2PBFA

Crystal structure of a putative protein-l-isoaspartate o-methyltransferase beta-aspartate methyltransferase (pcmt) from plasmodium falciparum in complex with s-adenosyl-l-homocysteine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
218
Chain Sequence
ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGIIKDRLFDVCFVSLKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase (PCMT) from Plasmodium falciparum in complex with S-adenosyl-L-homocysteine
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Protein-L-isoaspartate O-methyltransferase beta-aspartate me
total genus 73
structure length 218
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pbfA00
2BM8A 1JQEA 2IIPA 3KQOA 1O54A 3P8ZA 3FPFA 3BGIA 4R8SA 1ZG3A 1EJ6A 4NECA 1G8AA 2ZBQA 5F2KA 1AV6A 3JWIA 3FRHA 3FTCA 3P2EA 2G1PA 2P40A 4C06A 5GWXA 2XBMA 3P2KA 3Q87B 3FYDA 1HMYA 1I4WA 3G2PA 3HCAA 4FT4A 4PCAA 4RTJA 2BZGA 1H1DA 4X60A 3DXXA 4DQ0A 5KS2A 2FCAA 3B3JA 5EMJA 3B3FA 2AOXA 3PLAE 1D2GA 3DP7A 5EPEA 1ORIA 5C9ZA 5IKMA 2DULA 3DUWA 3M4XA 1VLMA 3BWCA 3MERA 3CCFA 3Q7EA 1VIDA 3LX6A 3PX2A 2ZTHA 3G88A 3ORHA 3FTEA 2ZW9A 4YUYA 1M6EX 2KW5A 5EHGA 3TLJA 2C7QA 3IV6A 5B1SA 2IDKA 3M70A 3TM4A 3E23A 5HEKA 5LQUA 3LPMA 2JHAA 3ANXA 3EMDA 2OY0A 2FRXA 2P3QA 1NBHA 2FYTA 5K09A 4X61A 1SQGA 2IP2A 1Y8CA 3VC2A 3HCCA 4C07A 2NP6A 1QYRA 3I9FA 3UJ9A 3OFKA 4X1OA 2IFTA 4IWNA 4KW7A 1BHJA 4DMGA 3FRIA 2ZZNA 2H1RA 1EIZA 2VDWA 3E8SA 3A26A 3KQWA 4ISCA 3REOA 3UJCA 3EEOA 2FK7A 2JHCA 2ZULA 4GOLD 3LL7A 3H2BA 2FPOA 5LQJA 3MAGA 5E9WA 1KYWA 5K0BA 3NMUF 1R74A 1MJFA 2AR0A 4GUAA 2PXXA 3KQQA 4QTTB 1YFJA 4CKCA 4PYOA 2AVDA 3OE4A 4ER6A 2O57A 3UJ8A 3MTEA 4X63A 1XJ5A 4DZRA 4XUCA 2O06A 3D2LA 3EVBA 1MHTA 5DTQA 3AY0A 2HMYB 3RIEA 1P39A 1SUIA 2ZWAA 1XCLA 4QPNA 3R0QA 3VYWA 1QAMA 2YXDA 4IV8A 2OKCA 4PGHA 5P8WA 3UJDA 5DX1A 3TOSA 5DTMA 1I9GA 5DWQA 1RJGA 3GJYA 9MHTA 3SVZA 3NJRA 1TW3A 3SXJA 1F38A 2PT6A 2Y1WA 1OR8A 1ZKDA 2ZVJA 3DMGA 2ERCA 3OPNA 4ZTBA 1NW7A 1WZNA 2UYOA 3ELUA 3CKKA 1R8YA 1VP3A 3HVJA 3RODA 5DXJA 4DM3A 1KPGA 3OZTA 4HGZA 2GPYA 3E7PA 3EVAA 5GM2A 5K0GA 3TFWA 4CXMA 3UJ6A 3UJ7A 1NW5A 2Z6AA 4U7PB 5IH3A 3GRUA 2OZVA 4QTUB 3EGVA 4RTKA 1G60A 1TPYA 8MHTA 3FPJA 4E2ZA 3R24A 4E2YA 3IEIA 5DRYA 1G38A 1NBIA 1ZQ9A 2R6ZA 4M7RA 4OX9Y 1WS6A 2E5WA 3G2OA 4QPPA 4RVDA 3LBYA 4F86A 2ZZKA 3HCFA 3NW9A 4KIFA 1M0EA 3JWHA 3ME5A 1JR4A 4PYNA 5LQRA 1DUSA 3AXTA 1VBFA 3GCZA 1KPHA 3P9KA 3KPVA 3OFJA 1UWVA 2UZ4A 3FUWA 3OU7A 3ID6C 5DLYA 2ZIEA 2YQZA 3EVCA 3SMQA 5K0FA 2PX4A 3JWGA 4EQZA 5EOVA 3K0BA 1ZGJA 4QQNA 5DRTA 1L9KA 3ELYA 3DH0A 1XDUA 1BC5A 2WA2A 4XUDA 2YXEA 5K8VA 5FULA 3HP7A 5EIWA 3T0IA 3GRRA 2B25A 1JTEA 5DM2A 5HZMA 5CVEA 4EVIA 1R8XA 2HWKA 2QE6A 3KQTA 4AZTA 4E2XA 5FA8A 1VQ1A 3FPHA 4RTOA 1AF7A 5HIMA 3FUXA 2ONZA 4FS8A 4RYLA 2CWWA 3LHDA 5BP7A 3DMHA 3LCCA 3AXSA 3MGGA 4JXJA 3NWEA 3CVOA 5EEHA 3MTIA 1P1BA 3UFBA 2XYQA 3TM5A 4OQDA 1PJZA 2PXAA 3CGGA 1SUSA 1JTFA 5KYGA 1JSZA 4PIPA 1IM8A 5FADA 5GIOE 1NV9A 1QAQA 3C3PA 1VL5A 2O05A 5G02A 2A14A 3DOUA 3KR0A 5E1BA 2AN4A 4RTMA 2NXNA 4DA4A 3CC8A 2FK8A 2GB4A 1P91A 2ONYA 3M6WA 5EMLA 1Q0TA 2AOVA 3NWBA 3HVKA 1YF3A 3MQ2A 1D2CA 2EJTA 5ICEA 3BWYA 1INLA 4AZWA 2O0LA 2ADMA 5LQNA 3LKZA 4FGZA 1QANA 5EGSA 2G72A 2NYUA 5EEGA 3AJDA 5D1NA 3UA4A 3TRKA 5U4XA 2PY6A 4HRAA 4Y30A 5GM1A 3THSA 7MHTA 4YV1A 3A25A 5T64A 4WVLA 4WXHA 2WA1A 4PYKA 3A4TA 2IH5A 1X1AA 5DM1A 5FWDA 5K03A 1NT2A 4U7TB 3OZRA 3A7DA 2XYRA 3LDFA 2IBSA 2PX5A 5DX0A 1R00A 1QZZA 2AOUB 2IPXA 5LSAA 3GRYA 5LR6A 2Z6QA 3KR2A 2JHPA 2EG5A 3CBGA 3GWZA 4GC5A 4IKPA 3MB5A 3GDHA 5BXYA 2BH2A 4DF3A 1PRYA 3HVIA 4B17A 4CWAA 4RVFA 1RI4A 2HTEA 4EMSA 5CCXA 3T7SA 3OU6A 2ZBPA 3G2QA 3KQSA 2ZIGA 4PWYA 3CJTA 4GOMD 4KWCA 3GNLA 4R6WA 4FT2A 5FHRA 5E1OA 1RJEA 3GO4A 3AWIA 3UJAA 5ICGA 3ERCA 3MCTA 4FZVA 4PYLA 4LECA 1FP1D 3KR1A 4MIKA 1RI3A 4HSGA 2OO3A 2QYOA 1KYZA 3QV2A 3C6KA 1KIAA 4DCMA 1BKYA 1DL5A 2B3TA 3SSNA 4ER3A 3G7UA 2C7RA 4GOND 4L7VA 5CVDA 3LECA 5CCBA 3G89A 3LSTA 5EIFA 1JQ3A 3DXYA 2VZ9A 2WK1A 5FA5A 4PYJA 3RW9A 1KHHA 5CVVA 4A6DA 4RTNA 5EMKA 3VC1A 5GOZA 2AVNA 3NVMB 4AUKA 3G5LA 1ZHFA 4FSDA 1XVAA 3SR4A 2F8LA 4YMGA 3M6XA 3QOXA 1X1DA 2CL5A 3R3HA 5FUBA 4FR0A 1N7JA 4KIGA 2VDVE 3FPEA 3FPGA 4PYIA 2JJQA 2FHPA 5JUWA 3R9XB 4CTJA 2QY6A 3C0KA 3E05A 3KHKA 5CUQA 2IDJA 3K6RA 2AN3A 5DSXA 2G71A 5C1IA 5FQOA 3DXZA 3KPYA 1XCJA 4QQKA 1EAMA 2P3LA 5HIJA 2H11A 2VP3A 5F2NA 3JWJA 4FP9A 2NXEA 5DTRA 4LG1A 4LWPA 3VSEA 3P9NA 4QDJA 4BLWA 1FBNA 3THRA 3O7WA 5E1MA 3C6MA 2CMHA 1AQIA 4C04A 3OCJA 4HGYA 1JSXA 1ORHA 1YZ3A 2ORED 2IH4A 1NKVA 3P71T 1JQDA 5CIYA 5E9JA 4EKIA 3B7PA 2AOTB 3O4FA 5DX8A 4RTSA 1L3CA 4E32A 3BXOA 4M36A 4PINA 4AZSA 3UA3A 1AQJA 1EG2A 4ATNA 1YB2A 3HCDA 4OA5A 3GXOA 4PYQA 5K0LA 3HEMA 2Z6UA 1N2XA 1D2HA 3GRVA 3UJBA 5BW4A 2EJUA 2AOUA 3HA5A 2PX2A 3LGAA 5ICCA 2C7PA 4OBXA 2ZBRA 3P9IA 3TMAA 3OZSA 1IY9A 2P35A 3I58A 4XCXA 2NXJA 4RTPA 3R6TA 2PVCA 4MWZA 2IBTA 1XDSA 4AZVA 4Y2HA 4P58A 3KQPA 4F84A 4OA8A 3FUUA 4E33A 3UBTA 3GRZA 3IHTA 2V74B 2HNKA 3V8VA 4PGGA 4QVGA 1XTPA 5CVUA 5KQRA 3DLIA 3BKWA 4RVGA 4BLVA 1RI2A 2VDUE 1X1BA 1KR5A 2OB1A 3DR5A 3F4KA 3KQYA 4PCLA 3BGDA 5EKUA 3TPZA 3B3GA 