  5IIN A;  3RH4 A;  1ZVZ A;  2HMZ A;  3HKK A;  2VC9 A;  2ZXW C;  1TFW A;  4LDQ A;  5J0S A;  4WQL A;  4NXZ A;  1YAR O;  3QW0 A;  3DM5 A;  2J9V A;  4K9A A;  5CB1 A;  3OWT A;  4LDR A;  4CJO A;  4CIH A;  8ICC A;  1D1B A;  3RKO F;  1M56 C;  3BEH A;  2XS8 A;  4XTK A;  5BUO A;  2ZHA A;  4YT2 A;  1RJ9 B;  2A68 F;  1DOV A;  3LLI A;  2LD6 A;  1TWG A;  9ICM A;  3T6G B;  2PFP A;  4K99 A;  4GXJ A;  2Y39 A;  1KEJ A;  2QY9 A;  2OOC A;  1GM5 A;  2ZH4 A;  4MQ9 F;  8ICN A;  1JQR A;  4U5H A;  4Q7C A;  3UNG C;  3IQT A;  3FMS A;  1HMO A;  3MYF A;  4TUQ A;  1ZQL A;  2LFF A;  1I5N A;  2J9U A;  4GXI A;  4I2A A;  3UQ2 A;  2R03 A;  2ZPA A;  4MS2 A;  4K4G A;  2XS1 A;  5D49 A;  3JZ0 A;  3ZG1 A;  5A6A A;  1OCC C;  1ZJM A;  4FHY A;  5BPC A;  5J0T A;  2XLV A;  2D4U A;  3CZ6 A;  4UDV A;  4E7X A;  5K0I A;  1AEP A;  1OR2 A;  3AJM A;  2A0B A;  4MKP A;  9ICV A;  4Z6C A;  2UUH A;  3L8I A;  4WC5 A;  1CPR A;  4N6H A;  1SR2 A;  3AQB A;  1ZQR A;  2HMQ A;  5EGY A;  2W4B A;  4MFA A;  1JPN A;  4D4N A;  3GEI A;  4N6C A;  2LSE A;  3K1I A;  1LPE A;  4F5Q A;  3DJN B;  3EZH A;  3AGT A;  3U2L A;  4BJ5 A;  1KTM A;  4LLC A;  8ICF A;  2L6H A;  1Z3I X;  2P7V A;  3PMN A;  3C62 A;  4EHP A;  1SMY F;  1O87 A;  4JZA A;  1H6G A;  8ICU A;  2XLH A;  2HSB A;  4FHV A;  1D0Z A;  3QMK A;  1Z5Z A;  3Q6N A;  3ZQV A;  1VLS A;  2FGY A;  3JRM O;  4NTF A;  1VOM A;  2EWR A;  1XZQ A;  3U9J A;  3HNL A;  3W4Y A;  2CNW D;  4NXU A;  1V74 B;  4IQV A;  3QZC A;  5IIJ A;  5IIL A;  1MQ2 A;  3GEH A;  3AQK A;  4PFO A;  3N2Z B;  3WAQ A;  5TZV A;  1LM3 B;  4LZG A;  2HN1 A;  1R8C A;  4R64 A;  2J9W A;  5BQG A;  4Z9J A;  4F4B A;  4P6I C;  4A4A A;  2HN2 A;  4L6R A;  1V4A A;  3SYN A;  2YVK A;  4E7S A;  5J0W A;  2R25 A;  8ICO A;  1FNT c;  2ICW G;  2V3C C;  1ZQY A;  3NDB B;  4DVZ A;  1V54 C;  4DRH B;  1MMD A;  4I2H A;  3KYI A;  1TQG A;  2R7X A;  4KB6 A;  1ZW2 A;  3MYI A;  5D92 A;  1C02 A;  4Z6F A;  5F28 E;  3JPO A;  4PJJ A;  4BG0 A;  3HJ4 A;  1TFK B;  1VFG A;  4M5D A;  2ISO A;  4EGW A;  2BPG A;  4WGY A;  3DAF A;  8ICY A;  4M0A A;  2YEV A;  4RT2 A;  3PDM P;  2ZH2 A;  4JWM A;  8ICR A;  3RQF A;  4X4Q A;  5DQT A;  3EHM A;  1ORY A;  4UB5 A;  1QLE C;  5D62 A;  4GXK A;  