2PBFA

Crystal structure of a putative protein-l-isoaspartate o-methyltransferase beta-aspartate methyltransferase (pcmt) from plasmodium falciparum in complex with s-adenosyl-l-homocysteine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
218
Chain Sequence
ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGIIKDRLFDVCFVSLKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate O-methyltransferase beta-aspartate me
publication title Crystal structure of a putative protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase (PCMT) from Plasmodium falciparum in complex with S-adenosyl-L-homocysteine
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 73
structure length 218
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pbfA00
3P9IA 2ZIFA 4DM3A 1NE2A 2QY6A 1BHJA 2A14A 3FPFA 3FYCA 2O0LA 5HILA 5K0EA 3EVEA 3PB3A 3R0QA 1XCJA 4FSXA 1RJEA 4IKPA 3BKWA 3KR2A 5CM2Z 3P2KA 5K0CA 1L3IA 1U2ZA 3K0BA 1NV8A 4X1OA 2H1RA 5HOQA 2ADMA 1RI1A 3GIWA 2PSSA 5KYGA 4RTSA 2N47A 5ICFA 2AN4A 1WZNA 4E2WA 5EEHA 1INLA 3SSNA 3PVCA 2GH1A 5FWDA 3FYDA 3A27A 2ZIEA 4QPPA 3LX6A 3HCFA 2JG3A 5DTRA 5K01A 1I4WA 5GM2A 3M33A 2NP6A 3O7WA 4QVGA 3TR6A 5LQRA 5D1NA 4E2XA 5ICCA 1QYRA 2ORED 3T0IA 3NWBA 2WA2A 3AWIA 3KQQA 3MB5A 2NYUA 1FP2A 1XCLA 2NP7A 2PX4A 2V74B 1O9HA 1RI5A 1X1DA 3I9FA 5DXJA 5EMKA 3RW9A 4E31A 2NNWB 4RTQA 3FUXA 3Q7EA 5DM2A 1KHHA 3FTFA 3X0DA 5FULA 5CIYA 1XDZA 2UYHA 1DL5A 5LR6A 2IFTA 1TW3A 3TM5A 3CCFA 5K0GA 4YUYA 1T43A 3G5TA 4CTKA 4FR0A 1D2HA 1L3BA 3MQ2A 2PX2A 3R9XB 5GOZA 4OQEA 1SQGA 1O9GA 1JG3A 1XDUA 2XYVA 4KIFA 1JQDA 3H2BA 3TQSA 3HCDA 3SGLA 4EQZA 3V8VA 2PT6A 3EGVA 5DXAA 1BKYA 2AVDA 3LGAA 3PTAA 3R24A 2PY6A 3OZTA 1WG8A 3DTNA 4PYOA 2AN3A 3P2IA 3HNRA 5EKUA 5ERGB 3I64A 3G5LA 3G7UA 3OE4A 4PNEA 1MHTA 5FUBA 3MGGA 1G60A 4RTOA 5CVEA 1DCTA 5EMMA 1Q0TA 4HGYA 2UZ4A 3OU2A 5C9ZA 3P8ZA 4WVLA 3I5UA 3UJ8A 3LBYA 5P8WA 1X19A 3MTIA 2NXJA 2FYTA 2IH4A 3UJ7A 2FCAA 2YXLA 5LQUA 3OZRA 2OYRA 5LQNA 5HIMA 3C6KA 4RTJA 2PKWA 3HCBA 3F4KA 4QQKA 3KQSA 2LD4A 3HTXA 3OFJA 2QYOA 5DT2A 5HIJA 4OA8A 1R8XA 1SUSA 1FPQA 4FGZA 3FPJA 3EEOA 2GB4A 3LBFA 1AF7A 3JWGA 4DQ0A 4HGZA 9MHTA 4NECA 3KQTA 3AY0A 2ZVJA 3E05A 3C3YA 3LDGA 3SR4A 2P35A 3PX2A 4P58A 5CD1A 3S68A 5K03A 4RVHA 3FUVA 1IY9A 3LCUA 4X61A 2UYOA 5K8VA 3NVMB 5DSTA 3U81A 3BXOA 3TFWA 4C05A 3Q87B 3HCEA 1M0EA 3KQMA 4DA4A 4YMGA 1RI3A 1MJFA 3GRRA 3IHTA 3DOUA 1JTEA 4XUCA 4H0NA 3E8SA 2C7RA 2VZ9A 3P9KA 1N7IA 4P7FA 2CMHA 4RWZA 4RV9A 5D1HA 5GM1A 4RVFA 4U7TB 4RX1A 4X41A 4LWPA 1YZ3A 5FHQA 3SM3A 1TPYA 2JHPA 3ME5A 3HVIA 2GAFA 4Y30A 4PYMA 5DRYA 2B9EA 4YUWA 2UYCA 5E9WA 3UWPA 1WXWA 1NKVA 2O06A 3HA7A 3KQYA 5DSXA 2XYRA 5GWXA 3JWJA 3TKYA 5ICGA 1FJXA 2WA1A 1FBNA 1HMYA 5LSAA 1RI2A 5EMJA 1XJ5A 4RVDA 3NWEA 3OCJA 1PJZA 3QOWA 4QTUB 5K0LA 3UJ9A 1VP3A 1F3LA 3ID6C 2OY0A 4B17A 1R6AA 3GRYA 4FSDA 1NV9A 3HP7A 2ZBPA 5DTMA 3UJ6A 2I7CA 2OPBA 3UA4A 3G2OA 2Y1XA 4YUZA 2ZWAA 3OFKA 4DZRA 2AOXA 1I9GA 3G88A 2Q41A 4GOLD 1VE3A 4M38A 4PYJA 4EKIA 3OPNA 3B3JA 2NXCA 2IDKA 2YVLA 2IH2A 2PT9A 4GQBA 2GPYA 5IH3A 3DXZA 4HTFB 2B2CA 2OO3A 2ZULA 4GOMD 1YB2A 5E9QA 2G1PA 2B3TA 3KPWA 2OKCA 5FQNA 5E1BA 5BP7A 10MHA 2B78A 3A4TA 4KIGA 4PWYA 5EZQA 5BW4A 5EOVA 1O54A 5DM1A 3AXTA 2G8NA 4GF5A 3UJDA 5EQJB 4RTLA 1PRYA 3OE5A 5EPEA 4ER5A 4Z2YA 3PFGA 3BWBA 3KU1A 4CXMA 4YV2A 3P97A 2Z6AA 1IXKA 1N7JA 5GP1A 2BR5A 1X1BA 3VYWA 4GOOD 2PWPA 1VIDA 4KRGA 1EIZA 4PGGA 2PXXA 1AQIA 4R8RA 5HEKA 1EG2A 5T64A 2GS9A 5CVDA 3CC8A 2ZZNA 5K0NA 3BGDA 3HEMA 4ATNA 4X60A 3BZBA 1VPTA 1JG1A 4JXJA 3KR9A 3LCCA 3M6WA 4L7VA 4PYQA 2HWKA 3CJRA 3D2LA 1YFJA 5FTWA 1SKMA 4CTJA 3BWCA 1RJGA 3BGVA 2HR1A 2QE6A 5FADA 4DF3A 4E30A 2O07A 1Q0SA 2YXEA 4OQDA 4F84A 1AQJA 5DX1A 2G70A 5E2BA 2OXTA 2ZZKA 1G6Q1 2AOVA 3GO4A 3NDJA 3DLIA 1ORHA 4XUDA 3VC2A 3JWIA 5KQRA 2AOWA 2CMGA 3MCTA 3EVCA 2JH8A 2P41A 3KQWA 1UWVA 4IV8A 4KDRA 4E32A 5ICEA 5E2AA 1ORIA 2H00A 3EMDA 2IBSA 2IP2A 4M7RA 4R6WA 1UIRA 2CL5A 2BM8A 3DUWA 4FT4A 5LQJA 1Y8CA 3LKZA 5CCBA 2C7QA 1D2CA 2AOTA 3P2EA 4MWZA 4LWOA 5C1IA 2EG5A 4X63A 3GRZA 4A6EA 1QAMA 1G38A 1KP9A 1EQAA 1X1CA 3G2QA 2CKDA 2C7PA 4E2ZA 2EX4A 4KVZA 2PXAA 4MTLA 4DMGA 1M6EX 3KR1A 3UA3A 3HCCA 2GLUA 2PLWA 2YR0A 4AZWA 1AV6A 4E2YA 2YX1A 5CCXA 2AOUA 3FUUA 1KXZA 5F2KA 3R3HA 3GDHA 3LCVB 3M6XA 1ZGJA 4GC9A 4C4AA 1KIAA 4QDKA 5DWQA 4F85A 1FP1D 3KPUA 3BKXA 3FTDA 3EGIA 1KPGA 2VDUE 5CVJA 2ERCA 3P71T 3WSTA 3ANXA 2BM9A 5EIFA 3CBGA 1VLMA 1XVAA 3KKZA 4DKJA 2P8JA 4U7PB 2ZWVA 5IKMA 4GC5A 1L3CA 3LKDA 3KPJA 3M70A 4CWAA 4RVGA 1NBIA 3NVKI 3EVGA 1JQEA 4YUXA 2PXCA 4K6MA 3B3GA 1D2GA 2AVNA 3OU7A 3RODA 3SXJA 5BXYA 5MHTA 1P1CA 1EAMA 4QDJA 4R05A 3P9NA 1Z3CA 4G56A 5F2OA 3SMQA 3THSA 3V97A 4YV1A 4QVKA 3K6RA 2Z6UA 5EMLA 2DULA 5EZSA 2XBMA 4RTMA 2O57A 5EHGA 4HSGA 3ERCA 2VS1A 2FHPA 3BWMA 5CVVA 3UJCA 5K09A 2K4MA 3EEYA 5CUQA 3SSMA 5GINE 2G72A 5BW5A 3R6TA 2I9KA 2BZGA 2ZTHA 3ORHA 1NW7A 4XCXA 1DUSA 3O31A 3GGDA 5HFJA 3B89A 2BR4A 2Y1WA 4V0RA 3GCZA 5FHRA 1EJ6A 1YUBA 2P1DA 3A25A 5K0FA 1X1AA 4C04A 2FK7A 2JHCA 3MCZA 1KYZA 5DLYA 5LQCA 3GRVA 1SQFA 3LL7A 5DRTA 3ELUA 5EG5A 3EMBA 1JR4A 3LHDA 4V0QA 5T67A 1UFKA 1L9KA 2IIPA 4C03A 5EGSA 2FPOA 