2PBFA

Crystal structure of a putative protein-l-isoaspartate o-methyltransferase beta-aspartate methyltransferase (pcmt) from plasmodium falciparum in complex with s-adenosyl-l-homocysteine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
218
Chain Sequence
b'ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGIIKDRLFDVCFVSLKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate O-methyltransferase beta-aspartate me
molecule tags Transferase
source organism Plasmodium falciparum
publication title Crystal structure of a putative protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase (PCMT) from Plasmodium falciparum in complex with S-adenosyl-L-homocysteine
rcsb
total genus 73
structure length 218
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pbfA00
1R6AA 4DCGA 1SVUA 2AOTA 3HVJA 3LHDA 4GOOD 2ZBPA 3I5UA 3DMHA 2FPOA 3G5TA 4QTUB 1INLA 2AS0A 3FPGA 3B3JA 3O31A 3EVBA 1XVAA 1NW6A 3FRHA 5DPMA 3RIEA 2PSSA 5LQRA 2I9KA 3GNLA 3SSMA 2UYQA 2XBMA 4C08A 2OY0A 1KR5A 5DTQA 4PYQA 1SUIA 4PYNA 2HR1A 2NP7A 3NW9A 5HIJA 1WY7A 2QM3A 2KW5A 3EVCA 4PYIA 3IHTA 4WVLA 5EPEA 1PRYA 2PJDA 1N7IA 1M0EA 4RVHA 1NV9A 1SQGA 3EVDA 1G38A 1XDZA 3MERA 3MTIA 1JQ3A 4Y30A 10MHA 2PKWA 3LDFA 4KW7A 5LQJA 4YMHA 1N7JA 1KIAA 3ER8A 4MQ4A 4PCAA 3NVMB 2IGTA 2P7IA 3SGLA 3RODA 2JJQA 1BHJA 3DOUA 2AN3A 1XTPA 4EVIA 1L3BA 4P7KA 3MAGA 4ER6A 5D1HA 5P8WA 3I64A 1RI3A 2ADMA 2WK1A 4PCLA 2I6GA 2IBTA 2G70A 2PXCA 4HGYA 3UJDA 3O7WA 4IV8A 1RJGA 1EQAA 5EKXA 4QTTB 3FTFA 3NJRA 1DL5A 1AQIA 2PXAA 5HIKA 3MCTA 3EGVA 1YF3A 3LDUA 3LBYA 3DXXA 5K8VA 2OB1A 1VBFA 1RI2A 1T43A 4GBED 3TMAA 3FUXA 3VC1A 5CVUA 5BXYA 5M5BA 4HSGA 4RTNA 2IH4A 1M6YA 2ZWVA 1JSZA 3DR5A 3KHKA 4C4AA 3UBTA 5MHTA 5DRYA 1O54A 2IDJA 2PLWA 4GOND 5LQKA 3EGIA 2P3OA 1P1CA 4E32A 1F3LA 3KQPA 4BY9E 3PB3A 1SG9A 1JG4A 5E2BA 4HH4A 4E2WA 3I58A 5KYGA 3OPNA 4MTLA 1JTFA 5FWDA 5GINE 2C7OA 2ERCA 2FCAA 5CCXA 3DMFA 3HCFA 3GRUA 5HIMA 4DF3A 4YMGA 2CKDA 1TPYA 1M6EX 2GPYA 5CM2Z 1L3IA 3BGIA 5K0JA 7MHTA 5GIOE 5F2OA 3UA4A 2O07A 3FUVA 1KHHA 5KVAA 3CJTA 3AJDA 3G2OA 4OBXA 1NW7A 3SR4A 4AZTA 4BP3A 4C06A 4DCMA 5IKMA 3LECA 4HRAA 3B7PA 2BZGA 5CD1A 1WXWA 4FT2A 4PIMA 2IDKA 3EVEA 5DXAA 5HEKA 2BH2A 1P91A 1JG1A 3FYCA 2H1RA 1X1BA 4KDCA 3KQVA 4POOA 4KIGA 4FS8A 3E23A 5EVJA 1QZZA 5DSXA 3M33A 2YQZA 2R3SA 3BGVA 5E9QA 5T67A 3X0DA 4DMGA 1G55A 3LX6A 4QQNA 4PYKA 3SSNA 4DA4A 4RTMA 3GGDA 1PJZA 2P3LA 3HCBA 4GOLD 4V0RA 1KPGA 3TPZA 4PYJA 1QYRA 4HC4A 2XYVA 4XUCA 2WA2A 4M36A 4ER5A 3OE4A 3UJ6A 3EMBA 4M38A 4LECA 2ZCJA 3S68A 5EOVA 3JWGA 3V97A 4FGZA 3KR1A 2AVDA 5K0GA 3HEMA 5GM1A 3A7EA 3SVZA 2GAFA 2PX8A 4PNEA 1SQFA 1YZ3A 5EMMA 2YUIA 3REOA 1XXLA 2AOWA 2JHAA 5FULA 4RTRA 4ISCA 1XJ5A 4EKIA 3G7UA 3LGAA 5GOZA 5F2NA 2PBFA 3NDJA 3BXOA 2V74B 4X61A 1AQJA 4KWCA 2JG3A 5DX0A 3KR0A 3FUTA 1UIRA 3GIWA 3Q7EA 5CVVA 3KQQA 3T7SA 4YV0A 4QDKA 2P35A 1QAQA 3IV6A 5ICCA 3NTVA 2K4MA 3PX2A 3AXTA 3R24A 5CUQA 3ELUA 1NE2A 4ER0A 1XCJA 4EK9A 3GRYA 2AZTA 5EKUA 2B9EA 5DRTA 5E8RA 2C7QA 4YUWA 2EJUA 2QE6A 1WG8A 3E7PA 3I9FA 3PX3A 3HTXA 1UFKA 4E31A 3KPJA 3P9IA 1L1EA 3UJ7A 3GO4A 4RTPA 2HNKA 3OZRA 2XYQA 4X1OA 3R9XB 3MB5A 2NXEA 3P9KA 2B78A 1AF7A 2GS9A 2OBFA 3CJQA 4IKPA 4QQKA 5E9WA 4BLWA 2YVLA 2PWYA 4OA8A 5HFJA 3EVFA 3HNRA 3P71T 4CKBA 1YFJA 2ZIFA 4C03A 4GC5A 3V8VA 2AOVA 5K03A 2ZIEA 2N47A 2IP2A 2CMGA 2ZZKA 1ZGJA 4KRGA 3RW9A 4AZWA 4CTKA 2EX4A 4R8RA 3SM3A 1NT2A 4BLVA 2FK7A 2Y1XA 3K0BA 4LWOA 2AOUA 3SX0A 3OCJA 5LQCA 2UYCA 2UYOA 1JTEA 3LKZA 4M7RA 5U4XA 3GRZA 3DMGA 1QANA 1B42A 3OFKA 4MIKA 5DX8A 5EMKA 5K0LA 4CWAA 3GDHA 5LQNA 2IH2A 4FP9A 4R05A 1EAMA 1G8AA 4XUDA 2PX4A 3G89A 4FT4A 5DSTA 5FHRA 4E33A 2YXEA 4EMSA 4V0QA 3EMDA 5GM2A 5C0OE 2VDWA 1VQ1A 5KQSA 3FZGA 3EEOA 4Y2HA 1RI1A 3KQSA 3TKAA 1XDSA 1D2CA 1YB2A 4E2YA 3OE5A 2PVCA 1X1DA 1X1CA 5HOQA 3I53A 4DM3A 5KS2A 2PT6A 1IY9A 4QPNA 2IH5A 3O4FA 3P2EA 2NXJA 3DULA 4EQZA 4BLUA 3C0KA 4FR0A 2BR5A 1R00A 2EJTA 4RX1A 5E1MA 3FPHA 2HMYB 3T7RA 1X19A 2FRXA 1KPIA 2P3QA 3MQ2A 4PGGA 1ZHFA 1X1AA 3ID6C 5CVEA 1BC5A 4O29A 1L3CA 1WZNA 1G8SA 2WA1A 5DWQA 3PT9A 2O0LA 2VZ9A 2VDVE 2LD4A 1ORHA 1KYWA 3C3YA 4NECA 3OZSA 5D1NA 2HTEA 5K01A 4PWYA 2OYRA 4EKGA 1MHTA 3HM2A 3UFBA 3FTCA 1ORIA 3FPJA 5EHIA 2AOUB 3DXZA 3EEYA 5EMLA 5H02A 1NBIA 3T0IA 2ORED 3A26A 3DTNA 5K0CA 5E1DA 4E2XA 4PYOA 4DKJA 3OU7A 2G1PA 5IH3A 3CVOA 3KQTA 1DCTA 4FSXA 2ZLBA 4F85A 4XUEA 3UJ9A 4LWPA 2QRVA 3CCFA 3P9NA 3R0QA 3R3HA 4HTFB 2IIPA 4X63A 1Z3CA 4L7VA 2ZFUA 3P2IA 5E2AA 1F38A 1VPTA 2PWPA 4U7TB 1RJDA 4RV9A 4PGHA 4K6MA 3UWPA 1TW2A 3JWHA 5EGSA 3DXYA 3HVHA 4OX9Y 3BT7A 3H2BA 4PONA 5FQNA 2OO3A 4IV0A 3ERCA 2UZ4A 4PIPA 4KVZA 1BKYA 2GH1A 1UWVA 5FWAA 2ZZNA 5E1OA 4GC9A 1ZG3A 3G8BA 4BP1A 4GQBA 3M6VA 3NDIA 5K0BA 4YUVA 1OR8A 3DLCA 2P1DA 1G60A 1EG2A 1ZGAA 4ATNA 2IBSA 2I7CA 5EIFA 3T7TA 1R74A 3E05A 3LCVB 3HA7A 1FBNA 5LSAA 3LL7A 1FP2A 3HCDA 4AZVA 2NXNA 4WXHA 1TW3A 2VS1A 2JH8A 3TOSA 2O57A 8MHTA 1D2HA 2PV0A 4C07A 1KPHA 5JR3A 2NYUA 5EIWA 5JUWA 1O9HA 2G72A 3LCUA 3TM5A 3FTEA 3CC8A 3M4XA 1RJFA 3PS9A 2JH9A 3HP7A 4LG1A 2Z6UA 3HVKA 4P58A 2Z6QA 5K0NA 3OU2A 3P9CA 3OU6A 3CKKA 1KP9A 2YTZA 4CTJA 2VDUE 1VP3A 3THRA 3TQSA 1NBHA 