2PBFA

Crystal structure of a putative protein-l-isoaspartate o-methyltransferase beta-aspartate methyltransferase (pcmt) from plasmodium falciparum in complex with s-adenosyl-l-homocysteine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
218
Chain Sequence
b'ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGIIKDRLFDVCFVSLKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate O-methyltransferase beta-aspartate me
publication title Crystal structure of a putative protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase (PCMT) from Plasmodium falciparum in complex with S-adenosyl-L-homocysteine
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 73
structure length 218
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pbfA00
2PX5A 4E2WA 5EZQA 2K4MA 5ICGA 2OZVA 1R00A 3A7DA 4GUAA 3SGLA 2PX4A 3UFBA 3HEMA 2P7IA 4QPNA 5FULA 1N2XA 3A27A 2PT9A 3DH0A 3KQSA 1VLMA 3GNLA 4HSGA 3SXJA 5CIYA 3MAGA 2R6ZA 5HZMA 3D2LA 2AOXA 1R74A 1G55A 3G8AA 3MERA 3NJRA 3UJ6A 3MTIA 3RIEA 1QZZA 1D2CA 3GIWA 2LD4A 1JQ3A 3ELWA 3E7PA 5P8WA 1QYRA 3DMFA 5DTMA 3C6MA 3RW9A 1EIZA 1KP9A 1ZGJA 5K05A 1Q0SA 3JWJA 5K0LA 4BLUA 2ZCJA 4JXJA 3SM3A 2ONYA 4X1OA 1UIRA 3OU7A 5EEGA 2B2CA 3SR4A 5DSTA 1YFLA 1O9GA 4F85A 4PYKA 3BGIA 3M6UA 3LX6A 1QANA 2P3OA 3G89A 1NBIA 3O7WA 5LQKA 3UA3A 4FT4A 1NW8A 3TFWA 4KW7A 3SSOA 4DM3A 2XBMA 3GXOA 3K0BA 3TKAA 5U4XA 2OO3A 1G60A 1DL5A 3DOUA 4O29A 4HG2A 4P58A 5DTRA 3TM4A 4CWAA 3G2PA 3G2OA 3LDFA 2OYRA 1BHJA 5DLYA 2UZ4A 5EGSA 3A7EA 3LCUA 2VDUE 3CVOA 3MTEA 2CMGA 1YZ3A 3EEYA 1BKYA 3R0QA 5F2NA 2AOUA 2PXXA 3FYCA 4LECA 4EMSA 4H0NA 1RJGA 1ORHA 2P3LA 3ELUA 3C6KA 2VP3A 5DWQA 4RTLA 1FJXA 2NXJA 4GC9A 1KXZA 2IBSA 4BLVA 1KYZA 5EMJA 4PYJA 2JHAA 1KHHA 3GRVA 2YX1A 3HCCA 3M70A 3AY0A 5D1HA 1V39A 5EEHA 5T6BA 5JUWA 5K0BA 1WY7A 4CXMA 2PKWA 3LDUA 3O31A 9MHTA 5CVEA 4KIGA 2DPMA 3FPEA 3AJDA 4MTLA 4E31A 1IXKA 2HR1A 2QRVB 1SKMA 4KWCA 4HGYA 1KPGA 3R3HA 5CVVA 1EG2A 2FHPA 4PYLA 2GPYA 5ERGB 2P40A 3BGDA 4M36A 4DCGA 4G56A 5EG5A 2YVLA 1KR5A 3DXZA 3EVZA 2QM3A 4GOMD 2UYCA 4DCMA 3BZBA 5IH3A 4MHTA 4P7JA 2CWWA 2PGXA 1VE3A 3THSA 3CGGA 4UOEA 4AZTA 2IGTA 3R24A 4PGHA 3I58A 3DLCA 4RTKA 2Z6QA 4PYOA 4DA4A 3SSNA 1RJFA 1M6YA 1AQJA 5HOQA 2EG5A 3LCCA 5EHIA 2AR0A 5T64A 3E05A 5EZSA 5EKUA 5EMLA 4ER3A 2HV9A 4PWYA 1FP2A 2YXEA 3FUVA 1XJ5A 3TMAA 2PLWA 5DTQA 5B1SA 2C7RA 1Y8CA 1F38A 2PY6A 3GU3A 5FHQA 3GGDA 1RI3A 4CTKA 2E5WA 1VP9A 4HC4A 4PCLA 3VC1A 5DM4A 4OQDA 3E23A 2F8LA 1UWVA 3GRUA 3DXXA 1P1CA 1RJDA 3FTDA 3BUSA 4PYQA 4R6XA 4BY9E 5EVJA 2ADMA 5FA8A 3UJ7A 1G8SA 4QQKA 5DRYA 3ID6C 3K6RA 4RX1A 1PRYA 3HP7A 3H2BA 1QAOA 3UBTA 2AS0A 4KIFA 5E1OA 1I9GA 3ELDA 1YZHA 5G02A 5K0FA 3HCBA 3DLIA 5F2OA 2ZBPA 2AOUB 2PBFA 3OU2A 3BWMA 4RVFA 2OB2A 4F86A 5BW4A 3ER9A 2IH5A 2WK1A 1XCJA 2BM9A 1UFKA 2O05A 2QRVA 3B89A 1RI5A 3EVCA 3DR5A 4YV0A 1EQAA 2OPBA 3EVEA 1FP1D 4DMGA 1DCTA 2ZVJA 3RODA 2Z6AA 5HIJA 5DXJA 5K01A 1L1EA 1N7IA 1JG4A 3BWYA 4RWZA 10MHA 2H1RA 3M6VA 3I5UA 1X1CA 5F2KA 3TLJA 4POOA 3FPHA 3HCAA 4P7KA 3DUWA 5E1MA 3EGEA 3KQTA 3TPZA 1ZKDA 1Z3CA 3FTFA 3NTVA 2PT6A 3CJQA 5FADA 5K0CA 4GOND 5K03A 3NVKI 2OKCA 1EJ6A 3P2IA 4A6EA 1NW7A 3EVFA 5HILA 4KVZA 2PX8A 2FCAA 1NW6A 1XDZA 2BR3A 2PJDA 3P9CA 5T67A 4Z2YA 1X19A 3G2QA 5CVDA 3GDHA 3LBYA 5HFJA 4DF3A 3I64A 4R6WA 4RTJA 2G70A 2YXLA 3FPJA 3BWCA 3M6XA 4OA8A 3GWZA 2EX4A 3SVZA 4E32A 3EVAA 5E9QA 2ORED 1VL5A 3P2KA 5E8JA 2XVMA 2EJUA 2ZIEA 4GEKA 2C7QA 5EC8A 1KPHA 3DMGA 4IV8A 1L3BA 1VBFA 3BGVA 4PONA 3TM5A 3UJCA 3A26A 3GRRA 1JSXA 5LQAA 3P9IA 5E2BA 4LWPA 2B25A 4GC5A 1JTFA 4X61A 2YQZA 1ZGAA 1RI4A 2BZGA 1ORIA 2CL5A 3C0KA 1JG3A 1G8AA 2QE6A 2NNWB 2NXCA 4M37A 4U7TB 4E2ZA 3Q87B 2PV0A 4XUDA 4ATNA 4DQ0A 1YFJA 3OPNA 4CKBA 4RVHA 3KR1A 4RTOA 2FK7A 2KW5A 2P1DA 1JR4A 1XXLA 1I4WA 4C07A 5K0JA 4PGGA 4BLWA 2O57A 5EMMA 4K6MA 2P3QA 1TPYA 4YMGA 1I1NA 2PXAA 3AXSA 3FTEA 1VPTA 2ZW9A 2V7EA 1NW3A 2B78A 2FYTA 2GB4A 3DP7A 4QQNA 3TKYA 2FK8A 2O06A 5LQUA 3G5LA 5D1NA 3V8VA 2IH2A 3KPVA 1MJFA 3LCVB 4Y2HA 4XUEA 4YV1A 2GA9A 4EKIA 1O54A 2P41A 3IYLW 2HNKA 2AZTA 4QVKA 5HIKA 2AVNA 3MCTA 3BT7A 3LPMA 2NYUA 4CKCA 2A14A 2PVCA 4ER7A 2GAFA 4E33A 4PYMA 4YV2A 1JG1A 2ERCA 3EMDA 4PIMA 1ZQ9A 3HVJA 4ZTBA 2BR4A 1D2HA 2ZSUA 2WA1A 4IV0A 5DT2A 3DMHA 3C3PA 2NXEA 4AX8A 2IP2A 5GIOE 4ER0A 3PTAA 4RV9A 3LECA 4U7PB 2YXDA 3P8ZA 4RVDA 3U81A 3PLAE 1SQFA 1KPIA 1R18A 3HA3A 1EAMA 4YUWA 3EVDA 1X1BA 3BXOA 3GJYA 1XTPA 4EVIA 4RSRA 4AZWA 1SQGA 2JJQA 4FR0A 3EGVA 4OBWA 3E8SA 1D2GA 5E2AA 4CTJA 1P1BA 5FTWA 5LSAA 4HH4A 4KDCA 1WS6A 1XDSA 2R3SA 5BP7A 5GM2A 1AQIA 1AF7A 3LKDA 4QTTB 4V0QA 5C1IA 3MGGA 3NW9A 3OCJA 2ZBQA 5C0OE 3SSMA 5DX0A 3CCFA 3QV2A 5FQOA 2O07A 3FTCA 2ZZNA 2ZIGA 1L3IA 2OB1A 3A4TA 3LL7A 4C04A 1Q0TA 3FUUA 4RTRA 2DULA 4FZVA 3KQYA 5FWAA 2PWYA 3HVHA 2XYQA 1NE2A 5CCXA 4DZRA 5ICCA 5E9WA 4B17A 5DRTA 3SMQA 2YR0A 3ELYA 3KR0A 3C3YA 4AZSA 3G5TA 5K0GA 2OBFA 2ZTHA 3NWEA 3G7UA 4FP9A 3FRHA 1U2ZA 3HCDA 4C08A 5FA5A 4AUKA 3VSEA 4CKEA 1KIAA 2G71A 2HTEA 2V74B 3KPUA 4EQZA 2XVAA 3KQOA 3UA4A 5FHRA 3KQVA 4LWOA 4A6DA 1NKVA 4MIKA 2ESRA 1F3LA 5DSXA 3KPJA 1YUBA 2B9EA 4P7FA 4X60A 1JQEA 2Y1WA 1NBHA 1HNNA 4WVLA 1JTEA 3TRKA 