1R18A 3GXOA 4PCLA 2AR0A 5LQKA 1L1EA 2FRXA 2DPMA 1P91A 1ZHFA 2EJTA 2ZIGA 2HNKA 1NT2A 3TRKA 1NW8A 2NXNA 4RTNA 3PS9A 4WXHA 3HA3A 2VP3A 3DMGA 2UYQA 3GNLA 4ISCA 4F86A 1SUIA 1JG2A 2PJDA 3A7EA 3EGEA 2PWYA 3KPVA 3O4FA 3NDIA 1HNNA 3C3PA 3TLJA 4E70A 3G8BA 5GIPE 5M5BA 5DX0A 3HCAA 5FA5A 4LECA 5DTQA 5E9JA 4HH4A 5JR3A 4MIKA 1TW2A 3QOXA 3G89A 4RYLA 2I62A 5DPMA 4FS8A 4AZTA 4YMHA 2EFJA 1P1BA 1KR5A 2PX5A 2XVMA 3PT9A 3LPMA 5U4XA 3FUTA 3IYLW 4IWNA 4PYLA 2IGTA 1G55A 1WXXA 5EC8A 2WK1A 4PINA 3DLCA 4MQ4A 3OZSA 4QTTB 4QQNA 4R8SA 3SX0A 4BLUA 5K05A 2ZZMA 4C07A 7MHTA 5FQOA 2ONZA 3FRHA 4M36A 2XYQA 3UZUA 3KQPA 2AS0A 1JSXA 1H1DA 3T7SA 4PIPA 1R8YA 3EVFA 4AX8A 3QV2A 1XDSA 4PYIA 3THRA 4HG2A 3VSEA 3A26A 4YV0A 2JJQA 5LQAA 3UBTA 2IH5A 3CVOA 1EJ0A 3JWHA 4ER0A 5FCDA 1RJFA 4PYNA 4O29A 5HZMA 2BH2A 3PFHA 2OB1A 4BP3A 2IPXA 1XTPA 4PYKA 3LECA 2R6ZA 4ER6A 5F2NA 2ZBQA 1QAOA 3B5IA 3DMHA 3M6VA 5G02A 4EK9A 3KQOA 2OBFA 2EJUA 4BLWA 2B25A 3FPEA 4C08A 3NTVA 2QRVB 5GIOE 3NMUF 2ZW9A 5K0JA 4AUKA 2ZBRA 5CVUA 4PCAA 1R74A 3E23A 3KHKA 3SVZA 3M6UA 1NW6A 4KWCA 5JUWA 2P40A 2PGXA 3TM4A 3B7PA 5H02A 2QM3A 1YF3A 3IV6A 3UJAA 1G8SA 4C06A 3FPGA 3TPZA 3FTEA 4M37A 4EKGA 4DCGA 1NW3A 3EPPA 4GOND 3HA5A 2JH9A 5HIIA 1NW5A 1QANA 3PX3A 3GWZA 3SSOA 2ZCJA 2E5WA 3I58A 1G8AA 4LG1A 2F8LA 3DP7A 4GEKA 1JG4A 4BP1A 1QAQA 3ER8A 1F38A 2ZFUA 2P7IA 3E7PA 1YZHA 5E8RA 4GUAA 5DM4A 3T7TA 1VQ1A 5E1MA 4FZVA 3GU3A 5DX8A 4POOA 3ELDA 1VBFA 3REOA 2P3QA 3DXXA 3CJTA 3KR0A 2R3SA 1KYWA 1VP9A 3G2MA 3NJRA 3DR5A 3BGIA 3TKAA 4P7JA 4RSRA 2HMYB 3KQVA 4EMSA 3LDFA 3EVBA 3I53A 4HC4A 4ER3A 1B42A 3RIEA 1SVUA 5K0BA 3ER9A 2VDVE 3ELYA 5EKXA 3EVZA 4ER7A 2CWWA 2YXDA 4KDCA 2OB2A 1JSZA 1ZQ9A 3MAGA 5C0OE 2PVCA 5KVAA 4IV0A 2ZLBA 3UJBA 3PLAE 2IDJA 4YUVA 1NBHA 2AZTA 2IBTA 3L8DA 2Z6QA 1ZGAA 4AZSA 1OR8A 2AOTB 2YUIA 2YTZA 4UOEA 3CGGA 1VL5A 5FWAA 5DM0A 2VDWA 2AN5A 3C0KA 3HVJA 5E1DA 1KPHA 4FT2A 2G71A 1JQ3A 3FRIA 4P7GA 2OZVA 4OA5A 1RI4A 2O05A 1ZKDA 1XXLA 3G8AA 8MHTA 3GRUA 4FP9A 1JTFA 1BC5A 5EIWA 3P9CA 2I6GA 3FUWA 4PONA 1R00A 3LDUA 2AOUB 3HM2A 2FK8A 3UFBA 3HVHA 4HTFA 4XUEA 4CKCA 1P39A 5B1SA 4PGHA 3BWYA 3GJYA 4PIMA 2P7HA 3BT7A 1SG9A 4BY9E 3FPHA 4E33A 1YFLA 2GA9A 4ZTBA 2ZSUA 3TOSA 3T7RA 1N2XA 2P3OA 1WY7A 3EVDA 3FZGA 3OU6A 3TMAA 4BLVA 4GBED 4CKBA 2PBFA 4OBXA 4RTPA 4R6XA 4HRAA 2C7OA 3B3FA 3FTCA 4KW7A 1V39A 4RTRA 2JHAA 1M6YA 3C6MA 3CJQA 5E1OA 5HIKA 2KW5A 3ELWA 3VC1A 5E8JA 4CKEA 1IM8A 2HV9A 4EVIA 1RJDA 4OX9Y 2ONYA 2ESRA 1KPIA 3EVAA 2P3LA 2H11A 4RTKA 4OBWA 5KS2A 2PV0A 3G2PA 3NW9A 2XVAA 3AJDA 1WS6A 4MHTA 2V7EA 1QZZA 3HVKA 3KPYA 5EVJA 2NXEA 3DULA 3DH0A 3DMFA 3AXSA 5KQSA 3CKKA 3MHTA 2BR3A 1BOOA 2YQZA 3MERA 4P7KA 5EEGA 4QPNA 2HTEA 3IEIA 3BUSA 3A7DA 3LSTA 5T6BA 3MTEA 5FA8A 4AZVA 3M4XA 1I1NA 4A6DA 2QRVA 3DXYA 4DCMA 4Y2HA 5EHIA 1ZG3A 2PX8A
chains in the Genus database with same CATH superfamily
4K81B 4K9PA 3BILA 2PEZA 5EZYF 2A14A 4M9RA 1GGNA 3QVJA 5IVDA 1RJEA 2H1IA 3R7SA 1TQ4A 2D1SA 1FEZA 4XWWA 4TROA 4IIJA 1DJQA 4A8JA 4BEWA 3S8YA 4XE5A 5FKJA 4BVFA 4XWOA 4DJEC 3DDNA 2EP7A 4LPKA 3DZKA 2H57A 2R85A 3A27A 5K8CA 4NVRA 1EVZA 4WT7A 2JG3A 1FXUA 5LKRA 1W75A 1H4SA 3VHXB 2X86A 2OM2A 2Y1GA 2JFHA 2XHEA 5K4GA 1JIQA 1QYRA 4DSAA 5JJ5A 3T0IA 2BISA 4IIFA 1KL7A 1T29A 4HNVA 3NWBA 5L3VA 4TUYB 4MYSA 2CLSA 8ADHA 2B36A 5DNUA 2O8CB 1ZWLA 4C2AA 3O93A 2VDQB 4LQCA 1D7AA 1Z6QA 4GI1A 4CGYA 3VPHA 2AG5A 2AK3A 3R7DA 5CGZA 2G1KA 3PKZA 3X0DA 1IRIA 2UVDA 2IFTA 4IMJB 1TTPB 3T0GA 2IYZA 1TYDE 2P9YA 5JAOA 5AW0A 5HUJA 4AJLA 3HZHA 1BGXT 4JDUA 1OBFO 1R37A 2J45A 5C5CA 1ULTA 2G7MC 2Q9CA 1E3MA 1DGQA 3QPDA 2RBKA 3CUYA 1BCSB 4R9RA 4ZI3A 1QH8A 3T7EA 2X3FA 3V00A 4E88A 1XLTC 1J23A 1IATA 1OU4A 3TSZA 1J1ZA 4MKIA 4WZBE 1YKSA 1UBSB 2PVPA 4L73A 5DHAA 1TMYA 3KJFA 4Z99A 5ERGB 3TL3A 1XZ8A 1DZIA 2HK6A 3DQPA 4RHCA 3NX4A 2FWJA 4YRGA 4WXRA 2A5DA 3PCTA 2Q1WA 4MA5A 2GUGA 3MUFA 4IRUB 3V8NA 1E7WA 1ZLYA 2GK6A 1NJ5A 4DLSA 1OUMA 1TVCA 1NMZA 1S3SA 2BGMA 3F3SA 3P8ZA 3QMPA 4IXWA 4JZYA 4CLXA 2FPPA 4PEVA 4KRYA 1I7QB 2XCSB 3DXFA 1U8ZA 1DBWA 3KSUA 2OZLB 1UWCA 2D74A 3MRTA 4ZI7B 5KYYB 1W4AA 4K3UA 1QM5A 1J9ZA 4OB8A 3KFVA 2TRSB 1I0ZA 1XTBA 4OQZA 4YI5A 3QYJA 5LZ5A 4B87A 3VKGA 1PLLA 1GPUA 1Z7EA 1LPOA 4DQ0A 1DAMA 3OIGA 5A4IS 3E05A 1FMCA 5FBLB 1OH7A 3OZFA 3PX2A 1KZYC 4XASA 3RC2A 3A37A 3G8CA 4LDZA 1MXHA 1TO6A 1A82A 4MS3A 1BDJA 3TXYA 3ZY4A 4A82A 3BH6A 3C7AA 1WZIA 4UC0A 3AEKB 2DWCA 5A1TA 3CZRA 3RF6A 3D43A 3DBRA 2H8GA 3KJHA 3LBHA 3EULA 3GUHA 4JJAA 4PZ0A 3VVCA 1ACJA 1B0ZA 3LXXA 1I0IA 5KWEA 5LPNA 2XT9A 1JKIA 1W0KD 3UUWA 3KD2A 4D5EA 3E7DA 4R0VA 1XD2B 4L0CA 5MGNA 4N5HX 4EO7A 1LWNA 5TLSA 2AE1A 1NQUA 5E0KB 1E61A 3QBJA 2C9MA 5JRJA 3KQYA 3O91A 4D81A 2VNAA 3R7LA 1TIBA 2VCYA 3KT3A 3V2IA 1TUEA 1CD5A 3FKSD 2R0QC 4HI0E 5CLJA 1JRLA 2HW8A 2E48A 2Q5OA 2Y66A 2EWVA 3EZLA 4KFTA 1HKUA 1QH1B 4DQVA 3VHRA 2F1HA 3FNEA 3BIWA 4N6NA 1PFUA 3EG5A 4IR7A 3L1UA 3N2GB 3WHLA 4O25A 1J2JA 4U39A 1TGYA 3G88A 2G40A 1DRUA 3EY9A 4YJ3B 1NFQA 2J6IA 4BMDA 1QQ5A 4JCCA 2X9LA 2JLCA 1XEWX 2WHYA 1XVLA 1ZVKA 2WJWA 3D59A 1IN4A 1P2GA 2YNMD 3HWSA 3ZWMA 3UN1A 1V1RA 2QL9A 2GPYA 3DFZA 1Z5NA 2AXQA 3F6CA 3GFPA 3UO8B 5KSZA 2BP7B 4K86A 1U2TA 1XZIA 2AF3C 