3KR2A 4RTJA 3PTAA 4GOMD 3AWIA 5T6BA 2NNWB 3VYWA 1QAOA 4YUYA 3Q87B 2HWKA 4FZVA 1ZKDA 1HMYA 5BP7A 3U81A 3BWCA 3JWIA 1BOOA 5DM1A 4ER3A 1NKVA 2G71A 2G8NA 4JXJA 3BWYA 5DTRA 4UOEA 1NV8A 2YXLA 3C6MA 2V7EA 2XVMA 2BR3A 1SUSA 2B25A 3B3FA 1H1DA 3KKZA 5KQRA 1VIDA 3BWMA 3FRIA 3QOXA 1Q0SA 3MTEA 5ICFA 5BW5A 5HIIA 3ANXA 5FA5A 3GCZA 4GF5A 2UYHA 5G02A 3UZUA 2C7RA 3FUWA 4AX8A 3UJAA 5K05A 2H11A 4R6WA 2AOXA 3G2QA 5GWXA 2AR0A 2P41A 1U2ZA 3FUUA 1R18A 2OKCA 3HCAA 4H0NA 3DUWA 1QAMA 5EEHA 3WSTA 5BW4A 5FHQA 5GIPE 2ZZMA 2Y1WA 5CCBA 4YV2A 2I62A 4YV1A 1SKMA 1FPQA 4RVFA 5HZMA 3OFJA 1RJEA 3LCCA 4X41A 4MHTA 2F8LA 3MCZA 2QYOA 1XCLA 2YXDA 3FPEA 2JHPA 4OBWA 4OQDA 4QDJA 3KPVA 2ZTHA 1R8XA 4HG2A 5FA8A 1JQDA 3NVKI 1VP9A 3UA3A 3HCEA 4IWNA 3VC2A 3E8SA 5LR6A 3THSA 3L8DA 4OA5A 2CMHA 3VSEA 2C7PA 3ELWA 4P7GA 5F2KA 4F86A 2Z6AA 2H00A 5DM2A 1YUBA 2BM8A 3MHTA 5DX1A 5DTMA 5ERGB 4OQEA 2ONYA 3HCCA 3NWBA 5K0EA 2DPMA 3KPWA 2PT9A 4PYMA 4U7PB 2BR4A 3EVZA 3TLJA 4YUXA 3B5IA 4QVKA 4DQ0A 5EMJA 4M37A 3NWEA 4RTSA 2NXCA 5EEGA 2ESRA 2EG5A 3GXOA 3ELYA 5EC8A 1I1NA 2BM9A 2P8JA 5FQOA 1I9GA 5ICEA 4AZSA 3FPFA 1AV6A 2ZULA 3LSTA 2IPXA 2A14A 2PY6A 4RTKA 3CBGA 1NW3A 3TR6A 5CVDA 4RTOA 2AN5A 2ZVJA 3HA3A 4DZRA 5E9JA 1ZQ9A 3TM4A 2AOTB 3F4KA 3B3GA 3G2MA 3LKDA 3ORHA 2AVNA 2JHCA 5CVJA 1FP1D 3P2KA 3ME5A 1FJXA 1JSXA 1N2XA 5FTWA 3M70A 2IFTA 3LBFA 4B17A 3G2PA 1JQEA 1D2GA 4RWZA 1NW5A 1Q0TA 4G56A 4XCXA 1EJ0A 2FHPA 3G8AA 5ICGA 2B2CA 4GEKA 5DLYA 4C04A 3ER9A 3DP7A 3QV2A 3HA5A 2YX1A 3EPPA 3GRVA 4C05A 3IYLW 1WXXA 2PX2A 3FTDA 3P97A 3UJBA 3KU1A 4F84A 3C3PA 2OZVA 2ONZA 4QPPA 5EZSA 3BZBA 2VP3A 3OZTA 4P7FA 2GLUA 1DUSA 1EJ6A 1XDUA 3LPMA 5DXJA 1JG3A 2R6ZA 3BWBA 4PINA 4HTFA 4ZTBA 5HILA 2XVAA 2XYRA 2OPBA 3KQWA 1JR4A 3TFWA 3DLIA 5EZQA 4MWZA 3KPUA 1I4WA 4HGZA 5B1SA 1G6Q1 2P40A 1O9GA 1WS6A 3SSOA 2GB4A 4RSRA 4CXMA 1RI5A 2ZIGA 3UJ8A 5EHGA 3BKXA 4R6XA 3BUSA 3A27A 1R8YA 2O05A 3D2LA 3A7DA 3P8ZA 1MJFA 2CWWA 3SMQA 2E5WA 4RYLA 2AN4A 2CL5A 4CKEA 2O06A 3LDGA 9MHTA 3KPYA 3FYDA 3UJCA 4Z2YA 1KXZA 4RVGA 4R8SA 3K6RA 2PGXA 2P7HA 3CJRA 3HVIA 1VLMA 4QVGA 5FCDA 2YR0A 2OB2A 5EQJB 5C1IA 5LQAA 3A25A 3TKYA 3CGGA 5EG5A 4E70A 4A6EA 1RI4A 1VE3A 5E1BA 3QOWA 4E2ZA 2ZBQA 5K0FA 1Y8CA 3KQYA 5CIYA 4PYLA 3GJYA 2Q41A 1YFLA 2ZSUA 1JG2A 4X60A 3SXJA 5C9ZA 3M6XA 2FK8A 2OXTA 4P7JA 3MGGA 3G5LA 3TRKA 1IM8A 1P1BA 2PX5A 4KIFA 2QY6A 1EIZA 3IEIA 5DT2A 4AUKA 3C6KA 3M6WA 3NMUF 5DM0A 3AY0A 3KR9A 2ZWAA 5FADA 3BGDA 4RVDA 5T64A 3GRRA 1NW8A 3KQOA 3AXSA 3EGEA 3GWZA 2B3TA 2FYTA 3DH0A 3M6UA 3KQMA 3A4TA 1YZHA 3G88A 3JWJA 4KDRA 5GP1A 1HNNA 3EVGA 4CKCA 4A6DA 2QRVB 3ELDA 3EVAA 5LQUA 2DULA 4FSDA 2GA9A 3BKWA 5E8JA 4RTQA 5K09A 4GUAA 1P39A 4E30A 4ER7A 2NP6A 2ZW9A 1KYZA 1V39A 2EFJA 3GU3A 3PFHA 4RTLA 4YUZA 5FUBA 1L9KA 1VL5A 3B89A 3PLAE 2HV9A 3PFGA 3PVCA 2ZBRA 2PXXA 1IXKA 3R6TA 5DM4A
chains in the Genus database with same CATH superfamily
2ZVDA 1Q0PA 1D07A 1V8OA 3VPAA 4ZCPA 5FI5A 3IAAA 4ZO7A 3NHZA 2IXGA 2I3ZA 3I5UA 3Q9UA 2GQ0A 2P27A 2IPNA 1B8PA 2L19A 2WAXA 5DFAA 2HFKA 3QXXA 5ALHA 5LZ7A 3S8EA 4IF4A 1JKJA 5CT8A 1V41E 3N59A 1QONA 4M76B 4FNAA 3HCOA 4HDNA 4OI2A 4U2CA 3AUTA 3GNLA 3RVPA 4EVQA 3HN2A 1EFLA 2LUOA 3K0AB 4M60A 3AEKB 4MV7A 3I62A 3NEJA 4DANA 3IALA 1PRYA 3H1TA 3I6IA 3M81A 4EHAA 8ATCA 4W1SA 1G38A 2RI6A 1XDZA 1OCEA 2Q0SA 2W2XA 1Z16A 3ZHSA 4GZLA 3I9MA 5T5QA 4TQGA 4MWSA 4U00A 2P91A 3VYSB 4BQSA 3AR5A 5AOVA 3S27A 2X6QA 4LFBB 1ECFA 3I01A 1J0XO 4E12A 4K7JA 1VHWA 3HJUA 4UBIA 3SEAA 3LTNC 2WTAA 5JEDA 2F90A 2JJQA 3U3DA 1SPBS 3BF7A 2HQBA 2HJ9A 1I4EB 2OZKA 2VJBA 1PSZA 2QD3A 4DDHA 3UKDA 2VF7A 1YT5A 1UK8A 4JT4A 2AQ8A 2KS6A 1XA3A 3O8NA 1NIJA 2FSSA 1XZCA 3ESQA 4QNRA 2BMVA 3O74A 1R5OA 3WV4A 1EFKA 4E7PA 2ZRFA 4LY9A 2HPHA 4U2GA 4XWTA 3LQRA 1KJYA 5IC6A 3BJMA 2WNHA 3LBYA 5BSFA 4I5FA 3KQNA 1JJ7A 1KZGB 2OB1A 4AXBA 3IT3A 4R51A 4QPDA 1QQ6A 3R4VA 3RCBA 1LNSA 3BXEA 4B0OA 2UZ0A 5MHTA 4R3WA 2PR7A 3E48A 4WCFB 1AGNA 3V6LA 4BKMA 4TLCA 4N6NA 3U3ZA 4K9KA 3EFOA 4F3KA 1PFYA 2V65A 1E2MA 4NOJA 1MW9X 4AIRA 1QIEA 2HT6A 2P9BA 2R8BA 1IXSB 1V7QA 2IE0A 2X8AA 3ENZA 5IAJA 3I58A 3VVCA 5ICMA 4EO7A 4WZAB 2YJ4A 1TLFA 4X84A 4YI5A 2V6BA 2Q3CA 1FSPA 2I67A 2IV2X 2Q49A 2RHRA 4DR1B 1X3SA 4LJ5A 3GVIA 5DGIA 4TWJA 1TQ6A 1OKKD 2QTFA 1C7EA 3A1TA 3I4CA 5CR9A 1P74A 3PHHA 3N2KA 4EY3A 4TVBA 4EPVA 5FTLA 2F8TA 4XDYA 1RKQA 4PS0A 3Q41A 4HRAA 4B79A 5HSGA 3QXHA 1QH1A 2QMZA 1TJ3A 1A77A 1DEKA 3QE4A 3MFQA 5D86A 1SHUX 1B8OA 3TDMA 5AKHA 2QL6A 1XTJA 3KQVA 2ODAA 4PAGA 5LYYA 4OJTA 3E23A 1ZMXA 1USIA 1Y6ZA 1TTPB 1VDZA 4IQGA 4RQUA 4TV8F 3HN7A 3OPYI 4UZFA 3SSNA 2EL7A 2H1FA 3GGDA 1S2GA 4GOJA 4AMUA 4WXMA 4ZARA 1RZUA 2WHRA 3GEEA 2GZ2A 1NVVR 1GITA 4O2AB 4Y7DA 2H08A 3MT9A 1CFZA 4BBZA 5I4IA 2XR1A 1JN0A 1Y8QB 3IODA 1AZSC 3LOUA 2B1IA 2J5XA 2XOKD 3H2IA 3SVZA 4D41A 1AGRA 1D2MA 2EDAA 2NGRA 3HJHA 1OLXA 1XRSB 3H65A 5I9IA 1O6GA 5M3BA 1LQUA 4R1UA 2JD1A 4ARZB 4EKIA 1QH0A 2ZTUA 3LGAA 3HDYA 4ASUD 1DX9A 1G0OA 1TFUA 2HQOA 1L8OA 1XDWA 2JGMA 2FW7A 3L1IA 3ZK9A 3PL1A 4Y3UA 4D97A 1C29B 4OAQA 4Q15A 1FZQA 1SXJE 3T7SA 1GOTA 4S1VA 1I0LA 2K4MA 4PR3A 2QZ9A 4P84A 4CT5A 3QEMB 4L8VA 5IDXA 2FKAA 4EK9A 4YASA 3UMYA 1QPBA 1T4GA 2Z5VA 4B8YA 5MFPA 