3HA7A 2LD4A 5D1HA 2I9KA 3BT7A 3O31A 4DCGA 2BR4A 3BUSA 3HA3A 3I53A 1KPIA 3IYLW 4YMHA 3DULA 4QDKA 5FQNA 2YR0A 4G56A 5E2BA 5F2OA 4YUWA 10MHA 2OXTA 3EGIA 4CKBA 3FUTA 3HTXA 3GGDA 2PXCA 4A6EA 2IH2A 2ZIFA 3PTAA 3A7EA 5HFJA 3GIWA 5E8RA 4MQ4A 4PNEA 4RX1A 5K0JA 1YUBA 1L1EA 4ER7A 1B42A 3LCVB 3M33A 4UOEA 1EQAA 1TW2A 3I64A 3V97A 4IV0A 1UIRA 5E9QA 1RI5A 1V39A 5DPMA 1R18A 1KP9A 1SVUA 2PV0A 2HR1A 1SG9A 5C0OE 3NDIA 4E70A 3OE5A 4XUEA 5LQAA 3C3YA 2P8JA 4GEKA 3EMBA 2R3SA 2ZFUA 2NP7A 5FTWA 3WSTA 2EX4A 5HILA 3SSOA 1ZGAA 3UZUA 4Z2YA 2Q41A 4RVHA 4PONA 3T7TA 3P2IA 2V7EA 1NW3A 2PKWA 3EPPA 1JG2A 2H00A 5EVJA 3M6UA 4BP1A 1G55A 2QRVB 3S68A 1O9HA 1FP2A 2BR3A 3NDJA 1NE2A 1SKMA 2GH1A 3G8AA 4X41A 2I7CA 4C03A 3SM3A 3EVGA 1N7IA 3PS9A 3ER8A 2AOWA 1KXZA 2CKDA 4R8RA 4RSRA 4EKGA 2PJDA 5FCDA 4RTLA 1SQFA 3FYCA 4RTQA 1R6AA 3QOWA 5K0EA 4PIMA 3BWMA 4KRGA 4KDCA 5EMMA 3KQMA 5H02A 1JG3A 2P7HA 2PLWA 5EZSA 5T67A 4BP3A 5GIPE 1O9GA 1Z3CA 2XVMA 5HIIA 1WY7A 5DT2A 3HNRA 2K4MA 3LDGA 4H0NA 5K01A 5EHIA 1L3IA 2P1DA 2GA9A 2BM9A 2G70A 2YX1A 2DPMA 2PGXA 4YV2A 2Y1XA 3KPUA 1T43A 3KPWA 4LWOA 3CJQA 5E1DA 2IGTA 4QVKA 5EG5A 4KDRA 2B2CA 3PT9A 2OPBA 1NW8A 4YUXA 2ZCJA 3NVKI 1JG1A 3TR6A 3HCBA 5DM0A 4KVZA 4E31A 1P1CA 2I62A 3SGLA 4E30A 2JG3A 3ELDA 3HCEA 4GC9A 4RV9A 4P7KA 3ELWA 2PSSA 5JR3A 3LBFA 2UYHA 4PYMA 3FUVA 1G8SA 1VPTA 3EVDA 3FZGA 4O29A 5E2AA 3CJRA 4OBWA 2ZZMA 2XVAA 2PT9A 2PBFA 5KVAA 4V0QA 3EEYA 3TQSA 4POOA 5K0CA 3HM2A 4YUZA 2ZLBA 1IXKA 2B78A 2PWPA 2YTZA 5DM4A 5KQSA 2EFJA 4ER5A 4CTKA 1VP9A 2B9EA 1HNNA 3DMFA 4OQEA 5T6BA 3SSMA 4YUVA 3SX0A 3I5UA 2PWYA 3GU3A 3P97A 3A27A 5FHQA 3PB3A 3BZBA 1NW6A 1VE3A 2O07A 2UYQA 2P41A 4GBED 4HTFA 3PFGA 4R6XA 4V0RA 4C4AA 3KQVA 3DLCA 4C05A 3KR9A 1YFLA 1RJDA 2NXCA 2JH8A 3BKXA 3LKDA 3PVCA 2PX8A 3OU2A 4HC4A 5ICFA 3BGVA 1RJFA 1UFKA 4M37A 4GF5A 2JH9A 3KPJA 5DSTA 4F85A 4ER0A 1G6Q1 1NV8A 2AOTA 2YVLA 4RWZA 3TKYA 5GINE 3ER9A 1RI1A 2BR5A 5HOQA 1XDZA 3G5TA 2ZSUA 1BOOA 5FWAA 2YXLA 5MHTA 5LQCA 5EKXA 4BY9E 3G2MA 1M6YA 2HV9A 2YUIA 1WG8A 2QRVA 2C7OA 4GOOD 2VS1A 5ERGB 3TKAA 1F3LA 5K0NA 3U81A 3HVHA 3M6VA 4CKEA 4DKJA 2G8NA 2GS9A 3B89A 4BLUA 2CMGA 2OB2A 3KU1A 5CD1A 2N47A 3EVFA 2UYCA 4P7JA 1JG4A 5DXAA 5E8JA 4M38A 3EVZA 2AZTA 2XYVA 3PFHA 1Q0SA 1XXLA 5BW5A 2QM3A 2OYRA 4RTRA 5CM2Z 4MTLA 3DTNA 1QAOA 1FPQA 1YZHA 3EVEA 2ESRA 1I1NA 3FTDA 4E2WA 1FJXA 2AN5A 3LDUA 5CVJA 4HTFB 3PX3A 2I6GA 2AS0A 1L3BA 2P3OA 2P7IA 3KKZA 3MCZA 3NTVA 3T7RA 2GLUA 3G8BA 3EGEA 3UWPA 1DCTA 4P7FA 3MHTA 4GQBA 5M5BA 4MHTA 1X1CA 3B5IA 4HH4A 5GP1A 3X0DA 1WXXA 4EK9A 1WXWA 2OBFA 5K05A 3FTFA 4R05A 3LCUA 3BWBA 3P9CA 4FSXA 4C08A 5EZQA 5LQKA 3L8DA 2NNWB 4P7GA 1EJ0A 1U2ZA 5EC8A 2ZWVA 5EQJB 1X19A 5HIKA 4AX8A 2GAFA 4HG2A 4YV0A 4K6MA
chains in the Genus database with same CATH superfamily
1RRMA 3A3YA 3QMVA 1JR3A 2IIPA 4MRAA 3V8BA 3HN6A 1E2KA 3X2FA 2A8YA 2J3IA 1H3FA 2R6HA 1ZGZA 3DMTC 3IMEA 4RE5A 2ZDHA 1U5AA 1P5HA 1PK8A 3FRHA 1OWNA 3IDQA 3M7IA 2JJ2D 4NESA 5DULA 3TDNA 3DBRB 3QNWA 2NO6A 5LOVA 5JJKA 2VJOA 4JC0A 3RBXA 2Q49A 3P2KA 1R5OA 4DMHA 3HCAA 1RSZA 4PCAA 3SQLA 2OORA 5FOQA 1H4VB 2FR8A 4EAAA 2XTAA 5JG7A 3QNMA 1TGYA 1JBEA 3B3JA 1Z38A 3FDIA 3IDZA 2O8NA 4NYIR 2ZRAA 2AOXA 2O2JA 1USKA 3T3EA 1NDQA 4YRSA 13PKA 2IPLA 4NMMA 5IKMA 1J2RA 2EYUA 2P68A 3V3TA 3H87A 1Y5MA 3E9MA 1BRMA 1CIPA 5F64A 1UEJA 3LX6A 4I1PA 1AUOA 4WK0B 3MHPA 3PWZA 3GXBA 1TU4A 3WWZA 1GY8A 4H4DA 3H8VA 5DSZA 4MLDA 3M83A 4ZQHA 4CIDA 5BSWA 2IOFK 4IR7A 5FDFA 2OO7A 1GV1A 3AUAA 2WEKA 4P33A 3MNFA 2FXVA 2G67A 1NW4A 2AXPA 3LC2O 4P34A 1WWKA 4IVQA 3RU3A 4LXHA 5KDDA 1VZ3A 4HH1A 3ZU6A 5DXFA 1UADA 5AHWA 5GZ6A 3STVA 3PWKA 3FNRA 1KOJA 3LP6A 4NNPA 4XQCA 1ZRNA 1ZYUA 2GFQA 3EGOA 3GEPA 4BATA 2VTDA 4OATA 1ONSA 1Y81A 1IPFA 1L8LA 4QPDA 5KTMA 4G6ZA 1CS4C 2WM2A 3Q2KA 4RIIA 1GQYA 3ANYB 4TWZA 1IOZA 4V39A 1QTNA 4ZRMA 1UAYA 3IQGX 1L4UA 1ECFA 3KOMA 1JNYA 4Z5XA 3SYMA 5CBKA 4B75A 1Q1EA 1QLWA 4E6EA 3L4JA 4GDFA 3HDQA 4CV2A 2XOKA 5DHUA 3RC3A 4NULA 2RHJA 4LTDA 4X3CA 4YALA 2IWHA 1N6KA 4BO1A 1MHTA 3EPRA 2HMYB 1E3LA 2PWAA 1KS9A 2Q9AA 1IOWA 2V3CC 3R0QA 3DHVA 1G20A 1HRDA 3FCSB 4DEYA 1NQXA 4TLBA 4C76A 1MB0A 4INPA 4L5BA 5DX1A 1I9GA 9MHTA 5CAEB 5C8VA 2JI7A 1W36B 4M1EA 1P3Y1 1YU6A 4IOMA 4A03A 4KNYA 5BQFA 3MJCA 1PDVA 1BCSB 1IY1A 1XVVA 2ID7A 1KR2A 2F3TA 2VA9A 4GYWA 2ERCA 4IMIB 5AM4A 2WJ3A 4CMGA 2RI6A 3LLUA 3MUFA 5HJ2A 2QTGA 3FA2A 5FBWB 3RG8A 3PPVA 1NQVA 2XQIA 3QKSB 3WK5A 3DCYA 3JD1A 2I2WA 5M34A 5JSYA 1ZUD1 3V9PA 1U5CA 2P9QA 1NXTA 4YNBA 3QE4A 5KNBD 1D2RA 4QTUB 5DYYA 2H0QA 2ODNA 3D43A 1GAXA 1ITZA 2WAXA 5LZ5A 4EB8A 2EDAA 1U0NA 2CD9A 2AL7A 3IQIX 4CCWA 1DC4A 1KAHA 4H2DA 4KSCA 3EDRA 4OI2A 4UD2A 2R48A 5BYBA 4XXHA 2BHSA 2GPBA 3PC4A 2FEXA 2O3TA 2AF4C 2PDAA 4W99A 3L8HA 1USWA 4LZAA 4N3BA 4ALKA 4CMEA 1KEZA 1ZIDA 3X1KA 3KPVA 1FTYA 5TX7A 1XYYA 1DBVO 2DKOA 2N75A 3CNHA 4LY0A 4D3FA 5A3JA 5BR4A 3F3MA 1K3UB 1L6IA 4RVNA 1GSHA 1V47A 3OE7A 5ARBA 2HK7A 2QMZA 4YPFA 3BORA 5D7BA 3ZCSA 1U0LA 1LXCA 4NG4A 3FYTA 3AKZA 4XUDA 2ILTA 5A0VA 4BJHB 3JYOA 1R9NA 2CV1A 1F2DA 3ZXIA 1VGVA 1PJCA 1H2XA 1FFEA 5DM2A 3D8UA 5FBRB 2B92A 2B4QA 1Q5PA 2O7SA 1R8XA 4M89A 4N0MA 4AMGA 5B3LA 5AJHA 1EHCA 3BCRA 