3L8DA 2XYRA 3BWBA 4GOLD 5CM2Z 5HEKA 5LR6A 2NP6A 2O0LA 3B5IA 3SX0A 4QDKA 3MB5A 5CCBA 4M38A 5CVJA 1YB2A 4YUZA 1AV6A 5KS2A 3IHTA 4HTFB 1QAQA 3LKZA 1R6AA 2BR5A 3QOXA 1JG2A 4RVGA 4EK9A 2H00A 2AOTB 3T7SA 5EIWA 5EHGA 3FUWA 3FYDA 4V0RA 2IIPA 3CKKA 5EMKA 2UYHA 2XYVA 5GOZA 2AOWA 3O4FA 3OZTA 4F84A 3BKWA 2BM8A 5HIMA 3FUTA 3EPPA 1RI2A 4IWNA 2CMHA 3VC2A 2I9KA 7MHTA 4M7RA 2AN3A 2JH8A 1M6EX 3HA7A 3OZSA 2JG3A 3CJRA 3LBFA 3PX2A 3GRZA 3UWPA 2IFTA 2JH9A 1WZNA 3JWHA 4HGZA 3S68A 3UJ8A 5KQRA 4YUVA 2I7CA 5LQNA 2C7OA 3FRIA 3GO4A 1WXXA 3PB3A 2OY0A 1XVAA 3TOSA 5LQJA 3NMUF 5CD1A 2ZFUA 2GLUA 3B3GA 3G88A 3NDIA 3QOWA 4GBED 5KYGA 4RTNA 1DUSA 4FS8A 3PX3A 3ANXA 1SUIA 3KPYA 1SVUA 2EJTA 3AXTA 3ORHA 4L7VA 5FUBA 8MHTA 5E1DA 5ICEA 3M33A 1BC5A 3NVMB 3M6WA 3REOA 3KQWA 2G72A 1O9HA 1OR8A 2PSSA 2YUIA 2ZULA 1RJEA 2NXNA 1INLA 5FWDA 4E2YA 1N7JA 4LG1A 2ZZMA 2C7PA 1FBNA 2WA2A 1NV8A 3FZGA 3HVKA 5EIFA 2EFJA 3P2EA 5ICFA 3KR9A 1G6Q1 1NV9A 2VDVE 2AN5A 2I6GA 3T7RA 2VS1A 4ISCA 3GRYA 3TQSA 2ZBRA 3DTNA 4MQ4A 2GH1A 4BP3A 5GIPE 2G1PA 5DXAA 3UJBA 1R8XA 2H11A 2YTZA 1TW3A 1ZHFA 1VQ1A 3KHKA 3KQQA 3PVCA 4KRGA 2Y1XA 1R8YA 4PYNA 4YMHA 5BW5A 5CVUA 5DPMA 4OX9Y 4C4AA 5M5BA 2JHPA 3JWIA 3LSTA 2HWKA 4HTFA 4QVGA 4PINA 2UYQA 5H02A 3LHDA 4EKGA 2AOTA 1YF3A 4X63A 2ZWVA 3KR2A 3HTXA 1WXWA 3OE5A 1TW2A 3B3FA 1BOOA 4QDJA 4RTMA 3FUXA 3I53A 3PS9A 2I62A 5EPEA 5HIIA 3WSTA 2BH2A 1X1DA 4FSDA 5LQRA 2ZLBA 1H1DA 4FT2A 3GCZA 3OFJA 3OE4A 2GS9A 3T7TA 2PXCA 3G8BA 4YUXA 1MHTA 1VIDA 2P35A 2PX2A 2ZZKA 3FPFA 3Q7EA 4WXHA 1RI1A 3DULA 2UYOA 3LGAA 5C9ZA 3PFGA 5GM1A 3B3JA 3B7PA 5MHTA 5E9JA 1FPQA 2NP7A 3OU6A 4C03A 1NW5A 2VDWA 3IV6A 2VZ9A 4GF5A 2Z6UA 2P7HA 4RTQA 5EOVA 3IEIA 3M4XA 4PIPA 5GINE 4GOOD 1JQDA 2HMYB 2N47A 1G38A 1EJ0A 4HRAA 1ZG3A 3NDJA 3AWIA 4ER6A 5LQCA 3JWGA 3HCFA 3MHTA 2FPOA 3EMBA 5IKMA 2P8JA 1SUSA 4OA5A 4C05A 1NT2A 3P97A 3HNRA 4OQEA 4E2XA 3VYWA 1XDUA 5DM1A 3HM2A 4XCXA 3T0IA 3TR6A 3THRA 1VP3A 3G2MA 2Q41A 3HVIA 1L9KA 3HCEA 5K09A 4XUCA 5KQSA 1X1AA 1XCLA 4E70A 3NWBA 4PNEA 1JSZA 4R05A 5EQJB 4FSXA 4R8SA 5BXYA 4RYLA 4BP1A 1QAMA 5GP1A 4P7GA 1KYWA 4RTSA 3UJDA 2IBTA 3BKXA 3I9FA 2IDJA 3R9XB 2AOVA 4Y30A 4YUYA 1P91A 1IM8A 3KU1A 1WG8A 5CUQA 4E30A 3MQ2A 3MCZA 5E8RA 2FRXA 2IDKA 2OXTA 5K0EA 2G8NA 4PCAA 3UJ9A 4NECA 5FCDA 3ERCA 5JR3A 2AVDA 3CC8A 2ONZA 3ME5A 3P9KA 3X0DA 3UJAA 4IKPA 4DKJA 3OZRA 5K0NA 3UZUA 4FGZA 2PWPA 3V97A 5E1BA 2ZWAA 3EEOA 4QTUB 1T43A 3CJTA 4R8RA 1HMYA 2IPXA 2JHCA 3KKZA 5K8VA 2QY6A 2IH4A 3PFHA 3EVGA 2ZIFA 3CBGA 5GWXA 4RTPA 3KQPA 1IY9A 2CKDA 3FPGA 1P39A 3KQMA 4X41A 4QPPA 2B3TA 5DX8A 4OBXA 4C06A 3F4KA 5DX1A 1L3CA 4ER5A 1SG9A 3HA5A 3R6TA 1PJZA 2QYOA 5FQNA 3DXYA 3ER8A 1M0EA 4GQBA 4MWZA 3P9NA 1B42A 2AN4A 3KPWA 5DM0A 3LDGA 3EVBA 4AZVA 3EGIA 3PT9A 5DM2A 5KVAA 3OFKA 4KDRA 5EKXA 4PYIA 3P71T 3A25A
chains in the Genus database with same CATH superfamily
2PX5A 4YAWA 2FN4A 5EINA 1A76A 1UJ2A 3EIWA 1JDPA 2KLBA 1L4YA 2OHIA 4TMKA 3QU4A 3U4DA 3PJFA 4G09A 3EHEA 1M74A 5A5DA 3GN2A 3V7WA 5IVHA 3FSGD 5MDHA 4QDUA 2PT9A 1E3SA 3ND8A 1GA4A 1B6SA 1IQ0A 1H9BA 1N6KA 1PDVA 1T8SA 2FW8A 2Y92A 3QIAA 3TI7A 1TO6A 2WG2A 1CIVA 2DEUA 2QDXA 2AOXA 3G8AA 2QTHA 3LZDA 3CB4A 3OG9A 4GRAA 4NAHA 3S1AA 3TDKA 4AX4A 3K6SB 1QRRA 4JLSA 2LCIA 2B0CA 2WAAA 5BVGA 1HORA 1Q0SA 1X7GA 2OO5C 5K0LA 3PF8A 3WNQA 1ZH6A 3TI9A 4F06A 4YP1A 1B16A 3IJ5A 4QGSA 4OREX 4DKXA 1YFLA 1OVMA 4K81B 1R5BA 3Q0TA 1U90A 3BHMA 4O5OA 4Q3DA 3HBFA 1LI4A 5JCOC 1RBZA 4X20A 4LSZA 2YCLA 3LBIA 1JBEA 1KAOA 3GXOA 4LTDA 4HVCA 2O8FB 4IIFA 1GGMA 2FWPA 1ZGBA 2W4QA 2FDRA 1R8QA 1G4AE 1P7CA 1QWSA 4IL5A 1FS5A 2GK6A 4J49A 4CUJA 1YASA 3I4LA 3C24A 4HS4A 2QTNA 1ZUWA 3ZHRA 2EX1A 2ZPUA 5KYXA 3CUSA 3OPMA 2G0NA 2W43A 4YRAA 2AOUA 2QSUA 3BL8A 2PXXA 3KOUA 1V37A 3U3DA 3R2JA 1LW6E 1JIVA 3ROKA 4WT7A 5DYTA 3R7WB 1T6ZA 1IOWA 4NZZA 4RPLA 2KYRA 2W6CX 3ISVA 4TTRA 4UHHA 5IJ0B 1ESNA 1N57A 3X1XA 1FFDA 2ID7A 5KYTA 4H7FA 2AG5A 1Q1ZA 1TUIA 2FXVA 3A6KA 3GRVA 4DLKA 4F4JA 4F93B 2CJYA 5EEHA 1F2UB 4XIYA 3ZDQA 5CA1F 4BLTA 1O03A 5T4BA 1K27A 1HH4A 1ZIOA 3IOMA 4JBWA 4W5WA 1PUJA 2BEWB 3MINA 4FNGA 4IQFA 4HDSA 4IIHA 4UTZA 3U7QB 4B76A 4EI2A 1AN0A 2ZJFA 1F4PA 3FETA 3PFBA 2YS6A 4FEEA 4KUEA 3SHFA 3IMEA 1TZJA 2XUPA 4RANA 1GUBA 4RDCA 5JMPA 1S7GA 4D43A 5JBIA 3DW3X 3MD9A 1OH5A 3GFGA 2G07A 4LDJA 5DCWA 1A9RA 1YXMA 4U7FA 3UAVA 1BMTA 1H6DA 4MDYA 4ZALA 1RLMA 3LWZA 3U3JA 5BWMA 3QVUA 2C5FA 2GFIA 2W8BA 3DHYA 1MA0A 1KJYA 3Q3EA 1J70A 3L7KA 4N7RA 3FWKA 4TTPA 2HYIC 1XXHE 2R00A 2OGSA 3BZBA 3I32A 4S0XA 4V0NA 3THYB 1W1IA 4P7JA 1U5CA 3TVYA 2I9PA 4OI2A 5F35A 4UDNA 4B3HA 1IHPA 1ORVA 2VCYA 4RCZA 4XRRA 3WO0A 5EPUA 5KPDA 1IN4A 1CD5A 1C50A 1UBUS 4N6OA 4ER3A 5T64A 3ENZA 4LF9B 2KLHA 5GVRA 3RROA 3IDSA 2YXEA 1UPAA 4QQFA 4GYWA 3FGOA 1SB9A 1BG6A 3IUNA 3Q1KA 4QBKA 1VMIA 3AVVA 2JIZD 3TBHA 1X6VA 4MH0R 1Y3IA 4WI1A 2WF7A 3AFGA 1ZR2A 5G0WA 4MVJM 3HO1A 1UKYA 3JYOA 4XR9A 2RSLA 2W5UA 5K8UA 4HNUA 2VT7A 3QXHA 1JHPA 4JGBA 1OI7A 3OQ6A 4HB2A 4ITRC 2QRJA 4LYFA 1GN8A 2A0WA 2J6CA 3BUSA 3RKUA 4A8JC 2HF7A 3ZV5A 4H3VA 3GRFA 4L0QA 1R6BX 5JNUA 4RD1A 1RTTA 3ND5A 4HWTA 2E82A 4K2AA 4MI1A 5DRYA 4D5GA 3W3ZB 5LD2C 3ICWA 5LU9A 2O8EA 3KD3A 2FI1A 5E4JA 2VYVD 