2HLPA 2PX3A 1QONA 3ACDA 2W5UA 2B3TA 3Q72A 4J1SA 5DBHX 1QDLB 5FQNA 2I1QA 1XEXB 3UUEA 3VHXA 2CFSA 4YDQA 4NBNA 5AXAA 1FRFS 3PC2A 4LHZA 3P9PA 5EZ5A 1U2DA 1PL8A 3WYGA 2J33A 4GSLA 2CMKA 4DCVA 3EIEA 3UH1A 1N8NA 4MW0A 1V45E 4EGCB 1GTMA 1QOPB 1RHKA 3GA0A 3R4VA 2OPHA 5J5AA 1RW4A 1ZM9A 4GOOD 4CLDA 3BX1A 1B8PA 1OQAA 1EIZA 3OURA 4ME6A 1QORA 4ZGGA 3M9LA 5EKSA 4B1FA 4BWYA 5LN1A 4QU9A 1LW6E 1Y34E 4IJVA 4NNJA 5T64A 3E2PA 1OC2A 1TMGE 3W3AH 3BL5A 2YOFA 4JHLA 5I8PA 1EFVB 3ESDA 3VTZA 2JD2A 5IMSA 2X2EA 6REQA 4WL0A 1RAAA 4EG3A 3A14A 4UJ5A 1GTJ1 3D7RA 2BC9A 4IHAA 4NABA 4QHYA 3M3HA 2O1WA 1YQTA 4EY7A 2FFQA 2IZZA 1SU6A 2YXEA 3SR0A 2IPAB 1KEEB 2X5OA 5FYDA 4KIWA 2V6GA 3BGWA 1YB1A 3ETGA 5DBOA 5FBQB 1ORHA 2QB5A 3PXUA 4BO0A 4L78A 3W3AD 3T06B 1EX9A 3X3HA 2OBBA 2AI3A 3TX2A 1U81A 1JA1A 1C9YA 1RWVA 4EYQA 1I10A 4NMXB 2PS9A 4TL6A 3ENWA 4Q7KA 2V6IA 5ELXA 1UIRA 1SU8A 2Q27A 2HIGA 4FT4A 1U90A 1CT9A 1U3DA 2BONA 3PFKA 2RHHA 4FZRA 4I6GA 4MLCA 3CVYA 2CXNA 1RSZA 2AYZA 4Q93A 3TJRA 4BQPA 1Z29A 1V6AA 1EPUA 4CNQA 1TQDA 2RH5A 3HFSA 3V48A 3HXMA 3QKSB 1XALA 1CP3A 1ZGHA 1ZUD1 2EX4A 2ZSBA 1IH8A 5LBIA 2MYTA 3FMFA 4CEHB 3TMYA 1IBKB 2AI1A 2XOXA 4GT1A 3DE3X 2XMPA 2YY5A 3OEWA 3PEYA 5CCXA 3K20A 3M9WA 1FYXA 3GWGA 3GDHA 2P30A 4NHEA 4GC9A 2ACVA 2PA0A 2QF7A 3ABSB 3K8QA 4R7GA 4BNTA 8GPBA 4DDWA 4DV6B 5IABA 1EX1A 1QIKA 2P2SA 2QD1A 3AM5A 3L84A 1XLTA 3H8WA 1EP2B 3GT4A 5FUWA 2AMLA 4JFAA 4DJJA 2WYHA 4IIHA 2P8JA 3BN3A 1N0VC 3PC3A 3P9RA 4OHMA 1WDLA 2ZI9A 3VV2A 1TJ5A 3UHFA 1ATIA 4XGNA 4JNKA 1MAUA 3FAKA 1LBIA 4MUFA 1JQEA 2GOYA 4HXEB 1DDGA 2CHUA 5ENDA 4ZDWA 4BRUA 1MX1A 1WL8A 3BF8A 1X87A 4ILKA 2Q5QA 1M6NA 1ZYUA 1M5TA 4HF7A 1NI4B 4WA8A 3C98A 3ROKA 4BX3A 5LLDA 1EA5A 1CVIA 3DWEX 2F8MA 5ALHA 5IC4A 1P2FA 5CUQA 2PZ8A 2ADOA 3A1FA 3MWKA 4Q6BA 5BW5A 1VLZA 4QM7A 2YZ2A 3NP7A 2GVDC 2QTMA 3ZCRA 1NDHA 2XJ4A 1V11B 1ZKMA 3N2GA 4E6EA 1KVRA 1QFJA 2K2QB 4MQFA 1SU7A 4X54A 2XZTA 1DUSA 4BUJA 4A2QA 4TYYA 4K2AA 2H08A 1H0HA 2G0AA 3D54D 3U13A 4WMLA 4CI9A 4X65B 4J4TA 1ZC4A 3SY8A 2GM9A 3VZPA 4WXMA 3VAZA 2FK7A 3B2NA 2BP7A 4EB8A 1KI8A 4QRDA 4FBMA 5CAEB 1VMIA 3GLFB 3PTLA 3PDUA 3JQAD 4RS4A 3IKTA 3MRSA 2NPIA 2Q3BA 3BZWA 2HRZA 4F7WA 2I3BA 1SBZA 1TU0A 5KYUB 2J5KA 2PA3A 2QXTA 4QRIA 4KKVA 1QRUA 4HAWA 4NCHA 5BUQA 1ZHFA 2F3QA 2VF8A 4HO1X 5CDFA 3Q2OA 3HA3A 2BGRA 4BGEA 1E3LA 5L45A 3KVRA 5IARA 5LB2A 2YYZA 1MJHA 4GMGA 1K1EA 1QP7A 3B8EA 3RT7A 4PFSA 2YJ5A 1ADGA 4ZQIA 3QWAA 3R5KA 3P52A 2AG6A 4JITA 5HZHA 2X0DA 3PFFA 5AI0A 2C78A 5HGJA 4EVQA 3E4DA 3RIYA 4F4IA 2OZKA 1XP5A 2GBFA 1II9A 2WKQA 3LUAA 4GXRA 2ODBA 5JR3A 3OKAA 3BOSA 3HGTA 4PRYA 4Z9AA 1XA4A 1N6RA 2CDRA 1X7WB 4C5AA 5MFPA 4AD8A 3RTCA 4MB2A 4PINA 1A71A 4PAWA 2XYHA 7MHTA 4JOQA 2QTAA 4QZVA 2E89A 3NC0C 1EWTA 1EVYA 3UICA 1QO0A 4OHOA 3G5MA 3QTLA 4UU1A 3VH4A 4EPWA 5JAIA 3AVUA 1XZJA 3EDOA 4H3HB 4DLNA 1EHIA 1IOVA 5K5EA 3CG4A 1V9LA 1UMCB 2MMCA 3THXB 2JJQA 3RYCB 1DU4A 1C7EA 1C50A 3CUUA 3B2QA 2PMCA 3Q3HA 5I8ZA 1V3TA 3EEBA 2Q9BA 2X9NA 5J4HA 3J81A 2FPIB 2CNOA 2FUNB 2FMXA 4CIVA 4EHIA 1JX6A 3WQSB 3V4LA 2IYNA 4Q9JA 1G7TA 2AQKA 3G49A 4M0LA 1TYAE 3NANA 4EY6A 4CEHA 5AUPB 1EXVA 4WN9B 1WBBA 1NUTA 1JG6A 2IPLA 2VHWA 2Z9CA 3NFYA 4MH0R 1JLKA 4Z9BA 3LYUA 3SE0A 5K0JA 2RHOA 4OKIA 4EFNA 1Q21A 1PFKA 1VI2A 1JH9A 1YDFA 3BJRA 2V65A 3ETNA 1TFUA 2XEDA 3HSSA 4P4SB 4Z7JA 1EUQA 3VZRA 2BKAA 5CITA 3MTAA 4N1AA 4WKBA 3ESCA 1JLRA 4BNHA 3HJRA 2IQ5A 4LQLA 1AURA 2EJBA 3B7GA 4D97A 1ESMA 1LPSA 3KJIA 4RE6A 4US1R 3DWFA 1FNDA 2CDBA 1KERA 1YC2A 2FE1A 2FPGA 1TM5E 2W6PA 3A2LA 3COSA 3SSOA 2YMLA 4EX6A 2QJOA 4LG1A 3ITEA 2OCIA 1DDIA 2EJWA 1ND5A 2OOSA 3ANSA 3WO1A 4ES6A 3KOYA 5DH9A 4MRMB 2D2VA 3E9NA 3KAQA 3KEOA 1DT5A 5AXCA 1P9RA 2N0SA 2ONJA 3UVEA 5ITVA 4QBTA 5E1MA 3CCBA 2C7GA 2EARA 4QQ8A 3QBEA 4M0DA 4UEJA 4Z4IA 4JVNA 1UKBA 2OORC 3DOJA 5JBQA 1M5RA 4CEIA 3KWFA 4FFBB 2NQ8A 2Y4NA 1MB2A 1GPJA 4HP8A 4AMBA 3GEPA 2XGGA 4Y0VA 5DGIA 4R0NA 4EQ6A 4XWGA 1TE2A 1S5PA 3HB9A 1EWYA 2XMCA 4RV4A 4OSOA 3TLGB 1FS5A 3ZV5A 5C7YA 1ZRHA 5K3FA 1UBTS 5EKXA 1XVVA 3RSGA 1PL6A 1PL0A 1Y1SA 2RK6A 4WE3A 2NVUB 3EPRA 4BVKA 4ESHA 1JEDA 1ZR4A 4JB8A 4CQMB 4EGSA 3EXHB 4N18A 4Y6QA 1JSCA 1ZIXA 5EE0A 4DIFA 1THTA 3AKYA 4OXIA 3EPHA 3B20A 3LHIA 1ZW6A 2LCIA 1SHKA 2PAFA 4NYMQ 4R01A 4ENPA 4PGAA 1PGQA 2TMKA 3B2EA 1E3QA 2QVBA 1K9SA 3NBAA 2Y1DA 4TV9B 4HXYA 2XCOA 1VL5A 5F12A 1M34A 1AX9A 3AQ4A 1KJZA 4YCSA 2B34A 1NIPA 2Z56A 2W2NA 1KPHA 3VOTA 1I01A 1JQ3A 2AJTA 2XCRB 2LPMA 5A4KA 1DTEA 4IOJA 3WIEA 3AQIA 4QOHA 3GOQA 4DIOA 1UEIA 1WB9A 3OICA 1WXDA 3ICWA 1ZOPA 5FPHA 3VKVA 1QTQA 1CF4A 1U1EA 3FUWA 3I3OA 1YZUA 4MQUA 1J9EA 3RV4A 5IBRA 4CPDA 3HVHA 2DFDA 1UXOA 5LIPA 2F1KA 2WF9A 1ZHHA 3OOSA 4JL6A 3KUKA 3OFVA 3U3OA 3U49A 4AJ9A 2ISQA 2X13A 3FMGA 4FILA 4MGHA 2BFCA 3FOCA 2PH1A 3TOXA 2X23A 1GNVA 4K1LA 1NVXQ 1H9CA 1GLGA 2B5VA 1BD3A 2ZS9A 1ISRA 3LG2A 4RCZA 3GNTA 1V39A 4ZVMA 3U19A 2JHAA 3R8FA 2BSXA 4X94A 2OGWA 1CX9B 3VC1A 3ZWBA 4G5GA 5A9TA 4NYJQ 4OBBA 4G37A 1PZHA 3L01A 4JBYA 3ZDCA 4IHJF 3V7UA 1RWPA 4KE9A 1XROA 3DYBA 4WRRA 5HCNA 1P2VA 2G4VA 1M1YE 2EX1A 2RAVA 4ZT5A 2IQIA 4WZZA 4F8JA 3CSUA 2AK2A 4B9AA 3RYCA 4Y67A 4GDMA 3TQFA 1CUIA 3CB4A 3D6NB 2BFNA 3DMFA 1O95A 3QLEA 