1H7I A;  2BL2 A;  1TFY A;  5HSW A;  2MWQ A;  2CGE A;  4MW3 A;  2OEX A;  4DRJ B;  1OU5 A;  1C03 A;  2G3V A;  4UB4 A;  7ICI A;  3F47 A;  3KL4 A;  4PHA A;  2ASR A;  3JPN A;  3VRC A;  2VCC A;  4IQW A;  4NLK A;  5J2D A;  4WBZ A;  3B0X A;  7ICE A;  4DOZ A;  3ZVR A;  4YD1 A;  1QVX A;  2VCB A;  4BJ6 C;  2Q00 A;  2NSG A;  4X4V A;  3ZWI A;  1BR2 A;  1UFB A;  4HEA J;  2XL4 A;  2WZF A;  3HX0 A;  3RVY A;  2EPL X;  4PHE A;  4ULW A;  5DB6 A;  4OIO F;  1BBH A;  3C2M A;  1CGM E;  4I2C A;  4AE4 A;  1G4U S;  3LS1 A;  4UAZ A;  1UET A;  1GQA A;  4MVQ A;  8ICB A;  4UB1 A;  4CIP A;  4PHP A;  2Q7R A;  4JWN A;  2EIL C;  4K9B A;  2EIN C;  3OVB A;  1ZQT A;  3KYJ A;  1NO5 A;  2YQY A;  3PHF 2;  2FAP B;  4MVR A;  2F22 A;  2YL3 A;  2R7V A;  4N7R A;  9ICW A;  3LNM B;  1LI5 A;  1OCR C;  4MVO A;  9ICC A;  3EFO B;  4NM1 A;  1UEU A;  3MGH A;  4JRZ A;  1JR8 A;  3RW0 A;  3RH3 A;  3I5Q A;  1ZHZ A;  3RJK A;  2H7O A;  2CCY A;  4JW1 A;  2I9G A;  2NG1 A;  4U9D A;  4KLU A;  2MHR A;  4K7B A;  2DGJ A;  1VLT A;  5IIO A;  2ZH9 A;  2M2U A;  1EA8 A;  4C3E A;  3M4B A;  5HRI A;  3N24 A;  1ZQS A;  3H2V A;  4NKT A;  3HW8 A;  3RH5 A;  7ICH A;  4RQ6 A;  2IHM A;  5DLJ A;  2R02 A;  2BBJ A;  3DJU B;  2A6E F;  4AT7 A;  3VYW A;  4MF2 A;  4AT9 B;  1U6H A;  2CDQ A;  9ICL A;  3LQC B;  4MW8 A;  9ICI A;  4MTG A;  3O39 A;  2XSE A;  2YL0 A;  3CQZ A;  5HRE A;  3M4C A;  5B3S C;  2UUI A;  3OA1 A;  1NU7 D;  3L1M A;  4X4N A;  4G78 A;  4OAI Z;  4U5E E;  1NOM A;  4XQ7 A;  3WG7 C;  4D4X A;  2ZXO A;  3SXM A;  3X2Q C;  2AWY A;  4RWN A;  4MVM A;  3ASN C;  3U8P A;  2QLA A;  2WVO A;  5GPG B;  2Q3T A;  3GOR A;  4JJG A;  4AL0 A;  4W8K A;  1YZC A;  2DB4 A;  3EJN A;  2BCQ A;  3JYH A;  3C8G D;  2H8A A;  4AT8 B;  3HTK C;  4X4R A;  4XEK A;  3DD7 A;  3G50 A;  2ISP A;  4RQ5 A;  3IEE A;  4F5N A;  2IXN A;  7ICR A;  4X4U A;  3E70 C;  5J2E A;  3X1O A;  2A0U A;  4FO1 A;  3DM9 B;  2R7R A;  1R4T A;  2Z15 A;  4CS9 A;  4ANJ A;  2O5A A;  2YKZ A;  3ECS A;  3B29 A;  4C7O B;  1ZQJ A;  3HLZ A;  2W9M A;  2JD3 A;  4NXV A;  9ICJ A;  4FHP A;  4RWQ A;  3MFN A;  2E87 A;  4O79 A;  1PD1 A;  4JKV A;  2IXO A;  3RQE A;  4KLS A;  1YYX A;  1B68 A;  5COG A;  2W4M A;  4RQ4 A;  2J7P D;  1FFH