1BFDA 4RU1A 4FDLA 2EKDA 4H1VA 2GXSA 2C9DA 3F7NA 3IDAA 1FTSA 4LOLA 5BQOA 5JWHA 4A82A 4DRXA 8ABPA 4INOA 3BERA 3HY3A 1W44A 3KZNA 4EJ2A 1J7KA 1EUCA 1Z17A 3D1VA 5IJXA 4BQRA 4GR4A 1HA3A 4X9XA 4Y98A 4JA0A 5DBEX 1GSIA 3C5VA 1OBVA 3RODA 1KZGB 4XR4A 5D3ZA 5F4ZA 1XC7A 2AT1A 1XCBA 3BFVA 5AK5A 2CJWA 4NU6A 3SYNA 5HHTA 2XBLA 3TXXA 1G6OA 1E3DA 2I3BA 2QUHA 1M9NA 4RORA 2PVSA 3ZHZA 3GEDA 4YA6A 3TLJA 2GUGA 5FNVA 4EFNA 3X1YA 3K5IA 2NV0A 1M7HA 4BJ5A 4I50B 5H83A 1TEHA 5IYZA 4RLHA 1KJWA 1HGXA 3I9NA 4X93A 2FN8A 4GSKA 2Z08A 5SYMA 1I2AA 3BE6A 2PX8A 3P9CA 1SBTA 1EFHA 5LUAA 1JMKC 1F2VA 5CVDA 1DC3A 5BR4A 1DQYA 1JIUA 2FSPA 3PWSA 4Q1EA 4KQXA 2QLTA 1KI9A 2CSXA 3LYLA 1JDZA 2PFKA 4BLPA 5JD5A 2VTEA 1PK8A 2PH3A 3BL5A 1VI5A 1MDFA 1XAIA 4O59O 3GW8A 3I05A 3JARB 4L15A 4H0CA 1S8OA 2VYCA 2P6PA 3L7LA 4V0SA 4JJGA 4F5EA 1U7PA 1WKBA 3L4BC 4G0MA 4B6QA 3W77A 4JI1B 4LWPA 1M1XB 5HS6A 4BYGA 1ZVKA 3DOIA 1YI0A 1RI4A 3WWEA 3C0KA 1JG3A 2VVTA 3BORA 3K0CC 1ZJ4A 1B76A 3T94A 4NPHA 4OM7A 4HUJA 4ATNA 2GYYA 1T0JB 4Q3LA 2EL7A 2JW5A 1PV1A 5ICMA 4J8PA 4Z0TA 3C4QA 2AF3C 2K5UA 2Z09A 5JCJA 1ULBA 4J1NA 2H59A 1EFPA 1XZFA 3A1VA 5FR2A 1TEVA 2UZ3A 3I01M 4BLWA 1WX1A 1PKEA 2W6JA 4NV3A 5DU2A 4LQLA 4ZCSA 1KI3A 3QUCA 3FNIA 3SBEA 1CYEA 4IIDA 1ZOPA 4X8OA 4C30A 5BSVA 2AJ8A 2ZTSA 4OLJA 3VKFA 1QTQA 2HBZA 1KGSA 2PQ6A 2Z2XA 3WAGA 4K05A 5CT5A 5KTOA 5HF6A 3B6JA 4FZRA 1NMSA 4D57A 3CZPA 1I1QB 3UWMA 4CL0A 5CD9A 2PL1A 4YXWD 1BCRB 3O8DA 1E6KA 4Q82A 3LV8A 1DJMA 2C99A 3GBVA 1VE7A 1EP3B 2QLJA 4C6TB 3CH7A 5DYGA 3D5EA 1U3UA 2XSZA 2ERCA 4J2TA 3IL2A 2PH5A 1ZQ9A 3R3VA 1AD2A 1D2HA 1JA0A 1ODKA 4PHCA 3ZCTA 1G64A 2CLDX 2XWSA 2QNIA 2LVBA 3QFSA 4M3NA 1FLVA 3ETJA 2M6RA 3CT4A 1F4VA 2XNDA 1ZGHA 3NBFA 3P8ZA 4QHTA 1U8UA 2HLNA 4L5CA 2F1JA 3HR8A 4EGFA 1X1BA 4LEIA 3FVQA 2CCGA 4TLBA 2CLFB 3E8XA 3G13A 3ZWPA 2JJQA 5J2UF 4YO7A 4DNFA 2GRAA 2LWIA 1Z68A 2OXEA 2W4MA 2XF8A 3K35A 4HH4A 4JJKA 4PXSA 5IARA 3U44A 1G20B 4V0QA 1HDGO 5FOSA 1ZESA 3SICE 2BFFB 2ZBQA 4OQQA 3ZTYA 1IWOA 1WJGA 2ZJ4A 2QK4A 4PLZA 3DE1X 2GCGA 3JALA 4XOIA 2CJXA 5DN6A 1EM8B 4X8MA 4QLAA 4M9SA 1TQ8A 3VX3A 2PWYA 4NJEA 2VBGA 3FKSA 2WQ7A 5J47A 4EDHA 3RRYA 4LJSA 5LQDA 2JEZA 2F3RA 5AJTA 5C81A 2ZAGA 3RU7A 2NVUA 3HRHA 4DDVA 3Q88A 4Z9XA 3JZMA 3TWOA 1NDUA 4PO3X 4DSTA 1K8XB 5LVAA 4R5MA 4FB4A 1XRPA 2ZTMA 2ZU6A 3M0EA 2DUNA 3ZLJA 4JBNA 4ZFNA 5DW3A 1KJJA 1EBFA 2ET6A 5ES3A 1QRUA 2Y4NA 2OILA 3ZVMA 4BN4A 1J49A 4GOLD 5INTA 2OHJA 1X39A 1W9HA 3TLCA 4ZDIA 2F7SA 4TT8A 5TGTA 5C1DA 4PFJA 1SH7A 5JLJA 4N48A 2EZTA 1RXYA 3UT5B 3SNHA 1IZ9A 1I3MA 2CF6A 1YB2A 4MO2A 1U99A 3ZIAD 3H1AA 2XZTA 4DCCA 3T1TA 2W0MA 2XRFA 3W8RA 3NAZA 4JLMA 1A5BB 1ADGA 4DIKA 5K4HA 3EOAI 1WXEA 1JFSA 4DJ5X 1VIAA 3N5CA 1S1CA 2VWHA 4FEGA 4BVEA 2I4LA 3H3XA 3OAAA 5LOVA 5HM8A 5CNKA 1NPDA 2Q0HA 3A4MA 5AXCA 2Y1LA 4FZ5A 4LOJA 2BHTA 2ZBGA 4ZHQF 1X1QA 3WGYA 1BMDA 1FU8A 7MHTA 1GM5A 1NQOA 3HA7A 2AI2A 4JELA 4GMKA 3KX2A 4R0NA 4Q12A 2CL7X 2BV3A 3GYGA 2O54A 3CH6A 4LBWA 1ELOA 3S68A 1ULAA 4H6WA 3AVPA 3UATA 3VR6A 4A3SA 5JJIA 1S3FA 3L8GA 4NMWA 3T7DA 3U6KA 4IDPA 5JE8A 3T0FA 1NZJA 4K88A 3HDVA 3WIDA 4TMTA 2NO5A 2PDAA 4GBED 2H2AA 4WBXC 4YFVA 2XZLA 1NC3A 2PWBA 3KBBA 1HTBA 1E0DA 3KPYA 3QPWA 4COKA 1DIBA 2PS1A 1OX4B 2PUHA 4HAVA 3VZBA 3OTQA 4DXDA 5JTUA 1LLUA 2B99A 2O2DA 3WK7A 1LBHA 1UBKS 4TTQA 4YEDA 2VDKB 2CBXA 2YUIA 3C3CA 2ZULA 5FWDA 1BYIA 1MNQA 4K9NA 3K9QO 3QF4A 4RZSA 4A8TA 4BNDA 2BF4A 3D4LA 1BD3A 3IEUA 5I7UA 4UHKA 2OCKA 2X5JO 3UVEA 1XELA 5IXYA 2PEYA 1P75A 2EFJA 1Z6YA 2INGX 4DLXA 4ZJYA 1RS0A 3VDRA 1HKHA 1JS1X 1NBME 4PLPA 1TIKA 2FN3A 4XZ3A 5A3QA 4XJXA 5CXUA 4DV4B 1KC3A 3ZCPA 3STTA 3MWYW 4BNTA 1C81A 5AESA 1YS6A 4F6RB 2H11A 2YV2A 3E5HA 3IESA 3K1JA 3NHWA 1VQ1A 4HNQA 4MJ7A 4P8RA 2RFLA 2ZSKA 1EXDA 3CTPA 4NBTA 3WADA 2WJ4A 4BGIA 1UFQA 1E3IA 1NXPA 5H4HA 1V45E 2G80A 4JOQA 4ZCLA 5B2EA 3MTGA 1Z39A 4KREA 1KE2A 5CFRA 3T99A 1S3IA 2P5UA 1GLGA 1FPMA 5ITVA 4RTMA 2I62A 1Y89A 2FP4B 1R2QA 1XNGA 1Y9EA 1KOFA 3KTAA 4TRJA 3DE6X 1ZVQA 1OXMA 3BA1A 2C04A 4FE4A 3DCIA 2G8LA 4MS4B 3CEJA 4PSVA 3I30X 4ENVA 4U6NA 4IZIA 5ALGA 5BW6B 3UMMA 4XFKA 4N0EA 4TLDA 3E22B 2MSLA 3QKUA 3NIBA 3T0GA 2GA8A 2EKLA 2Z6UA 3AV3A 1SVLA 2RGEA 3H2YA 1CERA 3G1TA 1YJ5A 3VHRA 4HRAA 4YYEA 1YULA 2W42A 4ENUA 4ZQCB 4OMUA 2CK3A 2DERA 4AZ0B 2GYUA 1MMFB 2BFDB 1WMFA 2MSNA 4G8DA 3IR6A 1VIMA 2J3KA 2Z4TA 2V9ZA 4AT1A 3WWDA 1O97C 2AZDA 5DM1A 5KYUB 3T0IA 2P9BA 2C8LA 4MJ3A 4MJLA 1AHNA 2ZJ3A 4PPFA 1JW9B 2YRXA 4KL8S 1RABA 1NJFA 3EVNA 4RJ2A 1DIAA 2PS0A 4BFYA 5FPSA 1XCLA 1CRWG 1GRCA 4EBFA 1R8JA 4L2IA 5EQJB 4HAYA 5I7HA 3COPA 2EC5A 2QTMA 5IJZA 4NBNA 1XNJA 1VHWA 4HQ6A 4KQ6A 5KDDA 4HEJA 1E64A 1LW7A 3S8MA 1AURA 3BB1A 1NURA 4GXRA 5ARDA 1Z45A 3B2QA 3W4KA 3VTZA 1EI9A 3H5WA 4O5AA 3FOEC 5E8RA 4DV0B 2RHLA 3OECA 2BLNA 4B83A 1QG2A 5GINE 1XTSA 3KETA 2FMTA 3ES9A 3M6LA 5ILGA 2XYGA 5JR3A 3G2JA 2AVDA 1SJ9A 2WC1A 5AKEA 2JJ2D 3TL3A 4DR4B 1QR2A 1FZTA 3H3JA 4JEMA 3HE3A 1GAEO 3RI3A 5JADA 5JPDA 3DEIA 4ZZIA 5JRZA 4MGIR 4ISBA 4QYSA 4A16A 3PSAA 3RV4A 1UKBA 1LLDA 2G08A 4GPZA 1M5TA 4J3NA 3WGQA 4ALMA 2CL0X 3IOYA 1Q1BA 4OXYA 5BNZA 1KBZA 2CKDA 2OQVA 1P39A 4WAUA 1IJEA 4IMPA 2B3TA 3DOCA 2QQ5A 1MAWA 3AEQA 3L6BA 4G5XA 