2NZVG 4I5EA 3PX3A 3WQHA 4BMPB 4D9EA 2W93A 4R8VA 5ECGC 1YSCA 3RRFA 4C78A 2OSBA 3A4MA 1R4ZA 3GPLA 3GEPA 2XDAA 1XU4A 2C84A 2XNDD 2IV3A 3STYA 3T5CA 3R9XB 3OT1B 2OO7A 1NQUA 1SWWA 2OV1A 3HQ4O 3MB5A 4MDFA 4BECA 3U6KA 2FJUA 1PL8A 4UFPA 1L5KA 4JEMA 2F8MA 3NGLA 4Y7CA 1IULA 1B1CA 1EP1B 4JL5A 2QT0A 4MS1B 1AQLA 3DZHA 3N8DA 3LXRA 1N5RA 3AIIA 3BD6A 4DT1B 4YAGA 3WWZA 4A26A 2XXJA 2G83A 4N6OA 5IJ9B 3SDZA 2WWWA 3OIDA 7REQB 5D5HA 2WHEA 1FRQA 1PYDA 4D82A 1W36C 5LQCA 2D6FA 3KS9A 1W5SA 3G2KA 4P3PA 4MW7A 2XDWA 4EAAA 3DDOA 1YBFA 3N5KA 4UHFA 3DJYA 3K0FA 1W1WA 2ISCA 3QNUA 4JWTA 2I76A 3G89A 1BEUB 4LUCA 4Z51A 1E2HA 1GNRA 3FLAA 4IHQA 5KVAA 5HKOA 1YJBA 1DO2A 2VDWA 2GARA 3CZAA 3DKVA 3DE1X 1AIPA 2Q0XA 3UMMA 1SC4A 1Q6YA 3AUAA 4WNIA 3W9SA 1CEYA 3SZUA 4E2YA 2N3ZA 1JB1A 5LJIA 1CY7A 3I53A 4R2KA 2ECQA 2NQ2C 4BMVA 1E8NA 2VUUA 3DE0X 1LFDB 3L9XA 1CERA 5JS1A 2B2XA 1QS0B 4LZLA 2JLYA 2JFQA 3L1HA 2HMYB 5JTUA 1WF3A 2MINB 1RIFA 3TLAA 4RK4A 2MSNA 3ID6C 3EIQA 2Q4OA 2FLVA 3DYIA 4M83A 4ZFNA 4A3SA 1QP4A 5C1BA 2RB5A 2O2YA 1CQIB 1X8KA 4MJXA 1T26A 3OLXA 4X1KA 1KYWA 1N2CA 1QUFA 2AYXA 2Z3WA 3KKLA 2C54A 3OCVA 5DHAA 2F1OA 1U9YA 3H5LA 4II2A 2OYRA 2EBHX 3TTWA 2ZT7A 3JYHA 1LEHA 2WFLA 1ULTA 1T6ZA 3PTZA 3VKVA 4EF4A 3PYXA 3SYMA 2PWAA 3R8FA 3A26A 3DTNA 4HX9A 4ZYZA 4HQRA 5GAJA 3B2EA 4DKJA 1MRNA 2J4FA 3CVOA 3IPXA 2H4HA 2ZXEA 2C1EA 3BORA 2CVPA 3F3KA 3OIUA 4LWPA 3HY4A 1ESMA 2VXYA 3AOEA 1SVOA 4I1UA 4X63A 1Z3CA 2VK2A 4AO8A 3ZHRA 3NGXA 4X6XA 1RD4A 5JJCA 1KJJA 3TW8A 4I4LA 3Q6NA 5F7JA 4DILA 1A8HA 3BT7A 1A4RA 2H4JA 1IXZA 3M49A 1ZN9A 4DPKA 1Y4ZA 4WXYB 3A04A 4OHPA 4UBKA 3DMDA 2X42A 1FS6A 4OM8A 1WABA 4QL3A 1RXSA 4X7RA 2NUPA 1WKVA 5LLSA 1A8IA 4M7OA 3QE0A 9LDTA 5I4BA 1M7HA 3BXHA 1CQZA 1MN6A 4OM7A 2FE4A 4B8ZA 1E1YA 1HE3A 3LL7A 3QE3A 1ML4A 4X66B 5IANA 4XDGA 5JAUA 3VHXB 1ID1A 1Z7GA 1X1RA 4N8EA 4C3UA 2JAUA 2C2WA 3ZYCA 5AJXA 5K5EA 1D2HA 1I51A 5GGYA 4Y2XA 4EF5A 2IHZA 2WBLC 1BS2A 1DAFA 5FI3A 3PE4A 3DYBA 3DCJA 2CGEA 1K7SN 2ZPAA 3BTUA 5DK4A 4DMFA 2I2DA 2R6HA 1XMJA 5FBZA 5IBQA 5KCMA 2VAMA 4OL0A 4BCDA 2CXHA 2IU4A 2XIJA 4JWKA 4N3CA 5AJTA 3ZVRA 4DIDA 1SOUA 3U26A 3WLTA 2P4HX 2QMYA 3KKMA 1E92A 2OWDA 2HT1A 2PBLA 1NBME 1WMAA 2Q5CA 5LBTA 4TRJA 3UV3A 2IX3A 1L8LA 1Y3FE 4FXPA 2XEXA 5DTEA 3SXUA 1EDZA 4PO8A 1KQPA 3DAPA 3K31A 1P7VA 4MA0A 5IFKA 1XA4A 2ZRLA 1TM4E 2ATXA 3C2QA 1ULHA 3HEBA 4HMQA 2PVSA 4XCQA 4Q4JB 2PS0A 2SCUA 1GKUB 3FGZA 2H4WA 3O91A 3HZHA 3OF3A 3SP1A 1Q19A 1NONA 2FPWA 3D6UA 3DOFA 1TT5B 2BCEA 3O26A 2QS9A 3CUSA 4JITA 5FOUA 2C7RA 2G9QA 1K89A 2NSLA 4BX2A 5EKSA 3M4YA 2AOXA 4DM7A 1DGQA 1LPBB 4HLDA 1JHYA 1SHKA 1G6KA 3E61A 3TSWA 1AZWA 3PFWO 4LJ9A 4YRAA 4ZI3A 4TWBA 1NR7A 3W2EA 2B6HA 1OAAA 2BLLA 4YMIA 5KJCA 4MRSA 1U0HC 3TRDA 1HC7A 2ILTA 1YTLA 1M10A 1Q1ZA 4KO3S 2G5PA 3KYDB 1Q20A 1O58A 1GJRA 1E79D 4OQDA 3GCDA 4Q7EA 4WIAA 5AM1A 2Q9CA 3B6JA 3FWHA 5HJEA 5KYWA 2L69A 2EHJA 4L4ZA 1UKCA 4RFSA 2EGUA 3TLMA 4A5OA 1JQDA 2JIDA 3A0RB 3EA4A 4GGOA 5HKAA 4OG2A 3ZWOA 3ZXYA 2P6NA 2V7BA 1M73E 1H0RA 1YJCA 4DWVA 3V7FA 5HKKA 4L3VA 4Y6RA 1GUDA 4J1SA 3UATA 3PFKA 4LXUA 4TLLB 1MENA 1JDPA 1GAQA 1K7YA 1WTCA 3IP3A 5EE5B 4AROA 4QWWA 4BHTA 1XC7A 1CX9B 1PEDA 2G3YA 2WG2A 5BN5B 3U48A 3ZJTA 3X1JA 4HRYA 4EUEA 2HF7A 2NXCA 4A9AA 3C7TA 1M2VA 3AZQA 4FFVA 1Q3KA 1IEXA 2NG1A 4F8EA 5ITWA 3LBNA 3PF8A 4DLTA 1DAIA 4EW6A 1G2IA 4M3NA 2CLKB 3SDSA 3NT2A 3DV0B 3KKPA 4BOYA 2W6JA 4ESEA 3NAMA 3ZWKA 2WVAA 1IUNA 4BUZA 3PXBA 2WU8A 3TM4A 1KK0A 4G9BA 5HUJA 4N82A 1CP3A 5L7YA 3FCEA 3OZXA 1LVHA 3VRHA 3KJZA 4Q37A 2PKYX 4B3FX 1RPAA 5JSUA 4WGFA 3RIHA 3TB6A 5A0FA 3EFOB 4D2IA 1DFHA 1NJ6A 1D2GA 1QNLA 4BVJA 3BCSA 3HRIA 2WWIA 3AM4A 4DLPA 2FHPA 4BFVA 1Q6ZA 4W99A 5ALPA 2CL0X 4JIGA 4EUKA 3O8BA 2BV3A 2CLCX 4NYJQ 2QU7A 4C0BA 1Z7EA 4BASA 4MNTA 3F5FA 4CFSA 1R0ZA 3C3PA 4FNMA 2D00A 1E9VA 2BOVA 2PRYA 2JGFA 1BW9B 1T2FA 4M4SA 5HIAA 1OROA 4YJ2B 3FUCA 1YL7A 2QL9A 4ZK6A 2X40A 3H7IA 3M5CA 5BR4A 5KSWB 3TK1A 4N76A 4D3SA 2YXNA 1TE2A 4IPTA 4ZTBA 3I83A 2XVAA 3C6ZA 1G17A 2R65A 1AN9A 4GQIA 2ZJ6A 3T0FA 1PJ2A 3VO2A 1FC0A 2C5SA 1JI0A 2Q5JA 2R7LA 4KK4A 4IIBA 1E5XA 4AKEA 1EI9A 2BE9A 1KSJA 1N1MA 1VPEA 2ETXA 4KN8A 4R6XA 4Y6PA 5DI9A 3L0CA 1V5FA 2R00A 4CKYA 4CMEA 1FLNA 2ZUVA 4FMCB 3MS2A 1PQPA 1EQUA 1VSUA 1NM5A 2Z43A 4J0DA 1K3UB 1EFPA 3DUFA 4I3GA 3FYHA 3IA7A 3P9RA 2DOKA 3KPYA 2H29A 1DLJA 2Z8YM 2EFYA 1KXZA 1HKUA 5BRAA 1K3FA 1W0JA 3TVTA 5MN4A 3HB0A 3T3DA 1LS6A 3QI2A 3B20A 3DE7X 1VGVA 1UQTA 4CM3A 1XTBA 1JEAA 2FQXA 1BNCA 2JFBA 1PJQA 3ISJA 2QXTA 4NU0A 2BBTA 1BXRA 4A92A 4EHIA 1T8SA 1S8NA 1PWEA 3WP1B 1AA9A 4E70A 2WU1A 3E5RA 4XQGA 3U13A 1F60A 4I99A 2OHXA 3UK1A 4AS3A 4AYXA 5ES3A 4GE3A 3S2EA 1BWQA 1J1IA 1FA9A 5DIFA 1P6XA 3T4XA 3GJYA 4K03A 2OBBA 1ZL2A 1ZVMA 1TM7E 4Q4DA 2ZYVX 4BNYA 3KE8A 3M6XA 1D6MA 3C8MA 2OXTA 1ZIDA 4D98A 5B4TA 3HZRA 3JALB 2BEUA 4KO1S 3EF3A 3BH6A 4X6UA 4EA6A 5CXUA 3L8CA 1QE5A 4GSLA 2PYDA 1QLJA 4G5HA 3FHJA 4J3JA 4QYWA 4ZYTA 1SXJC 4L4YA 2XUOA 5C35A 5IK2D 5KCZA 3BE8A 2QW8A 1DQYA 3R4CA 1DIAA 1F8YA 2FWBA 1X0VA 4R81A 3GLHB 3PQ7A 4NATA 5FWXA 5H4HA 3SLGA 5ENDA 4DYDA 3PWSA 1DBPA 1BGVA 2QRVB 3KP1A 4CR7A 2XOKA 2JL1A 4UKDA 4TTPA 4GKJB 2R47A 1WCWA 4Y9RA 4M22A 3CG4A 5HW0A 5BSEA 