2XUIA 5DHTA 1R0RE 3R5XA 4XB6B 4C4OA 3EGCA 2GJ4A 4TS4A 1HG1A 4JCCA 4EHKA 1NRJB 2BHLA 5JEEA 3HCRA 4Q4JA 3TRDA 1C1YA 3A28A 2RAUA 3Q3HA 2GBLC 3D4OA 2HEGA 3FWKA 5KYGA 4PW0A 2G6BA 2YHIB 1DKLA 2GPJA 2ONCA 2RG1A 3MTQA 1IWOA 1H6AA 4S0XA 4RLQA 3C3PA 4J16C 2O05A 3HJUA 4QOGA 4Q7EA 3CONA 3OVMA 1UDWA 1W5TA 4GP6A 2MJLA 1PWZA 3CX8A 3FSGA 5J2UB 1A9XA 1GZVA 2O14A 3HXTA 2C7BA 1Z22A 4YJ2F 2JCXA 2WG1A 4GSKA 4X84A 2QT0A 4G84A 1LKZA 3MUEA 5CVTA 1TCCA 2P9TA 4Q4LA 4LQ4A 3IUEA 1IBSA 1DRUA 2Y05A 5EGSA 1P1FA 1VKRA 4YJ2B 4TYYA 4AJNA 1GT6A 1Q0PA 3GGSA 2XQVA 4X7PA 3DJFA 2WNHA 1QR6A 1T0UA 5AI8A 1NJ5A 2F6RA 1F8YA 2ASVA 1C0PA 1QO0A 2H07A 2XWPA 3FCUB 3SY8A 7REQA 2VXYA 5KQPA 2QPAA 1U9ZA 1VRWA 4H7EA 2D5LA 4QWMA 2AXNA 1H2FA 3PNPA 4QQ8A 4I5DA 2DBQA 2GM9A 2VUHB 4RLSA 5K4GA 1NU8A 1MJNA 1FRQA 1XG5A 3CUKA 4RXTA 1W36D 3SJAA 1FNNA 3LYAA 4YO8A 1GU7A 1UKVY 2BE7A 2PGIA 4M3NA 3COJA 2I1VB 4BJ5A 2BFNA 4ODIA 1Y9JA 1M8GA 3L0PA 4P4GA 4XGKA 2C77A 4JL8A 3DCJA 1U0SY 4ITUA 4YT4A 5JAPA 1SRQA 2COKA 2ZRKA 3FWNA 3KEOA 1UODA 3O8QB 4QU5A 4D41A 1THZA 4QOFA 2G76A 5PNTA 5CB4B 5TF4A 3CWQA 1EDDA 3L93A 1QCZA 3ACCA 3LY9A 4YP7A 3C8MA 3T5BA 4GPZA 1ZKMA 3CNOA 4DEVA 5LN1A 1JPVA 2ZBGA 1TAUA 5JY6A 3GPBA 3KDPA 2EJCA 4MYTA 4IFTA 4H1VA 4OQZA 1BX1A 1SEVA 1WQ1R 2XUGA 3HDVA 1JQ3A 1BQ4A 1WKCA 1VB5A 3RTCA 5KX5F 3G82C 4OMUA 1XCBA 2D2VA 3PYXA 2ON6A 2HMUA 4ZOAA 1GG8A 1TPZA 5AVRA 4W9NA 4HFNA 1V11A 2NVUA 3L8CA 4IH9A 1X42A 5EHNA 4CM8B 2RC5A 1E4EA 3IT3A 4JGBA 5LP6B 1V1RA 3OJOA 1AX9A 3ABRB 3T9EA 5KVSA 4C7OB 3JARB 4X7RA 3VU9B 2A4MA 1QVZA 1EQUA 1XD2A 4IMJB 3AQ4A 4G5OA 2HJWA 4NR0A 1P3JA 4BO7A 1G63A 1HK7A 3BA1A 3VVMA 1RXCA 2Q5IA 3C6XA 4UVGA 5IT0A 1SHLA 3LSYA 1S96A 1TMYA 2PGDA 3FFTA 3TIIA 4D1YA 5H4GA 5EYPA 4BAGA 3ZV4A 5F2NA 2BLLA 3L0IB 1DQNA 1Y1KE 3FGOA 1W4LA 2JCBA 1GGMA 2C9YA 3B9BA 3SOPA 2J5RA 4B8YA 3DM5A 4HEHA 2QK4A 3V8PA 4UMFA 4JEIA 1NUAA 1ZUWA 4YEDA 2K6GA 4HAIA 1VHJA 3AHDA 2ODTX 2QM0A 4PLCA 1W4CA 5FWYB 1ETUA 4WNIA 1NKVA 1ZJYA 3H1TA 4HVAA 3B7PA 3V7WA 1PFGA 3MWEA 2WKPA 5EFOA 2AOTB 4ZCLA 3SP1A 2WBLC 2WB4A 4YC7A 3PFWO 4KE6A 4MIYA 5I48A 1A5SB 2PRYA 4M36A 3FZNA 5DNWA 2EZUA 4GWLA 1YJ8A 1W5EA 4UUNA 1KQNA 3DFUA 4KREA 4PBTA 2CSXA 4KXXA 4ZEXA 3HYTA 5HTKA 2IBSA 2YN0A 1YCHA 3EC2A 1CNFA 2DCMA 2WJIA 1Y8RB 2XWSA 3PPYA 4LWQA 1HFEL 5AVWA 1R6XA 3S8YA 1V16A 2V7PA 4YJFB 3MMXA 4CEIB 1U4NA 2P9YA 4R5MA 4X24A 5ADWA 2OM6A 5IFLA 1YASA 2IBTA 1PFKA 4D9GA 1V5EA 1K7YA 2V5AA 4P58A 5KTRA 2YY6A 1WPRA 2NM0A 5DKFA 1SUDA 3T3PB 1XCGB 2WF6A 2VJLA 5ILOA 4G0NA 1E94E 5FLYA 2EFEB 5L6LB 1Y8ZA 2JLCA 3EJWA 3FNGA 1RI2A 4FEEA 1CUCA 3G9TA 5JISA 1SCBA 3N1UA 2LWIA 3EG5A 2LD4A 2LPMA 1A8IA 4LBZA 1LPPA 5DOZA 2X76A 4BFTA 1V4BA 1OAOA 3L92A 3RSHA 3U4QA 3S40A 3HZRA 5FQNA 4A26A 3DE7X 5KCMA 4DAOA 2QDKA 4YUWA 1T8RA 1SCJA 4HDQB 2X8BA 4A0FA 4Z9XA 3U37A 1FRZA 1S7CA 2YWBA 3D7MA 3IP9A 3LV8A 3M5CA 3NHFA 2IH2A 1THGA 1YBAA 2BKXA 2C04A 3EWIA 3BSSA 1H0SA 1L1EA 4KQIA 5C8YA 2IHVA 4DA8A 3CWZA 4X1KA 1GFWA 4TQGA 2GTIA 4BOYA 4ZV4A 3QLTA 4IVPA 2TMGA 3QELB 2WM3A 1Q7GA 4IJ6A 4B81A 3BG5A 3V42A 4FXOA 4EHDA 1YKFA 2GAAA 1WMEA 3S44A 5JSZA 4PTYA 1Y3AA 1M7BA 2PRSA 2JBAB 2P1RA 3KXKA 3A6HA 3QMPA 4J1NA 4KL8S 5C0OE 1TYCA 1BN7A 1OX4A 1CJUC 1JG7A 2VNSA 3IVCA 4OQQA 1TM4E 4RD3A 1R88A 1MXFA 5U1PA 4K6FA 2XZDA 5B3KA 2Y2VA 3GLIE 2HGZA 2EX4A 1SUFA 3BERA 3WJ2A 4EA7A 5AUNB 2Z30A 3URMA 5HG0A 1GPLA 3TEJA 4CKBB 4PX5A 4Q48A 5IJAA 1JB9A 2V7BA 5DHSA 5EXXA 4Z0PA 3AF2A 4QBFA 4WA8A 3S68A 1TX4B 3V6LA 3F90A 3PJRA 3S1AB 1SKMA 4BP8A 3EEQA 4TN1A 1UZLA 4C03A 3CEHA 3GB9A 1FLDA 5BN1A 2P2ZA 5G1NA 3I12A 5ER9A 1G4HA 3D6NB 3VKVA 2QGFA 2VH5R 1E5DA 4RK4A 4KMSA 4J2TA 1AHNA 3GEEA 1IY0A 2P7HA 4NFHA 3I3SR 2H1HA 1MTZA 2GM3A 3CFYA 5BO5A 2CNNA 3O3CA 4XJTA 1B23P 2ZOSA 4G0UA 5CK5A 1KY5A 4LHYA 2WZQA 3RVSA 4H9GA 1X0XA 1RFGE 4L8WB 1I2MA 3FNHA 3CRVA 1L3IA 3BBLA 1PT8A 3NHMA 3OPYI 4AM8A 5U9CA 2HDHA 2QQGA 1L5LA 4HX2A 2RB5A 1KSFX 2V6MA 3BF7A 4L0DA 5J5CA 3IBYA 1W581 4DT1B 4AY2A 3MFYA 3RUIA 1P4SA 3HI4A 3QM1A 2ZCJA 4M99A 1XU7A 3HCPA 1XZQA 3AI1A 3IXQA 3SC2A 1V48A 1NLZA 2ZUDA 4AU1A 4CDNA 4BEVA 1NVVQ 1P1CA 2A9QA 1HBJA 2C4WA 2FZ4A 2I62A 2Y71A 4P7BA 4RAOA 4TWJA 4AXBA 4TVKA 1K06A 4I4NA 4LK3A 2X9GA 4ZO6A 1C4OA 4B79A 2UYHA 2HL6A 3BRSA 2VCEA 3FUVA 4PYMA 4CLXA 3DHNA 1V8FA 2JARA 2C1ZA 4C87A 4BNGA 4XQ9A 3WNVA 4EITA 3MT7A 4TN5A 2QSZA 3MILA 3HU1A 3PR2B 4OQMA 4EGSA 2GT1A 4G0QA 3SDZA 2Q5CA 2ZQZA 4KN9S 4PG8A 2EFJA 3F6YA 4WOPA 4ER5A 2HLHA 2I8LA 1C8KA 1LNZA 3MWDA 3LXMA 3THXB 3O8BA 3T0FA 1KTIA 5J3JA 4J03A 3FTNA 4KYUA 1W4BA 3CKMA 1JDBB 1J21A 1VL8A 4C4AA 4P1ZA 2GZ1A 3OZFA 2LCFA 4HNAB 2R0QC 1SVWA 2GJSA 2AN9A 1U65A 3A6ZA 1H93A 1BAPA 1EQ2A 4MUGA 2OORC 1IQPA 1NZFA 3BYZA 3TYXA 2CKMA 4U2BA 3UHOA 5HKBA 5K5EA 4EO4A 1BU8A 4RWZA 1DFHA 3NC0C 7AT1A 1ZW6A 4ZEWA 3K4QA 1RNLA 4O2RA 3DKPA 4EJ0A 1K97A 2J8ZA 3NTQA 1DGQA 1XVLA 4MHOA 3JQBA 1HQDA 4Q1VA 4DG5A 1UDXA 2JVKA 2GOYA 3U6KA 1G7TA 4LRSB 4JLOA 3AIIA 2VYVD 1T10A 2H6EA 1K2WA 3QXXA 2RFLA 5H3LA 4DKJA 2XY4A 3QVTA 1Y8QB 5CD1A 4QA9A 3T9CA 4C6TA 1RE0A 3BWEA 4KACA 2GCGA 4UDYX 2Y8EA 1FMJA 3MXOA 4ND1A 4EHJA 2RK4A 1Z7YA 4X45A 3ESYA 3G1TA 4OHMA 3MWDB 1GZSA 5THXA 5IDXA 3B9QA 1HDOA 