2ZK7A 1JQBA 3ZI7A 2EATA 1PJZA 1PEYA 3DCYA 2YOHA 1U8FO 3JVEA 4M9XA 1WEKA 5BN3A 4MKGA 2HU5A 2F8SA 2XMRA 1J2UA 4CMIB 2PX0A 1AKEA 4JOCA 4RK6A 1AE1A 3HYRA 3ZX5A 4BB9A 4WK2B 3A25A 4ZCPA 5BWCA 3IAUA 3PEFA 3PE6A 5AVRA 2CNWD 1FTNA 2WJZB 2Y1FA 3ZCVA 4F71A 3GEEA 1RC1A 1SC1A 3BIWA 3LQQA 2OYSA 4JJ4A 5HRAA 1I9CA 3W2EA 1OIXA 4V2IA 4PNZA 5DE3A 2ZSIA 4P3PA 1FW8A 1WVMA 2AH5A 3OM8A 4Y6QA 1XZBA 2CEAA 3NANA 5BMOA 2BFMA 2JBWA 4HKTA 4R2JA 1EE2A 4EWLA 1ZSYA 3KQSA 1EK0A 2VPZA 4P0PB 4BB5A 1LX7A 1OTHA 3OJWA 5C53B 1YR6A 2E4WA 2PO7A 5BNFA 2ZZMA 2CEKA 2XNJA 1T0PA 3JTMA 4PBTA 5BPHA 1M2OA 1NMEA 2LD4A 3IH5A 4KRFA 2PAFA 4YV7A 3JQ9A 3T5AA 3O3OB 4M0KA 3OD1A 1A1VA 2R7MA 3JATA 5JJ5A 3U5TA 2G36A 3SLRA 3JQBC 3PNMA 4TZTA 2H54A 4I0WB 4YT8A 1RLIA 4KXFB 2J41A 3LKBA 1O9GA 4KN8A 4J0DA 3WWZA 3H8WA 1G19A 4AF7A 1IBLB 1NRIA 2ZT5A 3UA3A 3W1VA 1PR0A 4CDMA 2FOLA 2IXEA 5U4XA 2HPHA 4L5IA 3RSCA 3KC2A 3O1HB 2IKQA 1I5OA 1QCYA 5DJ5A 3IAS6 4BEWA 1UXOA 1ECBA 3PEVA 2WZQA 1GV0A 3K30A 3F5DA 3OFNA 5C4GB 2ZG6A 5J2TB 4H3HB 4FDMA 2VHTA 4EHJA 2WJGA 3QZUA 4FHZA 4QWWA 4EMBA 4EMSA 3OZCA 3T9DA 1ORHA 4HBZA 4BGEA 3BPSA 4J29A 1PSWA 3I92A 4AQDA 4IH1A 3BIJA 4AKEA 4ZMSA 1R0ZA 3ZXXA 4RM3A 2MSCB 1AJEA 5LB4A 4YR7A 3DV0B 5JDIA 4NF2A 3THXA 3D6AA 3TGLA 1PL8A 3NWOA 4MI6A 2C84A 4CL2A 3CONA 4BRWA 5H3HA 4RK4A 1SHJA 4BV2A 3ZK9A 4JC4A 1AO0A 1CC1S 2V1UA 5EXSA 4JJAA 2QRVB 1JU4A 1NIPA 2C94A 3G6WA 3KT3A 4QE3A 4D8WA 2F8MA 3IDOA 3MRVA 4O4HB 2JFOA 2B1GA 3DDHA 2NOAA 4WBNF 2WMYA 5LWHA 1ZRNA 1BDHA 3QKWA 1VE5A 1XZDA 4BO9A 1Z0FA 1MAAA 1UM9A 1WDTA 3BGDA 5JIBA 2N1BA 1VG1A 1NA5A 1T5OA 3D7RA 3KE8A 5EXXA 5JNVA 5J3JA 2UYCA 1Y8QB 4GOMD 2I33A 1QYDA 3GMIA 1R9JA 3PGJA 2IXBA 4R51A 2XMZA 4TKUA 4MHTA 1HOXA 5AW9A 2JAHA 1DO2A 1OXUA 1GITA 4YECA 2JVIA 4U2CA 3MOGA 2XAAA 5EP2A 5KYNA 3U1BA 4B46A 2A9PA 3KXDA 1NKTA 1IB0A 4EELA 1JKMA 3ZTWA 5IT9A 3F96A 1MVOA 1YB7A 1YBMA 3BIFA 4UXIA 5EKUA 4BQSA 5H3CA 1ZKMA 1TUBA 4JC5A 4D0RA 4KQ9A 3U7FB 3UB2A 3QYFA 1V11B 3VNSA 5IUJC 2ZJAA 1CNMA 4P3OA 4URFA 2BFOA 2C9OA 2O2IA 1DRUA 3KQNA 3A1SA 1GZ3A 4C6SA 1GV1A 3D8NA 3QENA 5CW2A 1FLAA 4RIHA 2TMGA 4TKVA 3JASA 4QJ4A 4A5SA 1X8LA 2ORWA 3DSRA 3K6RA 3KSUA 5AI4A 4AJJA 1P2VA 1EDBA 3QBVA 4P3XA 1U28C 2J5RA 1ZEMA 2E6KA 1CQJA 4C5BA 2WP0A 2AZ4A 3HCBA 7MDHA 2FWRA 3V8MA 5CXSA 4AJHA 3A1UA 2NAFA 1FJ2A 3BWMA 2ZSFA 3ER9A 3THWA 3GB9A 3LOPA 3RYFA 4D8UA 3L4EA 4P36A 1Z7BA 2WSIA 1RI5A 2HSWA 5LLTA 4K9QA 2IX3A 1HQYE 1ISIA 2AJDA 3AG5A 3H8VA 2ZVJA 4Y1GA 4WNCA 1Q15A 2FPIA 2WUWE 1KDZA 3WLEA 5ALTA 4LV8B 2VJPA 1FXWF 4G1CA 2VHCA 1LXCA 4G0XA 3M6VA 1TF7A 2FJUA 2P9CA 4Q3EA 4CKCB 2QG9A 3FJ1A 4AUMA 4HXFB 4FMBB 3FTFA 3A8TA 1RBQA 1V8PA 5DNVA 2BJHA 3LO5A 4XYLA 1Z88A 2QR3A 2QUJA 4YAEA 1X3SA 3RS2A 3U0BA 1XDZA 2BR3A 4KFRA 1X19A 3V7UA 1P8JA 5JY6A 3CEAA 4IDFA 1U63A 3ORSA 3FPJA 3M6XA 4QHSA 4C29A 2D3WA 2FZVA 2JGKA 4IXNA 1M76A 1OHHA 1VL5A 3OEED 2FOIA 4OP3A 2JLSA 4PRLA 3NFRA 5CTAA 2C7QA 5BWNA 4IV8A 3WYEA 1Y7PA 1ZM7A 2XVXA 1V48A 3M1IA 3QKTA 1V3TA 3F5FA 2ZJYA 2D1YA 3EJWA 3GAZA 3WP0A 1SKYE 4TKMA 2C7BA 3N2EA 1PKXA 4OU5A 2C9YA 3ZGXA 4LSMA 3AOEC 3H5OA 1G5QA 3QBJA 4RFLA 5HF5A 1PR1A 2UZIR 3Q87B 3QMWA 1QORA 3T5GA 1OTYA 3KDSE 3UUGA 4EYSA 1FDRA 1WETA 3PVSA 2I8AA 4Y67A 5G4LA 4I36A 2XT9A 4KPYA 4YYZA 2A0FA 3C3MA 3V46A 4C07A 1KOGA 1BVYF 1YU6A 1RXCA 2A67A 3JVDA 4URWR 3SBOA 2GCIA 1MFZA 3F2VA 5ALKA 1NI3A 2ZS9A 3WJ7A 4QFCA 1Z63A 3NBAA 5F33A 4E5KA 1LF5A 1KORA 3NTUA 4EKNB 1KRHA 1JAZA 1E5VA 4I55B 2FK8A 4N3BA 4YIHA 3QXJA 3ZWXA 1FRZA 3AJEA 2CSUA 4Y2HA 4EF4A 2ODNA 1A04A 2P41A 2XD9A 4YP5A 5SY9A 1FSSA 4IKOA 2VHVA 4Q9HA 4GMFA 3R4CA 3VISA 4D44A 2DAPA 4L5YA 4MRMB 4PWZA 3EMDA 3DL4A 4QFMA 2Y1OA 4X92A 4JBYA 5AI8A 5F3DA 2CDBA 3FDXA 1DMSA 2VAWA 2P2SA 3O2NA 1RKVA 3PQFA 3CG4A 4IV0A 4B6JA 3QRWA 4F46A 4IWYA 2AEMA 5KWJA 4ER0A 3FLMA 2OE2A 1JKJB 2A7QA 3VR4H 4LBZA 2NIPA 1QO7A 4S1OA 2JLRA 2KWIA 5C7OO 4XM0A 1S9HA 1YTLA 2WUGA 4RSRA 1BMQA 1W75A 1ZA2A 1D2GA 1NZDA 2ZSDA 4M46A 4E6EA 1LJUA 3PUHA 4EJSC 2MINA 4BNVA 2GM3A 1Z38A 2R3SA 4HB4A 1PK7A 4FR5A 4ZQIA 3TB6A 4FD3A 1FYFA 4UJ3A 4AKHA 4MAFA 4Y9RA 4AAYA 1RWVA 3I23A 4U9HS 3SC6A 3ZWWA 3NZEA 3K9BA 4Q24A 1SCKA 1P80A 1T1SA 4WA7A 5EQTA 5FAKA 4H6PA 4BKPA 4EGCB 4Q6BA 1O9BA 1PR6A 4XQ0A 2DCUA 4QYTA 5DRTA 4HZUB 5EIBC 3WTBA 5EJ2A 1NI4A 2NZ8A 3CIFA 3D8SA 4QAJA 4HAIA 3VZQA 1MVLA 1MIHA 3OZAA 5TJHA 1QF7A 2BFCB 2XWBF 2DFPA 4O4IA 4BV9A 1UPFA 2J7KA 2W2XA 2COEA 1E5DA 3H5VA 2OL4A 3HU5A 4PX2A 1G21E 1M6VA 3B6EA 2I6SA 5EZYF 3E3LA 4CQLA 4CHTA 4DLNA 1BWSA 4MARA 2AJLI 2Q3EA 3TDMA 2WT8A 1F8UA 1TM2A 3D9QX 2A30A 2BEKA 4HEA6 4B45A 5ILQA 5C3UA 1I0IA 5ISMA 4LXQA 3P4UA 2OC9A 3IALA 3TVDA 3L4JA 3E9NA 3UXHA 3CH4B 2O3UA 3FPLA 3K70D 5DK4A 1Y7TA 1B26A 1UP7A 2FSVA 4TVOA 1E8DA 3PT5A 4US0R 5CJJA 1WY5A 3I6MA 4X45A 1IYZA 5A71A 1GY8A 1M1NB 2W2LA 2WWIA 4HTFB 3R9IA 3TLZA 5B6JA 4UU8A 5IDYA 4PG8A 2G28A 1XLTA 3VZCA 3ZDAA 3EFEA 1S2LA 2P68A 3DD5A 3I6ZA 2O8BA 3JAKB 1XI2A 2VJAA 2Z3ZA 3GGOA 1SUCA 3FUTA 5AK3A 2CBGA 4KYIB 3EPPA 1DNPA 4RF5A 3U3ZA 3WGJA 1B43A 5KYWB 3GJ5A 3O8LA 2P2DA 1JWBB 1M6EX 3KNZA 2ZREA 1TEXA 1UT5A 5CBKA 3CN7A 1DTEA 4U2DA 2GCNA 2GUWA 2A8YA 5A4FS 3TVTA 1X15A 1EFVA 2HJGA 3JZFA 4TSFD 1N6NA 