3VUEA 1V39A 4MW5A 2HHLA 5CB6A 1F7UA 1OOEA 1EWYA 1L9KA 1XALA 3EE6A 1KZ7B 4GBJA 1TB4A 1H65A 1TECE 1TIBA 1Y80A 1YGYA 2BZ0A 3PVCA 3QKWA 3R6TA 3SF8B 1H3NA 2CJFA 1W4AA 3LHDA 1AKVA 1OXSC 4US2R 4L0CA 2WI8A 4UE6A 4BWVA 2CJYA 1PX2A 2WINI 2Y1GA 3DC7A 3G5TA 3GL9A 3K0KA 3NP9A 4WL0A 4ED9A 4F3RA 5JU6A 1FTQA 1BG6A 4WJKB 2P30A 3X1KA 4EDFA 3LFUA 4KQCA 1OGJA 2IODA 3GA0A 2PUDA 1KR5A 2HI0A 5DBIA 1WLSA 4KR3A 4YMLA 2AR7A 4B6JA 2FZ5A 3MSXA 2IZ1A 4KL8S 4A0SA 3A36A 2I6QA 4Z3KA 3COJA 3K8OE 2DWQA 4AJ1A 2CLEB 3ESAA 5EE0A 1Y8RB 3TN7A 3VHXA 1X9GA 4DLNA 3P9SA 5CM8B 2O7SA 2QUJA 4LF5B 1OLUB 2YYAA 4PQEA 2QI9C 4KKXB 1MGPA 4ND8A 1EGQA 1YZKA 1GWNA 2IGTA 2YWRA 4RFVA 1K4YA 1HG0A 3HO8A 3L82B 4OJQA 2IDMA 1NE7A 1SFRA 2B61A 4H3SA 4BFYA 1BHJA 1IMJA 1ZXBA 3ADKA 3I45A 3MJEA 4CMGA 1ZA1A 2REQA 1GPH1 1RC1A 1IN7A 3N74A 4LOHA 4L4XA 4R9NA 4Q4LA 2LXNA 4CM8B 5C5EA 2IYAA 3JWEA 2IOHA 1MFZA 2AFIA 2EJWA 3OEED 4IQ0A 4D9BA 1GQQA 2ZXUA 3COYA 1X70A 3E2MA 4YMTA 5HIKA 2Q6OA 4HBZA 3IC5A 4DCMA 5ER9A 1CB0A 1PQUA 3UB3A 4P33A 4NFSA 2C5LA 4LHWA 4CF6A 4R69A 3BQMB 1M6YA 5KNDH 4H17A 1K06A 3MEQA 1DCKA 1R9MA 4EEZA 4GOND 1WEHA 1QCCA 3WDSA 4DLBA 1MO6A 3W4KA 5B2FA 2ZI4A 4UBMA 2ZG6A 1XG5A 1XP5A 4GYWA 4UTRA 3IO3A 4UVIA 2XUQA 1U8CB 5KYGA 1Z4LA 4HGOA 1HXHA 1GCOA 3CLKA 4CV0A 2FCAA 1EDOA 1PLKA 2FPPA 5CFMA 5JJKA 1ZC4A 1P9LA 2OGWA 1KVUA 3HCFA 4C7XA 4H7JA 4DF3A 2IOFK 1OBCA 1K7FB 2JIQA 3FCOA 2IF0A 4F9TA 5AW7A 1MTZA 5GIOE 3FOZA 2HMVA 1UPFA 2OFPA 2PBRA 3L77A 3LI2A 2CBXA 2CVOA 4KYIB 4OBXA 2BZSA 3OQBA 5G0TA 2VKQA 1D1QA 2VK1A 5AVJA 1FFGA 2R1TA 4FT2A 2EG9A 2XMQA 1RXUA 3RT1A 2GYVA 3SBEA 4Z8YA 5KOJA 2GD1O 1QQAA 1ABFA 4NENB 3FI9A 5LMUB 3AIKA 4QT4A 2YV3A 1QZZA 3LT4A 4P54A 1NVWQ 1O4VA 2QRGA 2VJNA 2YQZA 4Q3NA 4X3OA 2CYCA 3BN3A 3FA2A 1V5GA 3KRTA 1UZLA 3CONA 3RB8A 1QCZA 3K5WA 4AX4A 1LC0A 1UM8A 4XUCA 5A0VA 5G41A 3OF5A 1RQXA 3B7GA 1Z0JA 3P52A 3QW4B 1ZI6A 3VNRA 2IZ0A 3MIIA 4BX3A 1W8IA 4Q7QA 1FMFA 4Y9TA 4E5DA 3ZJ4A 2WEKA 3FSGD 1ZJJA 4EJ6A 2EX0A 3QFSA 1WD5A 3HB7A 1F2DA 3UWDA 2B7BA 2PRIA 1O08A 4PG6A 5FBHA 3OCWA 4C2BA 4EB8A 4H7EA 4ISCA 1HORA 4YDHB 1H5UA 4TWZA 5DWVA 2HSZA 2ZI9A 3RHSA 4JXZA 3BSFA 4P0QB 5GOZA 5FB3A 2YC2C 3DONA 2VQDA 3HL0A 4II7A 4R98A 4EUHA 3BL8A 5FV4A 1ZNXA 4P4GA 1PSWA 1S8FA 1JIIA 1M8FA 4JZKA 4WXEA 2BTQA 1PYOA 3PUWA 4HUQB 5AM4A 4B74A 3VTKA 5K6AC 1ZCFA 2H2WA 4Q5IA 2C7QA 2ZU0C 4YJGB 2WYWA 1LC3A 3D2AA 1ZHOA 1I3NA 1AU9A 3RUDA 5JSFA 1JHUA 2GEVA 2PN1A 3GYGA 3MELA 4YREA 1UBFA 4XQ9A 5LIPA 4YCNA 1GP2A 3DEHA 2E2WA 1JMVA 1WY5A 4MS3B 2XPCA 3G9QA 5A6SB 3FR7A 5HMLA 3RVBA 4BLWA 3HXQA 3C3XA 4GRDA 1D4ZA 1PFGA 1HG1A 2HIGA 4YAUA 5BV0A 4Y2GA 3ICEA 3NANA 2AOVA 4GL4A 4MQ5A 4PZEA 2WQ7A 2CMGA 1RPNA 3RW9A 4A0QA 4AN4A 4CTKA 2XITA 2WD7A 2OHJA 2GK4A 1K97A 1SXJD 2J30A 4HB0A 1GKIA 2FOIA 4TWRA 4M2LA 3HP4A 5AKLA 2H1HA 3L4EA 1JTEA 2QD5A 4IDBA 4QX6A 5ED4A 3O94A 4FNOA 3KLPX 3A1WA 1RWBA 1ZUIA 4A2WA 2C2OA 2C00A 3F6CA 2ZSAA 1TK3A 4R1NA 3X3HA 4LI0A 1CIPA 1A95A 5GM2A 3STUA 1VL1A 3OC0A 2A67A 1FF9A 4H2DA 4P6VF 4LGVA 3KQSA 1RQ2A 2YWGA 1XDSA 1Z33A 3QBEA 1PNOA 2CVZA 5U1PA 1FNCA 3QVWA 1BCSB 1RYFA 4A7PA 1YZUA 2V9PA 4EMTA 2QTMA 3GFOA 1JWBB 2Q5LA 1KEWA 4NZNA 2YIVX 3UWMA 1OPXA 1VJCA 1TIKA 3BS4A 4KXVA 2DQYA 3G1UA 4Q1BA 3T5MA 4E1AA 2JPDA 2NV0A 3N2IA 3TEMA 3WZLA 1GGEA 1XTVA 3DULA 1R00A 3HLKA 5JYDA 3T7RA 3BL5A 1E60A 4Y1RA 4RD2A 1PZXA 2ZUWA 1Y34E 4X6YA 1J5XA 1DUVG 2W42A 4QXMA 4GYYA 1NXQA 4GD3Q 4KMRA 3KZCA 1LW7A 5TE9A 2WHXA 1ORHA 5D1NA 5G0SA 3M3DA 4BLSA 5JXJA 5KZMB 4V1CB 5JYBA 4BC1A 1P8AA 3ED1A 4KH1A 1W36D 5AI8A 3T3PB 3FPJA 3EXG1 4OQ4A 5P21A 3FBWA 1NVFA 4PQGA 4IVRA 5A9RA 3WGZA 3IAS6 4UBNA 4HN2A 1COWD 1RCUA 5F9MA 1N25A 4BV8A 1H5NA 4O33A 5F12A 1UK7A 5IH7A 4CKCB 5GADl 3I23A 2JI4A 3I42A 3MJCA 3R5TA 3L06A 2UDPA 3WGVA 1Z18A 3IAM6 4IHJA 4U7TB 4KVFA 3IEUA 1Q14A 3KVYA 4QICA 3VPGA 4N65A 4Y9DA 4D8WA 2O5VA 3JAKB 3QU2A 3GXBA 1QC5A 1NRIA 3FNGA 2OLJA 2YMPA 3Q5EA 2PRSA 4JJ7A 1KJIA 1EVEA 4ZT4A 4B09A 3LDAA 1EDEA 3NBMA 3MMXA 4L74A 4U0KA 2HUPA 4TUYB 1XD2A 1UFRA 4HVCA 2A9QA 4Y2TA 3PVZA 1VG1A 2P3SA 3E05A 3LCVB 1V37A 3QVVA 5CRIA 1AKWA 2VHXA 1I36A 1RAIA 5K1ZA 4D3DA 2JLBA 3HADA 1JR3D 4DLSA 1ORRA 4B82A 5SY9A 2A9KA 2J5BA 4O0LA 5NLLA 3HBLA 1N2IA 5DCUA 1IJBA 1RABA 2O57A 4G5RA 1SBZA 1C8LA 1PBTA 2AW3A 1ST3A 5FNVA 5K0SA 3ONNA 3QELA 2OUIA 3DL7A 3LCUA 5EHNA 4DG9A 2ADFA 1B41A 3C8UA 3DE2X 3F6SA 1ZN7A 3P5SA 4HDSA 2I55A 4B4KA 1UMCA 2VPQA 2YMLA 3N0WA 2AJLI 4FPXA 3ZTTA 3TJRA 4DDMA 4EI7A 1OILA 3DFZA 3CRZA 3QE2A 4LZWA 4QARA 2XKAA 3FZEA 3PPWA 4XWKA 4YECA 4WZAE 5H3LA 2NUAA 1EHIA 1VG0B 3OCYA 4P83A 2QTWB 1YB1A 2RHGB 2XF2A 3RAPR 5IJZA 2NU7B 3B38A 3R7NA 1X2EA 3GEGA 2DXIA 4JJ6A 3JWIA 5DM1A 1J0DA 4V3CA 3PQ6A 1NKVA 5HDQA 4P0TA 4QNNA 3AIMA 4JI1B 4C6RA 1I0IA 1V0JA 1K6IA 1T2AA 1CHNA 2D1FA 3KTFA 3ZU5A 2CXUA 1REQA 4DTIA 3RR2A 3TLGA 3E15A 1NN1A 2I5PO 3DGFC 3NEPX 4NOMA 5HIIA 4BFWA 2FR0A 1NI5A 1GAXA 2A1TR 2AG5A 3OJEA 1N1GA 2ZSFA 4GT1A 1Z2OX 3IUMA 1TKAA 2AQIA 2ZYAA 4W1RA 2MWMA 2VZ0A 1DZ3A 1R0KA 3BXPA 3RSOA 4LCJA 1N0WA 1QAMA 4JOQA 2FR1A 4QDOA 5IUKC 5CCBA 1CNEA 2RKBA 3BA6A 3R20A 5JATA 4LDQA 1NMSA 4Z9XA 1N2EA 2I4MA 4MI1A 3GLGE 1NA5A 4XW2A 4H6XA 4LNHA 4DIKA 1TKBA 1BW9A 