1BOOA 2IZ5A 3VZQA 4B3DA 5JNLA 2OO7A 3O3CA 4TMWA 5KCZA 2Z0MA 2UUOA 4UM9B 3LSTA 6ABPA 4BFVA 1PWZA 3E81A 1Z7YA 1EK5A 4ZYLA 1LNQA 1NPDA 1WLSA 3G9UA 2PUEA 2G1JA 3ASUA 1USKA 4EJ2A 4S0ZA 3RUCA 2ZUCA 4Z9YA 4KITB 3V3KA 5JSZB 1OBCA 4LDPA 4R1LA 1ESDA 2ES4A 2WDZA 1RDFA 3FPFA 3Q7SA 4IS2A 3HRKA 4YJGA 4C4XA 1RC8A 1G8KA 1G98A 1S3IA 4KK3A 1C80A 3INYA 3MA0A 4JAVC 4JKIA 5LMCA 1E6CA 1ZI9A 4X1OA 2OCDA 3EXEA 3K0AB 1LDEA 4LJ5A 1US8B 1YQXA 4AO7A 1SCIA 5F4BA 5BN4A 1JW9B 1ICEA 3PVCA 1FL9A 2IZOA 2Q29A 5HRUA 1K63A 2NTJA 3ZWVA 3ET5A 5C8ZA 4DV3B 4PAQA 1CDOA 1O96B 3KYBA 3EARA 4JVMA 5A3QA 4X1KA 4OSEA 3VVLA 4EG8A 3G2KA 2EKPA 5DTRA 2GNOA 1X8JA 4YWJA 5IM4F 1N33B 2Q6TA 2MSLA 3DONA 3O7WA 3RSZA 3Q41A 3DKRA 3LT0A 3FCAA 3P94A 1VSVA 5CB4B 2JIPA 1LI7A 2JDIA 3U3MA 2NGRA 3ZWPA 3HJBA 1ZD2P 4RPKA 4DLTA 2NP7A 1RI5A 3VO1A 2PJRA 3QBDA 2G1PA 4LY9A 2JLVA 1BOFA 2NX2A 3AVWA 2OG1A 4AZ0A 2IPNA 2P9FA 2BJHA 3CX3A 4QDXA 5DCLA 5T6MA 5LR6A 2XNDA 3TUZC 5DMHA 3WS7A 3TM5A 5IN5A 1J33A 1UT6A 3SNKA 4O8ZA 4ECAA 3LDAA 3MELA 3KHSA 3R9XB 3EXHA 4JI4B 1ITZA 1X7GA 5K4HA 3TMKA 4KIFA 3H2BA 5FV7A 3V4VB 3UGJA 4PBRA 4URWR 5KQPA 1U31A 3PTAA 4V0ME 5HK9A 4MUYA 4C3VA 5KYVA 3S29A 1UBUS 4AUNA 3H2ZA 2Z98A 1VSBA 4WHMA 1MHTA 1G60A 3C45A 1RZRD 4IJUA 1ZJ4A 2G36A 3KIPA 5C3MA 1G2QA 1I3CA 5LJLA 3KUDA 1Q0TA 3K3PA 4R8VA 3E22B 3ONNA 3GOHA 1PDWA 4UTVA 1AN9A 3F4BA 5IEJA 4GG1A 5I5GA 1NXPA 1UK7A 5JW6A 2IH4A 2ZIWB 3CTMA 2G9NA 1HWYA 2OORA 5CA0B 3GPBA 4OIFA 3TO5A 4KEAA 4RTJA 1KEWA 5AM1A 2HYIC 4ZQEA 4LA4A 4LNUB 5BSHA 1ONBA 3IV9A 1N32B 4X45A 1TYEB 2O20A 3QH4A 1WMSA 3FPJA 5LP6B 1N6LA 4FE7A 2OCXA 3BMXA 4X9XA 4LJSA 2X19A 2DY0A 3FHJA 1EXMA 1M2OB 1P9WA 4I55B 1SRRA 2FDCA 3TXXA 4BO2A 4D8XA 5CDGA 3G6WA 3QHQA 4OUKX 2XWSA 3JQ7B 1DFHA 2P3SA 3E7WA 4HYQA 2ZYIA 1I2CA 2ZB8A 4LV8B 3JCZA 4MI9A 2FEKA 4OFZA 4C14A 2AUTA 1M54A 4ZFNA 1KARA 4ARAA 4ML3A 5FHQA 3GLIE 2YFYA 1ZSNA 1JAIA 1GZ6A 1TA4A 5GGYA 3RHSA 5IXJA 1V41E 4P3XA 3K05A 5CT5A 4BLSA 3DZCA 2X6TA 5C3UA 4EO9A 1DAEA 2DBZA 1F8GA 3SG0A 1SBTA 4JSYA 1DEOA 4DY6A 1SZPA 1FJXA 3OO1A 4DBLE 1AB6A 4BEVA 1EAYA 5K0LA 1Y82A 2QSJA 5B2FA 1HV8A 1S01A 2VKQA 1QGUB 1ADBA 1KAHA 1SKUA 1TT5A 2EP5A 4FSDA 1YGPA 4QXPA 4CQMD 4E13A 4ETMA 1JS1X 3FROA 5AHKA 3VU9B 3VUEA 4FB4A 3PDIA 3RVPA 3BFJA 3ROPA 1Z6TA 3MNFA 5J3JA 3HRIA 5KKAA 3KNZA 3K0AA 4FSHA 1NUUA 1US8A 2AYXA 5TPWA 1Y0BA 2WF7A 1U3WA 3HR7A 5BWMA 1J0EA 3ZXXA 4ABYA 3UMGA 4K6FA 1O96A 4GNRA 2WFMA 3MTJA 3SHWA 1IVNA 3A70A 3UMCA 3GLVA 2OKCA 1WMEA 5DZSA 3GAMA 2HLDA 3AXTA 2WFAA 4WK4B 2JCVA 2OK7A 4XPZA 1II0A 5J63A 1SBHA 4EW3A 3IIJA 3WKCA 5AP9A 3D7KA 1NUQA 3L8CA 3QY0A 4MGIR 4E5SA 2F59A 4CXMA 2O2CA 2I1WA 4ZA2A 4NP6A 4YP7A 3LI2A 4YFVA 1N36B 2PRJA 3CKLA 3TZHA 1JKJB 5DI9A 3USCS 3QF7A 1P18A 3ZQ4A 3R7WA 3EZ9A 1N9GA 1QHFA 2Q5CA 3GDFA 1UDBA 4G0ZA 3A4MA 4OHCA 4WUVA 3JVEA 3EBLA 4HDNA 2QGZA 1M67A 3DE0X 2IOFA 3R9XA 2BEKA 1ACMA 3R3ZA 2NMVA 1YFZA 3CMCO 2G5PA 4FGUA 5K0NA 1JLHA 2FZLA 2OSVA 3A1DA 1PP4A 1VPTA 4BNXA 1Y4DE 4R2JA 5CHEA 1YFJA 3I0MA 4HEA6 1FLVA 1O6CA 1C8LA 1NONA 3NBQA 1PFWA 4TMZA 5EUBA 3STXA 4BUCA 1QP4A 4B3TB 4ZOBA 4OM8A 2MWMA 2PLRA 1N7GA 2J3KA 2OSBA 2P0AA 2EHDA 1C5KA 1ML4A 5KBYA 3I5XA 1TC1A 3KSRA 1TADA 2CLIB 2QVYX 3OQIB 4JI8B 5CD9A 1OXSC 2HJGA 2PJZA 3HKCA 4JJFA 3N76A 2ZI7A 5CH8A 1K75A 1I3KA 2FAXA 3ZIDA 2BKXA 2E1RA 4O2BF 3IOEA 3IP5A 4RVSA 5CX1A 2IBSA 4TZ0A 4R51A 4L57A 3B9QA 5AKGA 4F3TA 1DIHA 1RADA 2EBHX 3F2IA 3P2EA 4LWOA 4UMDA 3AU8A 1Q3HA 4GUDA 2BBTA 3DV0B 1RYFA 3LP6A 1Z2NX 3A6DA 1TX4B 4FWTA 4KVZA 3EZYA 3PG5A 5A4JA 2P5SA 3EASA 4JGGA 3CVVA 3TI9A 5JY6A 2PMKA 2SECE 2DPGA 4MEAA 4ZQGA 4AZWA 5GMOA 2JATA 1WUIS 2ADFA 4AG5A 4JP5A 1OA1A 2GPBA 3BB1A 3M4ZA 1P80A 2PNJA 4C4AA 4BXOB 1CHDA 5C8XA 3VPCA 3MWDA 2ZJ2A 3EGIA 4R9VA 2YMQA 4QYSA 4LMAA 2ZBVA 1WX1A 3RUIA 3TW8B 1SXJC 4ZRNA 5D5QA 2ZR8A 1PFVA 4MJLA 1QIIA 2AQHA 1U3VA 3FFBA 3RVDA 1D0IA 4QT4A 4YCCA 4TYPA 2SCUA 3U4QB 1RXEA 4IXDA 5AM0A 3B3GA 3VJRA 2I4IA 6AT1A 4CF6A 1Y1QA 2W8BA 3V97A 4GKAA 3JQGB 1BVUA 2DT8A 1GYPA 1PR3A 2ZCVA 4FN4A 2N1MA 3TR5A 2O57A 4MWOA 1T3SA 1Y6RA 1AGRA 4EECA 4P3OA 3DBLB 3FLMA 3F97A 4N0QA 3UJCA 3S1LA 3LYHA 1QGUA 4PX5A 1V8BA 2ST1A 2HRRA 1G8GA 1HDGO 2EGUA 3OF2A 2QRLA 2ZANA 4JS0A 4GKBA 4L4XA 1WETA 1Z34A 4JSRA 3B89A 2IYRA 5ES4B 4DGQA 2OAEA 4G5YA 3NBMA 4QOFA 1EJ6A 2WJ3A 3FOWA 2IU0A 3VHQA 4C3UA 4BNGA 1CZRA 1FYEA 2VJQA 4NENB 3RADC 5CIWA 2OFPA 4ZKDA 3CUTA 3R3UA 3O2SB 1OZGA 3MINB 3EMBA 3DO6A 4GHWA 3L8FA 3SIWA 5LP1A 3DT9A 2Q21A 1UBMS 3L1JA 5JALA 2REQA 2VQ6A 4UTPA 1DDOA 3X1DA 5GPBA 5CFPA 1HE3A 2C5GA 5F9MA 4RE5A 2JLYA 2ZIGA 2UYHA 3ZDXB 1PV4A 2VHCA 3SBOA 4RTNA 3D8NA 4X92A 4XQGA 4U7DA 1DJMA 1QSGA 4KWIA 2WD9A 4Q34A 1JZTA 2F3SA 1YCHA 3UWSA 3ZE1B 2PH3A 1XQYA 4EX7A 3V7FA 3TLJA 1PZEA 3O8CA 4KXVA 1IB6A 3IDQA 3L43A 1VLQA 2VYCA 4ICIA 2EBWA 4BRSA 1P5ZB 5DX0A 3L49A 4EVRA 3QVWA 9LDBA 2PTGA 1UK8A 3LU1A 3WL6A 2O3QA 3DVLA 2NTYC 4WCFB 1YOVA 4A8PA 4ZYYA 1TW2A 4MSUA 2WP8J 4B80A 5A06A 1OBHA 4FS8A 2C5BA 1XTQA 2EFJA 3DPUA 3ABQB 3TNDA 5EC8A 1XZLA 4M8LA 2OVFA 5C5DA 3B38A 1PD0A 1DTSA 9ABPA 3PQ3A 1VL2A 3ZH2A 3WK8A 1PX2A 3RAGA 5AM2A 4UAUA 4L22A 1M2JA 1QKJA 3CW9A 4NFLA 5CW1A 5TGDA 1T6NA 1ECGA 4BASA 2QT1A 3CRMA 