A;  1ZQO A;  3B9Q A;  2QTV A;  5DB8 A;  2YL1 A;  2BCR A;  2GFH A;  3CEX A;  4RBN A;  5KYW B;  1PD0 A;  5J2I A;  2I15 A;  3W2W A;  4UB3 A;  3LES A;  4DJ9 A;  1HW2 A;  4RPZ A;  5TJ5 E;  4X4T A;  3UXP A;  4I27 A;  2YZS A;  4KLH A;  4O6N A;  4O5E A;  3EPV A;  3ISD A;  4O9M A;  1TKN A;  3JSE O;  1VB5 A;  3WFP A;  3C2K A;  3POV A;  1TWH A;  3DE9 A;  3AQL A;  1PCX A;  3FAJ A;  5J2C A;  1KNY A;  3HIY A;  1FFT C;  4NM2 A;  2KJG A;  2VH3 A;  3HNK A;  4LEZ A;  5E33 A;  1LS4 A;  2PFN A;  7ICL A;  2XRH A;  1ZU4 A;  3JPR A;  1ZQD A;  1PX5 A;  4RQ3 A;  5CR0 A;  1E2X A;  8ICQ A;  3UPS A;  5KYU B;  3ER8 C;  3LUT B;  2PFD A;  4O67 A;  2JPU A;  4UBB A;  2M2W A;  8ICW A;  4E18 A;  2H7B A;  3AQM A;  2DYS C;  2L9J A;  4P9T A;  3OVS A;  1D1A A;  3TFR A;  1WGW A;  9ICO A;  5COF A;  5KYX B;  1V55 C;  4OIQ F;  5DBB A;  3TOM A;  3NMK A;  3GM2 A;  3AG3 C;  7ICK A;  8ICE A;  2BCV A;  4YL0 A;  1R8A A;  3ZTZ A;  1EI7 A;  1BDJ B;  4O5C A;  4BJT A;  5JTG A;  7ICJ A;  4WJ0 A;  1Q79 A;  2RSE B;  2IXM A;  3RIP A;  4IGG A;  3C5F A;  4JLX A;  4M63 A;  3LEO A;  4J7Y A;  4E80 A;  3AGU A;  1BPD A;  5BQI A;  5L3V A;  4G0H A;  3ERC C;  4YMO A;  4Z6E A;  3KPH A;  2KYH A;  3ZDL A;  5A6B A;  2P66 A;  1Z6A A;  2M64 A;  4K8V A;  3F46 A;  2L6G A;  4ATB B;  3JPS A;  3C66 A;  1LS1 A;  4ULV A;  3OEO A;  2X51 A;  3SEO A;  1K04 A;  3S0X A;  4NQF A;  1RKE A;  4CDV A;  5E3A A;  4QZF A;  4ONS A;  4MVU A;  1ZQN A;  4IB4 A;  1S05 A;  5HC9 A;  4MND A;  2P1A A;  1Y6D A;  4PGQ A;  3O6X A;  3T6J A;  2XM4 A;  4X0R A;  3GM1 A;  3QVY A;  2J0X A;  4DBQ A;  3LAY A;  5JVE A;  4KLF A;  8ICV A;  3ZQY A;  5DDM A;  4LEW A;  3T4R A;  5A6J A;  1RZT A;  5JT4 A;  4J7T A;  5FCL A;  1ORS C;  3JPP A;  3LNR A;  1RJ9 A;  1A7D A;  3RQG A;  1LE4 A;  1ZQM A;  3ITF A;  4XLP F;  1RKC A;  3W8H A;  8ICS A;  2B4V A;  2KQ9 A;  1ZQK A;  4W8P A;  4B6I A;  4CS7 A;  4RWP A;  3NWI A;  1OW6 A;  5DBA A;  4IAQ A;  3AG1 C;  3C5G A;  2RD9 A;  4O7G A;  2NUP B;  4JUR I;  3MDA A;  1OCO C;  4PGY A;  1SF8 A;  2R7U A;  2R7T A;  4YT8 A;  1WTY A;  4I1O B;  3NVO A;  4FWV A;  3K1H A;  3R2P A;  5DS4 A;  3HNI A;  3JPT A;  2P61 A;  2WB7 A;  2ZH5 A;  8ICK A;  4P4P A;  3K75 D;  1FAP B;  