2MMCA 2J07A 3CYFA 2CLSA 3I0ZA 3NQ41 3UWKA 1ZCZA 4J0HA 3WZ2A 3N2EA 3S1AA 4BYGA 5IT5A 1L5ZA 1VP9A 1X7YB 1IHXA 2GN2A 3M5DA 4YCDA 2HA2A 3HDVA 1DCMA 5IYZA 1XZHA 6Q21A 1R10A 3LHKA 4OA5A 3S1LA 5FOQA 1E3IA 2Q2VA 1QG2A 4ZVRA 4ZIRB 1YONA 4FCCA 2WWRA 5CJ2A 3HB4X 3CLRC 4KYTA 2OVFA 5BNWA 2I8AA 3I04M 4GXNA 2OC4A 3UC9A 3F46A 4LNUB 4D8TA 4PYMA 1CIJA 1G19A 1TUIA 2HEGA 5ADHA 1C9KA 3GELA 4LJ6A 3QWBA 4O25A 2ECOA 3W6NA 4MJ7A 1MIOB 4URXR 2PQ6A 1QK5A 4FYJA 1G1MA 2EKQA 2PKQO 4EG5A 2GAJA 4DNQA 2RIPA 4IBOA 3CQ9A 2F55A 1UXHA 4XX0B 5EFZA 4UM9B 4WFKA 2N0SA 4ZOLF 4CI0B 3R7DA 3LFTA 1L7RA 1T9AA 3OI7A 1E1RD 1CVRA 1DC5A 1SBQA 3Q2OA 4DLUA 2AN5A 2JCSA 3LKBA 3SHWA 1OAOA 5J4KA 3D7NA 4QD3A 4YGYA 1CLEA 1L1RA 1LLQA 3F4KA 1CUEA 1P31A 3HO1A 3QENA 5IHXA 4BFXA 5ALWA 3NDRA 1YNSA 5BN3B 5CFQA 3ZK8A 4I4NA 4YPVA 2I2XB 4BVAA 1XN4A 4Z4CA 1NQ5A 4O4IF 5IMBA 2IYWA 2Y77A 3K0CC 5C4MA 4AP6A 1Y7HA 2BGJA 3KOWA 1NW5A 1NY6A 3EC1A 2YRFA 4W6QA 5MDHA 1PG5A 3NOQA 4LZJA 4Q16A 1T1SA 1QGDA 3LHSA 3LXMA 2CEKA 1E1MA 4ENSA 3DHYA 1L5HA 2TMGA 1FRFS 3QM1A 3CWCA 1C1DB 5LM3A 4E22A 1UBRS 4US1R 2H17A 4KV7A 2RKWA 2VP3A 5A6SA 3DMNA 3JQ7A 1A7KA 1QTIA 3HU3A 3LF2A 4MGZR 3WKAA 5CM9C 3T3EA 5JC8A 4BU0A 5IKOA 2FG5A 5HE9A 4AKGA 2PSHA 2OPBA 2B1RA 2VCEA 3CH5A 3KQWA 3MRTA 3G2NA 1A98A 3NBUA 2OV2A 2JGDA 4L9AA 3C7AA 1UMBB 4ND1A 3WNVA 4CEHA 4AX8A 4FJ0A 4OMFG 3P0IA 3E53A 2YVQA 1RI5A 1BX0A 5DK6A 1KQOA 2XGGA 3NDPA 4KBYA 3RRYA 1S02A 3ZLBA 2J3QA 1FDUA 4BNHA 2Q3BA 4B5KA 3A7DA 4ITVA 3IP6A 3NBFA 3D3EA 5A2QA 3L5OA 4PX3A 4QFDA 5H82A 5A0TA 4EHHA 1N1DA 2XVXA 3DDNA 4ZC1A 3PQFA 2QEQA 2GI4A 3NIFB 1X80B 1J21A 2HOQA 2B4RO 3BTOA 3VZSA 4P93A 1CUHA 3FOCA 3ESXA 5HRAA 1PV4A 1M8GA 1OIVA 1Y8AA 2F1RA 4LZPA 3SBOA 4UVDA 2J3IA 2O3QA 5LQMA 5CLIA 1WB6A 1M33A 1R0CA 5FBKA 5EG5A 2HYDA 5BNTA 1RP1A 1WXIA 4EYOA 1C9YA 2R6GA 5BWBA 2NVUB 3QOWA 3K0EA 5LOVF 4MUAA 5A2GA 1YJQA 1G7SA 1FNSA 2DTDA 4YBRA 3TZKA 5EMNA 2AFHA 4RJTA 2JFPA 2OAQ1 2VT6A 4JSYA 4Q3EA 1Y5LA 4GGPA 4XVHA 2WAMA 2HDOA 3FDJA 3BERA 4HXEB 2I2FA 1JG2A 2DPLA 5C9ZA 3BAZA 4BGUA 1X74A 2GX6A 2IPOA 3OY7A 5AVXA 2ZIXB 4MQEB 1WU7A 5IJ0B 5INTA 2A59A 1YXMA 2FRDA 2L2QA 3GVCA 5DOVA 4D3XA 4FZ5A 3QLVC 3RUCA 1UT6A 3G1WA 4TKZA 2X8JA 5IBRA 3U2QA 1IAVA 3WMWA 1B2LA 4MS3A 1LFAA 1XK6A 2J3DA 1DB3A 1G5IA 1EM6A 1BEEA 4GP6A 2VPXA 4D4GA 3JWJA 1D8AA 5F21A 2BMAA 3VISA 3O2NA 4A6DA 2O8BA 2N46A 1I6MA 2DU8A 1R0YA 2WJ3A 3FSGA 4AU1A 4F5EA 2PMDA 5BQXA 1JLKA 4ESOA 3U5ZB 4B43A 5JD6A 2ZKLA 1ZM7A 4JJZA 1U9CA 4RPIA 2FF5A 4HMOA 5ENVA 2JLCA 1JRLA 2XLCA 5H70A 4BJ5A 3DCIA 4UNPA 2AE2A 1OLSA 4GXQA 1JDUA 1YJ5A 1ODCA 2I1QA 2Y3IA 3O0DA 1M7GA 3V2GA 1R66A 4DQVA 3P9QA 1NVAA 4F60A 1G5PA 3UOAB 4BE9A 2ZS8A 4EMBA 4P36A 4RHYA 3FPGA 2OILA 4FKMA 5DHRA 1B3BA 4KPEC 1MV5A 1TT7A 3D31A 3D2CA 1JT2A 2JHGA 4LJRA 3H99A 4HAUA 2V0NA 2EARA 3CCCA 3RDPA 5KYVA 1WVGA 2CNOA 2GBLC 2R1TB 3GEHA 3NW9A 4BZQA 3EVCA 2MYPA 5GQSA 1JAYA 3WOVA 2CNKA 3J81A 4QM7A 1HE2A 1B1AA 1P72A 5DB4A 3ESZA 4ANFA 1M2KA 1N2OA 3QLTA 2HGSA 4C0KA 5M04A 1UOOA 1YC2A 3JQ9A 2X0DA 1N2BA 2J9XB 2Q0QA 1GQSA 1Y3IA 3X1DA 4BVGA 1DIOB 3FZYA 1ORVA 1GEGA 4IMIB 4NE9A 5AM5A 1OFUA 3DE4X 5HF9A 3WV5A 3SGLA 3ENWA 4WN9A 1P1IA 3KJGA 4L2IA 1GGVA 3IOBA 2N9UA 4GPBA 1JIXA 4IVPA 4LDAA 4OXNA 2HH9A 3TX6A 1M34E 3NNSA 3TQRA 2XYGA 4OP2A 2QTCA 2Y9MB 1S2IA 5D1HA 3I64A 4KKVA 5HS6A 4CQLA 3SQXA 4BKOA 4HZGA 3FFBA 3GLHE 1WVIA 2G70A 2QZPA 1XYVA 3BREA 3IUPA 4HGYA 4Q66C 4B4VA 3HKDB 4QGAA 2XMRA 1YS2X 3SPXA 1FFYA 5DLDA 3MUEA 4ECAA 4MGHA 4RY8A 2YV1A 3K1YA 3B5JA 1ACMA 5ALUA 4AKSA 5K6RA 5DASA 1K6EA 1VBFA 4L5YA 1KI6A 3FUXA 3FY4A 4EABA 1JZSA 4RTNA 3LGSA 3MWDB 1K5DA 4Z4QA 1JSZA 1MX3A 3ETLA 3L6BA 2IS6A 1OGYA 1G3UA 1RKUA 1VKZA 1X87A 1UBNA 1E7QA 2RJOA 2LP4Y 2XCUA 1OGIA 3EGIA 3M83A 3IOEA 4LHZA 4LC9A 4S1WA 3MTDA 3HWX1 1V1MA 4J0FA 2UYGA 5FJJA 5REQA 2BJHA 3IT2A 4FFBA 1V4NA 5FPYA 4X7PA 3CR3C 1C3JA 2DFLA 5K8LA 3C5CA 1H2ZA 4NYIQ 1GNTA 1UOPA 2EBWA 3QG5A 2WWVD 1SIOA 1UBCA 2MSWA 2ZRKA 3KKOA 3EIOA 4RY2A 1AKNA 1KHHA 2PUGA 2Q6VA 2CJWB 5AJVB 4Y1EA 1BDHA 2BZGA 2AZMA 2X6RA 2YS7A 2CHEA 1UAYA 2YHBA 3L7DA 3OTGA 2C2KA 2EZ9A 1Y6JA 1RJ9A 3AVQA 1YZFA 4S05A 5B58T 4KDCA 4D4IA 1Y48E 3N0TA 2C07A 4D9HA 3GJSA 4YCLA 2PZEA 3PEWA 3BFVA 2HF9A 1NBMD 1ZGGA 1G55A 2A4MA 4LV8B 4UEKA 5AHOA 4F1JA 2J3JA 5G1OA 4ZIRA 3N07A 1CS4C 4FIDA 1UDRA 4JBWA 4OK3A 4PFSA 1DG3A 1ZW1A 4MV4A 1JW9B 2WJPA 3ZBPA 2V8OA 4YMUA 2WM3A 4AI6A 1P4GA 3EDCA 3R76A 1OQAA 2OAEA 3LGXA 4DC9A 2VDOB 2LKDA 2PX8A 2AZ4A 2LWIA 3OCXA 5C8XA 3WWOA 3ETGA 1T6XA 4RA9B 5IAAA 2V59A 5KJFA 1DKRA 1M3SA 3CRMA 3T06B 1P7PA 3ZE6A 3UJPA 1J4AA 2ZSIA 2G9UA 2ZITA 1A27A 2MMGA 2QN1A 3SQOA 3C1TA 3NDJA 3IPCA 2E5FA 4JT9A 5KYUB 3HL4A 1I7LA 3QEKA 4HNSA 3TJZA 1V9LA 1YVRA 3FUTA 3KOOA 5T57A 3ZPXA 2PWZA 3VDXA 4EPTA 2G63A 2GJ8A 1QZXA 4QDKA 1QAQA 1OBFO 1XZ8A 5C4GB 1L5RA 1Q77A 1MT3A 3ZBTA 2AZTA 4BGDA 5DRTA 5K51A 2HJVA 2G7MC 3A2LA 3HTXA 1PWYE 1ZGBA 2DECA 4ARUA 3ILVA 2EF0A 1GG5A 3DFFA 4ZDWA 3DM5A 4EG1A 1HYBA 3CMMA 4IOJA 1F2UA 5EP1A 3VPSA 5JQGF 2XJ4A 1GT6A 2RAUA 4U39A 8GPBA 4PBSA 1A7JA 5EIEA 3G0IA 3WO1A 5DBFA 2GAAA 1HV8A 4DT1A 1YR7A 3EVFA 3O8QB 1DEAA 2QPTA 5KVSA 1R0SA 2IYUA 3GGCA 1P6UA 5CAEA 4KRFA 5LD2C 1Q50A 4KTTE 