4UZEA 4D3XA 4B6JA 1FTQA 1XF1A 3TDMA 1E96A 1C2TA 3IAM1 4YRIA 1OB5A 3THRA 2QUIA 5LQAA 2VHXA 3CEJA 4S2UA 4C1BA 2MYNA 4RJIA 4KWTA 3OZEA 4DZZA 3UKDA 1UKAA 2OB1A 4F91B 1XKXA 4KUHA 4BDSA 4BP3A 2WJJA 1MF7A 1CU1A 1P2TA 3LECA 2I2FA 2WJGA 2YN0A 4TMFA 5B6JA 5BOSB 1BDHA 4W4TA 4G3XA 4DCTA 1D9ZA 1OI4A 4YUAA 1W59A 2QBYA 3C97A 3PZBA 5GY7A 4XIYA 3NTVA 4P32A 3TTXA 1ZIOA 4BMOB 2YW9A 3M6LA 1RD4A 3WHKA 1F0PA 3WYDA 1F5SA 1PNTA 1L7EA 3ZZNA 3FF1A 2Z2JA 4M1OA 3R7AA 3AF5A 1PKEA 4I5FA 4TRNA 4HAIA 5HKOA 4RS3A 5PNTA 1NQAO 2MR5A 2QM3A 1MQSA 1A5ZA 3IV6A 1APBA 1Z82A 3WKEA 3OQMA 2OUKA 4O2LA 4EKGA 1NFRA 2E0IA 2FEMA 4DCGA 5BV2P 3AY3A 3KZKA 1K6IA 5ALEA 4UBJA 2QUKA 5KREA 4ASUA 3CWCA 3K2IA 2WZBA 2WYIA 3DLHA 1DO0A 4M1ZA 2A84A 1KC3A 3C5VA 3DP7A 1GNPA 1II8A 4RM3A 4LXHA 5AVKA 3TW4A 3E7PA 3OPQA 2JCYA 3QLVC 4OEHA 4HKTA 3JQGA 1SO8A 4RDCA 5E8RA 1TM4E 4DCNA 5I47A 1EIWA 4EIWA 5AJHA 1N6NA 2E21A 4CLEA 1JJBA 3HFRA 4YHBA 5AFSA 5GVSA 2CB0A 4J1NA 2YVAA 1J8YF 4H7JA 4WX2B 5DHTA 2A0XA 2R1VB 2IUUA 4AWAA 3KQVA 3VSAA 4MQ6A 1LZLA 2A4KA 4LYHA 3REQB 1OGIA 4KKXB 3ZNOA 4AL4A 3ER9A 1TLLA 4S1WA 4L74A 2C2HA 1EUCA 1X1RA 2ZYSA 1YVUA 2OB2A 4PHHA 5DCYA 1GZ7A 3WRYA 1PE0A 3E03A 4RGQA 1ZH8A 3CX7A 1ZOOA 4UEQA 4UU0A 3K0HA 3OTHA 3C70A 1N0WA 3K5IA 5EN4A 4XJVA 1JLMA 4QWWA 4BCCA 2DBVO 3I9NA 4JUAA 1F2DA 4WZBA 2YTZA 1YO6A 4YRDA 2W93A 1X1QA 1SXJA 5TVGA 2ZAIA 3UPUA 3GJXC 1E2FA 1PN3A 1UFVA 2Y1EA 1H9BA 4RDIA 4ZOLB 4DDHA 5I3CA 4JKYA 5LWQA 1ZR2A 2G71A 4DA8A 4L51A 4Y6SA 3H7IA 4HDOB 3T12A 3OJFA 4BQSA 3M5DA 2EZTA 4EHNA 4URUR 5BYJA 5A3VA 3LO8A 4HLQB 1BJTA 4NU8X 5TSDA 3WYCA 2Y9PB 3O1JC 4G1MB 4KXQA 4P4GA 3EXFB 4PONA 2FUG6 4A8TA 4Z8YA 3OEYA 3KUUA 5DTJA 4A0SA 1U0RA 1C9JA 4A23A 4E33A 2DZDA 1M7GA 2C82A 2HIAA 4IXMA 3GFFA 4YVFA 4GXQA 4CT4B 5I9IA 4ZTUB 1RQXA 3KSBC 5JBNA 4WCFA 4ZIRA 3X1JA 2PKCA 1ZXBA 2FW6A 3AKZA 3IA7A 3NAMA 4KW7A 1YS9A 3ZC3A 4OL0A 4DVJA 5JNRA 4GLBA 4PYRA 3F71A 4UOQA 4ZU3A 2ATVA 1RJDA 1RM0A 2GRUA 5I6DA 5ELLA 4C9BA 5DBGA 4ND8B 4TYMA 3WOHA 1R0WA 3ZU5A 5K2MA 2IYVA 3E3NA 2HK8A 3N70A 1IEVA 4GM4A 1NNEA 1ZJ5A 4DB2A 1C41A 4ACAA 5CA1B 3ULKA 4Z49A 4L0DA 3U62A 1FQWA 1UBJS 1PIWA 4RIIA 2YYAA 2P6OA 1E62A 3IR7A 1EMDA 5TVKA 4UW9A 5EEGA 1W52X 4EM6A 3GUCA 5B1YA 3U44B 1YQ9A 3FCOA 5IJ9A 2A5GA 2VP6A 4KQFA 1GL9B 4PSKA 1F14A 3HUEA 3M4XA 4JMLA 4R5MA 4IX1A 5EJIA 1CE8A 4HUJA 5EHIA 4D9MA 1LI5A 1KWGA 4IQ0A 4GDFA 1T2CA 4Z4QA 1L5SA 3BA1A 1I8TA 4UPDA 3PHLA 4NFYA 2IEZA 1B4DA 3GJZA 2JJ2D 1LW7A 2Q2QA 2QE7A 3C7DB 1D3AA 3HYTA 3MM4A 4FSXA 3DNPA 1QYIA 3GCWA 2QPLA 1GAQA 3GFQA 5CM2Z 3NU1A 1NJ6A 4DRYA 4RSGA 1LCIA 2GDJA 5KKNB 3F8TA 1VBMA 5KYGA 2NQ2C 4M4SA 1SKQA 2O2XA 2G07A 4D2IA 3EF1A 2QORA 1DAPA 1TRHA 2C2OA 3C3WA 3FIUA 3R6DA 1Q92A 1U7HA 5CBKA 2FV8A 5KNCH 4ZCSA 3MTDA 2K87A 4QELA 2FXIA 3OCVA 3RRXA 1Z5GA 1LXCA 4N5NA 5JS6A 3HJTA 4Z1MA 1T1GA 4IXNA 4BQEA 4QUJA 2IW1A 5CP8A 2FR0A 3MJFA 3D5EA 1QPBA 1Z15A 1ZVQA 2HWUA 2NXWA 2JKYA 3ORYA 4FHEA 4GGMX 3N2IA 4I8DA 4D3SA 3MJCA 5LYJA 4GGOA 5H3CA 1VG1A 3HB7A 2B92A 3LDHA 4MS1B 4MR7A 2I03A 4NBWA 4UHBA 5A6SA 5BR1A 2AD1A 4KUEA 1W25A 5EIXA 5GADl 4KLRA 4KR3A 2RGUA 2X7HA 3VDRA 3SZOA 3PJFA 5TV2A 5KNCD 4B46A 5P21A 2YHUA 1SHLA 2FSHA 1XL0A 3DAYA 3P0FA 1LU9A 4Q4AA 4YUYA 2VPYA 3PEUA 2Y1LA 1CHNA 4ZQBA 4AUMA 1OKKD 3HGMA 5I9TA 3U1BA 3AFIA 3OP1A 5DYNA 3NIDB 4K28A 1SPBS 3D7NA 5AOCA 2QSUA 2XXJA 1A8SA 4R0MA 5LVAA 1U8CB 2D1TA 4RHTA 1T10A 4G5SA 3R24A 2FWNA 3KAKA 3DTNA 5ALOA 2AN3A 2HA6A 2GVZC 1X3SA 1ZCJA 4WXPA 3WFIA 1Q15A 2VYQA 3OFNA 4EPTA 4MQBA 2IVZA 1MZPA 4DXDA 3CE6A 5AO9A 3PWSA 4IM7A 2FFAA 4YX9A 4RTOA 1W2GA 1USVA 4YRQA 3MJVA 3KBBA 4IBOA 4O4HF 1TMOA 3NBZC 1Q7GA 3RR2A 4DA7A 2FJ0A 1CUCA 3QLVA 1LJ8A 3CV3A 1V35A 2QLNA 3BC1A 4F0JA 2FYTA 2GJ4A 3IODA 5AJXA 4D0RA 3UJ7A 2XKKA 1DLIA 1J1IA 2QR3A 3CEPB 2E87A 3N7UA 3WLLA 4Q9NA 1NP3A 3F4KA 3I9MA 3HTXA 1W29A 3E27A 3FDZB 4OA8A 4FTWA 2W2XA 2VDNB 2F7SA 4HGZA 3FWNA 2W58A 4IYRA 4NECA 4XQCA 4R8LA 1VKNA 3GT7A 4FNGA 4R9NA 3AJAA 1IAVA 1NLUA 3SR4A 3R8CA 9GPBA 5CD1A 4NQRA 5BN3B 1CQPA 2W4IA 5K8VA 5DSTA 4ZCPA 1GEEA 3T9DA 2WZCA 1PQ4A 1BWPA 4LYYA 3VNRA 1XRQA 2IEBA 4B74A 5HQTA 2Y77A 4P0PB 2ZRIA 3INGA 4UUAA 2G17A 4CG3A 1T0PA 2C2BA 2C0CA 1N5MA 2WTNA 4H0NA 3RRZA 4B3XA 3CLKA 3ZHRA 4PLHA 1IBLB 2PVSA 2ZATA 3JQ8B 4QUAA 1PO7A 2V6JA 1P4JA 2W83A 3PLNA 2JHPA 2QU8A 2G5CA 3K1AB 1FVXA 1JHMA 4U9HS 1J4AA 3BSYA 3FYUC 4OQ4A 4EWLA 4ENUA 1W7AA 1KK3A 3NEAA 4F3YA 3FGPA 4M3NA 5DSXA 5GWXA 3VNAA 1KMCA 1ARZA 4RVDA 1JPVA 1QZ3A 3LFTA 3KB8A 5BYBA 4E5MA 2CCJA 1CY4A 4DIBA 1I13A 3HP7A 4PCVA 4C0LA 4Q3DA 3L6EA 1QFXA 2A94A 3LHKA 4LOKA 4GO1A 4KZPA 4Y3UA 1KE1A 4EITA 4J94A 4B5KA 3AHHA 4M38A 4PYJA 1J0XO 4KGXA 4F1WA 1USIA 3OPNA 1EVKA 3I4LA 1JHXA 3IO5A 2C92A 2UV8A 1KF0A 5C81A 5DN6D 5JTUA 4R4JA 1YMQA 4BAZA 4CKCB 1RLTA 2JFUA 3C2QA 4RD3A 3TTYA 5ALRA 2HO5A 2HXSA 2YASA 4AB1A 3U26A 1K08A 1T24A 3B3AA 3PHCA 1PWEA 4A73A 2RD2A 4KIGA 3CLTD 2XYGA 1E94E 2VG8A 5LXTF 3VR5A 1ADFA 3EGCA 4O4JF 1EQ2A 1ENOA 421PA 2BFEA 3K72B 3ZWDA 4D4MA 4B3GA 3FM9A 1S9DA 1QK3A 3UMBA 1PX0A 2PIDA 3N28A 1S3FA 3MLAA 5LLTA 5GP1A 3WSWA 4D0LB 3VYWA 4PHFA 1GGFA 2HSEA 3JZFA 1GL6A 4MVWA 5EUCA 4CM8B 4ZDKA 1NMEA 2MMGA 3ORRA 2O8BB 4EHJA 