3T6B A;  4DOC A;  2ZH1 A;  3RFY A;  1OKK D;  3CSK A;  2O9X A;  3QTH A;  1OCZ C;  4WC1 A;  5T3T A;  4WBY A;  4P4M A;  4OIP F;  4RQ7 A;  3K1I C;  1HUZ A;  1TVA A;  1HMD A;  2P0N A;  3CK6 A;  4JCZ A;  4WH5 A;  1S7Z A;  1W2W A;  1QSP A;  5DB9 A;  4F5O A;  1KDH A;  4WC7 A;  4BJ5 C;  2VB6 A;  2HV7 A;  4R63 A;  2YHS A;  5D61 A;  1H9T A;  3S84 A;  4RQ1 A;  4M47 A;  5D63 A;  4OD4 A;  4M9G A;  3RJI A;  4LLE A;  2LQG A;  4NXT A;  2AVK A;  4RQ0 A;  4Q5S F;  3TOL A;  1FR0 A;  4I2D A;  4NTB A;  2XL6 A;  4MFC A;  8ICP A;  4P9F A;  1IZM A;  1O3U A;  2HUJ A;  3DAG A;  4O6M A;  3OV7 A;  3GDX A;  4LDK A;  3NMI A;  3ISB A;  3EF2 A;  4IQT A;  4PJL A;  3PCV A;  1ZQB A;  7ICF A;  1Z7Q c;  3GWN A;  3HNJ A;  3B0P A;  3HWT A;  4Z9H A;  1QPU A;  3UMH A;  4XEV A;  4RPY A;  1ZQF A;  3EG9 B;  3PMR A;  3ZIB A;  4LAC B;  4CDA A;  5J2H A;  2YRF A;  2PNO A;  2NSF A;  2AU5 A;  2R9R B;  2G3K A;  1VJ7 A;  5HRF A;  1BR4 A;  4NXW A;  1ZQI A;  2DRB A;  3LJB A;  1CGO A;  3UMK A;  5KYY B;  4JTD B;  3OUY A;  1ZQW A;  3EGX A;  7ICV A;  2IYL D;  4LEV A;  1CGN A;  1WAS A;  2QE9 A;  1NG1 A;  4QZA A;  3SNH A;  2Q9B A;  5DS5 A;  4K96 A;  2PP4 A;  3VAY A;  5HRL A;  5HV9 A;  1OQC A;  1JN3 A;  5J0X A;  1MQ3 A;  1FMV A;  1R5I D;  4PK4 A;  5F5F A;  8ICM A;  4EUK B;  3UR3 C;  5A69 A;  2YLG A;  4UAW A;  4EBK A;  1SYQ A;  4QDL A;  5CWR A;  4F5P A;  2XLE A;  4P4O A;  2R7Q A;  4CBE A;  4BJ1 A;  4KLG A;  3RH6 A;  4LVS A;  2PXI A;  2Q4F A;  4EEB A;  4J30 B;  4CSA A;  5HRG A;  4JEB A;  5DBC A;  2NRK A;  3NKD A;  4MTF A;  5HHI A;  4LER A;  4X4P A;  3C8G B;  1YAU O;  4QZG A;  3DI5 A;  1EKY A;  1OXB A;  2OQM A;  2L81 A;  1WAT A;  4IJJ A;  4JC7 A;  3WFS C;  4TUS A;  3S29 A;  5J2J A;  4MVS A;  4HE8 D;  2NUT A;  4YN0 B;  1QKR A;  4BEJ A;  3GM3 A;  4G7Z F;  1G8X A;  1L7C A;  3ZC4 A;  3WOD F;  4FH5 A;  4YL1 A;  4OAH A;  5EOZ A;  5HR9 A;  5CJ7 A;  2HSQ A;  4EV6 A;  5B3I A;  3OGU A;  2Y3G A;  4XWJ A;  3FXH A;  3JSZ A;  3DWW A;  2I8B A;  3IHU A;  3U5S A;  4H4K C;  4JCH A;  4UD4 A;  2C03 A;  9ICH A;  1ZU5 A;  5T3W A;  3W2V A;  3EZI A;  2EPO A;  3UQ0 A;  5JSL A;  3MX3 A;  4JTC B;  5T1D B;  1LI7 A;  1U0B B;  2PX3 A;  4WQK A;  4M9J A;  8ICX A;  