3WIBA 2W22A 3HJFA 4B6PA 4WBSA 2JGDB 1TTTA 1DAHA 2ZJ6A 4R2KA 3X1JA 3ANXA 4ETMA 3EFHA 1XEWY 3NBKA 4QNMA 5FJIA 2MMGA 1U81A 3ONVA 3NVMB 5BV2P 2NU7B 2DPHA 2EBWA 1FS4A 3PHBE 5TQ2B 5JBNA 4NV1A 4ZI3A 1DJPA 1S2DA 1F60A 3LNCA 1EGHA 1Z5NA 2BFEA 3LZCA 5EZ6B 1P1JA 4WNIA 2C7PA 1D1QA 4L0DA 4PXAA 4UBOA 1NX9A 3BK2A 3AVXA 2X0NA 1JDVA 3P2EA 4WL0A 4RDHA 5HKAA 2PUFA 1AGXA 2Q21A 1M7GA 3P4YA 1XD2B 4UOQA 4EKGA 3P9YA 5B3KA 2G1PA 2WEKA 1ZXBA 1MO6A 4V1CA 1J0EA 3STUA 3FSGA 4OHYA 1Q84A 4QOJA 5BMVA 1NF8A 3GP8A 3UKJA 1HX7A 3TF5A 2JI9A 2Q4EA 2BMEA 3B5EA 4N8SA 1WP9A 1H8HD 1MC5A 3G59A 3MHPA 4CT5A 3PHHA 2HWKA 2E1RA 2FFQA 4IMJB 4Q4JA 3ANMA 4OJYA 5E6UB 2ZPTX 3IVAA 1GZ5A 2H31A 4MW7A 1QS0A 1VPEA 2FLWA 2HU8A 4B8ZA 1X1DA 4B5KA 1DADA 3UHPA 4II3A 2IEZA 5HW0A 3O6VA 4MYHA 4YUXA 4LWZA 5KOHA 5KUTA 4LHVA 3SX4A 1ARZA 4DIDA 1F0NA 4HXYA 4TN1A 4UFNA 1WEHA 1O7JA 3DJYA 4BU1A 4B7CA 5BR7A 1P44A 2HK6A 5KWVA 1G98A 1U1GA 2EFHB 2W2VA 2Q27A 3QQ5A 2FG7C 2PU5A 3OP1A 3T4XA 1PFVA 1T2EA 3PC7A 4IDOA 1K1EA 3SJ7A 4Z4IA 5B37A 2V0NA 4C14A 3A3KA 4MWTA 3IEIA 1DBIA 4JEIA 2W8ZA 4O8CA 2PN1A 1ABEA 3AWIA 2R1ZA 4EYEA 3MHTA 1X7ZA 2FRDA 4OA5A 2YZ2A 1J8FA 2VI5A 3FOWA 3UQYS 4C05A 1P19A 3U5ZB 3O2QB 4GI5A 3TBFA 5FP0A 3LHFA 2ZBFA 2ZE5A 3ZNPA 1LQTA 3ZBTA 3D6MA 2PVPA 5KX5A 1RZUA 3HCEA 1I0LA 3INTA 4XUCA 4RCYA 3U60B 1PFYA 4OKSA 2F4NA 5K3FB 5FEMA 4GRIA 1VCNA 2NW6A 5BUSA 1BDIA 4GLOA 4I1PA 3RLFA 2WHRA 3HWSA 1VSBA 3GLFE 1V16B 3DONA 4IIJF 5B3JC 2FMHA 2QZPA 2YIMA 1S1MA 3RKSA 1Z0KA 4LV6A 1NW9B 1M1YE 1LFDB 1OZHA 3R9XB 5HRCA 4NEQA 1EX6A 1E3JA 1T1RA 3NC4A 1JIKA 3UWSA 3D0RA 2XNSA 5IAGA 3HR7A 3V7YA 1G2OA 5AUQA 1IU9A 1ZNQO 2JFQA 3C6YA 4FOLA 4K2HA 4O4JF 4DUGA 2C9ZA 2VZLA 4G5QA 4KTTE 3KSAC 1XQ1A 5JSUA 2XB4A 1G0OA 2WE7A 2Q6LA 1LLCA 2R5FA 4XQGA 2HDOA 2IVZA 1VB5A 4EB0A 3D8RA 3D4IA 1V1RB 2NQ8A 3FB1A 5DHUA 4GIBA 4P38A 3I1FA 2AYXA 1UT6A 3L06A 3HZOA 2P9YA 4UASA 3PZRA 3N7TA 1CDZA 3CJTA 4GBGA 1TAUA 1RQNA 3RJ5A 1I1HA 1B41A 2ZTUA 5D5PA 1EXMA 3MEQA 2IH4A 5ITZB 1I0ZA 3DDSA 3N28A 3HP1A 3KQPA 4RGYA 5AW0A 5LN1A 3FWYA 3TIIA 4FM9A 4C06A 2CDCA 2ZJ7A 4K9SA 1RKUA 3NTQA 4YGYA 4FKMA 4GECA 2GBCA 4W9NC 1CUUA 3UK6A 1L4HA 2JIZA 3V4LA 1RQ2A 2H63A 4Z5XA 1Y1TA 1N5RA 3P9NA 3IBCA 5AT1A 3KPWA 4Y6SA 1XHEA 1JDSA 4D8TA 2VDWB 1R0SA 3DFZA 2RJOA 4R83A 5CYPA 3MT9A 3USCS 2R6JA 4M7OA 4R68A 2XCUA 5AKJA 2OZVA 1IG3A 2BI7A 2DC1A 4WK0B 4HAXA 1ULTA 4KO4S 4IXDA 5HF9A 3R9KA 2FA9A 1JE1A 3SGLA 2FWIA 2P91A 1GZ7A 2EBHX 2QR2A 3AB8A 3GG9A 2VYVA 2WUEA 4M8KA 1FEZA 2OCGA 5SZJA 3N9IA 5JZMA 3U56A 4KE6A 2ZB3A 1G1MA 2Z2JA 3GNLA 3HJNA 2Z6VA 4HI0E 4HMQA 1XO1A 1R6UA 1E3WB 2PRKA 1VPLA 2J9FB 3QWHA 2R6ZA 3BDVA 3UCEA 2RGDA 4LK3A 3CXRA 1VBMA 2JLCA 2P5TB 3MTIA 3UJ6A 4CLOB 5KO2A 2QJRA 2SKDA 5F3RA 4K1LA 3DT9A 1H4VB 1XYVA 1JZTA 2FUNB 1J42A 2B92A 5DTMA 3RSFA 3VOAA 4CGYA 3G0OA 5F23A 4G0VA 4FC6A 2Q5LA 3JWJA 2C3PA 4BLUA 3NI2A 2ZBUA 1BE0A 3ZJ5A 1V71A 1ZLYA 5IS2A 1DG3A 2GDZA 5AHXA 5FR1A 1Q0QA 3VU1A 5BUCA 1RHQA 2CLSA 2BEVB 3DCNA 3M81A 3RSOA 4ZI7B 1MR3F 4P4SA 1QANA 3IVXA 4UMDA 1NBIA 1EFTA 3O7WA 4LK2A 4RK1A 3OO1A 4PTYA 5CPBA 3AJ8A 1VG8A 3WLOA 4ZYZA 2GMWA 4C6RA 4F2WA 2ZRQA 3IP8A 3IP5A 4PSKA 3AI1A 2D0OB 1Z6TA 5TMBA 3LDFA 3CNOA 4HDNB 2OYRA 5DLYA 3ISTA 3HYLA 3OT4A 3PYXA 3R7NA 4QT4A 3HVRA 2UZ4A 2DR3A 3LCUA 4DDUA 5CW1A 2PFSA 2ZUBA 2PGNA 1OPRA 3G9UA 1P77A 1GJRA 1GDHA 2DZDA 3K6JA 5ALLA 4YLYA 3T5DA 4AMVA 3CW9A 4ZYYA 4FYYA 2P2CA 1YFZA 3ELUA 1HEIA 1QPBA 4M0UA 3RIXA 2I5PO 1LBTA 4ALIA 4IUBS 4BEBA 3O0DA 2CKMA 2JPDA 2NXJA 2XQGA 5LFAA 2PTGA 4V0LA 5E7QA 3LX5A 4I14A 2O52A 1GA6A 5H7XA 2AWNA 3ILXA 4E5PA 1Y3CE 5JUWA 4RM2A 1KMHA 1NKSA 2ZI6A 3PYMA 4MEBA 5IT4A 3QU7A 2AXQA 2P4HX 3QFFA 1QMGA 3MOSA 3R74A 2HR1A 4BU0A 3SEFA 2X23A 3M82A 4TXJA 5AW6A 1GUAA 1TAGA 4ZDKA 1FNMA 2EZ9A 5AVYA 1FW6A 1GGKA 3IVGA 2Y67A 3LX4A 1W4LA 3VR4D 3UAYA 1M5UA 3ZE6A 1RM3A 1OU4A 2AFHA 2DQYA 2QNRA 3Q4GA 5FWYA 2VJYA 4L72A 2YDXA 2OORA 1D2MA 1XLVA 2B4KA 1PQUA 1TK2A 3MNFA 3LL4A 3ORRA 4JZKA 4WV3A 5E6RA 4HPWA 4YXWA 3ZLUA 5JJCA 3V8QA 5K6RA 2ZBDA 4OGLA 1DJNA 1WPGA 5BNWA 5B7NA 1DKUA 3V9PA 1S8FA 4L3WA 4RHCA 2PGXA 3TSWA 1EEHA 1Z6PA 4AJOA 3GUZA 4FYVA 3QJ5A 4YCJA 3EMKA 3W6OA 4EG4A 3U4MA 4RPJA 2X1LA 3OEYA 5G2OA 2A9FA 2DOKA 4EGJA 4QKQA 1JR6A 1JEJA 1WOYA 3BMQA 4IFEA 3ZQ4A 2GM4A 4JJIA 1SEPA 5J4YA 1G5PA 1L5HA 3GMDA 4MVJI 4GMXA 4YJFA 1NNI1 1R6TA 1RYEA 2DFDA 4ZD6A 3EK2A 3U3KA 5KQGA 1CDOA 1FRFS 1NDQA 2NO0A 1T5TA 2PY6A 2PMCA 3IO5A 4FCCA 4N3NA 4E03A 4EUHA 5KOYA 1VKNA 2F8TA 1DSSG 1EQUA 1FTYA 2WSMA 2WI8A 1T1EA 4J9UE 1Z8HA 3CF4G 2VJDA 1B8OA 4JWKA 4L74A 3EGDA 4OQXA 5DM4A 4ZEXA 1V0JA 5KNBH 3RFVA 2WTUA 2XVZA 3UG6A 3WKEA 1A5TA 1US8A 3TJMA 1T8YA 1HQDA 3NOQA 5GOTA 5EWLA 4EYQA 1W36C 3CLRD 1U2DA 4FMCF 4QQKA 3ZQKA 3ID6C 4KDFA 2YUTA 3SWWA 3PRKE 3LW8A 3IELA 4TSKA 5TJ9A 3HH8A 4W5JA 1SUDA 3MJ4A 1FVOA 1OCEA 3LOQA 1G0NA 2DUUA 4YB8A 4JS0A 1JT9A 2H2IA 1U7DA 4M1TA 1NASA 5LBIA 1VHJA 1K3FA 4TS9A 4DSAA 1RRGA 3F1LA 5HG0A 3R3SA 1JHMA 3SZLA 1QQBA 1QB8A 4BBZA 3ZJ4A 1XBTA 3FA2A 1KAMA 1AY0A 1E1RD 3KB2A 4AB1A 3PNOA 5K01A 2MR6A 3JRXA 3M4NA 1TI7A 4BCBA 4RWZA 4DREA 5IYZF 2JCSA 3GLGE 1ZWLA 1YV9A 3AERB 1ZBDA 3EW7A 4I1OA 4EGQA 1FYWA 1ZI6A 4QLOA 3CVYA 1DVRA 