2WFZA 1EFKA 2BTOA 3QHPA 5MFZA 1V5EA 1CWUA 5C2JB 2GS9A 2EW1A 2KLBA 4TWRA 1P6QA 2RHGB 5KAMA 4NBRA 4CTMA 4R7TA 2KMLA 4IW3B 4BO6A 1CZUA 4FM9A 1Y9DA 2P27A 4TT3A 4UUNA 2QN7A 3WVNA 2HDHA 1RWWA 4RAQA 4UE6A 1A72A 1TRKA 2IJGX 4L7VA 3QNUA 3GJ3A 4HNAA 4R2LA 1G7RA 2IOQA 2PD4A 4UAGA 1J09A 3AR8A 1DJNA 1FNSA 1OFIA 4HDAA 5DASA 4JXKA 4TL7A 5IDVA 1WXGA 2HR1A 4OQDA 1I5EA 2HMVA 3S28A 3G0OA 3RC7A 3NDJA 4WOCA 4HH0A 1DQSA 1ZU5A 3JWIA 3PU6A 5A5VA 3KQWA 3BAFA 4X24A 1UWVA 5I48A 5ICEA 1E9BA 5AICA 2AR9A 1NMXA 4NDZA 3UB4A 4KI7A 5IAGA 3VM6A 2C95A 1WM1A 4IG4A 4J0JA 3V4FA 5CCBA 3BYZA 2BSAA 1XQVA 1OX6A 2IOHA 4YMWA 5KKCA 3AR2A 4TVOA 2A9KA 5AK5A 1DCKA 4OLJA 1E1QA 3G2QA 4Y2TA 5EP4A 2QMQA 4YQEA 3AETA 3SHVA 1QG4A 2BFMA 5K3CA 3K9FC 2W2LA 1G5PA 1WP4A 3HYRA 1FJ2A 4DQUA 1D6SA 5TMPA 2AF4C 1JE1A 4HPXB 5A62A 3BQNB 4OXKA 3RUPA 3COVA 3GW8A 4LSWA 4JI5B 2R4TA 2C54A 3BE6A 5BN3A 4M0CA 5IN4A 5L3QB 3VKHA 2OHXA 1YKFA 1MIHA 1UZAA 2ZXFA 1YHYA 4RPIA 4AMYA 1I4LD 2YS7A 4MCIA 4W7IA 1SXGA 4F60A 4RULA 3AP3A 2RHLA 3V2UA 4M1EA 1D6NA 1V8PA 1GCOA 3PHIA 3P71T 3PNVA 4RXMA 2BM9A 1I2DA 4NJMA 2HA4A 3DHWC 1GSOA 1XVAA 2FB9A 2XOKA 3PC7A 4HBGA 2WVJA 3TD2A 4JEMA 4QGFA 1L3CA 3W5IA 4LRQA 1KAMA 1OYYA 1XL1A 3W8RA 4X6XA 2IWRA 2XHZA 4YUXA 4GPTA 4OQNA 2EVWX 1P1CA 5HKKD 1CS0A 1QFYA 2QXYA 2GJKA 4N3AA 5DNEA 3TAUA 1XG5A 2PG3A 4YGXB 3GJ5A 1FW6A 3GVCA 1DG3A 1KS9A 3PNQA 3MJRA 3VHLB 2GZRA 2PS0A 4IZHA 5A0FA 2C96A 3L0ZA 5LA6F 1A1SA 3AVXA 2XA9A 4BIMA 3EEYA 3IDAA 5GINE 1WQ4A 5GZ6A 4W5RA 5D6NA 2V0GA 1JPNA 4DLZA 4KQXA 2XE6A 4M0UA 1CK4A 2Y1CA 4WBNA 1AMOA 3OCCA 3ZDBA 1T9CA 2WTMA 1L7RA 3NPAA 2RHMA 3O4RA 2P2NA 5HFJA 2Y1WA 1L7XA 4UE2A 4DTIA 5KHLB 2CXXA 3C6YA 1VE1A 3V2GA 5CBPB 3DL4A 3FZQA 4MKRA 4MMZB 2C5HA 3MCZA 5TF4A 2PKEA 4H4CA 2P8SA 5KCMA 1EDEA 2L0XA 2QI9C 1WW3A 4IJMA 3C5EA 1UDAA 4LOIA 1T15A 1YNOA 1LV8A 1S8OA 1VL0A 1XJWA 2OE2A 1UCFA 2ZRQA 1T1JA 2DVMA 3HJGA 5KNDH 4DS3A 2OV2A 2QD2A 2VK2A 5AHXA 3S40A 1U4SA 3SQXA 4QFCA 3QOYA 1VBKA 1V2GA 5TDHA 3TTVA 3MAAC 2PLAA 2WWXA 3KJQA 1IZZA 3FPAA 4OAQA 4P83A 4TUYF 4IH1A 2IHUA 4A0FA 4BNKA 1E20A 2QW8A 4DBLC 1M2HA 2YV2A 3RARA 3WA7A 1S2IA 4FYMA 1KY5A 3VJLA 4RMGA 3C3PA 2NTVA 1BSVA 2OFOA 2A0FA 3GV0A 5BMVA 5IAAA 3G8BA 3H3FA 1OTHA 1YZFA 2PKXA 3O9VA 5ALSA 2CV2A 4B3RB 5F9FA 4F5ZA 2OBMA 4GX5A 3W8DA 1HE5A 4OGGA 3H4VA 2ID9A 5KNDD 4GL2A 1T2VA 4H0FA 3WNCA 4JLAA 5HQ3B 2AC4A 1GPNA 4B8YA 1KQOA 1DTWA 2C03A 3PRKE 1ZCAA 3R3SA 4FYXA 4L8LA 4P5PA 5M34A 3AUKA 2I78A 3T3NA 1D4ZA 2JFGA 3IAHA 1DV1A 2VK1A 1MB9A 4DANA 1VJGA 2PMDA 5IH7A 3N0RA 3HU2A 1K2VN 1JQAA 1XIVA 2HADA 4C6TB 1NOKA 1B0AA 1O6GA 2ZBGA 3OZGA 5DW3A 5L4LA 4NHOA 3V4ZA 4RDHA 2XBMA 2ZSEA 5AXDA 3SQMA 5J5VA 3N6XA 2B37A 3P0HA 3TCXB 2O2IA 4JT4A 1TK9A 3WGVA 5JS2A 1SUDA 3NNNA 3GFSA 4KLAA 3C24A 1XTPA 4QE3A 3P2OA 2VAPA 1ZJZA 3VR0A 4BRZA 1E59A 4E1AA 5CEFA 1B6RA 2WPDA 3CZMA 3GC6A 2UXBB 3MRVA 4HUQA 3O2JA 3OT1B 2EJUA 4C08A 5COAA 3TBFA 4ZI7F 2YBDA 5KTYA 1Z56C 4RENA 3LX8A 1XMJA 1Q1ZA 3ER6A 3NHBA 2LZ0A 3HRHA 3O8RA 4E7PA 2HK9A 1L6RA 1ECLA 2QV0A 2R6AA 3JZIA 1TYZA 3RK0A 4MV8A 4QLOA 3W9YA 4CDMA 1D2NA 1ZUWA 3JPWA 5L3QA 2HPVA 1R6UA 4ESVA 2HMUA 4ZHQA 4YP0A 4J4BA 3MT8A 4WN3A 1JIUA 5HF6A 5EJEA 5L40A 1SURA 1PFQA 1OGYA 2HSZA 4FKZA 3VKFA 4L15A 3V4OA 4I50B 1J2RA 3DOOA 3ZWAA 3K6JA 2RKBA 4M37A 1W96A 3EEQA 3FG9A 1NW3A 2OEPA 3FCYA 1H0RA 5JLAA 4H7DA 1QANA 1OYWA 4YWHA 3MYYA 5KVCA 3ZLVA 5LC1A 4QUEA 3IPCA 1G0NA 2EF1A 4QO8A 2ECOA 1Q91A 2PPLA 3I2GA 5LOVB 4D25A 1FTGA 1ZI6A 1D5CA 1HQCA 1VCMA 4MB6A 3OZIA 4BKPA 3DXXA 1L7DA 4N5LA 3RYIB 4G1UC 5DWDA 1X9GA 3EEFA 1XXHB 4KHPB 3GP5A 3GELA 4RXTA 5DM70 3U37A 4ZRDA 3DVAA 4YS6A 1JNYA 2Q4TA 1MUUA 2HU5A 4GICA 2YQ4A 1L5VA 1IY0A 3GN1A 2W6MA 5L51A 4D80A 3ENQA 4B76A 3GGGA 2H4FA 4NNOA 5CLIA 1J0BA 1SXHA 1NYTA 5KWIA 3UJBA 1QIHA 2ZLBA 1Z5PA 5HKLA 4ZAZA 4YJ3F 4XQ0A 5B58C 3GAFA 4D46A 3RVBA 5E2IA 1VKJA 3ZE9A 4L3OA 1IUNA 2JIOA 5AYVA 2QX9A 4CQLB 1RE0A 2PZEA 4IVNA 3RNOA 5CDSA 1CYEA 2A9FA 3SXUB 4KXNA 4POAA 4DR1B 1K8QA 3N2YA 5D84A 2DGDA 5KDLA 1FYWA 3ZGOA 3X1WA 3CNOA 3WC4A 4TKZA 4EJ0A 3N5KA 3IAS6 2OZVA 1XDGA 3D8RA 2A1UB 2R47A 3DL0A 3IPYA 2W6JD 5KVVA 2XBLA 4FP9A 1SH7A 1XRNA 1KEZA 2LIPA 1LKZA 3TOVA 1MG0A 1FLDA 1R88A 4AN0A 5HNKA 3FLAA 3S70A 2KB0A 4XUEA 2P4UA 1ACLA 1G20B 2XDQA 2P7HA 3GGPA 4IWYA 1BWRA 2BKLA 2J5BA 3FPHA 4YMIA 4YP9A 4BY9E 5B2ZA 1U2QA 1RZ3A 2OP1A 1LUAA 3SDBA 1YR2A 4G5HA 5HCIA 4YAJA 4F04A 3K9GA 3SLGA 2ZROA 3IPXA 3N8NA 3OU6A 4F38A 1G42A 3ZQUA 5EJ8A 1MQ8B 3F7NA 5EP2A 1VSTA 2QAGC 3VR6A 2BUBA 1R2QA 2AXEA 4XAQA 1SU4A 3WJ2A 5ADVA 4XA8A 1S2GA 2HGSA 2Z4RA 1H94A 2G83A 3F9IA 3WG9A 4PTYA 1Z39A 1SXPA 2PD3A 5JQGB 2CUTA 4C5BA 1N1EA 3A28A 2PV7A 1GZHB 1FMTA 1QX4A 2OMEA 4LQDA 1N2GA 2XVAA 4XI9A 4YBRA 1NI5A 1Z06A 2G04A 2MIIA 4ZT6A 4HVAA 1WTAA 1X80A 1L5MA 1AKMA 3GLIA 4ZAWA 3I9KA 2I0FA 2A7XA 3TKLA 2I65A 2YWCA 1Z0ZA 4CIWA 3AZOA 1XQ9A 3NHZA 2HWXA 3OT1A 4GR9A 4TRJA 1GVHA 1SIUA 1P17A 4R41A 3UKJA 3ZIAD 4D9BA 2IF2A 4JYBA 4C4OA 1ZG3A 4TMTA 4DIKA 2IYPA 5F23A 2XNCA 1UKEA 4ZVKA 1AN0A 5AJYA 5TJ9A 1C3LA 3OZWA 4DJAA 3LYAA 4PAGA 3FWYA 4PC1A 4L9WA 5K0CA 3N59A 3RREA 5FWXB 2HSJA 1MC4A 2EDCA 3GIWA 1GDDA 3B1FA 1L4UA 4LZWA 5ICFA 5JXGA 4UDOA 4N3CA 