1M2O A;  4I0U A;  2EIK C;  2HJ3 A;  4JIO A;  5CIV A;  1HW1 A;  4KLM A;  3KH2 A;  1RMV A;  1M57 C;  4YN4 A;  1T6I A;  4AK9 A;  1YVI A;  1WN0 A;  4QZD A;  2X0C A;  2KGO A;  2M2T A;  4QZI A;  1HE9 A;  5KYN A;  3MDC A;  2BBH A;  1L3P A;  2Y69 C;  3C18 A;  2ZHB A;  2XXA B;  3AQN A;  4GYT A;  1TR2 A;  4EP7 A;  4CDY A;  4CJG A;  1ZQC A;  3UXN A;  3N0T A;  5L0H A;  4CS8 A;  3DXJ F;  3C8Z A;  2CW0 F;  4E0H A;  3DKA A;  1T01 A;  2V26 A;  4KLJ A;  5DEC A;  2ZD9 A;  1TFO B;  3VF0 A;  3TJ5 A;  1A7V A;  1LIH A;  4WC6 A;  3BRJ A;  3G4Z A;  2OJE D;  4U5F E;  4PHD A;  4LT6 A;  4X5V A;  3U0C A;  2GA0 A;  5J0U A;  8ICH A;  3FHD A;  2YLD A;  4X0B A;  2LFD A;  4M9H A;  4LEY A;  1QZX A;  1MIY A;  1ZQV A;  2BPF A;  5B1B C;  4WAB A;  1JMS A;  4HFK B;  4NY3 A;  1ZQP A;  1YDI A;  5III A;  1YA9 A;  4IAR A;  2WVN A;  3GOD A;  3GAN A;  5L0D A;  3FOP A;  4AT9 A;  2GWS A;  4N4W A;  4S3N A;  3NRH A;  8ICI A;  5JRA A;  2O1P A;  2R7S A;  1Q78 A;  4BEM J;  4E0I A;  3ISC A;  4KC9 A;  2PX0 A;  5JLI A;  4YK5 A;  2IBF A;  2XM0 A;  3B0V C;  4WC3 A;  1M2V A;  4XRH A;  2Q66 A;  4KLL A;  2HV6 A;  1XWJ A;  4IQU A;  1TWA A;  4GEH A;  4E17 A;  4O6Y A;  4EKW A;  4KLI A;  3US6 A;  2C04 A;  4DO9 A;  5JS5 A;  4CS9 C;  2QNL A;  3JYY A;  1KU2 A;  2VAN A;  4U5D E;  2KW3 C;  3IPM O;  4TUR A;  7ICG A;  4AL1 A;  2ZXP A;  2OCC C;  3Q6M A;  1XZP A;  3MBG A;  1O5H A;  3IQ5 A;  4MF8 A;  4PJM A;  4PAC A;  4YMN A;  4C7O A;  2BCS A;  9ICT A;  3U3B A;  1Q0D A;  2G62 A;  1LVK A;  2XL8 A;  3AUO A;  1MIV A;  2J0W A;  4UD5 A;  1A0B A;  2Y3H A;  2B51 A;  5IY5 C;  4WC0 A;  1ZJN A;  5CI9 A;  4YJW A;  3U9M A;  3C2L A;  4YCX A;  4J32 B;  5DVW A;  1ZYR F;  7ICS A;  4JTA B;  1I4Y A;  9ICU A;  1D0Y A;  3EGD B;  4JLZ A;  5KYW A;  1Z23 A;  4YWQ A;  1NFO A;  5L0G A;  5B3Q A;  3RJE A;  5CHG A;  1BPX A;  1ZQH A;  2JX0 A;  4C3D A;  4FO6 A;  4I2E A;  1D1C A;  4XPX A;  5AC5 A;  4QI2 A;  5J2B A;  1D0X A;  1VK5 A;  3QW1 A;  5J0Q A;  1NBB A;  4WC2 A;  3S9O A;  3IQC A;  3H37 A;  3K66 A;  5CI8 A;  2DR8 A;  3EH2 A;  2KSF A;  3RJG A;  4K97 A;  3Q7G A;  1E84 A;  3TD7 A;  2M4E A;  3O55 A;  1AVO B;  9ICN A;  4RQ8 A;  9ICX A;  1MMA A;  3S28 A;  5CFS A;  4KLQ A;  2OG2 