3VNSA 2HH9A 1GSIA 1NR7A 2E6KA 1U5BA 5TC4A 3KOZA 1HTWA 1XAHA 1YJBA 1MR3F 4JVNA 2P3OA 3Q3GE 3KKZA 3U62A 5BR1A 2H4ZA 4EHBA 5ENVA 2IA5A 5B53A 4JYAB 4GZMA 3NIWA 4XEUA 4RETA 1CB7A 5DN6D 4QJ5A 3C1UA 3Q7PA 4IFIA 3NBQA 5EUQB 2JKZA 3OLZA 4GFDA 3LUJA 2G7MC 1GCAA 1I2CA 1U2ZA 1W19A 1I7NA 2OLKA 3HUDA 3PFKA 1F2VA 3OP1A 2EL7A 4UVHA 1KSJA 3U2QA 1HA3A 2FPSA 4IIGA 5JC1A 4WBNB 3A3KA 3H1AA 4HRVA 1JBKA 2CDRA 2I54A 4K6MA 2BM8A 4U6SA 5DGTA 3CEPB 2PJRA 2JKYA 3DLTA 4NECA 5EZYF 4ZVOA 3TLCA 3UC5A 4BWFB 2GLXA 4U7FA 5CGZA 3P2EA 2NZ8A 3IP6A 3PIIA 2QTCA 4B7ZA 4F3TA 4DV7B 1T5TA 1KH1A 4RTJA 1VYHA 1BCRA 2FUKA 1M72A 2L19A 4CGZA 4QBHA 1ZITA 3A9TA 4L22A 2BV3A 2VTEA 3DL0A 4DDVA 2PUBA 3EZ2A 4OF4A 4GMDA 1WUHS 3DQQA 1G3MA 3Q8XB 4HFRA 4ZV9A 3HWRA 3AVUA 1K5PA 2WYVA 3SHFA 3VMMA 2HSWA 3LQQA 4AKEA 2ZRDA 5B4TA 1E3JA 5LA6A 3U4AA 4YDQA 2GHTA 5ENZA 3FTEA 3PR1A 1M6EX 3V4SA 3VSCA 4X66B 4CU2A 4ZVSA 5E3JA 2BONA 4U6NA 3BREA 1DO2A 3PICA 4J4HA 4DW8A 4QUAA 1LTKA 3L4BA 4GKBA 2A9KA 1DPFA 1YL6A 2VF5X 2AEFA 3VPCA 3IOEA 4IMPA 3ZWNA 3V4PB 4FB5A 1ZC4A 3CCCA 4Q1BA 2BGRA 3Q3VA 4DA6A 1QRTA 3OFKA 2OCYC 5HKKA 1JSRA 2IFTA 4Y2JA 4B3XA 4DMGA 5JYDA 4XEHA 5A0FA 2ZSDA 1APBA 5ESRA 3H9GA 2BBSA 2PMWB 1QU3A 4RJLA 2OVFA 3HRHA 2GYWA 3LOQA 2OAGA 2QQ0A 4NS4A 3TSCA 1B2RA 4LRQA 4Z99A 4UDXX 1RBQA 4CKCA 3JATB 2FUG6 4YFVA 4UASA 1YAHA 5FLXA 1NULA 2PFKA 5LC1A 3GRAA 1FUYB 4MKIA 3CE6A 4DLYA 4GD3Q 4WGGA 1Q6YA 1DKRA 2CXOA 5CP8A 1QB8A 3Q6MA 5A5GA 3L7NA 1ZIYA 1H1TA 2V7TA 1SUIA 5IN5A 5SYMA 3ZWYA 1Y34E 3OQIB 4WK6A 4IXWA 4TRNA 1KMHB 4YROA 3T5GA 4HDMB 4M1OA 4N6NA 4DDWA 3JZFA 2E18A 4REOA 1QC5B 4ZA2A 4BNFA 3RJ9A 4EECA 4CEIA 3QLVA 3VJKA 5B7QA 1SHKA 3SXUA 5ES4B 3BWXA 3FG9A 2O2IA 4NSNA 4JOBA 4INZA 1IXSB 3GG9A 4YAWA 1E6CA 1U2QA 1TU0A 2GCOA 4KXVA 2E4YA 1C7EA 3S2SA 1E3IA 5JH7A 2QVBA 1L5OA 2GPYA 3FVRA 4UFOA 3CF0A 2P6UA 1EX7A 4P4SB 1O95C 3MWEB 4NK5A 5D5HA 1NDUA 1AXEA 4WZ6A 5CPBA 3UWKA 1JEYB 3NEJA 1PJ4A 4HX9A 5HKOA 1PBTA 2PKCA 4BGEA 1NIJA 3ZD6A 3R24A 4E2YA 1R3DA 4PLGA 4W5TA 2O2XA 4BFCA 2BCGY 1Y3DE 4LE1A 1YZNA 1YR2A 5KYNA 3GLHA 3LHSA 4LRTB 4QOSA 3TQRA 3JQ6A 2X1LA 3LX8A 4ENQA 5BR7A 4O2LA 4N7MA 4WLOA 4INJA 4DHEA 4YCLA 1CRQA 4ZJPA 3G0HA 2E9SA 4N5IX 1VBFA 1KPHA 1G2IA 3G7NA 4M0KA 2DWUA 1QGED 1SVLA 3PQ8A 5JLJA 4I4LA 1DX6A 1MO5A 4H16A 4G0VA 3HRKA 2GK6A 1FZTA 4R71A 3QKSA 1OBFO 2AUNA 3K0EA 3G6WA 5CURA 4ZRNA 3JVEA 1LY1A 1DJNA 1HE3A 4G1CA 4Z7OB 1O94A 4YA6A 4LMPA 3OPVA 2VBGA 3ZE9A 2J6BA 4TV8F 2F4NA 2JB9A 2WQ7A 4U6QA 4G07A 1UP7A 3REGA 4V2UA 3SC4A 5BRJA 1CSEE 4XUGB 3ZYZA 1THTA 3KVOA 1ISMA 1JTVA 4KRXA 3PF8A 3BAZA 4O59O 1JZSA 3KYDB 2CDNA 2FMUA 1E7WA 4K9NA 3BE6A 4ERXA 2BF4A 3AIKA 4NV1A 2W8BA 4A23A 1R8QA 3NTLA 4EJ6A 1QV6A 5IDVA 3K2QA 4F7WA 3KXLA 5F76A 4RVOA 1P0PA 3CGGA 1DELA 2HJSA 3B9PA 1MDFA 5EKTA 3ROQA 2PTGA 2PRIA 3HMQA 2KLBA 4QSHA 5KCZA 2IEZA 1BN6A 2HA3A 2C5LA 2CFOA 2JASA 3DG9A 4IHJA 4ZT7A 1IN1A 2KJQA 2A7QA 2FQYA 2C42A 4L9AA 2H4HA 1C5KA 1O6CA 3H2GA 3LS2A 3OLXA 4TUYA 5J63A 2LKDA 2P2GA 3ZWQA 1B7GO 1M83A 1E2GA 2ONYA 2GB4A 2XUJA 3O2QB 3TOCA 1GZ4A 1XV5A 4ZREA 4RE6A 2WWXA 3ZHQA 1C8BA 4BCCA 4MIOA 4NEHB 3EFBA 4AZWA 2AD1A 3S27A 1SCKA 1O96B 3EWSA 1ZISA 1SIBE 2YFQA 3L1IA 3WMXA 5IABA 5F1OA 3TRKA 4F9GA 2WFAA 2C8LA 4KQ1A 4DPMA 4WFQA 3EDOA 5KTYA 3I0ZA 1O6BA 2J3JA 3E4DA 4N5HX 3T9AA 4KXYA 4QM7A 5IVHA 4HNSA 1A5AB 2NYVA 1SG0A 1SQ5A 3W6PA 4KR6A 4MCIA 3KR2A 1J5XA 1H2HA 1XOIA 4KGXA 3EDYA 5DK4A 1E7RA 4DR3B 4GC5A 4U7DA 2QQ5A 5K1ZA 2YZGA 1TC2A 1VHLA 1XD2B 5BQ5A 4HDSB 1X8JA 4NV0A 3BB3A 3KAKA 4CWAA 2QTRA 5J2UA 1T2UA 3T7SA 1MQSA 1K6MA 1L4KA 3A37A 4TXJA 4BP9A 1IG0A 1VCNA 2VBIA 1RPAA 2AQIA 3ESRA 4KWCA 5TT1A 4AMUA 4DR6B 3QVLA 2IC5A 3NKVA 1NT4A 3UJAA 4C7VA 4E5NA 1RXVA 1XTKA 2R85A 5D3ZA 3GFTA 1M7GA 3JYLA 2VXCA 5C1DA 1P4JA 2DCUA 3TEFA 1Z4KA 2VQ3A 2QR2A 3OF2A 3WWPA 1YC2A 6Q21A 5JJIA 1O5TA 1HDRA 4N48A 3IUJA 1P1HA 2H3HA 1NJ6A 4UHKA 1PL8A 3S3TA 1WDWB 1FU8A 2DHDA 3EA5A 1WR8A 2VSNA 2RBGA 4OV6B 2Q6KA 3HFSA 1Q3TA 1KARA 1U99A 1DMSA 2NG1A 4Q3OA 5GZ3A 4JJGA 3EPLA 4JDPA 4IXNA 2GPTA 1EFPB 1NY6A 2NZWA 2PA3A 3BQ9A 5CDYA 3BXGA 5A3SA 2UXDB 1N3BA 2ZBEA 4DUZB 4LTMA 4PEVA 4F96A 5FOVA 2QLLA 1S2DA 3IC5A 3VHLB 3T1TA 3I2FA 2ZUVA 1SUWA 3X44A 3EQ2A 3RI3A 2DY0A 1CVRA 3Q8MA 3OZCA 5EJ7A 1E8NA 3A10A 3BICA 1XCJA 3GLHE 1EAMA 1EEXB 2GZHA 1BYIA 2PXHA 4Q3AA 4IIJB 5GGXA 1VIVA 3O26A 1OFUA 4NZZA 3P9NA 1O96A 2X42A 4F04A 2GSWA 3UNXA 3MMPA 3O7WA 1FU4A 4UPVA 3A6GA 2JD2A 4YAGA 1QH1B 3ZDAA 3MWYW 4O2BA 1E2EA 1BRTA 4NYIQ 2R60A 5L4SA 2ZRJA 1US8A 2JLBA 5FBHA 4PHFA 2ZJ5A 4LDJA 3O4FA 1VGRA 1PEAA 4MHSA 1L3CA 1E60A 4ZT5A 3DPUA 3UOWA 2F64A 3AF3A 3BXOA 2HRQA 1GAWA 1KKMA 2C4VA 4J49A 1T4MA 2BW0A 2FRVA 3BXZA 3HCDA 1SURA 4ROSA 3RUFA 3TBHA 2WJWA 3IS3A 2EYQA 2EHJA 3P96A 2P90A 3C5CA 1KKLA 1N2XA 3AJ8A 1LLFA 3ESDA 3GG2A 3VPHA 1GLNA 2JFUA 3HWWA 3C3DA 4AIRA 3HM9A 3VDXA 1GN9A 3RVOA 3TECE 4CMBA 4DPKA 4JOCA 1UFRA 4XLLA 4MVJA 5IJ9A 3MT0A 3NXKA 4CF6A 1E5LA 1XDSA 3KALA 3HNOA 3CRW1 3KZVA 1WMAA 4R1LA 3O9VA 2WTEA 1CKEA 1UIMA 2V98A 3FIJA 4LC1A 3WO1A 4R1UA 2FEWB 4EVRA 1Z2AA 2HB6A 3NX4A 2XODA 1JEDA 3UAZA 5AW5A 1T9GR 3KZ1E 1T5OA 3C6BA 1YK0A 1AV7A 2BI7A 3KEFA 3GLFA 4Z3OA 1B3RA 3OI7A 