5EE5B 4E2WA 2O59A 1UT5A 1X3LA 1PWXA 1ST3A 3KLOA 2Z2KA 4X3CA 2PUHA 3LIPA 1OXKB 2VYND 4LRSB 4YECA 4MUAA 1TZCA 4XGQA 2PZMA 4JR1A 2PUBA 1E9CA 3GMSA 1I4WA 2QJTA 3M33A 4RJLA 2W2MA 5BRAA 4OYLA 2FMTA 4E2XA 1DRVA 2WABA 2WYUA 3VYSB 5KOYA 2ZI3A 1JIKA 1PVVA 2FN4A 2GJ9A 1FYVA 5IJ0B 1QQAA 2WA2A 3Q1KA 2H9IA 3RYIA 1SGWA 3AR9A 4H18A 4AF7A 1O9HA 1EDDA 2XWPA 4NBKA 3A1UA 3NV7A 2PEYA 4N5DA 2H52A 2VYVA 1M8JA 2NNWB 2PZFA 5ALPA 3DR3A 3ENNA 1KHHA 1KZ1A 5DM2A 2BGNA 2OWEA 2QL5A 3QFRA 4AX4A 1CUEA 1TW3A 3G8DA 3SC3A 2P2DA 3CCFA 4QVIA 1XNJA 3CWZA 4TQUS 2XUIA 4CTKA 2GX6A 1XYGA 1Z5OA 1IHPA 4D4KA 4P35A 1XA3A 2B8JA 2ZRKA 2NT4A 2XYVA 4WNYA 1Y4SA 5CDTA 3SGLA 4CG0A 1ZUNB 1CUBA 1E4YA 3QVKA 4YQZA 2O7NA 2EEZA 4KR0A 4RQTA 3WYNA 1X1TA 5ARCA 3JWPA 3OZTA 1RR6A 2XJ9A 2YHBA 4YJFA 1IJEA 2FVXA 3H0EA 2XUKA 3EXG2 2XSZD 4PNEA 1B14A 3MGGA 1A96A 3E82A 3U9LA 4DDUA 5EP1A 3A3KA 3WGGA 4LZJA 3L0BA 2ATCA 3H13A 1Y7HA 2QUAA 3FJOA 3HKEA 3IQGX 1VRCA 4RF5A 1UJ6A 1IHYA 1ID8A 5EIBD 1USWA 4WVLA 4DSUA 5JYBA 1X19A 1HYHA 2IUEA 3LGSA 1G20A 1KEUA 2VBIA 3AVYA 5LNK1 4MW5A 1TUGA 3GJTA 1JIJA 2YXLA 3T4XA 5FLXA 1YZNA 4INJA 3WMWA 2POQX 1XPUA 4KACA 1NBME 4CF4A 5EMNA 1JDBB 1ZY2A 4QQKA 2NPFA 1SCAA 1Z3IX 2I1VB 3KQSA 3NTUA 5SZJA 1E58A 3I5MA 3KC2A 2X7XA 1OAAA 4S04A 4WJLA 5MN4A 3OTOB 5JH7B 3MZ0A 4ZV7A 2QLFA 4QDZA 2FWBA 4F4UA 2DETA 4DLPA 2CD7A 2I4MA 3DNMA 5DYWA 5CFRA 1IY9A 5K03A 4OLBA 1IHXA 1BCRA 1L4LA 1QKIA 3NHSA 4QG3A 3ZVRA 5IDQA 3GNQA 5KEIA 4XR9A 3ZZMA 1CEYA 1N5KA 1YIDA 3KZCA 1QGOA 5ECGC 2DFPA 1KMQA 1XKQA 4K9MA 4A36A 3A4IA 3E8SA 2AEEA 2JANA 2VAVA 1Y9JA 1DZ3A 2H1WA 3AIKA 3V5NA 3WB0A 4RX1A 3I30X 2D7JA 2Q0SA 2V98A 2VBFA 3RHZA 3PVZA 3MSCA 4MJXA 1X7YA 5AM5A 4AP6A 2EGGA 3JAWB 2MSNA 2A0KA 1DIGA 1XPJA 4PQYA 4ID9A 1HZZC 1N77A 1P7CA 2N75A 2DFLA 3ID6C 4JLPA 1YBAA 2YRXA 2V1XA 3D3WB 4PLTA 3ZI7A 1FTYA 1TJNA 4G0YA 1E1CB 1YZTA 2I2WA 2IHKA 4ZCLA 3WBJA 1KSJA 5F98A 1G21B 3LZDA 2EL7A 2QAGA 3KZ1E 1NXVA 1AE1A 1ZD3A 3FYHA 4EZIA 1VA5A 2B8WA 2NXCA 3N1UA 1B3BA 1L4EA 1KDRA 5IUNC 2IH2A 2OXFA 1NSTA 5LMZA 4URXR 2OO3A 2ZRHA 4TS3A 2PCLA 1KVQA 2ZYWX 1S2MA 1YA4A 1NVAA 5M2QA 4EPRA 3EOAI 4G0UA 2O3JA 4OCZA 3COZA 5BW4A 3F98A 3A31A 2ZWOA 1ONSA 1E4EB 5CPBA 3LX4A 5LQDA 1K9VF 2VHEA 2DC1A 3HLKA 1WPXA 5IJ0A 3RSHA 3RNLA 3V46A 1SUFA 1U4NA 5JSHA 4IMIB 1C4KA 1E8DA 3H1PA 3FUCA 4UNPA 1RQGA 1YOBA 2PL3A 3EPKA 1U11A 2JD1A 3TSCA 1EGQA 3GLKA 4LAFA 4GP7A 1Y98A 3V4SA 3U39A 1N5OX 1QR6A 4PS1A 3UOAB 1BH6A 1BXRA 5TEWA 4Q9DA 1I2MA 5IF3A 2JGJA 1H66A 1N2CB 2PJUA 3ML1A 3H9EO 4B40A 4KZKA 1XVUA 2F64A 1A5BB 1E2QA 2HF7A 4CMHA 3PQEA 1CY0A 3IAEA 3JTEA 1A9XA 4QL3A 3L07A 3URMA 2OBLA 2HO4A 5BSMA 1RXSA 3K31A 2P4SA 4TTQA 4CM1A 1Q84A 2FG6C 3DOCA 4KXYA 5FADA 2VRCD 1SC6A 4MB0A 2ZUVA 5TE9A 4TV9F 3G2JA 4S1PA 1S9HA 1YE5A 5G3YA 4DNQA 2GKOA 2CHQA 4Q9KA 2FZVA 4RLQA 1OXTA 2IYAA 2ZKIA 3LJKA 1OWPA 3OQBA 4AQDA 2B4KA 3EMDA 4DQDA 4H60A 3G2HA 3DLPX 3OECA 4V03A 2TYSB 3P0IA 2CL5A 1UBCA 4LFBB 3GLGE 1KZHA 3A1CA 5BRNA 1QUFA 3AYXB 5BNFA 4IDPA 2DPLA 1JAZA 2X3UA 2XCIA 1XCMA 3WNVA 3VVBA 1X1CA 2FDXA 1DPGA 4DJTA 2O0JA 1SJ9A 2UZAA 1TECE 1PR6A 2P4HX 4ZMSA 2C9CA 3EWIA 4IGFA 3CSSA 1PR4A 1SZDA 1R0BA 3DDSA 3P9XA 4WLEA 3U4HA 1AZWA 3NOOA 2DECA 4LRXA 3U4IA 1L8LA 2XOEA 3HDHA 2VZ8A 4QNNA 3IMGA 4WGFA 5DWQA 2DH6A 4DAOA 2EKDA 4N0DA 3BKXA 3FTDA 2EIHA 4F96A 3OQNA 4DJDC 3C1TA 4Q05A 3FCXA 4PZAA 3BJMA 4N7BA 5LD2B 4HGRA 1JAXA 3L0YA 1PWHA 4GC5A 3LKDA 1C0IA 5JDIC 1GTZA 2JIBA 3CPJB 1I14A 2HWWA 1WAMA 3QXHA 4LV6A 1IJKA 4PQGA 1QHYA 2WE7A 2ZYUX 3RODA 2A0YA 1OW3B 2CDNA 5CB8A 3QX3A 4YV1A 3JAWA 3BGOS 4MINA 2XNHA 3Q1LA 1QO7A 2ORWA 2Y9MB 2E6UX 2GPSA 3N2ZB 3P26A 2WD7B 4MWSA 2F43B 2F8TA 2L69A 3E9CA 5G0TA 4I1YA 3R7BA 5GZ3A 5JARA 4JUIA 3ZE6A 1OIWA 3M5WA 3R6TA 2IS6A 1B41A 1G21A 4BDTA 1JMVA 4R1QA 1QMGA 3KWJA 4WLUA 2UUBB 3ZZTA 2I8CA 1Y6JA 2PT5A 2Q4RA 5T8KC 4IJ6A 3VO9A 1UF9A 3IKLA 1YTLA 3GCZA 2ILVA 1UKCA 3PE6A 4MUKA 5KJFA 4N65A 5CCDA 4W5OA 3KOXA 4PCUA 3W05A 4L85A 5B5SA 5F3RA 2R6GA 1WV1A 2Z5LA 2Y0DA 1KU6A 3PC8C 1XLVA 1MIOB 1Z33A 5LJIA 1P62B 1KYXA 4PS0A 3S7TA 4B3IA 4I9UA 5EG5A 1ODTC 4I46A 1UDXA 2RHJA 1MVLA 3B9BA 3G1UA 4ZQHA 3SFZA 3WL7A 1E4EA 2W2KA 4C20A 2HY7A 3NYQA 3U7JA 4ZVOA 4F5YA 1T0BA 3ZBUA 1SBCA 3IP6A 1JU3A 3SZUA 4PCLA 4MLPA 4MUXA 4U2CA 4UHDA 5IT5A 1NW8A 2X0FA 2FEAA 2VP3A 2FF5A 3BXPA 5CB4F 1OA0A 2IXTA 2UYQA 2ANCA 2ZB4A 3STUA 5FUVA 1T1IA 3W5BA 1LPNA 3BIXA 2JGDA 4LQ4A 1RE1A 4B8WA 1VHQA 2FX2A 3P2MA 1HZZA 1N2CA 3HSYA 2EZ4A 4HAYA 1VLHA 4IEIA 1U5CA 3TIVA 2Q7DA 3LUGA 4K88A 3TFQA 2AJDA 4LBWA 2VA8A 3LZ6A 4HQKA 4L4UA 2JEYA 5EAIA 4KRFA 4RYLA 1DQZA 3S2GA 1Z62A 5DPMA 3BD6A 4EKNB 4N3NA 3Q9NA 4UAJA 4WTOA 3WP0A 4F6RB 1YFLA 4TX1A 1IK6A 1G55A 1QS0B 4ZXPA 3RJMA 5FNVB 1L7VC 3F8WA 2WWFA 1YZYA 4C07A 4IJKA 4P5EA 4U2FA 1W9HA 3R5SA 4J0IA 1JHDA 3ICOA 3AIOA 2VBCA 2H1LA 4HX2A 1NG1A 5DTEA 5E9AA 1HDRA 1CR0A 3PSAA 4HGPA 2O5CA 3QV1A 3WYEA 4ZOCA 1N92A 1GP2A 4YV0A 1DOHA 2QVGA 3OESA 3K9HA 2C61A 3E18A 2P5TB 4I08A 3LOQA 3I5YA 4BNLA 3UMYA 1LB1B 3TRDA 1AU9A 4QTXA 1EBUA 2B5OA 2RGNC 4PXSA 5GONB 4KVGA 3SNHA 2VH5R 3B9RA 3QWFA 1WHSA 4BFZA 1GAJA 3IL2A 4DDKA 4R1UA 4KK4A 3M6VA 4YC7A 4H9GA 2DT5A 2OBFA 2W48A 5CA0F 1GG9A 5A71A 