3I12A 4BWYA 3PDIB 3CJQA 3EPRA 5A7FA 4O0MA 4NU8X 3M5DA 4LNUA 2QLMA 5T4HA 4G81A 4A91A 5HILA 4A6EA 1TDJA 5AQ1A 3TGPA 3T1YB 4E2FA 4Z9FA 1FQWA 5HFJA 3ZCSA 3GDHA 3KWFA 2XXAB 4DLBA 2YXLA 4QO8A 3ZIAA 3BWCA 3LBAA 2OENG 3I2KA 1Y6RA 3BS4A 5CK5A 1SOAA 4R8MA 4ZOLF 3T12A 2AFRA 1AIPA 3DWEX 2P6NA 2QUZA 1N2ZA 1FSZA 1N3IA 2AFHE 2LIPA 4G01B 4IUDS 4L8GA 4XDGA 3TKLA 1GUZA 2I4TA 3AHGA 1TD1A 2TMDA 3AW8A 4BMDA 4L73A 4Q1FA 4HATA 1UBHS 1VE6A 2FVXA 2GT1A 2NU9A 2PGJA 5DV9A 4BLSA 3T3HA 3JRWA 2JKYA 3OLZA 1SQ5A 2ZRLA 3LLVA 3ET5A 4Q1AA 5HGJA 3SKVA 3TQHA 4DQKA 4DQVA 1A82A 2OV6A 1COWD 4IGFA 2PMBA 4WNAA 3VKUA 2B98A 2QGZA 3O82A 3WX0A 4I3GA 4PZPA 1N3YA 3M34A 3DHNA 4CKWB 1KH3A 3UBMA 3JQ8B 2J09A 2G1UA 1YFJA 1DAPA 1Z2EA 2PWZA 1KERA 4K3UA 4N9QA 2UZ1A 4LRWA 1XMSA 4RVHA 4D4GA 4CVNA 2WG0A 3KSMA 1JR4A 2GEKA 1HFJA 2JAXA 1PG2A 1WXIA 3DEAA 2P3QA 2HQOA 2HJVA 2WHPB 4OGWA 4PPNA 4TQGA 2GZ3A 3ZYCA 5I7RA 2DYKA 1H2FA 3AVTA 4ND3A 2Y9MB 1L8OA 1ECCA 3GDOA 3KZOA 3NOVA 4IGEA 2FYTA 3NHLA 5AKZA 3ZGOA 4WK4B 3LY7A 4DABA 4G0WA 5JWOA 2W4IA 1GTMA 2NV2B 2XMCA 3AJ9A 5DFAA 1BKSB 3SKXA 3UJ3X 3ZQ6A 1E0JA 3RM3A 1CZLA 2GA9A 2NZXA 1O54A 3M9LA 2Q3MA 3I3OA 1O95D 5CURA 1PP4A 3E1KA 3GAFA 4I5GA 4ZAYA 1R6XA 3NBMA 4LRYA 1Y9JA 5TRTA 2A5LA 2DG2A 4WZAA 3WGIA 1IAVA 1YBFA 4Q4LA 2UAGA 4Z8YA 2BR4A 3GMSA 3NR2A 1NP7A 1N2EA 2C1ZA 2RH4A 4M9UA 3DDUA 3P96A 1BTOA 5HQJA 3ICQB 1KC1A 4FK8A 4RL6A 4R8KA 1FFEA 3OCXA 3GT7A 4NZMA 2IP2A 3RG2A 1CX9B 1ETHA 3TQFA 1EAMA 1RC0A 2AQIA 4YUWA 1K7SN 2Q6VA 3GFTA 5IKEA 1YL5A 5K9ZA 4C0LA 4ZU3A 4P0TA 5FB3A 1G6KA 2PT7A 4UTVA 2AC4A 1O8CA 1T3HA 3RUDA 3EW9A 3SEQA 2ZIXB 4DR6B 1ZGGA 4US2R 1YRQA 3A9RA 1FOEB 1ICIA 4R1TA 1XHFA 1JPJA 3JPYA 3QUQA 3R5XA 1FP4B 3B53X 3QKSA 4P93A 4QGGA 3CF0A 2Q45A 1B6RA 2JIBA 1NI5A 1U2PA 1Z82A 3QLUA 2J3MA 2UVPA 1W0KD 4ZJZA 4II2A 4AZSA 3NORA 3COWA 3PUJA 3L7DA 1P74A 3H9EO 2NVOA 3HCDA 3PIDA 1NPYA 1LBSA 2B5WA 4I9NA 1GZSA 2FW0A 3FY4A 1E1DA 3LQRA 4DV6B 1CJUC 1GG9A 1JP7A 1U1IA 1ZSVA 2QX9A 2JFYA 3BD6A 4JYMA 5FUVA 2ZUCA 3OA0A 4E6PA 3KDAA 2VQSA 4CR7A 1JQEA 3II6X 5T8KA 5I9IA 3TLYA 4BMYA 1TJPB 2P77A 4JB0A 4UM8B 2NP6A 1YQEA 1QH8A 4V3BA 4OOEA 3TZKA 1E3MA 1FNSA 4GO1A 3BCRA 1HYQA 1NNSA 4INAA 5BSRA 1TCCA 3BJZA 5J5CA 5LZ9A 5LOVF 1L4FA 2OO7A 4TV9A 4KEAA 3QOXA 2C29D 5ALIA 3RHSA 2XX3A 1NN0A 2H00A 1VHLA 3H2KA 4FFRA 1EWYA 3H2SA 4ZVPA 3CVJA 3FYDA 3R0ZA 1PJLA 4Z4EA 4BZQA 4YJ3B 3KEOA 3TUIC 4CDRA 3Q8WA 2VOEA 3R3ZA 4E5DA 5AM2A 3NALA 2VG8A 4O4LA 4UAUA 3NX4A 4W8OA 4JSTA 5IANA 2I9KA 3M1LA 5FI3A 3NH6A 3VUFA 3ZV3A 4LGVA 2HHHB 4L3VA 4M7RA 3N53A 4WZAE 3UKOA 3PC2A 2B37A 3PX2A 3UWPA 4JQZA 3FGPA 3AP3A 5EP4A 1CJBA 1ZM4A 1NSFA 3TDNA 1DOHA 1OBHA 3V00A 3BWDD 5CLIA 3AVQA 1JECA 1RYYA 3GO4A 4Q37A 1WB4A 4NZOA 3UHAA 1HZZC 1QVVA 1VG0B 4HK4A 2XLCA 3PI7A 4YMIA 2V3VA 3CUKA 1Y5RA 3H1PA 4UVHA 1KOLA 4UDYX 1T8PA 1WLYA 2DHRA 3G88A 2CF5A 2I4NA 5KYGA 1DUSA 1D9ZA 4FS8A 4KLCA 2CGEA 2ZUUA 7ABPA 3AY6A 2FVYA 5CB6A 3B1KA 3K8ZA 4L95C 3Q8MA 1E7MA 2NU8A 4A8PA 3KLNA 3M33A 2ZE7A 3HZZA 4CMAA 1GCIA 5CXXA 2DP4E 3X3HA 2VSQA 1IPEA 1OR8A 2PSSA 3K2BA 1NVGA 1CR0A 16PKA 2IW1A 1N7JA 1DQNA 4YT2A 2RGBA 2VDOB 3ADPA 4BDTA 1HYHA 4CMKA 1CF2O 2VUHB 2GZ1A 4JBXA 1J5XA 4AY5A 1AQ6A 1USVA 1T2VA 3JQGA 1VJ5A 2CNWA 2R8PA 2XHEA 3H13A 2AJCA 4ACAA 4MV1A 4EVSA 1FX1A 3TQSA 5GIPE 4G8JA 4DLAA 3E9QA 3P19A 1R8XA 3FCSB 4PLHA 1AKWA 3G7SA 3EUEA 1PR3A 5BW5A 1RQLA 1F0YA 1GEEA 1GLVA 2EJWA 3Q85A 1HV8A 2G4LA 4LWQA 4QUHA 4XM1A 4Y0VA 3GCDA 4RV5A 4BX2A 2X0RA 2YJ6A 4BXOA 3CX3A 4P3NA 4A7PA 3K9NA 3V4VB 4EDFA 3AVOA 3IAXA 4YQEA 2R5WA 1YQUA 3DYBA 4F4HA 1ZI9A 3BRWD 3MJEA 3KR2A 1P1IA 2R47A 4G0UA 2Q1YA 4MR8A 1NT4A 1VIVA 3M6IA 1A1SA 4JVOA 4LE0A 4LYDA 2IRWA 4NG4A 5DP2A 2QTWB 4ROSA 2X9LA 3RWMB 1YS2X 4HNSA 2RGXA 4MYUA 4B1FA 3C16C 2D00A 4D9MA 1SXPA 2P35A 4J1TA 2Q49A 4GS5A 2OV1A 1W76A 1MB2A 1U8XX 2J4DA 2HXSA 2XCOA 3OZVA 5GM1A 3IV9A 1FPQA 3QIVA 5G41A 3GJ8A 1OOEA 1XZCA 3AZPA 3ILHA 1IOZA 4F7WA 2RAVA 2CXOA 3KEFA 1JWLA 3W2GA 1MKYA 4GOOD 4Y7CA 1F51E 1XIVA 1CUWA 3PFNA 4FNOA 1JLMA 4XWKA 5T4FA 5KI6A 2WAMA 3S81A 1SUSA 3TLGA 3W7VA 4BP8A 1A71A 4UM7A 3P1JA 3ZUPA 4E09A 5CVTA 1UJBA 3BMCB 2Q3CA 3MVEA 3BMXA 4WXYB 2ODEA 4FFSA 4P5EA 3DF9A 3K16A 5CDFA 5A9SA 2I6XA 3C5EA 1JFFB 5DVZA 1UC8A 1TM5E 3ZWYA 4DCOA 1M7BA 2HXGA 5SY6A 4O1IA 4R05A 4WUVA 4C7BA 2V7QA 5AXAA 1TC2A 4K1XA 3LPLA 2P9FA 2RGGA 2PU7A 3ZH9B 1GAWA 4BHTA 3NH9A 4P7GA 3OT1B 4NOLA 1ABBA 5B36A 3QWIA 3PFCA 2PJZA 3KUXA 2HGZA 1AKVA 1LPOA 2M1ZA 4MPJA 3U4AA 3WDLA 3ZHTA 4G1FA 4KRXA 3KP1A 2AOVA 2JFHA 3OM1A 4PLGA 4E13A 4UTNA 4R1SA 1WB5A 2OBMA 3AR6A 3F5SA 2A4KA 2GVDC 2QPAA 1RMYA 4BRZA 4BX9A 1NM5A 1NXXA 3SYTA 4BAUA 5KC9A 1G8MA 3OETA 4J0FA 1P4RA 4WQMA 3PGVA 3KU4A 1QIIA 2ANBA 2H4JA 2X8WA 4DR7B 3PXGA 5K4AA 2N1MA 1U8EA 3ZLTA 1CUIA 1NF3A 4QFDA 1TKRA 1SBQA 1D0VA 1N9GB 3HHPA 1TVCA 3E1SA 3WAJA 2F6RA 5HJ2A 3M8KA 4LF4B 1LS6A 2PSHA 4HWKA 4MV4A 5B4VA 1HKUA 3RS5A 3HL0A 3EQ8A 5IJ0A 2JZCA 4M6WA 1DT3A 2BLLA 2CDAA 2V55B 1OTXA 1SEVA 1XAGA 4D9CA 5K3CA 4IQGA 2QYOA 1ISSA 1Q1GA 1TYAE 2GWRA 1F2UA 4PHHA 1YZQA 4YDHB 2AG6A 1MHTA 2BEWA 3DTYA 4GEGA 4PAWA 4X95A 4N8EA 1JNYA 1YIAA 2AG0A 4XEUA 5DM0A 3U7QA 3WLQA 4C9BA 2C97A 1N8TA 5FWXB 5JECA 