5A62A 3HWWA 3R40A 1TJPB 2QLMA 5CYGA 5KYXB 1KEEA 1SCBA 5FIUA 4UJ5A 3WJ1A 4ZMSA 1U99A 4R8RA 3WYEA 2ZT8A 4Q19A 1SU4A 5B58C 3IB6A 1WP9A 4MR8B 3SR0A 4B4DA 2X1MA 5HQTA 5K3CA 4KFTA 3T7IA 4WERA 1T4DA 3EULA 1TM2A 2RGWA 1MQSA 5IC4A 2F67A 4I4TB 4R7GA 1DKNA 1KP2A 4DLAA 3UPDA 1Z63A 2BW0A 2YXEA 3M9WA 1V8ZA 4L22A 5KQSA 2G9VA 1VE9A 3MIZA 4CEJA 2CDCA 2H7VA 2HRRA 4K28A 2VDWB 3E9NA 4FMBB 2BDUA 2B37A 3IVGA 4EPRA 2OORC 3KT3A 4LF9B 1F9AA 1XDGA 2ZRBA 3KFXA 1IQRA 4YR9A 2DERA 2F17A 3B2QA 4F0JA 2JK0A 3TOXA 4KXMA 3LL4A 4AULA 1CUWA 2H1OA 3VVMA 1H8EA 4M6WB 4BVFA 4DCOA 4OKIA 3CPHA 3ICOA 3UF0A 5B30A 1KPIA 4W9NA 4MR9B 3K6SB 4MZDA 2IW1A 4J0EA 5HF5A 1MIHA 3QXGA 2WY2D 1L3CA 4AKTA 2XGJA 1P4SA 4W5HA 1GSHA 1V35A 2WA1A 4IQ4A 5JECA 3RV4A 4PNPA 3KIPA 2DUWA 4PSUA 2GYUA 4HSEA 1AB5A 1TUEA 2IYOA 1KC1A 4L27A 2HA5A 4PGAA 5A06A 5BYKA 2CL6X 2NW6A 2CMKA 4QUHA 4TTSA 3DXZA 4P08A 2P90A 3ZQ4A 3U6BA 3ESDA 3OG9A 4AICA 1Z5UA 3QU7A 1BAPA 1XEXB 1NY5A 5B4VA 821PA 5D7NA 3O7MA 4HVAA 3C1UA 1JLSA 1Q0HA 2DT5A 3D5EA 3GARA 3UXHA 4EYSA 4I36A 4B83A 1FYFA 4LEIA 4HXGA 5FPSA 5LXTA 4IDFA 2I6UA 2PFKA 2PWPA 3PEEA 4Y1GA 3N2GB 1KE1A 1T24A 4KIWA 4AN0A 2I1VB 4CYMA 4J90A 1WDKA 1NVDA 3H2BA 1SVLA 3HCPA 3KSMA 4NCKA 1A76A 1LI7A 2GFHA 1QIGA 1O1YA 2UAGA 3ZDQA 2FFJA 5J1SB 3L4KA 1YZTA 2ZZNA 5CB4B 3BHMA 5JXGA 1R5NA 4GZ3A 4MVCA 4MCHA 3DNFA 1EG2A 1SGWA 4RC9A 3WGGA 3QOYA 2I7CA 4B3IA 2AE1A 2VPYA 2XMGA 3OZWA 5D3MB 4P5DA 1N6KA 1TKCA 4C2TA 1XXHA 1DKUA 1HOXA 3B1JA 3D4BA 1H23A 2ZUTA 1GZ3A 2NXNA 1W9HA 2AI2A 4J2HA 4RBNA 4WXHA 1TW3A 3ONVA 2E4XA 1GNSA 3QKSB 4Z53A 1AQYA 1W5FA 1IRXA 1H6DA 4JI0B 1H1LA 3HG7A 3VOAA 4UQPA 4PSCA 5JUWA 3CC8A 3CEMA 4JC4A 1Q7RA 1AKQA 4JUDX 2WW8A 2XB9A 3L8MA 4TTRA 3HVKA 2NUTB 4NBTA 3TVYA 3EFHA 2CFCA 3OU6A 2CLLB 2ZPUA 1KJZA 4INPA 1RP7A 3ZNNA 1MIOA 5FKJA 1TADA 1DPGA 4NPHA 4Z7JA 2R62A 3DWGA 2VZ8A 3OOHA 3EZ9A 2FH5B 3AF2A 4B2YA 1CRLA 4CQMA 2FVXA 2FZCA 4D45A 4YAWA 3REQA 1JEOA 2DY0A 4B71A 1RACA 2HWKA 4G81A 1HMYA 4WZBA 4ADSG 4HCJA 5IJWA 2BMFA 1GLGA 2FXIA 2A6PA 4PZYA 4WJLA 2ZATA 2G8NA 5JH7A 2IS1A 3PI7A 4FDMA 4MVJM 3KCQA 1GCGA 1E1CB 4BDTA 2ACWA 5JASA 5JFOA 1BROA 1NRJB 3BGSA 3ZLVA 1Q12A 4M53A 2YIDA 3E9QA 3L7OA 3DZBA 4DBZA 5A9SB 5LP6F 1NFFA 1EWRA 1U9IC 2W22A 3RIGA 4BNKA 2FLWA 1X3LA 1BMTA 3STTA 4ZYUA 3OQIB 4DV5B 2XXBA 1ZIYA 1FU4A 3G02A 4FDUA 4US0R 3AEKA 4BVBA 4HNQA 2AMJA 4J6EA 1DXHA 1NVMB 2WU4A 3QU4A 4KQ9A 3KQUA 4YRJA 2GN8A 2WTNA 5KTYA 2F3TA 2UZIR 4HNTA 3VZBA 3AI1A 5JDIA 3PX7A 4RVFA 2GCPA 2QGZA 1RJEA 2BLNA 3ZNOA 4I1IA 5L7TA 1XCOA 3DMYA 1JEQB 4MLZA 5JADA 5KNBA 3GLIB 1KF0A 4LSZA 4KSCA 3BFXA 4HQ0A 2AB0A 1MABB 1WLYA 5DNDA 3VYRB 5KYWB 3NVKI 2O52A 1SVWA 1K8XB 1T3HA 3R9IA 3JPWA 3GJQA 3MPOA 4A8JC 4UTVA 5CD9A 3DL0A 3CF4G 3UNXA 3U56A 1C7IA 5EZ6B 5KIAA 4B6FA 1E2IA 1N5JA 4REQB 1HMPA 3AV0B 2OBMA 1PR4A 4QQFA 3SYRA 5JZBA 4FLFA 2WF8A 4PTZA 4N03A 4OKNA 4U7PB 3RBAA 4YUXA 1DOHA 1OX4B 4OV6B 1F14A 2ZBGA 5AXCA 4OHWA 1Z26A 1ZK4A 4O4IA 5AW4A 1I4DD 1SCUA 1SHJA 3V1KA 4GLBA 4AO6A 2C4HA 3T5AA 2GYWA 4J1NA 1BJTA 3ET4A 4HRXA 3DFIA 1QMPA 3X2FA 4DA0A 3GZTB 4KUEA 4MKFA 1QWSA 2PY6A 4MHOA 3VU9A 4ILEA 4DJ5X 3TR6A 4MICA 3AESB 4QJIA 1YBHA 3DV0A 3H1AA 3UB4A 3K35A 1SBCA 4YY3B 5EFOA 5FX2A 1P2GA 3OSUA 1GUFA 3L8FA 4LJYA 4MEBA 4Z0HO 4ZC8A 4KXNA 3G2MA 5ALJA 3TGWA 721PA 1BDBA 5KSZA 3BQ9A 2GHIA 1HDXA 2C4KA 1YZNA 2AFHB 1ZMTA 2QVLA 3MNFA 3BMOB 5KYUA 5KSOA 4Y6QA 2XRZA 1CQPA 4RLQA 3TSYA 1Z39A 3VA7A 4DRXA 2WLTA 3EHDA 3G2PA 5THKA 4EPWA 3K32A 1C4KA 2YZGA 3EAGA 3H5NA 1BVRA 1T9DA 3KJNA 4RWZA 4UBOA 3DOEA 3WYNA 2HU7A 2QJTA 3H3FA 1E77A 1THGA 2W8BA 3KSBC 4DLWA 4I6JA 4QGHA 1Q95A 1HLGA 1EK1A 1K6XA 3QKUA 4IJ5A 5IM5A 1T0IA 2V1UA 3C3KA 3L0DA 2GTPA 1ZH4A 1C9NA 2C88A 3IKVA 3INRA 3IP1A 4R7ZA 1GTL1 3CFYA 5KUTA 1KC3A 1XL1A 1R64A 3K9BA 1F2UB 4OQMA 1Q0RA 3U0BA 3C6YA 1AK2A 1U7TA 1IEVA 1KBOA 4RKEA 2FJ0A 2XAAA 4YP1A 4E51A 1YI1A 4ZYLA 2CY0A 3P0FA 4P2BA 2GBLA 2G1JA 4K46A 4B87A 1RZVA 3MWEB 3H11A 2BGNA 1KO8A 4C0XA 1U4NA 3IAM1 5IFLA 4MV8A 5IC5A 3S1SA 4DSZA 3PIDA 1M66A 2XE7A 1BCRA 1L4HA 1ZBQA 3HC7A 4HN9A 4DNPA 2UU9B 1A88A 4M0KA 4G09A 3VR6H 1NRWA 4G01B 5D3QA 4MDEA 4MR7B 1R8QA 2FMIA 5HVNA 2IWHA 5IUNC 2F4VB 2V03A 1UDWA 2WQZA 1IZYA 2O06A 2X2OA 5IRCD 4NONA 1LBIA 2VI5A 2ZJ8A 3MTGA 5C7LO 3HKCA 3PCXA 4MMYB 1BD3A 1P5JA 5CT4A 4JH0A 1HFWA 4L50A 1IAQA 3K96A 1JXMA 3CR7A 1XEFA 4YAIA 4A6EA 2P2NA 2VUSA 5K8IA 3WGKA 3O3OB 4WJZA 1QG6A 4Z1MD 1G64A 3D3KA 5AVKA 4E2FA 2YFHA 1QR6A 4QOHA 3O75A 1XPRA 2XMBA 4WLUA 5FLYA 1NQXA 1VMEA 3INNA 5SZIA 3SHFA 5FI1B 2ZUBA 4EY8A 3VGJA 1B0ZA 3FE2A 4N49A 2OBYA 1D09A 5L53A 4X45A 2BFCA 4H6VA 5F1PA 3V8QA 5BW8A 2BEVA 2WZCA 2YJGA 3EUWA 1BE1A 5AI0A 2C0CA 3GLUA 2CXXA 5A05A 3W90A 4CNBA 4A15A 1ZQ1A 4JR2A 1N1EA 5TX7A 1CE8A 2DFNA 2CDRA 3RJ5A 1R3DA 3RIYA 1QHYA 5AVUA 1QYIA 2LZ0A 4PW0A 4BAGA 5CFLA 4D25A 2R5NA 1UDCA 9LDBA 5KVVA 4N41A 1YZHA 2O7NA 3FHCB 2ODEA 3W79A 4DRYA 1ZH2A 4Q9KA 4PG7A 1OXMA 5BVHB 2QAGA 1PL7A 1C0LA 4XYEA 3W6PA 4DLXA 1GDHA 1QG4A 3ZI4A 2NP6A 3PFHA 3GUZA 1O94C 1ZCJA 2HK6A 3MUOA 1U1DA 1XMIA 2V5UA 2FEXA 3NBXX 3MSCA 4HDKB 4BCCA 3EUFA 3LYUA 4R1LA 4BNJA 4TT8A 4ZTUB 4D4MA 3IO5A 4J8PA 3I12A 4CHGA 1IHDA 2R96A 1WB4A 2I2WA 3K9GA 