2X58A 1NVFA 4UPDA 4XD7A 3R9IA 3A1SA 6GPBA 4EVSA 1BGVA 2W48A 3GFPA 3ROKA 4EFNA 4L5CA 3BH0A 3V4LA 5CNJA 3O75A 4URFA 4M86A 1XDGA 3GPCA 4Y2PA 1GNSA 3EGIA 2ECQA 2Y3IA 4HSEA 3GVXA 3QY0A 1Q57A 3UENA 4YQZA 3A7EA 4M76B 2AG5A 2I33A 2EL9A 2X3FA 3W5SA 4ZMSA 3MPUA 1VI2A 2HJRA 1L1RA 3PDIA 1SUCA 1I24A 1Z56C 2M6LA 4YWJA 4EUFA 1RS0A 5IH7A 4B6RA 4V1CI 1NG9A 2BHRA 1KQFA 4DLWA 1V39A 1GWNA 3R9XA 1H6CA 3JQAD 3QPDA 2P2CA 2QL6A 5ECWA 4BVBA 5JXGA 1FBTA 1K7CA 5BN3B 1WBDA 2C7VA 4HMPA 4IJKA 4C2TA 3HFGA 2CK3A 4DANA 1YBHA 4ZICA 5A5EA 4QYTA 4L75A 5FTWA 4CMHA 1DLIA 2OLEA 2UZIR 3WKEA 4V0MA 4TL8A 5L3SB 4LOJA 1GZ5A 4IH4A 3SQOA 2NTEA 2WT9A 1EVZA 1F8XA 1B0UA 1EFHA 1K66A 1TVKB 2H00A 2O5VA 1ORRA 4P92A 4BP1A 1D4AA 1Z15A 5I01A 1MDBA 1USUA 1L7MA 1WVMA 2I22A 4KQCA 5ALGA 1NE2A 2X9VA 2XLCA 1VI6A 3IEPA 5C5EA 3WDSA 3DEZA 3PS9A 2DPHA 3EB9A 4UATA 3WK7A 4B31A 5BQOA 3M1LA 2FTKE 3SEAA 3QTBA 4I4TF 1KVUA 1PR3A 3QW2A 3GZNA 4UU0A 4CETA 5EY5B 2J9GA 2DQKA 4Y1FA 1VXOA 4URHA 3IMCA 1RAHA 4NZPA 5KNCD 3UW1A 3RVPA 1HT0A 1DV1A 2XYPA 2I2XB 1MH9A 2J9XB 3AHFA 4TUYB 4V38A 1XO1A 2R1ZA 3LRTA 1P2VA 4ID9A 4UBMA 4ZYUA 3JD4A 4WE3A 2B61A 1X7WB 3NXSA 3AJRA 3KL4A 1JVBA 1FUUA 1EXVA 1LUAA 3IEVA 2IY7A 5K3OA 5IDQA 1QQ6A 3ZDBA 5DM0A 4A2CA 4WBNA 5JS2A 4UCQA 1U0OC 2N9UA 3GVHA 5ESDA 2QWXA 2NQ8A 4X65B 1OYVA 2DFLA 4MV1A 1V1MA 2OO5A 1SFRA 2EBUA 4JIMA 4XR4A 3I39X 4Q9KA 1GL7A 3HH8A 5EMNA 2ZZMA 4N0EA 1YFZA 1E2JA 3PCTA 1L1QA 2OXEA 1WMFA 4DGQA 1I0IA 2GZRA 1MTOA 1A71A 4CCYB 4YUZA 5H8WA 1AKVA 4TLEA 1UP6A 1VL0A 2ZAMA 1I4TD 3I6YA 4KPUA 3PC2A 5KQSA 3RIGA 2LV8A 4OQEA 3TLEA 3UT5B 2OXRA 3T3DA 1A7JA 4D42A 3TZHA 1TTHA 3JYPA 5FOWA 1COWA 1FFXA 3H04A 4OHKA 2W2XA 1DBSA 2LDBA 5AMXA 2QX8A 5H7XA 3W8RA 1XEWY 3HHPA 3TZLA 4K0RA 1DAFA 2G4CA 3NTRA 4Q47A 4ZI3A 4WECA 2EDCA 5KNDD 4PAOA 3AHGA 4HC4A 2PHZA 4JSYA 1WV1A 1A1VA 2JIRA 4ZQGA 2BEVA 1TEVA 3WQHA 2QPLA 4WCDA 1UWLA 3I0NA 2BR5A 2VT7A 1ZK4A 4HVTA 4AIIA 3W2IA 2YXLA 3EUFA 1TEZA 1NMZA 5AJTA 3UV7A 4X3PA 2W6ZA 2Q3DA 3RRXA 5AVVA 4AJOA 3BL6A 3I6MA 3NAQA 4B3HA 1SC1A 2IV7A 4NARA 4X6LA 1F3LA 3VPSA 1X1QA 3M6VA 4EUSA 1T13A 5KX5A 1JDTA 3FPSA 4ADSG 2N47A 2Z2IA 1Z5VA 5EVCA 2KBFA 3L5KA 5CVCA 5LDGA 1AA9A 3VYUB 3RNOA 1JHMA 4JGGA 2YH2A 3MWLA 5FLKA 3R76A 4DV1B 5ADHA 2O2GA 2HA0A 3DTNA 4ECEA 2WWIA 5AVOA 3DBHA 4P5PA 4WNYA 2AN5A 1BIFA 2QRKA 2W6OA 4WEQA 4IQ0A 5LXTF 1L5VA 2UXCB 4HYYA 2FAXA 3S28A 1FYXA 2QW8A 2Z5LA 4XB1A 3KYDA 3B9RA 1GPDG 3G8BA 4CMEC 4LQDA 3E6AA 3FR8A 2FZKA 4FOSA 2Y2UA 1YQTA 2VDLB 4JI3B 2P11A 1Z2CA 4EHAA 5K05A 521PA 5DCLA 5DCUA 1RLJA 4RZIA 4BDSA 2AT1A 4F0JA 3RHSA 4D7AA 3KB6A 3MTJA 4I6JA 5JJBA 3FJ1A 5B6JA 3T95A 4J07A 1YUMA 4Q9DA 4RKEA 2X0FA 2RHWA 1HT1E 1YTLA 3KJHA 1U0RA 1OI3A 1GZUA 1TRHA 1JQEA 4INAA 4NICA 4P3YA 1SBYA 4KX5A 3HUUA 2DPLA 5LJLA 3RC7A 3UOAB 3QVSA 1NC1A 1YDEA 4FYXA 2AD5A 3DWIA 3R3UA 3GYBA 3QVGA 2CBGA 4GLOA 4AL4A 3KQLA 1XP5A 1JR3E 1ULZA 2QN6A 5EHQA 4EPVA 3J81k 1UXJA 1D6MA 1W30A 3GRFA 2PJUA 2WW8A 2YV5A 3DXXA 4KDFA 4NP6A 4DJTA 1EDZA 2W42A 1ZN7A 2C2MA 2W2NA 3QQPA 3SKXA 4YV7A 1ATIA 3GLGE 3GLKA 4MJ7A 3VU8A 3DP7A 3JQEA 5EPEA 1DT5A 3VZPA 3SQNA 1ORIA 2GBIA 2VAXA 4D5GA 3M4XA 1T9BA 1TYDE 1WXFA 1VLMA 4LHXA 4MAFA 3SFTA 4JT8A 4KK4A 1QRAA 2IZOA 1NWHA 3KG2A 5DOVA 1E3WB 4HUQB 3I5AA 3WLAA 1NBMD 3TRJA 3CH7A 4MH0R 1M2OA 4N0DA 2H1FA 4I46A 3V3KA 1Z63A 4HGOA 4EGAA 3GEIA 4GOJA 5B1DA 3WLQA 5HQ3A 1NATA 1B1AA 4IG4A 2IYSA 3M1IA 1JKIA 4P8RA 4US2R 1OLUB 3QPBA 3QVJA 1ZJ6A 4C07A 3HCNA 1LVUA 2C3OA 5J4YA 1V8OA 2F67A 5TLSA 1DZIA 4Z51A 3IO5A 2CCKA 4NK4A 2N3ZA 5JS1A 2FPPA 4AYWA 3NEPX 4FU0A 3DMDA 4XARA 5FI3A 3TAUA 1MJHA 1RLIA 5HM6A 1W7AA 5SV2A 1E6KA 1UBKS 1E1KA 5IUNC 2JFPA 3TW8A 1E79D 3ZCXA 2C9OA 5GADl 3Q9SA 2WWFA 1ELOA 1EXWA 3CH5A 4IWYA 4KRYA 4EIWA 1H42A 3AI2A 1P2FA 4K9RA 4X63A 3I9JA 4CCSA 2BGIA 3LZCA 4I19A 4QRDA 1KTVA 1UOOA 2OVBA 3ASVA 3KUKA 3OFNA 3UVEA 4AJHA 3AVTA 5J1SB 3R7NA 4P5DA 4RK6A 4CM3A 2VATA 3GEHA 1Y4AE 1DB3A 3G0CA 3FF1A 3PWTA 5IK2A 3RTEA 1JILA 3WKCA 4DL9A 5EHXA 1P2UA 1WD7A 3DT9A 4LRUA 4NNOA 4DCTA 2EKQA 3I01M 4BNKA 2QZZA 1MABB 2DLDA 2J45A 2ZYTX 3PQEA 3ZXSA 2EZ9A 2CZCA 3A6DA 2ANBA 4QGFA 4B4DA 1RZRD 2H85A 2X0RA 4US0R 2FG7C 3O2NA 4ACBA 3VO2A 3ELUA 1YVUA 3QBVA 3BJEA 3PD0A 3WGOA 3IV7A 2W58A 4Z4FA 1GGEA 4ND4A 3P2OA 2IV3A 3UJ7A 1NW5A 2XZOA 3FROA 4AF6A 2FW0A 3HZZA 3TIVA 2OG1A 1P80A 4NBVA 4Z49A 5LZ2A 3FPJA 5BW8A 1A72A 4JA2A 4I2NA 3CLTC 5DRYA 2WSMA 1XFAA 4R8LA 1RAFA 2AV6A 1KYYA 2D2EA 2ODWA 1I01A 2R6ZA 2HN9A 4FGSA 3ROGA 4O25A 2B1JA 3YASA 4LFBB 1RWBA 4NV3A 2ZJZA 3AHHA 1SHTX 2H5EA 5FPSA 5H80A 5HP4A 1DXOA 1TVCA 4DCJA 3WB0A 3DOEA 2FA9A 3H65A 2XDWA 4QEZA 2XQJA 1J49A 1SM4A 5CFOA 3G7SA 2HV8A 1A5TA 3E7DA 1NVXQ 4RY2A 2G5CA 1OTXA 1G5IA 2HC9A 3ICQB 2Y92A 4JZYA 4ZC8A 5H70A 3TI7A 3HG7A 2JLUA 3I9V6 4MQ5A 5EIWA 5IT9A 1G2QA 3FCEA 3U80A 4EVIA 4MI6A 2QE6A 3R5SA 2H1IA 4IJWA 2PBZA 5FTMA 3GCXA 1LSSA 1XAIA 4B2PA 2B4YA 2ZRMA 4FDAA 3B7GA 1QK5A 4M60A 4OH1A 4A27A 1YVPA 4PPFA 2J1LA 3TJZA 2Y1KA 1O87A 4WOJA 2ZIXA 1S8NA 1YGPA 2XADA 4KO3S 3K09A 5C5IA 4JQOA 4O4JF 1ZGGA 4PR0A 1FXWF 1D5CA 1JTFA 5ITZA 5LMCA 2FF7A 1QO9A 4UEWA 3VMFA 3GLGA 3X3HA 4RZSA 3OBBA 5LNK6 2VSFA 1BVRA 2RARA 3DOUA 