4OL9A 4M7WA 5JANA 5EJ2A 1ZM2A 5DF1A 5B37A 4PQEA 3L8YA 5CVUA 4LMBA 4RPLA 2BDEA 4RMHA 521PA 5LP6F 3W77A 5JJBA 3JATB 4M87A 4M1KA 2W70A 4BVBA 3RAPR 4CM5A 4YAGA 3K70C 2PUFA 2WIGA 2R8XA 3LMKA 3TZLA 2BMEA 3GEBA 4P36A 3OT5A 4ND6A 3WKDA 2IYSA 1EFTA 1KJYA 3RS3A 4OQFA 4H7EA 4LZNA 3T4UA 3VXKA 3ZOZA 4I55F 1ODIA 3SQOA 1C0EA 4ZARA 4C4ZA 3LT1A 3MLBA 2VXYA 5AI6A 3LTNC 3EFHA 2IP1A 4MWGA 1N6KA 4TKUB 4DYDA 1N4DA 2BFBA 4O33A 4LVNA 4J43A 7YASA 1HZJA 2CNWD 3DBHA 5FBVB 3AL2A 1U0BB 3UUGA 1GLNA 2IEAA 4BPBA 2ZUBA 3JQ6A 4EUNA 4PTZA 1DG1G 2VHYA 5H70A 2WD7A 3VPGA 1ULBA 2F43A 3L4EA 4HGNA 1QIDA 2JJYA 5NLLA 1J56A 1DKMA 1B8NA 1B2LA 1JL3A 1U94A 5F21A 4B09A 4D6YA 5AVOA 1Q1AA 1QF9A 2HMYB 3S44A 3ZDZB 4ER3A 4R83A 1Y80A 1V7QA 1W49A 2B6HA 1JXAA 2V8BA 3FDFA 2CWWA 2XECA 2D5BA 1OE0A 3IQEA 1Q77A 4XXHA 1KQFA 3H16A 4WV3A 4QGHA 3HKBA 5L6LB 1J2EA 4J0KA 3TLZA 4D8YA 4QC2A 5JD5A 1EUZA 4MW7A 3KP1A 5C8YA 3WGUA 5FR1A 4M88A 4GPIB 2F67A 1MAAA 3KZOA 3J7TA 4IDNA 4RFSB 5FLKA 4BBPA 5KTTA 1IWBB 3MMPA 2FMHA 3HVJA 5LD2C 4BKQA 5TARA 5JDIA 2EWMA 1R4NB 3CM0A 1A7JA 4JJ8A 5IAEA 4WH0A 3T34A 3MMZA 1Z35A 2I6QA 3OQPA 4F71A 3ICEA 4F6LA 4C76A 1O94C 4HLUC 2PUWA 1NUPA 1R00A 2PFSA 1AKEA 3BWYA 4MV9A 3K1YA 4QXMA 2VOJA 3FPSA 4E5DA 5EIAA 2GD1O 2GA9A 1L8XA 1T0UA 2QN9A 3CR7A 3LVFO 5DMXA 1QU3A 2VK8A 1M2GA 1U7OA 3DMDA 1N2XA 1KZ4A 4HQNA 3B9PA 2ACWA 3PEFA 3MC1A 1E66A 2P9CA 2COKA 3KYDB 1S7GA 4F6RA 1WTCA 3KL4A 1A8IA 2VTVA 4X1YA 5T8KA 3OEHD 4MRPA 4ZAXA 4C29A 2HJSA 1AT1A 2WG0A 4NFSA 4LIPD 4YCDA 4US0R 5F7JA 4Q1FA 4JR2A 2Z5VA 1EVLA 3OD5A 4P98A 4TXMA 3GGOA 3ZU4A 4B33A 2OECA 2OQRA 1ZUHA 3PC8A 1TQ2A 2PV0A 1Z38A 5HE8A 3ZKAA 1KKLA 1HE8B 2POCA 5H5JA 4YRJA 3JD1A 4HFMA 4QUBA 1T0HB 4CZ2A 5EXPA 1J8QA 1H8HA 1GARA 3PQDA 2CVHA 5LZ8A 1J0DA 1KE2A 1U8YA 5KX5B 5C37A 1FNBA 3ZVKA 3MHTA 2C97A 1M1NA 3Q3GE 3UGQA 4AUKA 4C43A 3PYLA 1PT8A 4MVCA 1Z26A 3UAZA 5BSKA 4UCFA 1XXHE 2Z08A 1RAGA 3CZQA 2ZQ5A 5LB4A 5C52B 1RHRA 4M21A 2WYOA 3D3NA 1ZNQO 1WCIA 1I6LA 1IHUA 4Y2HA 4IMRA 5E6UB 5KJEA 4PC6A 1MTOA 3RSLA 5C1OA 5IKXA 4LZLA 3EBOA 1A3CA 1UJ4A 1NXOA 3ZHVA 3H9BA 3CUVA 5HILA 2O0LA 1JHOA 1RM3A 1HRDA 1VHDA 3FWPA 3R0QA 4DJFC 4EGFA 4UHHA 4XOIA 4HYTA 5FD8A 1VLLA 3RJTA 1K7SN 2BE9A 3ABIA 1N9ZA 3DCJA 3MJTA 1G5FA 2A5JA 1WZEA 3LX5A 4Z2AA 5JMOA 3QXCA 1RC1A 3HXLA 2QWXA 4WD3A 3TGWA 1X2EA 4IKEA 5EFOA 1L7QA 3I34X 2ZE5A 3BSWA 3CVJA 3PGA1 4Q9HA 4YXWA 3WJ1A 2O3UA 4HDKB 3AUXA 3CU5A 1OWMA 1Z12A 4RZHA 4MR9A 2J3LA 1POWA 4P8RA 5AM3A 2Z9BA 3W9UA 3ZX4A 1NBOA 2CSUA 2YV4A 4LRUA 4AJKA 4M76B 2R7KA 4A2PA 4EUFA 2RGNA 4ZEMA 1OFUX 1H93A 1WB4A 3CKMA 1KS2A 1CUZA 3DMNA 3NCHA 4NL4H 3L7IA 1WABA 3FCSB 2R9VA 4OVKA 1EEXB 2H59A 3EMKA 1G17A 3FYSA 3WLOA 4FN5A 2JAQA 1G3MA 1O1YA 1ZL2A 3KDPA 4MI1A 2LWIA 5EA2A 5DJ5A 3GROA 3FOZA 2R8EA 2PXHA 3VKUA 3PFIA 3B13B 2Q99A 2PIAA 5JCOA 1AD2A 1DAHA 1KP3A 4IWXA 2Z83A 1NUAA 3ZNPA 1RYHA 3M2TA 1R50A 1X15A 1C1XB 2AVDA 4K9QA 2H3HA 2VRBA 4RFSA 1KMNA 3OVMA 1YACA 3DUFB 2YJNA 3WRXC 4CMGA 3ENVA 4QGSA 5C80A 2F4NA 3NHRA 1M76A 1FFBA 1QYWA 3HDYA 1HNXB 2WSSD 1MORA 1GCUA 1DB3A 2B4QA 1E1RA 2D13A 2ZYTX 3F1KA 1CUVA 2ZRAA 3GF4A 2FKNA 4LSMA 2FZGA 1CNEA 1IQUA 1MB3A 2GN2A 3I5UA 3C3EA 2O2JA 4D96A 3I1YA 4EUSA 4NPAA 5AHOA 2ZIZA 4LE1A 2VL7A 4G26A 1GUDA 2B8NA 3QFTA 4O4LB 5F35A 3V7NA 4AIRA 5LQUA 1T8TA 1YRAA 2AUNA 2WV7A 2G77B 4N7MA 4HSEA 4KMMA 4NZZA 4R8MA 1Q50A 4RQUA 5E6SA 4DZTA 2YJGA 1IG3A 5AHRA 4XD7D 1TTTA 3WP1B 1D6JA 2O50A 4ZV9A 4B8ZA 5CEJA 3MB8A 1DKOA 1KA9H 1KMIY 3JD0A 4CLOA 5F77A 1UOOA 3WGOA 1GA4A 2C88A 2HA7A 3QE9Y 3CZ9A 3QVMA 2YIDA 3C3YA 4MVJG 3I9LA 3K9BA 4WINA 2XW6A 1M0SA 4IEFB 2JLUA 1Y9AA 3ILVA 3QVOA 1W47A 1KJ8A 4IFEA 1L1FA 3MJDA 3EHDA 3FB1A 3ETLA 3EDCA 2MTBA 1PT6A 5DW0A 2B7CA 2C2MA 1F0NA 3WICA 2F1IA 3PL5A 4RWZA 5D1HA 2C9YA 2V45A 5KMGB 2JLZA 1COWA 1U28C 3M2PA 4MVXA 3NDBB 1T1RA 1FZQA 1RWOA 4Y2VA 3SM3A 4ROSA 1KZ9A 3FGNA 4BWGA 4YCLA 3HZOA 1QVZA 1XQWA 4Y30A 3ZHXA 1MEOA 1WDWB 1E3EA 2GZSA 3O5AA 4CM9A 3UWPA 4EOGA 1ZOLA 3HA7A 4S3MA 1H5UA 3RJ5A 1IBMB 4FHGA 3SIRA 5L9AA 3LQYA 3IO3A 3DG9A 3QKIA 4B17A 1UBGA 1WWKA 2H7XA 2WKRA 3GRYA 2GLXA 3AUSA 4GBJA 4KO4S 4KQHA 3V8QA 5H7XA 5A5DA 1FFXB 1O3YA 3AERA 2C7RA 4E3WA 2QLBA 2C29D 2VJKA 5FWYB 2AV6A 4BYMA 1UAAA 3DOFA 3O8BA 4MQEB 2X0NA 4YI3A 1SKBA 5G4KB 3CX6A 4M8NE 2CXTA 3F9RA 5KTSA 4AKIA 1HYGA 1W30A 5DWVA 1WUJS 3N0TA 4HLDA 3MTQA 1K0UA 2X1LA 1T5OA 2FJUA 4LMRA 2XCUA 4TV8B 1NVVQ 3RFFA 3AK4A 1H2ZA 2A78A 2NAPA 1TZ2A 3QEMA 2CLOB 1A9OA 3LIIA 3R6GA 4QO7A 3DBVO 2OAGA 4LXTA 4QYIA 3F6RA 2MSWA 2JJ1D 3SFTA 1M1XB 3DZIA 3M5CA 3RABA 4DCUA 2AN1A 3BE8A 3IOMA 3TINA 2H16A 2REXB 4M54A 3S4YA 1FIUA 4I2VA 3JSXA 3UMSA 2BRUC 3BCRA 1JVNA 1VHJA 3I2YX 5SICE 1MMFB 2F8SA 1IJBA 1FC0A 2B4YA 2H2WA 3ZNQA 1EQUA 1MN6A 3H3JA 1AA6A 3QF4A 4PX2A 3PEWA 1FDUA 1LPAB 3JQEA 3C39A 1T35A 1VBNA 1A04A 3JQDA 1ESZA 3ZXSA 1UEXC 1UP7A 2ZGVA 5FFNA 1TJPB 1ZM7A 5DV9A 2QT0A 2WQ7A 1EX7A 2GAAA 3M6WA 2OXRA 1QKKA 2F1RA 4FCTA 4G86A 1F0KA 1ULZA 5AH0A 4QYWA 4DILA 4E5NA 4BWVA 4N48A 4A0RA 5KO2A 2O7RA 2PSFA 2ZPUA 2QUBA 1HRKA 1WXQA 1PG2A 3QLJA 1PS9A 1KAGA 2IEIA 2AQ8A 4U6NA 4LYFA 2IIBA 4ZOLF 4YASA 3QNWA 1BGVA 1A97A 2NO5A 4G36A 4NZYA 1PVDA 2H00A 4WLFA 1GR0A 5COQA