2WJYA 3HBJA 2QLTA 1KTIA 1YS4A 3JS5A 3D4NA 3GX1A 3TL6A 3O31A 1ZO8A 1NW6A 4EY4A 4LCBA 5MF6A 4A2PA 4HF7A 3FLMA 4QJ5A 2DWUA 5JMTA 3R3JA 4XR4A 4AZ3B 4YLEA 4DOMA 3QWHA 1QFMA 4N54A 4WVLA 1YL6A 5EPEA 1R15A 2Q62A 1K4MA 2KB0A 2V7GA 5DNWA 1GRCA 1IBRA 1S0UA 2PUAA 2ES4A 2PKWA 5AO9A 2WJAA 1T29A 4OQXA 2FVYA 5JS8A 2D1RA 2JGAA 2XUDA 1P0PA 3BULA 4LRTB 1KIAA 1JEYB 4FE4A 1RYMA 2IBMA 2MYUA 5CK4A 1H1LB 1Z2AA 2P7IA 1DC8A 3MYYA 5CG1A 1AMUA 1KS9A 3DOUA 1I24A 2IIVA 3CUYA 4EVIA 2Q7XA 1SK8A 1BXZA 4Y18A 2NT3A 2W83A 1W29A 3IMGA 1W6RA 2B21A 2F1JA 2I7TA 5ECWA 5HGJA 1EQAA 3TQCA 3PKIA 1G4UR 3X1XA 3JTMA 2C8VA 3RK0A 5HF6A 2BDEA 3MCTA 5JZSA 3QOFA 4ZOLA 4NBWA 4NYIR 1UEJA 2GZAA 4YEDA 2AUTA 1ICIA 2Y6UA 4BP9A 1K8RA 4U9HS 3AMVA 4Z4GA 1WMFA 4M98A 2GD2A 3KDSE 5IKEA 2ZWVA 3L7NA 3OZ7A 3ROMA 1IM5A 3S70A 4R9UC 2PLWA 3PUKA 3R3WA 4H7FA 4D0NA 1TMOA 1DT5A 2P3OA 4D0LB 1NI4B 1Z2DA 2AMFA 2JLWA 4ERNA 4JKIA 4BB6A 3F6BX 3LFHA 3PB3A 1QDUA 5AKYA 3RUPA 8LDHA 5IJ0A 1IN5A 3PUVA 3LU1A 2XA1A 4L07A 4NYMQ 4DEYA 1C3XA 2GHQA 3B5EA 1AXGA 1KIMA 1SCDA 4JVSB 1Y4SA 1VSBA 2JD0A 2QP3A 1LX7A 1FFAA 3S2ZA 3BWXA 5FBQB 2JLXA 2VF4X 1U8XX 3C3EA 4WDRA 4LF4B 4WH0A 3KWLA 3NLLA 2Q1WA 3OQMA 1A4UA 3FUVA 1GU1A 1SHLA 3OX2A 1CS0B 3ETDA 1NW7A 3VYVA 4XKJA 4QODA 3UKJA 2IP1A 3KVRA 3W5JA 5I5GA 3RTAA 1UKZA 3PA6A 2WSSD 2FX2A 2O8CA 2Q27A 3OHPA 3PNKA 5DP1A 1HTTA 3SYTA 4DV3B 1ZM4A 2HK7A 2OORA 3GB9A 4M7PA 4FGUA 4AJLA 5C37A 1AD2A 3ICPA 5KPJA 5EVJA 3U7IA 2W6NA 4M49A 4E5PA 1JPNA 4OVKA 1YHZA 4OSEA 1K1EA 3SS7X 2DHQA 2RHTA 1AKUA 4DIMA 2XUZA 4RDHA 4V0OA 5E7MA 3TDKA 3LX8A 1KQNA 2LCQA 1ZUD1 4KE9A 5E3HA 4CDNA 2BISA 4M0UA 4ITRC 3ZQJA 2QQEA 5JO9A 4C20A 5EJ6A 1QKIA 4NBVA 5J2TF 1ND5A 3A06A 3EODA 3ZGOA 4DY6A 1EXWA 5DNVA 4MX8A 1HDYA 4CIVA 1E3MA 4W6ZA 4P81A 4YJ3A 1YZ3A 2XQVA 4KYVA 2BAGA 2PGNA 1HLFA 2QTZA 2VATA 4DCTA 3QE9Y 1EVQA 1GPJA 2ONKA 3PQ4A 1ECCA 2PMFA 5G0WA 4WKOA 2YJ3A 5DM60 3LPLA 5EWMB 1C3VA 1ZJ4A 3H9QA 5JCJD 2J08A 2PGAA 3LUKA 3L6CA 4FYPA 1TVMA 2J9YB 2IUSA 5JPIA 5FBVB 3LQFA 2P35A 3OQ6A 4RSHA 3I2FA 1UQUA 1PD0A 2Q1YA 1VYHA 1QTRA 3ICVA 3NIBA 3HWRA 3TPCA 1J49A 1LTKA 1X9IA 3GRYA 4Q3OA 3FDZA 1JLMA 1Q22A 4X8HA 4C0SA 4FB4A 1SWVA 2B5WA 2XE6A 4BWYA 4HL6A 2PL1A 3UYKA 3U39A 4JP8A 1VSTA 4RPKA 4KJXA 1BFKA 1KERA 4EJSA 5JAZA 1M6VB 5JMWA 1S01A 3EJ6A 2BGRA 3D8HA 1PR2A 1CJTC 2H07A 3PZBA 4KN6A 4P86A 4PAWA 1V16A 5IWAB 4ESVA 4GI1A 1GZVA 2H5IA 2ZIAA 1X0XA 3QVLA 5F5XA 2V97A 4X1YA 4PLTA 3AFGA 3V8MA 1VA5A 4IEEA 1BVHA 3PSAA 3CVWA 2ZEJA 3EOBI 3A05A 3EZFA 4YRNA 4X7BA 4NEGA 2DLDA 2GPWA 2M9MA 2W2LD 2AJBA 1G8YA 3IRUA 1UJNA 3OMXA 4L5IA 2QSYA 3CU5A 4Q93A 3VNSA 2HCFA 4HGQA 1M74A 2G1AA 1T5IA 1O94A 3OEHD 3GOQA 4LVOA 5LZ4A 3OF2A 3AFNA 2PU7A 2O4CA 4Z99A 2A0WA 2ZRDA 3VMFA 2LDBA 2PR2A 3ML1A 2XCOA 1EESA 1GA6A 5C53B 4GW3A 4AMYA 3EWSA 4DE5A 2XODA 4Y2UA 4DVGA 5KNBH 4IG9A 4MCIA 3GW8A 1AKEA 3FZGA 1PCXA 3D2BA 3TQTA 1E5DA 4F71A 5D3MA 1IQUA 5JOQA 4ARSA 1WUTA 2FZGA 4B34A 2HBRA 4YXFA 1FVHA 4Q00A 4DNXA 1IOWA 1KU6A 1V1RB 3KELA 3ZGNA 4DZTA 2JFHA 1VHLA 4XFJA 2EQAA 1N8SA 5EJIA 3WLLA 2Q29A 3RI3A 1NU6A 2X8WA 1N9ZA 1NUPA 4HFJA 3RYIB 4K8RB 5LVAA 4S24A 4BNXA 1U63A 1X86B 5LMZA 2ZB8A 1U0BB 3RVRA 3AETB 1IUOA 1K7EB 4MGKR 1ZVKA 3U9LA 4DRXB 1X1AA 5BR1A 1M83A 1YDMA 4JLVA 3W5IA 1M2EA 5DYNA 2ZETA 5DWQA 3L3BA 3EJWA 1YVEI 2OCIA 1U5CA 3I73A 3T1OA 2EJVA 2PJUA 4FKZA 1W6UA 2VSQA 1AHHA 4F5ZA 2HHAA 3MGCA 1NP6A 1QYCA 1P44A 3UV7A 5GTDA 1SCJA 2MSKA 2CK3D 3X2SA 2AOUB 3D64A 2AD1A 4QBFA 1DEOA 1Q0LA 3PC8A 4YCMA 2XZDA 1Y4AE 3T35A 2GCOB 3OHSX 1B8VA 2VWHA 3ORSA 3NNNA 4IIHA 5JLJA 1EJ2A 1ZI8A 4UCQA 2B83A 1L5OA 4J7AA 4B7XA 3PC3A 3ZDBA 4W63A 1CZNA 2EFHB 5F64A 4Q02A 1DI0A 3A9RA 3K4HA 5BVHA 1O87A 2ZAYA 5E6UB 3TE7A 2DR3A 1E0JA 2ECFA 2RGDA 2RHDA 4PGHA 4JBXA 3JWHA 4R2HA 1PR1A 1QHHB 1XCGB 4L4SA 4MVJI 4N3AA 3WYGA 3IT0A 3EY4A 3M6AA 3U60B 4RD3A 5FWAA 2GH1A 4J43A 4RIIA 1KO7A 1RRPA 2DPHA 3GLQA 4J9UE 2FSVC 2ZRAA 3RAGA 3QV1A 4RA6B 1BRTA 2Z30A 4MWBA 3E35A 3L84A 4CTOA 4C22A 4JXXA 3HY3A 3PFCA 4RGBA 3OH8A 4YCJA 4LBVA 1FP2A 2ROQA 4MQMA 1MMFB 3KUXA 4KQWA 3CLSC 4AZVA 4UXHA 3ZQ6A 2I78A 5CXQA 2WAOA 4L8YA 1DV1A 3FPSA 3B13B 4BFUA 1KAQA 2MSEB 3BICA 4I9UA 2R85A 3CVVA 5CNJA 2I7VA 3EZYA 4DMUB 3H13A 2IIBA 1LI5A 3LBIA 4ZOCA 2Z6UA 1RPTA 3PDCA 1HLDA 3NZEA 3BZUA 5ARBA 3CKKA 1KP9A 1QPZA 3HACA 1UP6A 5CYFA 1FYDA 4W8GA 5K6AA 1UBLS 1FQWA 1NR1A 2AG0A 2NU7A 4G5OA 3GAAA 3PJFA 1KI9A 3N7UA 2C99A 1JDSA 1IHPA 2C9OA 1FX0A 3ANMA 3MJFA 4KCGA 1ZN2A 4OGGA 1N0VC 3BFJA 2IUUA 2QVXX 4GKVA 3KT8A 1WXGA 1E69A 3LWBA 1DDOA 1REQB 2X5JO 5EKTA 3KLBA 4K3UA 2A2ZA 3IP7A 3GPDG 2F3SA 3IUYA 1YJAA 4MH0R 4NCJA 4WV3A 2GEBA 2X0KA 3LC0A 2CCGA 1EJBA 5DNEA 3SN6A 4BQOA 3DEZA 3GP8A 3DV9A 1T3GA 3CX4A 1LSOA 1EUCA 3FYUC 1JVNA 2G82A 2JFYA 5ESWA 3AVUA 4L5AA 4RLSA 5K05A 1VL0A 4FX2A 3UJ7A 4RM2A 4LRYA 2Q5IA 2CC2A 1BD4A 3THWB 5FHQA 4J29A 2BFPA 1Z28A 1MH9A 2R86A 2W8BB 3C5HA 3EG5A 1BEZA 5JVDB 3QFTA 4AJ9A 1QVRA 3B82A 5NULA 1QBKC 1TTQB 2R1VB 1M8KA 2WM2A 2RHBA 1OLUA 1KY5A 2DSNA 5AKKA 3IR6A 1SKQA 1V2HE 1P2DA 4IIJF 4O4HF 2JFXA 2NTYC 1U2DC 1U3DA 2LGJA 5GY7A 4JSRA 3NTXA 2ETVA 2VPTA 1U94A 2FB9A 1CUUA 2IU3A 1Q7TA 3BXFA 2GZ1A 3JQFC 4RPGA 3SC2B 2FEWB 1W7AA 