1QDEA 2FLVA 4BBAA 4ZZ1A 1W1UA 5ESWA 2EKZA 1EK1A 3FYUC 4TQ9A 3IP5A 3RRZA 2GEJA 4DLNA 1J8VA 4KAFA 3R3ZA 1FDUA 1SOAA 4KTVE 4PZ9A 5E3HA 4I9HA 3EQ8A 1LCIA 3PJDA 1ZJJA 3H8WA 3LOUA 3R1IA 2OP1A 2EW2A 4BMOB 2XMCA 1X1RA 2ZRFA 3FSJX 2VSXA 3AJDA 4FHDA 2O7VA 4Q0MA 2R1VA 4TV9A 4DJAA 1RMQA 1H2BA 4U7JA 4IJ5A 2Q5QA 4N9WA 4UEQA 3UY4A 1GG2A 4BECA 4NFYA 4OUDB 2EGGA 2CE7A 1EBFA 1JT2A 4PYKA 3T4PA 4DQXA 2RHCA 4QXQA 1GQSA 4IRXA 3QE0A 3NYRA 2JKVA 3VA7A 1VA4A 4E0BA 2R97A 1R00A 4QT0A 3GRYA 3QLUC 5JC8A 4BVGA 1GCOA 1IN6A 4KNWA 4UM9D 4G8BA 1T9AA 1X7ZB 4IKPA 4XGRA 4D9MA 4EGCB 1QRUA 5EE3A 3A2KA 3QTLA 5E6RA 3HVIA 1YBVA 1ZNZA 4XSVA 1GLGA 1JEJA 2HTEA 4LJ9A 3LD9A 2MOKA 4WJKB 3G2QA 1XKQA 3VOSA 3I2IA 1SKUA 5FHRA 4LYEA 1Z4JA 4OXYA 2V03A 3RS9A 2VP0A 4HNQA 1HWYA 5LXTA 4OY3A 1N6PA 3KR1A 5JPDA 1HETA 2XRFA 4OLHA 1B43A 2QYOA 1SKYB 5IBRA 2R4UA 4DXHA 2B3TA 4ENUA 4YRNA 2OM2A 1O3YA 3G02A 4U63A 1QWOA 3ZE2B 1JJ7A 2X4IA 2I99A 3EPKA 3OZ7A 2V3VA 3V5NA 4HN2A 4XLZA 5CPFA 5GOZA 4QELA 1M1YB 3IBSA 3VR6D 3HJRA 1P44A 4Z86A 1GQ2A 1SOVA 2O3RA 5DIFA 4KO1S 1PVVA 4TYWA 1EM6A 4NCHA 2WWTA 2X0JA 4HDAA 3GLFE 5A4JA 1VL2A 3R74A 3HR4A 4F5YA 4R41A 4ZVKA 1LLUA 1ZH4A 3AW8A 4TKMA 2DT5A 2R1TA 1VSVA 4WL0A 1P6UA 3LUKA 4DAEA 4ZGBA 4YB8A 2IJGX 4II7A 5HUHA 2F9FA 3ZDFA 4FP9A 3ZDDA 2NU9B 1ZSVA 4PG7A 4GICA 1TA4A 3OWHA 4PCVA 3SYLA 3ST7A 3OWXA 3W4IA 3GCGA 4BV8A 1HOXA 1LJ8A 3DB1A 4HAYA 3R6LA 1H85A 4IGKA 2Y0CA 3DVLA 3MCWA 1EP3B 1H1LB 1DCFA 1MW9X 1QSGA 4O2BF 4TSRA 5FTJA 4C0AC 4UQOA 1DWPA 2AMFA 4Q3DA 5E9JA 4QUDA 4DRXA 3KJFA 2G7ZA 4O4IF 1UEIA 3QEAZ 3PFNA 3UICA 3UTDA 3WZLA 4OHVA 1AQJA 4PINA 1O94D 2Q28A 1PCXA 5FNVF 2JJ1A 3LKVA 2NSYA 3HEMA 2Z1MA 4D9KA 1K8ZB 5CA0A 4F8JA 2DZDA 2C1XA 3ZCPA 4X8OA 5JMPA 1MVLA 5NLLA 1NBAA 5ALMA 1YCFA 2YC2C 1EINA 4JB0A 2G1AA 4LMBA 3E3LA 4YAEA 5GV8A 2WVHA 4RTPA 4FKMA 1MO4A 4FXPA 3ENKA 4DCNA 1RRCA 3KWFA 1EFRA 1Z33A 2XUAA 3MWJA 3O8RA 1N5RA 2YMPA 4F1KA 3COPA 5EJ8A 2ZTVA 2REOA 2WFMA 4W5JA 1E3TA 5CB4F 4JSTA 1KBQA 3E61A 2CNKA 1PE0A 2XCQA 4FYHA 3DR5A 3F4KA 3B8EA 3HA7A 3V55A 2R87A 1Z5PA 3FLBA 4YJGA 3UV3A 5F23A 1L4HA 3VZRA 4IOLA 1BA2A 1UXGA 2BISA 1QYXA 3IIMA 4P22A 1BHO1 1WP9A 3QYAA 4YJKA 1I2DA 1V6AA 4RMIA 4QT4A 1YE5A 3VNBA 3ESXA 4DY6A 2AR9A 1E64A 5JYEA 5CJ2A 4KHPB 2PXCA 3WLPA 5LP6F 4JUAA 5CA0B 2P77A 4EKYA 2QR5A 3CUUA 2DEUA 5DIZA 1XTBA 1O4VA 1KVSA 2QZPA 4FX2A 5D87A 2ZU6A 1PJRA 1EQAA 1V7PC 4WZBB 5C1BA 1YD7A 4REMA 3UWOA 5BVHB 2MINA 3U09A 1MT0A 1MJGA 1WQ3A 3I2YX 2R47A 2O54A 4DZTA 1XZPA 1ZICA 4J7AA 2A6PA 5DGXA 1OU0A 5I7FA 4QPZA 1SGWA 3WIVA 3OQ1A 1IAQA 4UM7A 3AW9A 2R1UA 1B93A 2DU8A 5CCDA 4M1MA 4OI0A 5KQGA 5IASA 3NHSA 2WQ6A 1ZX1A 2Q7XA 3O38A 3OHMA 4CLEA 5FFMA 3QNUA 1Z4MA 3TGWA 4AQ7A 4GL2A 4PGAA 1C2YA 1NW3A 2V7EA 4FFSA 4PCUA 4RYDA 4I1IA 4TS1A 4Y6QA 1G55A 1N2CA 3HS3A 2XA2A 4XVUA 3OE7D 4MB2A 4WBXC 1TF7A 3H6KA 2BR3A 1GRRA 3NDJA 4LXYA 4DLXA 3PDIB 1N92A 4P4UA 1J1UA 4Q1FA 4XCQA 3F0TA 3F49S 1YXMA 3VO9A 1XKLA 1Q19A 2A1TR 3ORRA 1YK1A 2JFQA 2EW8A 2ZB2A 1XZMA 3L79A 3RBZA 2ZAYA 3GQBB 3WKAA 5F12A 2CJFA 1R6AA 3ZQ4A 3X2EA 1JQKA 5AKHA 5BNWA 4DLAA 4EPRA 5CYGA 2X2FA 2HA4A 3B53X 4GPBA 4KVFA 2XE8A 1CDOA 4BP3A 5LYJF 3R4CA 3UWDA 3KKOA 5AHOA 3SDBA 4EY3A 2I0FA 4ZYLA 1HYHA 3IRVA 5IUKC 5KOJA 3Q15C 4H7HA 2ZTUA 5DP1A 1NOJA 2DOKA 5ITWA 5EHIA 4ZI2A 1PKXA 3BCSA 3K5WA 1ZXXA 2DTEA 4MUHA 8ADHA 1Y5LA 3BXPA 2OG2A 4KBYA 1HDXA 5E1DA 1PWYE 3EZGA 5K8IA 2JEZA 4ALMA 4KEAA 1Z39A 2OPBA 1TQ2A 3HCWA 1RAAA 4QDOA 1AKMA 1J2TA 2JGLA 3BDAA 4YRQA 3W8FA 1NM5A 2NSDA 4DSTA 4MQLA 2O2CA 3GWGA 1GGJA 2X0IA 3EH1A 2H4JA 3KVNA 1QP8A 3Q3EA 4XDGA 4Z9YA 4EZBA 1YTUA 3ZW9A 2G08A 5KAMA 3C70A 1DIRA 3WAKA 3FPLA 4ARZA 1FQWA 1QS0B 3PGA1 4MKHA 4B4UA 4I5EA 5DCYA 1QFXA 1Y48E 4P2GA 4N18A 1Q0HA 1NUSA 2PBFA 4NAUA 4BLTA 1EZ4A 4GE3A 5ERXA 4G9BA 3FOFC 4G0OA 1NZDA 2R6DA 5AKLA 3VPFA 1ISGA 2WYWA 5IYZA 1F06A 3EBPA 1IQRA 3PEWA 3ILHA 1TRKA 4CPDA 1JH9A 3Q1LA 4GM0A 1FA9A 3KOWA 4NENB 4AUMA 3U26A 3ECAA 2YQ4A 1MC8A 4M0DA 4RVUA 2ZI4A 3Q8KA 2D4AA 1XD8A 2QSJA 2BKEA 3KQVA 1TUBB 2IDZA 3VH1A 2P9GA 2ZRPA 3TLKA 2JJYA 1WJGA 2QU7A 1NQOA 1ISRA 2JFBA 3D31A 4M37A 2LUOA 4GF5A 1VXRA 4P5EA 3STXA 3ZE7A 3ZLTA 4MO2A 4CQMB 2ZIAA 3PNKA 4DUYB 4J0KA 5HOQA 5GY7A 1D9ZA 3U0BA 1BOOA 2XSZA 2C07A 4FW8A 1U9YA 3IQEA 3EVTA 3CW9A 3RVBA 1RM4A 4H1TA 1MAHA 4I8IA 2P9BA 3BTVA 3TB4A 2R8XA 2P9CA 4HYEA 3K9NA 1JJVA 1E4OA 2ZJ6A 2CMGA 1NBMA 2OB2A 3D6JA 4MS1B 3H1BA 2LIVA 5LWHA 1N8TA 1YCGA 4GUDA 4Z6KA 4M0UA 1E5XA 4DMUB 3F46A 5DBIA 3HB5X 1I5RA 2DR0A 2QRQA 3LT5A 1J8FA 1JG6A 2VC2B 4ND2A 4EFLA 3C3XA 3NAZA 3G0OA 1XEXA 2WHRA 3ABQB 1DBPA 2OC9A 3KZKA 3WNCA 4DQUA 1BMFD 3O8NA 1K63A 1NVWQ 1PLKA 2BEUB 4FLEA 3OECA 2VDPB 4Q4AA 3VZDA 1MB3A 3ZY2A 1QYDA 5CRIA 3UK1A 2QN1A 2BMJA 5A05A 1LJUA 2ARKA 5BPHA 2VK4A 4KPEC 3F1KA 4MHTA 1CD5A 2CHVA 3QPAA 1SIUA 1HYBA 1QZUA 2EBHX 1XRMA 4GX1A 2Q8QA 4UBKA 2PKEA 1P8AA 2BBWA 3WYCA 5FWXA 5CG1A 5AW0A 1WUYA 2Z9CA 3AGQA 1L4YA 4F45A 1F6BA 1H6BA 5H3CA 3RWMB 3NTXA 3OUUA 3HB7A 1A7KA 3A4IA 4AX8A 4AP9A 1TVEA 2J3MA 1XFDA 1XL0A 3L18A 1CV2A 1HYEA 1ADGA 2H2DA 4BQFA 2GK4A 1BQEA 1JIIA 3GJ5A 3QPUA 4HZUB 3ZVMA 1EFTA 1WY5A 2HRCA 2F8MA 2VYCA 3OJFA 5LIPA 1FTWA 2CVOA 2DHQA 