A;  7ICT A;  2W9Y A;  1PV3 A;  3ABL C;  5BQH A;  3W8I A;  3GEE A;  3ZTM A;  5JUA A;  3H39 A;  1OW8 A;  1JAJ A;  3V5Y A;  1QQ3 A;  3SXZ A;  1M6T A;  4FAP B;  3HJ1 A;  2BPC A;  5L0C A;  4YD2 A;  2AWC A;  8ICT A;  2OEV A;  3ZSU A;  1Q0G A;  4UBC A;  2IHO A;  1VTM P;  2QUP A;  5HRH A;  5COM A;  3JT1 A;  2EPK X;  2A6H F;  2HJM A;  4PJN A;  5J2F A;  3LEV A;  1BPZ A;  3V5X A;  1OXK A;  4EWC A;  1BPY A;  4XQ1 A;  3UXO A;  4ER9 A;  5BOM A;  3UPQ A;  5FZT A;  3AOU A;  1ZHX A;  4PR9 A;  3NKU A;  3V5Z A;  1K40 A;  9ICR A;  2CNW A;  3I4U A;  2FMP A;  4I3M A;  3M79 A;  3S90 A;  2HS5 A;  2DRA A;  4H54 A;  5CP2 A;  9ICP A;  2WZL A;  1ST6 A;  3SZR A;  2L6F A;  3RJF A;  5J0Y A;  5JP7 A;  1OR3 A;  4ATB A;  1UEV A; 
#chains in the Genus database with same CATH homology
 9ICC A;  3OUY A;  4NM1 A;  1ZQW A;  9ICG A;  1UEU A;  4I28 A;  3MGH A;  4R65 A;  5J0P A;  8ICA A;  5DKW A;  5J2G A;  1ZQQ A;  7ICV A;  3PNC A;  3RJK A;  2I9G A;  2DR9 A;  4QZA A;  4KLU A;  4KLO A;  5IIO A;  4E8F A;  5HRL A;  9ICQ A;  2ZH9 A;  5IIM A;  1JN3 A;  5J0X A;  1MQ3 A;  4I29 A;  5J29 A;  4RQ2 A;  2M2U A;  8ICM A;  2YWA A;  1YLQ A;  3B71 A;  5HRI A;  4UAW A;  4EBK A;  1ZQS A;  5BOL A;  3O10 A;  4NKT A;  3TUL A;  3HW8 A;  3RH5 A;  5CWR A;  4RQ6 A;  3K7D A;  4F5P A;  2IHM A;  2HHP A;  4P4O A;  7ICH A;  1MIW A;  5J2K A;  2BCU A;  4M2Y A;  4AT7 A;  3OVA A;  4KLG A;  5D46 A;  8ICJ A;  4MF2 A;  4AT9 B;  9ICL A;  3LQC B;  2ID1 A;  9ICI A;  3RH6 A;  4XA5 A;  4LVS A;  2PXI A;  2DVI A;  4Z6D A;  5HRE A;  2BE3 A;  5HRG A;  5CA7 A;  4X4N A;  5DBC A;  2NRK A;  3H3A A;  3V7L A;  2ZH8 A;  5HHI A;  4X4P A;  1NOM A;  4XQ7 A;  3C8G B;  4F5R A;  4QZG A;  4TUP A;  5DDY A;  4NLZ A;  3WFS C;  4M9N A;  4TUS A;  8ICZ A;  4RWN A;  5J2J A;  8ICL A;  4QZ8 A;  1WWP A;  2M2V A;  5DB7 A;  2PFO A;  2ZH6 A;  2BCQ A;  3GM3 A;  4PGX A;  3C8G D;  4FH5 A;  4AT8 B;  4X4R A;  4XEK A;  4DOA A;  5EOZ A;  2ISP A;  5HR9 A;  3H38 A;  4RQ5 A;  1ZQZ A;  4WC4 A;  4QZ9 A;  1ZQX A;  5CJ7 A;  7ICQ A;  4F5N A;  7ICR A;  4X4U A;  3OGU A;  5J2E A;  2ZH7 A;  4RWO A;  5HRK A;  4I2F A;  2O5A A;  1XSL A;  1ZQJ A;  2W9M A;  4UD4 A;  4QZH A;  9ICH A;  4FHX A;  9ICJ A;  2DR5 A;  