4DNXA 1GRVA 2LP4Y 1KYTA 5ALEA 2GLTA 1W2HA 3JX9A 4W7HA 4BECA 4LC1A 3WGNA 3ZDBA 1T4BA 2COKA 2Y0BA 4TM8A 3UV6A 2Y1DA 3LXRA 1IK4A 3S2UA 4NXMB 4MHSA 3KV1A 2FPWA 3HEMA 1FBTA 3G9TA 1N2XA 3A27A 3HADA 4BEJA 2FEWB 2FZ5A 2DF8A 4D9IA 2EGGA 4DZTA 5FOXA 3CLUD 1GPMA 1HDEA 1RM0A 3NGLA 1SRRA 2VOJA 5AJZA 2Y8EA 2OYCA 3KUKA 5CIYA 3THYA 2PZ8A 1GNPA 2Z8XA 2BPOA 1XLUA 1XD8A 2DBRA 4I4TB 3IHLA 1IJKA 1Z4QA 2W93A 4KXUA 4M8LA 4R1MA 4BMPB 1IWBB 4JENA 5P8WA 1O3YA 2CXHA 2I2DA 4EIWA 1EIZA 1SBHA 3WNVA 1WZUA 2AK2A 1TJ5A 4KR3A 2I3AA 3EIUA 1D03A 1UIRA 3Q5GA 4OPMA 3DUFA 3PHGA 3LUKA 5E38A 1GTVA 1AS0A 1E1YA 2GDJA 4I9HA 1C9NA 5EUBA 1NGSA 3ZW8A 4TV8F 1CY8A 3OJXA 3D54D 5L3ZA 3UT0A 4ASUD 3TKAA 3D2BA 2Z9DA 2HMVA 5EYPA 4B7AA 1JR3E 1CWUA 2Y1CA 2BKXA 2IZZA 2YVAA 2ZJOA 3JR3A 2ERYA 4F72A 1YIDA 3OY2A 3HUTA 4IVNA 4K6GA 1MQ8B 4OSPA 3OEEA 4HJRA 5J59A 4K9MA 3LT2A 3VVMA 5J4VA 4NH0A 5L45A 3H84A 5HE9A 2IOQA 1L8QA 3NIGB 1JQJC 8OHMA 1G16A 1BJTA 2ZJZA 1G6HA 3KXLA 4I9UA 1PR4A 2H5EA 2XA9A 3RJZA 2AHRA 2FJ0A 1VLJA 1RTKA 3LDAA 2HBYA 4S2UA 2PZKA 1EFKA 2A5FA 2PJRA 4MW5A 1M2GA 2IU4A 4HN2A 5D84A 4GRDA 4FFBB 4J3JA 5DYWA 3IC5A 4C7VA 3AF5A 2VUSA 3EGWA 4E1AA 2ZOSA 2H4FA 3O3CA 3RVOA 3U7GA 1YJCA 1Z2DA 4P83A 5IDXA 2ZU0C 2RGWA 2J3DA 2AYZA 1CR6A 5JAIA 1GPBA 4EO9A 2R66A 1CS0A 4F2HA 3MCUA 2I7XA 3T7IA 3LVFO 3KWJA 2VIIA 1SKMA 4JSYA 2QLFA 4LQDA 4GGOA 4CCWA 1JQLB 1PUXA 3FXAA 1T2FA 4DJDC 5CYGA 3N8IA 3ZKWB 5IN5A 4B79A 3IAM1 5C5CA 4QU5A 1JFLA 2ZS7A 3EEBA 3F98A 3KM0A 3F73A 2Q3LA 4HF7A 3FCCA 1FL9A 2I1VB 2J5BA 3KEGA 2Z04A 3HDGA 3CUVA 2YHIB 4EHDA 3NBYC 1JE0A 3ZG6A 2JLZA 1UKCA 3BQ9A 3LQ2A 1XDDA 4BATA 3R24A 4GFDA 1MGPA 3DLCA 3JQRA 4RAOA 3ZHQA 1O57A 1GVHA 1K7CA 4TKZA 2NACA 3VV2A 4TLCA 4OJTA 2ILTA 4CU2A 3WLPA 4Q05A 1W4RA 1U2QA 3K1AA 2FPLA 3YASA 2RHBA 4U7GA 4BKMA 5HJ7A 2BUCA 1KQPA 2HX1A 4INZA 4MW0A 5DTQA 4C3VA 4EZBA 3T4PA 4D99A 1ST2A 1ZH4A 1U8YA 3KOXA 1YQGA 2JI8A 1XJCA 1FLNA 2H2WA 2BGLA 1ND6A 1P0MA 1ZCFA 4C5CA 3NHMA 2FKNA 2DPLA 4IIBA 3T34A 3V2IA 1LDMA 4R1QA 1A8HA 5LCXA 2W6ZA 4CF3A 2V03A 3W5SA 4X7MA 1QHEA 2JC3A 3IR5A 3WICA 2UUPA 2XMSA 2YICA 1SXJD 2KPOA 3ZBUA 5HCUA 3CZQA 5EMNA 2APJA 2J6HA 2X40A 1BIFA 3EIXA 1BXRA 3ZDCA 2KSQA 5HF8A 5TR9A 4EX7A 1H0RA 2ODQA 1QZXA 2WM2A 3LAWA 4C6TA 3ICPA 5JHGB 4J1SA 1E5QA 1UFKA 3DFIA 1T6BY 1N34B 5TF0A 3BSYA 5EUMA 1FJHA 1XR3A 2HYDA 3G2KA 3PXAA 1JVBA 2P0EA 2XWQA 5DXJA 3CZMA 5FI1B 4BC0A 2FTKE 3HO8A 4HYTA 4WEQA 5DYNA 4DGQA 2A9OA 5FI5A 2ZUTA 2H1RA 2C59A 1X1CA 4QX6A 1E9AA 3EC1A 4GGPA 4II7A 2ZWOA 3TOXA 3QVVA 2ETXA 2XDWA 2FZEA 1RAHA 1T91A 1FMFA 2VJLA 2X4IA 5ALUA 4DMMA 4EG7A 3RTGA 3WWOA 1Q3HA 4XUGB 2FR1A 2CXSA 2I54A 2ACEA 2JB9A 4RLQA 3OZGA 1I6MA 4X1KA 3TZEA 3DO8A 3LD9A 4WEOA 1A27A 1ZOOA 2D7CA 4G1EB 4KPEC 4O2AA 1GQOA 3B1XA 4YP0A 4PQYA 4HQNA 1CUCA 3TXYA 1ZRMA 1ODSA 1YC2A 3SKYA 5E8JA 3ZD9A 2ZIEA 2REQB 3H0CA 5EWJB 2H8KA 3Q11A 2YVKA 4B32A 2FPKA 5KX5F 2IYSA 3PQ4A 3UJCA 5KYXB 4FNAA 4YMWA 5DHFA 2ZJ5A 2XAUA 5IAEA 4KHZA 3T3DA 1PJBA 4EUNA 1WU8A 5T7BA 4X61A 3B12A 4QXMA 4AG5A 3M5WA 3WMEA 4LGMA 5GZ1A 4K87A 4AP6A 3GMTA 1UPUA 3QEMB 4M37A 5L3RA 1RAGA 5EESA 3P2YA 1JI3A 5GJWC 4RULA 2PV0A 3PBKA 1NIJA 4X6LA 1WSDA 4TSFA 2B4AA 3T9EA 5BOSB 4DWOA 5TB5A 2Q1SA 3FWHA 1DMRA 2KW5A 3B1FA 3BGWA 3W9YA 4D0GA 1OGYA 3BSWA 4MXDA 4JLKA 3OQBA 4WKPA 2JFZA 4RXMA 2NUAB 2KMLA 1H6AA 4PHGA 2Q8QA 3EWSA 4ZYVA 2WQZA 1KY4A 3EZGA 2VAPA 4TWAA 1Q3TA 3DEJA 5TMPA 4C6HA 3EXEB 3DNFA 3GJZA 4GX0A 1P3JA 1ZYUA 5JU6A 3GUCA 4PU0A 2CVZA 3RAEC 1OD6A 1SHZA 1W87A 4BYMA 4N5DA 3IYLW 4MV7A 1Q19A 1R4ZA 1SY7A 1XTIA 4GBJA 4QARA 4FBLA 5ALPA 3MMNA 3SM9A 5HIKA 5G1NA 2XJ9A 1KWKA 1P2DA 3SP1A 4ER7A 1M0SA 4PYMA 3WYBA 4PQEA 1YDEA 1OLUA 5JLAA 4JB2A 3QBDA 4BP9A 4K28A 4XX1A 2HHLA 3EQ6A 3NWPA 3R75A 2Y05A 5CAEB 3U26A 5JZOA 3UK7A 5BYJA 4TYPA 3ABOB 3KWLA 1KMQA 2B36A 3A6JA 4UVGA 5IMBA 4RV9A 3LT4A 1NBAA 7YASA 5FOVA 1H8HA 2YXDA 5JZ9A 1YL6A 3LT5A 1CJVC 2WWTA 4HR7A 4XD2A 3BAFA 4QJ3A 4F3YA 4ENWA 3J80A 3KVNA 3LO8A 2JI7A 4IIVA 4TTTS 1NMYA 1WBBA 4IMRA 5EUCA 5E2AA 1MDBA 2AD1A 3P2MA 4RJJA 4D3XA 4KDCA 4WLUA 1AT1A 3GGSA 4A2QA 1GN9A 2ZR0A 1E3QA 1T9ZA 5GM2A 3CE9A 3FF4A 3LKDA 4EI9A 3WC4A 4D92A 3DD1A 4N3AA 1PT6A 1K8ZB 1XZHA 2BCEA 4FKBA 3QPVA 1G20E 1XKTA 1PG0A 1Y8RA 4B3BA 1B8NA 3CLTD 3NV9A 1UK6A 2ZRDA 2G06A 3FVWA 5LZ5A 3V7NA 1W5TA 3S2FA 1QFYA 5H0IA 1B0ZA 3C3DA 3FMFA 4OI4A 1BWPA 5FWAA 4ETNA 1L7NA 3MWFA 2WAYA 4UM9B 3IE1A 2XGJA 1DG1G 5ICCA 3I8XA 1UUFA 3R8XA 2IKSA 1W5EA 3IUPA 3ELYA 4DIBA 5DKFA 9LDBA 3GJQA 1KJQA 3CVVA 4LXGA 2LXNA 1X1TA 1AKQA 1Y3FE 1OFHA 3B52X 4NDNE 3F7OA 2ECKA 2GEUA 4AUKA 5IDWA 1M73E 3IQXA 3MUNA 4OHWA 5BN4B 2H4HA 3P0RA 3ZC3A 1Q20A 1I8TA 2RGUA 3FFWA 4BZWA 1MTOA 2NZ2A 2XCQA 4Z9YA 3JYQA 2MTBA 3W9SA 4BX0A 4JHLA 1FTQA 1Y8AA 3RO7A 1ZCZA 3TNDA 2Q5HA 2BTOA 2YYZA 3V34A 2MWMA 3O38A 4PZAA 2OP0A 1OVGA 4MSUA 3ED5A 3L02A 1LK5A 1RWWA 3R09A 2YC2C 3TEFA 2QV0A 1Z4PX 2ZAOA 4FIDA 1NVTA 5A05A 1GT6A 3SEAA 1ACJA 1XMJA 5F5XA 2WPDD 2WU0A 3DGEC 4JCOA 4MRVA 3RHZA 3AOGA 4RA6B 5CVJA 4CYMA 3BMNA 2BEUB 3DT8A 3UXMA 3ZWDA 4BNHA 5CLFA 4ZXPA 4KWTA 4J7XA 5JFOA 5KS2A 1QAQA 3WK4A 4UQPA 2RGNA 2HFKA 1I2CA 3B3QA 1V35A 3QEJA 5KINB 1N1DA 1UBCA 4G41A 1U02A 3E22A 1RWXA 