2CHEA 2OBBA 2OHJA 3CO5A 1OPRA 2PVPA 1F1BA 1U1DA 1U8FO 8GPBA 1E7SA 2B7CA 2XUQA 2JVIA 2QLBA 1PW7A 2PUAA 2RAFA 2NT3A 1Y7LA 4B5KA 2Y1DA 1PL6A 5DDIP 1DLJA 1EGAA 2BFDA 1MXHA 2OECA 3GOQA 4OP3A 5H5JA 3TE6A 4CM9D 2HADA 1P0QA 1RWWA 4A8JA 4BRUA 2CVQA 2DULA 5D3MA 5CDTA 4KITB 1KZ6A 5BSGA 2B30A 4HS4A 3CZ4A 3A2NA 3ETEA 2WYOA 3Q7EA 2ZR7A 3BTOA 1DUIA 3JQFA 4QUGA 3LBNA 1KYVA 3KEQA 2WI8A 3I42A 3N8DA 1IWBB 4I55F 1YR3A 3F6BX 4KXWA 3KQHA 3UPUA 3WBFA 1RDFA 5AI5A 3M70A 5AXBA 1C1DB 2MYUA 1R3UA 1IYZA 2JVJA 3AYXB 1DEXA 4RIFA 3EW7A 1IHXA 2FSVA 2SICE 1Y7HA 2RHTA 3CRMA 3GD5A 3UAXA 1JPNA 3DOFA 3VC2A 4A1FA 1H8ED 3KQNA 2JIZA 2YIJA 4KW7A 1OC2A 4LHWA 3T12A 2ZZNA 4ISCA 2BT4A 3REOA 3KKNA 1EUZA 2JIZD 1KAEA 3ES9A 3N2LA 2CXSA 4YCAA 2ZULA 4OJKA 3SU8A 2ZS7A 1E2NA 3VXKA 2K2WA 3DLHA 5K0BA 3VNAA 3LVBA 1JR2A 3W78A 1EZZA 1G19A 3KQQA 4L3OA 1R2QA 5A1JA 3DCIA 5BMOA 3OE4A 5HTOA 1DIAA 2DR3A 5JRZA 2EQBA 1IXRC 3I6ZA 5K3DA 5BV1A 3LU1A 1DBQA 1WEHA 2D4HA 3N5KA 1QNLA 2A67A 4V0ME 1R8JA 4B8WA 3WYEA 3H2YA 1XTIA 2X8JA 4FE7A 4OQLA 3DZHA 1A95A 2N1BA 1ZR2A 2QYHA 2DRIA 3GLGB 1K6EA 1HFJA 4E7PA 3H5NA 1YJCA 5P8WA 2IW3A 1E2HA 4RJIA 4AN1A 3NH6A 4E46A 1KJ8A 2Q2OA 1OZAA 4F93B 1R0XA 1XVTA 3GMIA 3AV0B 3QFCA 4YQYA 2DX7A 4Z1OA 2RD2A 3CVWA 1PSDA 1KO7A 2E3JA 5F3DA 2VAPA 4AZ3B 1KRXA 4S2EA 4TVBA 3RK4A 4JC8A 5I3ZA 1ZS9A 1KYIA 1IATA 2E49A 4LDNA 1BEUB 1T2DA 3OOWA 1WD5A 3R5JA 1SHUX 1XRNA 4KO8A 3M4YA 3UJ6A 4CR6A 1J2UA 3QVGB 4HAVA 3ASYA 4U7PB 5TNXA 4K6KA 4RK7A 2HA7A 4M1QA 5HCNA 3RROA 4YMUA 4TKUA 5C18A 4K9LA 1VDMA 1J09A 5JZVA 3L7DA 4IIBA 4R0VA 2JIBA 4DV3B 1GJRA 1X80B 3HBLA 5TS2A 3DHEA 1AQYA 2E5WA 3INGA 3H2KA 8ATCA 3M1YA 4RORA 1TEXA 1GNQA 4K9QA 1M0EA 1MV8A 4U2CA 1YI1A 3VTKA 1CQZA 2COUA 4NL4H 3THYA 4GBGA 1UBOS 1NMQA 3KXIA 1FJGB 3VSDA 1Y1PA 4MV3A 3PL5A 4TKLA 3T3IA 3WYDA 4TWRA 1Y5RA 1XJ0A 1YUNA 4WZAA 2O8BB 5AOVA 3BCHA 5DLYA 3F71A 1U28A 1WKBA 3F7OA 3WQQA 1JI3A 1C50A 1OI2A 3IDFA 1PQPA 5K8JB 2O1SA 2ZTSA 3VPAA 2QN9A 3EHEA 1WV0A 1PJTA 4GKAA 3RUAA 2G0TA 4DMCA 2ODPA 3MMZA 2BKVA 4KQ6A 4HMOA 3VKGA 1LQUA 4TKVB 2FU5C 2X1HA 3FNFA 1Y89A 4PV7A 4ESVA 4ILKA 2J6CA 2DVMA 1JEQA 5AOAA 5KOIA 2FW8A 4DSZA 1U4SA 4BQNA 2CWWA 1EWRA 3NDPA 3LL4A 3O4JA 1NUQA 3BHJA 1UK7A 1X7ZA 2FX3A 2R7MA 3BOSA 4MMXB 1FQKA 2O2HA 4PS0A 4ZQIA 5KYTA 3OESA 4EA6A 1UAAA 4BO6A 1H22A 5HZHA 2FCRA 4DARA 1M2HA 2F62A 3LT4A 5GIOE 4ZFNA 2ATVA 1O95A 1YGYA 3KYCA 4LC9A 4D0NA 4D4IA 4BKUA 2BKUA 4F5DA 2Q0HA 5AVYA 4EY8A 1OWOA 2QUKA 2XOXA 4EKNB 4DA4A 2WVJA 1Z2PX 1Q0RA 1J24A 1HDEA 1Y9ZA 2ZAOA 3JQ8A 3L7BA 3VKFA 4OB8A 1UJMA 3HVKA 3HSSA 4MQEA 3MQ2A 5EJIA 4BYGA 4G37A 5KWJA 3KAQA 3M6FA 2WIDA 3AY6A 3CM0A 3DE0X 4Y7CA 2E1RA 5CFQA 1EU1A 1PNOA 7MHTA 4ACAA 2ZANA 2VDKB 3T6KA 2I3DA 5BNFA 1YS1X 3EFHA 4PZYA 4WVLA 1X7XB 3ESAA 4IIDA 2W6QA 5CBPB 1OFTA 1GGNA 4N1AA 3PNQA 4LXIA 4C7XA 3CN7A 4KRFA 4KR7A 2CYBA 1ZK1A 2PX5A 4HEQA 4KSYA 1RKQA 3I52A 1NUHA 4H7FA 4NYMQ 5AJVB 5AW4A 3IT0A 2EG5A 1Y7IA 4WN9B 1J2YA 3NJ8A 3LX4A 1S4MA 4BO4A 4TZ6A 1H8HD 2B34A 3AGPA 1AG9A 4BB5A 2PEYA 3WNBA 1KK1A 2XNKA 1OBCA 3CISA 3VH2A 1IIRA 2XAAA 3ZJTA 2QM8A 2QAGC 5A7GA 3WZ2A 2NSJA 1NN1A 2C8VA 3AP2A 2Y6VA 5JFTA 3JARA 3DBVO 1XXHB 2ZGVA 5I9BA 1JIXA 4UBOA 4D99A 5ICGA 3HGQA 1NKSA 2I7XA 3MWKA 4LZOA 5U4QA 5AOBA 3VFDA 3LGXA 5FFFA 2OO3A 2V6IA 2VAMA 4HQNA 4KBFA 3C6KA 2X77A 3FIUA 3QKWA 3OPYB 1JLSA 1LRLA 2JAPA 2YBDA 4KG7A 5FOXA 2AX3A 5TMBA 3V32A 1NQ5A 3WI7A 3ZNNA 5CCBA 3QJ5A 1A2BA 1DX4A 1U4OA 2DM6A 2QD1A 2Z3VA 4IZHA 3TSZA 4BGIA 4DUGD 4RL4A 5FA5A 2CL0X 2X0KA 1KHHA 1U9IA 1QJCA 3NEAA 3PHHA 4YH1A 4QYXA 4Y2RA 2AVNA 3MIZA 4KYIB 4CQMA 4FSDA 2FSGA 1UMCA 1BS9A 2AEJA 3X2SA 4XFJA 3QUAA 3QOXA 1X1DA 2X3YA 3PUKA 4G9GA 2XB6A 4WERA 3CXRA 3L8ZA 1UBGA 3FPGA 3TL2A 3IEXA 2XB8A 3DL7A 1VRCA 1O6FA 5BQXA 4QKQA 3B48A 1DJMA 1HQYE 2DUUA 2VP3A 2WF9A 3MTAA 4PC1A 4D0LB 1CY6A 4S2UA 4YCBA 1J06A 2OUIA 1UPXA 3FLMA 2BGTA 3ZDRA 2MDTA 2H8KA 5E1MA 3MEQA 2LZ0A 4BNNA 1ZNXA 1SXJC 1DAGA 3ZNQA 4DQDA 1ONNA 1XZHA 4K9PA 1TZCA 2IDMA 3CSUA 3FCAA 2XSZD 2VNJA 1RP1A 3HYNA 3PUYA 4I4TB 4V1CA 2KB0A 1E92A 2EWMA 4HHEA 4NU8X 3CZRA 1MU0A 5KNDH 1JAYA 4WAUA 1GNRA 3ABSB 1ZQ1A 5K0LA 1U2GA 4DWOA 1T3SA 4C4XA 5JHHB 4QOJA 3H4IA 3R7FA 3UTCA 3P9PA 2C5AA 1DRKA 3HA5A 4AN4A 1EWYA 1BMTA 4G5XA 4ZOQI 2R8RA 2XUKA 3OZSA 1IY9A 4N4AA 1R6TA 4NONA 2OV1A 2VHTA 3FCOA 4FDVA 3ZWOA 4EY6A 1ACLA 2O8FB 1VPVA 1HE5A 1K88A 5KTTA 1UZAA 1UJ4A 3UBTA 3GRZA 2ZI7A 3COYA 3DOHA 4J1QA 4FGLA 4UXIA 3H2HA 3V8VA 1LZKA 1U2EA 1XTPA 3SDSA 4EARA 3ROPA 2B4TO 1TYZA 3EGDA 4G0WA 1UJ2A 3VR2D 4EL5A 4QG3A 4Q4HB 3A9WA 4HI0E 2G9QA 2D8AA 5KBYA 1PO7A 1QONA 1JU3A 2HHAA 2PUJA 4I1VA 4LZJA 3UK6A 1TC1A 3D4NA 4IVRA 3HBJA 2IU6A 4MDHA 2IX3A 1IN4A 2QHXA 3DULA 2ZJ7A 1XT6A 2IHYA 4JEHA 2FWIA 3PTLA 1DBIA 1NJ8A 4JUIA 5CX4A 4B6FA 3DC2A 4K9OA 4EO9A 4TXMA 2HI0A 1LPBB 1L8AA 1X7YB 1Y98A 2H1WA 4MQ4A 4MQFA 3RT1A 4AECA 1KI4A 1GA1A 1LX7A 2WF7A 4TWAA 4D8TA 1ONBA 4NMHA 3H99A 4CLDA 1CTQA 2P5YA 1H2AS 2GZMA 4UJ3A 3NDRA 4MDYA 1KP9A 2J4DA 2Q3FA 2Y1GA 5B37A 4BTVA 1CQPA 1KU0A 3RADC 4MI1A 3I6BA 1F6DA 2FQQA 2P8JA 3H9BA 3GJXC 1BDHA 4TV8A 4DABA 4BUZA 2XNJA 3WSTA 5HILA 3EIWA 1QVAA 5I51A 2YJ4A 3AUKA 3V00A 2IUTA 1DFGA 1RHRA 2JFZA 