4FHP A;  4RWQ A;  3MFN A;  1F5A A;  4M04 A;  5IIN A;  1BPE A;  3UQ0 A;  3RH4 A;  3RQE A;  4KLS A;  1OW7 A;  1TFW A;  4XQ8 A;  4M9J A;  8ICX A;  4RQ4 A;  1ZQO A;  4MFF A;  5J0S A;  5J2A A;  2BCR A;  5DB8 A;  4KLM A;  4NXZ A;  4XUS A;  4YN4 A;  4QZC A;  4QZD A;  1XSN A;  4FH3 A;  3OUY B;  2M2T A;  5CB1 A;  4QZI A;  5J2I A;  3MDC A;  8ICC A;  4UB3 A;  9ICF A;  4R66 A;  3C18 A;  4RPZ A;  2ZHB A;  3AQN A;  4X4T A;  3UXP A;  4EP7 A;  2ZHA A;  4I27 A;  4KLH A;  4O5E A;  4I2J A;  3ISD A;  4WCW A;  4O9M A;  1ZQC A;  4PH5 A;  3UXN A;  3WFP A;  3C2K A;  9ICM A;  3AQL A;  5J2C A;  1KNY A;  1ZQG A;  2PFP A;  4GXJ A;  1KEJ A;  3HIY A;  4NM2 A;  3MGI A;  2ZH4 A;  4RT3 A;  8ICN A;  1JQR A;  7ICL A;  2PFN A;  5HRD A;  4I2I A;  3JPR A;  4TUQ A;  1ZQL A;  1ZQD A;  1PX5 A;  4RQ3 A;  4GXI A;  5CR0 A;  4I2A A;  3UQ2 A;  4KLJ A;  5DEC A;  5F2V O;  8ICQ A;  3UPS A;  4RPX A;  4WC6 A;  3JPQ A;  4NY8 A;  4K4G A;  3BRJ A;  4K4I A;  4PHD A;  4LT6 A;  5D49 A;  3JZ0 A;  3AU6 A;  2JPU A;  4UBB A;  4X5V A;  3U0C A;  2M2W A;  4M9L A;  4KLT A;  1ZQA A;  5J0U A;  1JOG A;  3TFS A;  8ICH A;  8ICW A;  3WFR E;  4X0B A;  3AQM A;  4M9H A;  1ZJM A;  4FHY A;  5BPC A;  3V7J A;  5J0T A;  1MIY A;  1ZQV A;  4E7X A;  3OVS A;  2BPF A;  3AJM A;  2LK4 A;  1JMS A;  3TFR A;  1ZQP A;  5III A;  9ICV A;  4Z6C A;  9ICO A;  3L8I A;  4WC5 A;  5DBB A;  4AT9 A;  1ZQR A;  2GWS A;  7ICM A;  4MFA A;  4S3N A;  3GM2 A;  9ICE A;  7ICK A;  8ICI A;  2KK1 A;  2O1P A;  8ICE A;  4QZB A;  1Q78 A;  2BCV A;  4F5Q A;  3L9D A;  3ISC A;  1R8A A;  4KLE A;  4I2G A;  1TV9 A;  4O5C A;  1KTM A;  4X4S A;  7ICJ A;  2L6H A;  8ICF A;  4WC3 A;  3C8G A;  1WOT A;  3PMN A;  4XRH A;  1Q79 A;  2Q66 A;  9ICA A;  4KLL A;  4IQU A;  3C5F A;  8ICU A;  3WFO A;  2HSB A;  4FHV A;  2PBE A;  4E80 A;  1BPD A;  4NKU A;  4KLI A;  4DO9 A;  4X4O A;  7ICO A;  3JYY A;  2VAN A;  4YMO A;  4Z6E A;  2DRB A;  4NLN A;  2P66 A;  4PPX A;  4TUR A;  7ICG A;  4UAY A;  5HRB A;  4MF8 A;  1ZZP A;  2L6G A;  4X0A A;  4P2H A;  3MBY A;  4ATB B;  4IQV A;  5IIJ A;  9ICK A;  4YMN A;  5IIL A;  3JPS A;  1MQ2 A;  1HUO A;  3C66 A;  2BCS A;  9ICT A;  3AQK A;  1K04 A;  4NQF A;  3AUO A;  1MIV A;  4UD5 A;  5TZV