4YQYA 2Y76A 3G8CA 1I4LD 2E9SA 3JYPA 3K92A 4IIDA 5ALYA 3VSEA 1UZAA 4C3VA 3V80A 5ERGB 2ZANA 3R77A 4HLNA 1YRHA 2O2EA 3ZWCA 1HURA 3T5DA 1TEVA 3RYFB 3SX2A 2G5GX 4GMDA 4PLPA 4MB0A 3OM1A 1TMYA 4S0ZA 5F7ZA 4JI3B 4W7SA 2ESRA 1QM5A 1FDTA 4G6ZA 3ZQKA 5LNK1 4ARIA 2BY4A 3I01M 4OH1A 2BM9A 4YJDA 3DLTA 4L5BA 2H9YA 3KJIA 5I9BA 4ARZA 3BDVA 3E70C 4QELA 3TEJA 3TOVA 1SC1A 4O63O 1XQ1A 4L28A 3M7IA 1B16A 5IAGA 4JODA 3LK6A 2WABA 3WKDA 3EGCA 4DZRA 4HLCA 3WZMA 1XAGA 3R0ZA 3A6LA 4XZ3A 3X1YA 1I7DA 1NNSA 4BATA 3ANTA 2QRPA 2Y2VA 1FJXA 1RR6A 1XRPA 3SIWA 2IDZA 1YK0A 3SSAA 4B17A 4EIWA 5KBYA 4AY2A 1MUUA 3L6OO 4UNIA 1UP4A 2JFZA 2Z9DA 3FAZA 2MIIA 5KO2A 1EJ0A 3AB3A 3HFGA 1JG6A 1S3IA 3JZFA 3LH5A 3ZTYA 2P78A 4A8TA 4IEFB 2QRJA 3L0BA 2WF9A 3GRVA 1R9GA 4LE1A 3KL4A 5A4AA 4IOKA 4X24A 5HCIA 2CLOB 4ZA2A 3LT0A 2NAPA 4FHZA 3LCMA 4MIOA 4CM1A 2UYYA 5IVHA 2AGVA 1H0KA 3E3LA 2HLDD 4QPJC 1L4BA 4RFSB 3UIEA 1GFZA 2IYEA 3C4VA 4JENA 1D9XA 4ZO6A 3BB1A 3L8ZA 3LE8A 2ID8A 4GIBA 3SIPA 3AVTA 1IC6A 5B5SA 3AP3A 1R7RA 5EZQA 2ATVA 2ORYA 3LCJA 1U8UA 4MWZA 4F6RB 5EYPA 3AVXA 2J4CA 3EW9A 3H5TA 3EX7C 2PZBA 2VTBB 4J0IA 3BB4A 5F1YA 4HB2A 2H52A 1CEXA 1MNQA 2CFIA 5LNK6 4YAOA 3SI7A 2H1WA 4GX5A 2CNWA 3V55A 2DM6A 2RCNA 2W8ZA 5ETJA 5IF9A 4JNCA 4QLAA 1E64A 3GK3A 1Z6QA 3UY4A 4CKEA 4NLLA 2HU8A 3QHPA 4O6VA 4PSDA 5SZHB 5KQMA 4Z2YA 1W0KA 4G5GA 3K15A 4KV9A 2B8EA 1YUMA 3OUTA 2E37A 3SJUA 2ECPA 3BCHA 1FMJA 1Z0AA 4HUQA 3HVIA 5FTKA 2XNCA 3KB1A 3PQ2A 2VBIA 1J99A 2YR0A 3LW8A 4Q1EA 4EF6A 1QSGA 3VVBA 3FWZA 3I2HA 2JLZA 2NVUA 4C3OB 3CGGA 1KARA 3JQ8A 4FQ8A 1ORDA 3DZDA 3U49A 4R68A 1JKMA 2QLFA 3E22A 4DQXA 2ZRMA 1TDJA 1NSTA 2BMJA 1DHTA 4FW8A 1XJ0A 5B1IA 3HDHA 3ZHTA 1F8FA 2FN3A 2GCIA 1QO0A 4NY1A 4EJ2A 1AC5A 1J9ZA 2WSSA 1SG6A 2XNJA 2Q41A 1QX3A 2ZSUA 3C4QA 4WA8A 2OHIA 4YJFB 4BNFA 2PX5A 2WTBA 3MBIA 4JROA 2ON6A 1BGXT 1ULBA 4Q03A 5CYPA 1P29A 2VSFA 3ZC3A 3SJ7A 2E21A 3ST7A 4RMGA 2CVHA 3PXAA 4WZ6A 4K9RA 1L7EA 3FCAA 3K4PA 2ZJZA 2QNBA 3AXSA 3B1VA 3OETA 2NSJA 1KO5A 2FW9A 5LA6A 1GN9A 3Q3GE 4BYMA 1ICEA 3QVUA 4ZJYA 3PD1A 4EY5A 2DULA 5BSHA 4QDZA 4OCZA 2OXRA 2XRMA 2QYSA 1IEQA 4YCBA 4BNWA 4FDVA 5CBKA 5E3JA 2A5JA 4U2BA 4WCVA 3WB0A 4AF6A 2GXUA 2E0IA 3CLHA 3LT5A 3P2YA 3RKUA 2CJXA 5ESDA 2H0QA 2VJCA 3G5AA 1A97A 3MTQA 1SU8A 5EWLB 3OIWA 4M8NE 2D1SA 1NZFA 1OZ0A 3ILHA 5BURA 4P22A 3L49A 1E5VA 1GEEA 1HYQA 2O2JA 4YGXB 1I2CA 1NUUA 1XMQB 2AI3A 5PGMA 2OHVA 4JP3A 3BTSA 3G5MA 4XDHA 4YRDA 3VH1A 2GF0A 4R1MA 5CP8A 3W8DA 4XWWA 4EB3A 1UZNA 3AVYA 1XPUA 2GKGA 4M1WA 2JDIA 4C08A 1CUSA 1N9GB 4CLOB 4C0HA 5D51S 5HIJA 2JIOA 4PYIA 4WECA 2ASVA 2QM8A 1EBFA 1DAGA 4RL6A 5GZ6A 4BLQA 3GLIE 4LBWA 2CZCA 1S4MA 1KKMA 4YMHA 3FNRA 3MWYW 1W4CA 2PL5A 4LDNA 3T9CA 4RFLA 1U1CA 2C8JA 2DBVO 4ZOAA 4JBGA 2Z1MA 3NVMB 2FFAA 1JZQA 3EF1A 1Z5GA 4FX5A 4KX5A 4LXHA 1WZIA 3VZQA 4DA7A 1QHFA 2HZ7A 4ECEA 5SZKB 1A9QA 1XTPA 5K3FA 3BIXA 3CSSA 1OC4A 3ULKA 1OWPA 2QUHA 4OJYA 2QRUA 4RF4A 3AYXB 1Z6PA 4F4DA 5TMPA 3OE7D 1E7RA 1XKQA 2IBTA 2PXCA 3UJDA 3SU8A 1JHVA 3D6JA 4YS6A 5LLDA 1JLHA 3AR3A 4DW8A 1MPTA 1DL5A 3D3QA 2XZTA 3EGVA 1ODFA 1KI6B 1GGFA 1ZGCA 2QRNA 3DXXA 2SCUB 2IYZA 3V8EA 5K8VA 2UUCB 2WDPA 5H0IA 1G2OA 5CVUA 3KEFA 2AX3A 5DEIA 3RVNA 4Z3OA 4GKAA 1O54A 4IWYA 5FUQA 3DZGA 3OCCA 1NBWB 2ZSHA 3OLZA 4IDGA 4DGSA 2GRJA 2X7JA 4AMZA 1SU7A 1LS1A 4IW3B 3WL4A 1PW7A 1WUJS 1XEWY 1GZ6A 1PEKE 4R31A 1T0BA 2Z8ZA 4F3YA 1JG4A 3OQHA 1E7WA 1Q92A 1QQ7A 1SUWA 2FFHA 2VJMB 3BSSA 1I7PA 2XKJE 3KT0A 4MTLA 5K2MA 1DUIA 2YMMA 3EW7A 3F8WA 3UN1A 2P0YA 1IWPB 4W5QA 2VDQB 3LCRA 5AKZA 1G7RA 3BGIA 3JD1A 4TLEA 5K0JA 5F2OA 3N75A 3NCHA 4LRSB 4OJMX 3AUJB 4NICA 4QHYA 5JZ9A 2EU8A 4CLDA 3CO5A 2WYIA 4L73A 3OQOA 1P91A 3KJHA 1T25A 3NTRA 1ZD4A 4KMMA 4WFJA 3EXEA 4WBNF 2F9LA 4XRRA 1KYXA 4IXMA 4POOA 1CC1S 4KFCA 3GEDA 1VBNA 4OK6A 3ZDRA 4MP3A 1RFGE 3WAGA 2DPGA 2J3LA 2GKSA 2R8RA 2D2XA 6ADHA 4ND8B 3ZHCA 3BGOS 1W5BA 2EKDA 2QJWA 1D4FA 5JNVA 4R8KA 1F20A 3RBVA 1YS7A 1L4LA 3A4NA 1ZAKA 5AJYA 5EOVA 4W9RA 4ZVKA 1EFRD 5ECDA 5GM1A 1IU9A 4TXNA 4HUTA 1KFJB 3E5NA 3K05A 2R2GA 4OL9A 5EA2A 4IFBA 3GAMA 2JHAA 4MKIA 4CIYA 2PZAA 3CVJA 3EG9B 3IQXA 1M2NA 1N2SA 2P1RA 3MUFA 2AJDA 5CFZA 5IBCA 2RONA 4IZOA 3UB2A 4LRQA 4XPIA 5FDFA 3ZX4A 2YY6A 4ZAFA 2J6IA 1R16A 2V74B 2EZ8A 5B7GA 1C3EA 1ZOLA 1PR3A 3AW9A 3KQQA 3MF4A 4X20B 5FLKA 1AS3A 1Z5NA 3FIUA 1U9ZA 2P0AA 3AEYA 3AXTA 3HUUA 3PX2A 4L57A 4Q9AA 3RYHA 3M6MD 3PNLA 4EPYA 4G4SO 2DETA 2WRZA 1HT2E 5DYWA 2EJUA 3ZDDA 2VN8A 1UFKA 2P2LA 3RAJA 2PUWA 4EW2A 7AT1A 4CCSA 2LDXA 3MTJA 5TDHA 1L5QA 3I0NA 3P9KA 4P82A 4RD0A 2INGX 2PA3A 4JP1A 4JLNA 4OXQA 2Z2JA 4FYHA 4IXWA 5KQLA 2OM6A 2YN2A 2QP9X 3GOHA 5HFJA 5JD5A 1ZK1A 3A2NA 3Q5GA 3D4LA 5KYYA 1YFJA 4E46A 2FAXA 1T36B 5K03A 1LJ8A 1ST2A 2CV2A 3BJIC 3TTYA 3UICA 4IIJB 3NATA 3JQAB 1ZGJA 3A6DA 5AQ1A 2GSDA 2EX4A 3WWPA 1P7YA 2XD9A 4R0VA 4TV8B 5CH5A 4HQFA 1L2TA 3AFMA 4N7JA 1SD5A 2WU3A 1MAAA 3GFBA 3H4MA 2P9HA 4KU4A 3EC2A 3PG5A 4M7RA 1OKKA 3CNQS 3GRZA 3ZYZA 4W7HA 1B42A 2GMWA 5K0LA 2IH2A 2IXEA 1ZBDA 4WZZA 1BU5A 1QF9A 4I9NA 4K6CA 3O9VA 3L0PA 3T3OA 1Z12A 2UXCB 3KG2A 2B0CA 4MV6A 1N8NA 4WTOA 2FN7A 2Q6IA 3EMDA 1Q1QA 1FJGB 5C0OE 3LC2O 1RLUA 4MQ6A 4LA4A 2IHTA 1GLNA 3Q3VA 1XDDA 3PXGA