3OZUA 2QDXA 3PE3A 4FDMA 1J70A 1LI7A 2ZKIA 1TCUA 1PQUA 3RS5A 5TS3A 3MQFA 4DCPA 5B4UA 2H17A 1YMUA 2ID8A 2VSQA 4Q7LA 3TX6A 2XE7A 3FCYA 3JQ7A 4FGUA 4JWTA 4WNCA 1US8B 1QBKC 2ZSJA 5G0SA 3TDKA 4JB8A 4X41A 2YOHA 2H4YA 4FK8A 1VMIA 1C1XB 3N76A 1N7IA 2IPNA 3HKBB 5CAEA 1RCUA 2AOWA 4RSRA 5JCJA 4YYEA 4AK9A 4R8VA 5EJAA 4GQIA 3KQKA 1QP0A 1NUUA 2DLNA 2PUGA 1HEYA 4UNIA 3AX6A 1NAIA 1SHJA 5CT6A 3LC0A 3UYLA 2PLWA 2OA0A 1FPMA 3TCXB 3C1TA 3GUZA 2WKWA 5B6IA 5IXJA 1EHYA 4HN9A 5EXTA 3ZY3A 1PFYA 2BHNA 3AESA 2P65A 4DJDC 2IHKA 3HSYA 4R31A 5CB4A 5AWFC 1LRJA 1KO4A 3WFIA 2C2OA 5JRJA 1Q0LA 2YUTA 4WIAA 2ZRQA 4XR9A 5L3SA 3VOTA 3AR7A 2BM9A 2G70A 3K0AB 5M2QA 4RHUA 4XVHA 1YMQA 2ISCA 2ETVA 2HIGA 4QXMA 5DTJA 3L3BA 5FEMA 1FOEB 2IGTA 4Z4CA 5JATA 4KDRA 2B2CA 3I6IA 3C3KA 3HUEA 3RUCA 3T52A 4W6ZA 1P0MA 4YUXA 1W4AA 3HCBA 1E7MA 2QXYA 4Q9LA 3K9FC 2WIFA 2C5EA 1DJQA 4HOYA 1ISJA 1XRLA 3SGLA 3IO3A 4J0CA 2R8BA 3ZLUA 5CJPA 2XA9A 4FB4A 3U44A 3SJUA 1R5NA 1XZNA 1Z75A 3FPBA 1QMPA 2J32A 3EVDA 4AWXA 5AUOB 1DTWA 3KX2A 3M3DA 3VC7A 4YHHB 4MS4A 1YHNA 3AFGA 1AO3A 2M6KA 3ENQA 2WKRA 2Z2ZA 2G4VA 3R41A 1P2BA 3QBTA 4QJIA 4CKZA 1FRNA 5A02A 1WNFA 4G1BA 4CTKA 1HNNA 5JECA 3AETB 3SX0A 3WRXC 3RC8A 3JR7A 5FHQA 2ATCA 2HZBA 4HTFA 1XZFA 2MSDB 5JJ5A 1KJWA 1OV6A 2CNOA 2CL7X 4UE3S 5ALOA 1S4QA 1T34A 2ZXEA 2DYKA 1OXVA 4FYJA 1A5ZA 1CHDA 3AUJB 2EOAA 1FQOA 2PX8A 3OU2A 7ABPA 1I80A 2H48A 2VQDA 4FX5A 1NZJA 2GTHA 4ER0A 4FFOA 2ODBA 3TKYA 4EJSB 2CXXA 3PYLA 4JENA 3ZWMA 1T2CA 3CV3A 3RVDA 3IMGA 3UAWA 2CLHB 4F6LA 4EX6A 3CBQA 3HYSA 1E58A 1Y6RA 3VU9A 3WIOA 2OHVA 1R4AA 1ZCZA 3BS4A 5L4LA 4Z4QA 3HBFA 5L9AA 4CEJA 5ERGB 4RH1A 1QDUA 4U5XA 4BVFA 4CI0B 2G8NA 2BEWB 1ZZEA 1I33A 3KVYA 1ULSA 1TFRA 4NJEB 5CTAA 4YT5A 4OM8A 1TJNA 1UM9B 2PGLA 1JPJA 3RWOA 3TJMA 3ZK7A 5AO9A 5CDFA 2Z83A 1QVVA 2HPAA 2AZTA 2YMQA 3RTAA 3RU7A 5C8DA 1TQDA 1TUBA 4P53A 4BFVA 1E3QA 4TM7A 2B1QA 1A7UA 4EG8A 1Z4NA 1EBUA 5HPYB 5HXAA 1VL6A 2I2AA 4KSBA 2CLMB 2HKIA 3H0CA 1I6MA 4S05A 1M5UA 4TUYF 3LDUA 1N3IA 4OXKA 4LDPA 2REXB 3H9EO 4IHJF 1EFVA 3UB4A 2GGSA 4B0OA 1CVIA 3MCZA 3AR4A 5JT1A 1SOMA 4UOZA 3AF6A 2BSXA 1UXIA 2X8WA 4GZ5A 4P7FA 5G40A 1H5QA 2ZG6A 4GQBA 4HVCA 1ZI8A 4WK4B 1OB5A 3FFWA 4D82A 3E48A 3X0DA 4EK9A 5GJBA 1WXWA 2FRDC 4YN3A 5BNIA 1XRRA 3U3JA 5MGBA 2XMRA 2VDRB 4BCBA 5C7IO 3UBMA 3K6JA 4WZBE 3EUAA 3ISTA 4HWGA 3ZXUB 4LOLA 2QRUA 4ML3A 2R8PA 2ZUBA 1RKBA 2GCOB 4HG2A 1CQJA 2UUPA 3TCKA 3X1MA 2DLCX 4XJVA 2V7QA 3P8ZA 4Q37A 3QEOA 3OX1A 2BYTA 4FNGA 7MDHA 1UFQA 1H9AA 2AZMA 1O1YA 2P40A 1ESEA 2VKQA 1XN4A 3ZPXA 1EK2A 3AKCA 5AP9A 4AKTA 3JAWB 4PG4A 2PSEA 2VRNA 4JQCA 5T57A 4CMJA 5JAHA 3O8CA 3LYLA 1PAUA 2GJKA 2YW9A 3OJLA 4DC0A 2GN6A 5KWVA 3DPSA 1SUEA 4MWGA 1X8XA 2QL5A 1S2GA 2YY5A 3PXDA 4CODB 3U19A 5KNLA 4C7OA 1VSTA 4JL6A 3HKBA 5EZ6B 1QIEA 3ULKA 1C7RA 1OIVA 1R9JA 3KS9A 3GQBA 4RD4A 1JR3D 1WOMA 2DKNA 2NGRA 3LX5A 4O3MA 4CKCB 2WJPA 1PR6A 3EFEA 3O7MA 2VP9A 2QW0X 3S2GA 4E22A 1QFJA 4ROTA 3CLKA 3N2NA 2IOFA 1WLSA 1SVOA 2VTVA 3IIIA 3NETA 4QWWA 1UC4B 3GZJA 4ASUD 3CRRA 1QX4A 4RH0A 4E07A 5LQMA 3LPMA 2ZIUB 4BS9A 5CIWA 4LVUA 2FSPA 4Q82A 1YZTA 4YIHA 1T36B 1WZIA 2LIPA 3WRWA 4UTNA 4GRAA 3NC4A 1NR5A 3VRHA 4IS3A 3NHAA 1CIVA 3KQWA 5LQSA 1IONA 2CHUA 1OYOA 1FDRA 3GNSA 3P0HA 5J5AA 2WIJA 4FPXA 1P9RA 4MS3B 4R2IA 4OBBA 4REQA 1R74A 5KNDA 2J08A 1NMEA 3SR3A 3SYTA 1HUQA 4OGWA 4D8VA 1AD2A 2B1GA 1PUIA 2OP0A 4QGHA 5LWQA 2NO5A 4HX5A 1D03A 3LVQE 1SB9A 1KO5A 2O57A 2GN4A 3B1VA 4NOJA 4RJKA 1RWMA 1S3GA 4WT7A 3C5VA 3WLIA 1DRVA 1GZHB 2BBOA 5HJEA 4D0SA 5LLDA 5I9NA 3D2LA 3P9QA 1X9HA 3JQAA 5BSVA 1K5HA 4HNTA 1OWPA 3RRJA 4HH0A 3B7WA 1R0YA 4FNOA 2PX0A 3LRPA 1IU9A 2HQ1A 3WV5A 2NZVG 5JWRA 2FLWA 2QG9A 2JLZA 1L8XA 3HLYA 4KZKA 3GUHA 2I8CA 1ZXBA 1A82A 2PH5A 3BMCA 4FFWA 3JASA 4AKSA 3ZCTA 4UTRA 1SU8A 1RJGA 3MGKA 2A5JA 4UNNA 3SKYA 1SWVA 2AEMA 2LCIA 2H52A 1NKTA 3MB8A 1T36A 4C7MA 2TMYA 3PU6A 3NP9A 1FCJA 1WCV1 4ZTBA 2WVAA 4FWIB 4ZPJA 2V6BA 3NPAA 2PZEA 3K0KA 5HA5A 4KU4A 4BLQA 4CUJA 3SX2A 4U1RA 4DM3A 4BFXA 3CIFA 3E7PA 3JAKB 4XDZA 2I5PO 1PZHA 3BC1A 4WNAA 1M8FA 4QOHA 4DBZA 3WQBA 4WUTA 3TZEA 1RMYA 1P77A 3DLAA 3KLNA 2C2YA 2JF0A 4HO1X 4WCFB 1QWSA 3E1SA 3A6EA 5K6AC 4EF5A 2OD9A 1NBIA 2OAP1 3O1JC 2PR2A 4M7RA 4TGLA 1MX3A 3LZDA 3MJRA 3LBYA 4IM7A 4LXUA 3VVLA 1M2VB 3FTPA 2BGNA 3E9RA 4RKYA 4LEIA 3AHEA 1T2NA 5I45A 1V8BA 3FN4A 2CXRA 3C5WP 1V8PA 3WHKA 4DJFC 2R9VA 1AKTA 1ONOA 1YJ5A 3N87A 3IPAA 5C32A 3PI7A 3SMQA 4ED9A 5DTEA 2SNIE 4XDYA 1ZGJA 2ZWOA 4QQNA 3S55A 5KSYA 2HU5A 4RXMA 5I7AA 5IBPA 5AKJA 5DGIA 2ZVPX 3QF7A 4K8OA 1ZRSA 4RQAA 3JXEA 4D9JA 4X62B 5A03A 4B33A 1IEQA 4IDQA 2B25A 3LC7O 4HUTA 1GG5A 3W3AA 1AK9A 4I6GA 5K2MA 2G5TA 3QWAA 2NZJA 1EWKA 1M9NA 3T7IA 4CG0A 4ARUA 1TJ5A 2RAVA 5EIAA 2R4TA 3PQ5A 2UKDA 4A6XA 4L8VA 3JRWA 1P5JA 1LK0A 1V95A 2HXGA 2J07A 1WUKS 2HNAA 1A5BB 2NSLA 1XZCA 3N2IA 4QFCA 4BQSA 5A6SB 3RG2A 2YFKA 2HRDA 2Q5FA 3AXSA 1XA0A 3MT9A 2B2XA 5LU9A 5JD6A 4IZOA 3VR0A 1JSZA 2AXQA 4PIPA 4GXNA 1ZK0A 2BN4A 3PJFA 5DB4A 4L6AA 2YCLA 5IEBA 3TW6A 3NDBB 3HCOA 3C87A 2WYHA 2EJBA 4C7JA 5AJZA 2A14A 4OMFG 3WTBA 1KDZA 3VVBA 1Q16A 5GOTA 1GQOA 3SJ7A 4F5WA 1P91A 2QTVA 1HLDA 4RJTA 4KV7A 3AR3A 5KVQA 5HDQA