A;  4QZF A;  4UB2 A;  1ZQN A;  3RJH A;  4I2B A;  4LZG A;  5HC9 A;  4WC0 A;  1ZJN A;  1R8C A;  4R64 A;  1K05 A;  4PGQ A;  5IIK A;  3C2L A;  4YCX A;  3GM1 A;  1R89 A;  1V4A A;  9ICB A;  7ICS A;  5J0W A;  8ICO A;  9ICU A;  4KLF A;  1ZQY A;  8ICV A;  5DDM A;  3RJE A;  5CHG A;  4I2H A;  1BPX A;  1ZQH A;  1RZT A;  2JX0 A;  4AT7 B;  4FO6 A;  3U3F A;  4I2E A;  1BPB A;  3WFQ E;  2PFQ A;  3JPP A;  5J2B A;  4YMM A;  4Z6F A;  5F28 E;  3JPO A;  5J0Q A;  3HJ4 A;  1VFG A;  3RQG A;  4M5D A;  3S9O A;  4WC2 A;  2ISO A;  1ZQM A;  3H37 A;  2BPG A;  2DR8 A;  8ICS A;  4XEF A;  1R8B A;  1ZQK A;  3RJG A;  8ICY A;  4RWP A;  3RJJ A;  1OW6 A;  4M0A A;  2RFF A;  5DBA A;  4RT2 A;  2ZH2 A;  9ICN A;  4IG8 A;  4RQ8 A;  3C5G A;  4JWM A;  8ICR A;  5J0O A;  9ICX A;  4R32 A;  3RQF A;  4X4Q A;  4KLQ A;  3MDA A;  7ICT A;  2ZH3 A;  4PGY A;  4O5K A;  1PV3 A;  5DED A;  1WOL A;  4DOB A;  1WTY A;  4UB5 A;  4GXK A;  5D4B A;  1ZQU A;  3H39 A;  1RPL A;  3JPT A;  4EBJ A;  3V7K A;  2ZH5 A;  8ICK A;  1OW8 A;  1TFY A;  4P4P A;  3K75 D;  1JAJ A;  4DOC A;  2ZH1 A;  1FA0 A;  4UB4 A;  1OU5 A;  2BPC A;  3HJ1 A;  7ICI A;  4YD2 A;  9ICS A;  2FMQ A;  4WC1 A;  8ICT A;  4WBY A;  4P4M A;  4UBC A;  4PHA A;  4RQ7 A;  5J0R A;  1HUZ A;  1TVA A;  7ICP A;  3JPN A;  7ICN A;  4IQW A;  4NLK A;  3PML A;  5HRH A;  5J2D A;  1KDH A;  4F5O A;  5DB9 A;  3NYB A;  4WBZ A;  3LK9 A;  3B0X A;  4LZD A;  4WC7 A;  7ICE A;  4R63 A;  4YD1 A;  1QVX A;  2Q00 A;  4X4V A;  4RQ1 A;  4M47 A;  7ICU A;  1UFB A;  4M9G A;  3RJI A;  5J2F A;  4AT8 A;  3B0Y A;  4RQ0 A;  4FHW A;  1BPZ A;  4I2D A;  3HX0 A;  8ICG A;  1BPY A;  3UXO A;  4MFC A;  5BOM A;  3UPQ A;  8ICP A;  1XSP A;  4PHE A;  1O3U A;  2FMS A;  5DB6 A;  3OV7 A;  3GDX A;  3C2M A;  4I2C A;  5HHH A;  4UAZ A;  3AU2 A;  1K40 A;  3ISB A;  1UET A;  4IQT A;  9ICR A;  3L8J A;  2DR7 A;  2FMP A;  1ZQE A;  8ICB A;  4UB1 A;  1ZQB A;  7ICF A;  4PHP A;  3HWT A;  4JWN A;  2DRA A;  5CP2 A;  4XEV A;  4KLD A;  4RPY A;  1ZQF A;  3OVB A;  9ICP A;  1ZQT A;  5J2H A;  4QZE A;  1NO5 A;  2L6F A;  3RJF A;  5J0Y A;  1VJ7 A;  5HRF A;  9ICW A;  1ZQI A;  4K4H A;  4ATB A;  1UEV A;  3V72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...