4MKHA 2TS1A 1H3FA 3PEUA 4LSGA 2IS1A 1IM2A 2NNLD 4YN3A 4CL3A 2Q8PA 2AOWA 4A15A 2DHQA 1WHTB 3KYCB 1L8AA 5HIMA 2QIOA 4BPBA 1NATA 2TMKA 1W85A 1YDMA 2ATCA 4TQUS 3JD2A 2QWXA 5F64A 3F7TA 1Z56C 1KYXA 2NUTB 3FFTA 3RU2A 2Q5IA 1HLFA 1YE5A 1GTL1 3IT1A 4AZ0A 3E7DA 2BFDA 3E18A 1CDDA 2ZSJA 4MUKA 1NOJA 2FW7A 1M8KA 1VLQA 1KI2A 2JH9A 4L3OA 2C8VA 4JVMA 4G4SO 1HYBA 1IE3A 1U5BA 4M7WA 3WRXC 1J4AA 5HWSA 2PLNA 4X44A 2YMPA 3K1TA 2ZT7A 5KSWB 4LVOA 1MB0A 1SIUA 2Z5LA 2GD2A 4Y9DA 1XWWA 2XTJA 2HRBA 1A9QA 4MW1A 1PT9A 3TQRA 3WLMA 4WLVA 3N8DA 1U7ZA 3PJGA 2CE2X 4HGPA 1XMPA 2RK4A 3LVRE 3NKFA 3RANA 4DA8A 3QVTA 3EG9B 1GZHB 1EHIA 5IBRA 3U9TA 5C2JB 1R6DA 1RRFA 1U3FA 1YACA 2DSNA 3EDYA 2MCFA 2C0CA 2JIRA 2JZNA 4A2CA 3PGXA 4KGVA 4IDQA 3FLBA 1DEXA 1UR5A 2RK3A 1HT1E 1T0HB 2BFBA 1Y98A 4GZ3A 2B1IA 3GUHA 2B1JA 2AMLA 2BZSA 3C4JA 4HWSA 4QATA 3IB3A 3WKBA 4PN7A 1D1SA 1G4HA 1HMPA 1QIGA 3K0FB 4BAGA 5BMVF 4B3MB 3R5KA 5DXAA 2J0UB 3K8QA 3C1OA 4IOKA 4QGAA 2YTZA 3G17A 1JDBC 2VJCA 4D8YA 1KU6A 1WUHS 3D6NB 4LXHA 3TMYA 1NYRA 4HPJB 2IELA 1F9EA 3GK3A 1XZAA 4X64B 1DINA 2JL1A 2PUBA 2H5IA 3ZY3A 2WWYA 3AUXA 1JEQA 1FDVA 2WTBA 3B3FA 3O5AA 1VXOA 4HDRB 3TTTA 2HA5A 4O4JB 2H7YA 3PIRA 4F3TA 1ESEA 2OBBA 1SXIA 2PL5A 1IBSA 3FDZB 4B75A 2DFNA 3MTQA 2Q9UA 1RFGE 3Q3JB 5CBPA 3NAQA 1KEEA 1QH9A 4YMVA 4CMIA 4IHJB 4EB6B 2GN8A 4OHKA 3I04A 5TGZA 2QTBA 4UHCA 4YAGA 3UYKA 4RTQA 2I0FA 1U11A 2HTFA 4QXOA 3LF1A 1JQDA 2XB9A 2GARA 4MQEA 3HJCA 3P9QA 4AS2A 2ZYWX 4G85A 1P33A 5TEWA 4CQNA 2BIFA 3A2NA 4DNOA 1SBYA 3V55A 4UVIA 5D5QA 2J32A 2OCIA 4MPPA 1ADYA 2FMIA 1I6LA 1FQOA 2W6NA 3FHLA 3CFYA 4S35A 4CF4A 4LZAA 4EB8A 2AW5A 4DLTA 1K88A 1V2HE 4IXMA 1NJGA 4R31A 1M66A 2ENUA 1TYEB 3H4MA 5GONA 3HS3A 3H5IA 5I8WA 4Q66C 5K09A 3A9CA 5LYJF 1XRMA 2D2FA 3I6BA 3RYIB 4A10A 1QJCA 3AF3A 3QMMA 3OTGA 4KJXA 1XZIA 4JI8B 2JRLA 3WSWA 4F0JA 2RKBA 2WICA 2KBFA 1KYWA 2ZR8A 3GEGA 4M49A 1LBIA 3DV9A 4OM8A 3SAJA 5L6LB 4ND7A 9LDTA 4ZVQA 2ZRCA 3S1AB 5LZ2A 4WCFC 1ICEA 4KAJA 3KQHA 3TQCA 3N70A 5BVGB 3MCZA 3NAMA 4HQRA 2DR0A 1S2MA 2OXTA 3VR4A 3Q41A 4ANFA 4N47A 2OVFA 5FCDA 2WPNA 2W00A 3I2FA 1BJRE 2OHOA 3A06A 2P62A 2H1SA 3QFRA 4LDZA 3A0UA 3RTBA 5J2TA 1ZN8A 2ROQA 1RZRD 2AZXA 3OZRA 4MQLA 4XIGS 3H65A 5KAMA 3UZUA 1Z4OA 1P7ZA 1V7CA 1PWHA 1KJ9A 3IT0A 3BILA 3CKLA 1GTZA 4LMPA 4PM4A 1K3UB 4P5DA 1F9AA 2G7ZA 4EW3A 4JMLA 3ITEA 2BKUA 3DHVA 1XLTC 3EVGA 5GWXA 2X9GA 1KVRA 2BJWA 3N05A 3Q0IA 1WXFA 3LSYA 4QPPA 1Q83A 2R8XA 4QODA 5JANA 3STVA 1WWKA 3F4KA 1A9YA 3B3AA 1JDTA 3ORYA 5DP1A 1KSFX 1SCDA 1Q21A 3IPLA 3PITA 4M88A 4AURA 1V2GA 1P0QA 1FTWA 3VKVA 4MWZA 3GX1A 3IPYA 2CBZA 4BNIA 1SHLA 2VWQA 3FYSA 3LDGA 1G17A 3CRW1 1IDOA 1POXA 3LUGA 4MRSA 5DBOA 5DCUA 4TTAA 5DM2A 3ICEA 1OB2A 3S2GA 4M38A 2J33A 2XRMA 4LAFA 2OBXA 4UNPA 1RPTA 1J6UA 5LIRA 2NAPA 4N5MA 3F8TA 2VP6A 4Y9TA 3MWEA 4G8CA 1FNDA 5DNEA 3M6AA 3O92A 4BMOB 3ICCA 5JXHA 5JD6A 1O6FA 4TXMA 2QRQA 2HHJA 3BE8A 3MINB 2JGRA 4HDSB 3IQEA 3KV3O 1P1RA 4IRUB 1HDOA 4LZLA 5F2EA 2X0DA 2YW9A 1E89A 3LQYA 1R5JA 3E9ZA 3SXJA 1CXZA 2XOXA 1ZM2A 3LOUA 4JUIA 3ZXYA 3DO6A 2IIVA 1P60A 2IXTA 1G8YA 3FLAA 3TNLA 3VAZA 4BDSA 3DZDA 3K2QA 3UT6A 5HDQA 2RC5A 3C15C 3KOOA 4PLTA 3TZ6A 2MYPA 3JYHA 1OWPA 1E1RA 4QAQA 4UD6A 3ROFA 5EP1A 1GKYA 2PEZA 1OI2A 2W8BB 3CUEF 3WNBA 3KYDA 3Q6IA 5B1EA 3S2IA 3W90A 2ONYA 4MB2A 4CIAA 3UEOA 2ZAYA 1YR8A 1WUTA 4KAFA 5B3AA 1EBUA 3I72A 1W4AA 2QX6A 3AL2A 1ETUA 2KBEA 4HEQA 4D4KA 1NBEA 3U39A 4UPEA 1X70A 3W8FA 4F56A 2I4MA 1T36A 2XBMA 1GU1A 2PFGA 4KO1S 3THXB 2X1HA 5C80A 1G60A 4N3GA 2Z2KA 2PRZA 3L5KA 4KR9A 3B60A 2WZDA 1BHJA 3WHKA 3U4HA 1RWNA 3QG5A 5HJ5A 1ZH0A 4MZDA 1Z08A 5AKGA 5C52B 3CVOA 1KZ4A 2OP1A 5TT1A 4TYQA 2HMWA 3RBZA 1YZ3A 2XDYA 1UDWA 1WBJB 1AGRA 5DGCA 2P65A 4QNRA 1DBRA 3FYCA 3TRDA 3TRFA 4MAMA 6NULA 1RJGA 4MJXA 1VJ0A 3MILA 4W9RA 3UICA 4CTMA 2RC6A 2QN9A 4I99A 2G09A 4CCYA 1P0PA 1COWA 4I6JA 1GL6A 3RVRA 1FSPA 2JDID 4RSGA 5ECYA 2MSEB 1JPUA 4N0QA 1CUSA 4ZMBA 3LA6A 4Z7OB 2C61A 1XL1A 4HADA 4DRXB 5LMNB 4MQ6A 4PZDA 3C1AA 3VHLB 1WXDA 2RGCA 2C5LA 4CZ2A 2PKWA 3LDUA 2FRDC 2VDMB 1EUCB 2P9EA 3BEOA 3DVLA 3FBTA 3FTPA 1Z7WA 5JAUA 4ARBA 2JNWA 3JQCA 5K0ZA 4JUBA 3HG7A 3L4SO 2ZUEA 4EP1A 3FBGA 3C8UA 2QN1A 1Y4DE 2CJWB 1U4SA 1AGYA 5B7PA 2UDPA 4YY3B 2A3RA 3FFXA 3DLPX 5FNVB 1KVTA 1NXWA 4M36A 4DCGA 1NN3A 4G56A 2RG7A 5C3MA 3TL6A 4H3KB 1O95A 3DXZA 4B73A 1H5QA 4LZPA 4A03A 2HMUA 2QMHA 3CEHA 1NQ5A 4K9DA 1VE3A 1L4LA 3PRYA 3O90A 3S7TA 2QDKA 3DP9A 2IGTA 4RTKA 4GSLA 2QOEA 1U0JA 2R25B 4PYOA 2CVPA 3ESAA 1LD3A 4J2OA 3E4CA 4LY9A 4TM7A 3PICA 4YACA 1E9VA 4YMTA 4BFSA 5JC1A 3DDCA 1S89A 1A2KC 3W5VA 4PG6A 4LV5B 4KCGA 1UBTS 5JDCA 3O9ZA 4G5HA 2BAGA 2P8SA 4MWBA 2W9XA 1GCUA 3V4ZA 3LS2A 4GG1A 2J30A 2I2AA 4HC4A 4ZOCA 1ES9A 2MHCA 2GN1A 2YNMD 3OHSX 4GU5A 4MUGA 1BVRA 4OQDA 4OYYA 4R3WA 4H35A 5CFMA 3T3IA 4WXPA 4XVRA 1N2SA 1VZ2A 3MWDB 1T2NA 5BQXA 4KX5A 2ZROA 4L8VA 4E21A 4Q19A 2AF4C 4X3OA 4AJ4A 5EHQA 1CW2B 4JODA 1EFPB 1ONOA 1MOZA 3OKCA 4Z9AA 4Q1BA 3DZ8A 2IOHA 2R5NA 1W0KA 4JP1A 2IH5A 2VTBA 1SIWA 3D4BA 5AVQA 3ZU6A 2H1OA 2FW6A 4NXNB 1D8AA 3EVCA 1W5AA 3GLQA 1AVTA 4M99A 4BO5A 3I04M 3I09A 2UU9B 4ZA2A 3CWZA 2GBIA 4C0HA 4JUFA 4RVOA 3HV0A 5B3LA 1CULC 1DTWA 1P1KA