2PBGA

6-phospho-beta-d-galactosidase form-b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYCDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
total genus 174
structure length 468
sequence length 468
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pbgA00
1W9PA 1UH3A 2W61A 1E1FA 1JIBA 2CXGA 1JGIA 3N04A 5M03A 5JBDA 4ACYA 2YDRA 7TAAA 1M04A 3O2LA 2AOSA 5A8NA 3CLWA 2IXVA 4HU8A 1LQ0A 3PTQA 1QBAA 1BG9A 1J11A 1RD6A 4F66A 4MNJA 3EMQA 1BYCA 2FHFA 4HOZA 4FLQA 3IANA 4TVUA 1CXEA 3KEHA 3L4WA 3W0KA 1KCKA 3OBAA 3GBDA 4IPLA 4URIA 5A8PA 3RJYA 1PBGA 3KL5A 3MMWA 2YKKA 2XPKA 1WNOA 4ZEPA 3EMZA 1H4PA 1UG6A 4D6CA 5TD4A 1HJSA 4AZCA 2XVPA 4M29A 1VFOA 5D9MA 2WKGA 2ZIDA 2OSXA 2GJXB 2XVLA 2J8GA 2D0HA 2VX5A 1B90A 2DT3A 3AZRA 3L4TA 3AXHA 2FGZA 3AIEA 2XJ7A 4ZE4A 1KGXA 1B3ZA 1E0WA 2Y8KA 4WKFA 3IJ9A 3RM4A 4JL2A 1GQJA 1OGBA 1UKPA 2VZTA 1JYVA 1V3KA 2J62A 3I3DA 1C8YA 4Z2IA 2VZSA 4CD8A 3OGVA 5D8ZA 1EIBA 2V3DA 4E2OA 3GZAA 2W63A 3VIFA 1JF5A 4QFUA 3ALGA 3L4XA 3S2CA 3W4RA 1KQZA 3L4YA 4OIFA 1BYAA 1ZJBA 2F2HA 1QI4A 4HU0A 4OJYA 3AJ7A 4GQRA 1ZL1A 1WDSA 3VIHA 4OUEA 2ZUUA 2OSWA 2VT0A 4YPJA 5BXRA 4AD5A 3CHEA 2YJQA 1OINA 1OB0A 3POCA 2XFFA 1VENA 2CKRA 4NRRA 3FY1A 1PIGA 3RJXA 4EANA 1NH6A 1BYBA 3FAXA 3ZJ8A 4TVCA 1V3HA 4ATDA 3K46A 1EO5A 2EPLX 2BY2A 3RO8A 2WMFA 4U2YA 3B9AA 2WAGA 3VD7A 3OIHA 2OYMA 2GUYA 3IAPA 3ARWA 3W25A 1E6SM 1R8LA 4LQ1A 2ZXBA 3WQVA 4CUCA 1ISXA 1DWJM 2XG9A 1PX8A 3ZR5A 1O6IA 4LYQA 3WEZA 4IM4A 1DWFM 1NOWA 3DHPA 2EXOA 3T0DA 4F9JA 1V3MA 3HN3A 3WDPP 3WF0A 2EEXA 1W1TA 1E3ZA 2BXYA 2OWXA 3VDHA 4CGTA 2EPOA 3WY1A 1UD6A 1VJSA 4AIEA 5BRPA 2WLZA 1NP0A 2JF7A 2J7CA 3TONA 2BXZA 4TOQA 1RPKA 2E4TA 3RPMA 2Y2WA 1GJWA 4L4OA 3CUFA 3U5YA 3CMGA 2WVUA 4AZIA 1K9FA 2CHNA 2DT0A 4ACZA 3VUPA 4LXFA 3WDIA 2OSYA 4YN5A 1F4AA 4WF7A 1OIFA 1BQCA 4TVDA 2QHAA 3M7SA 1UWIA 3L2LA 3LPOA 4JAWA 4ZXOA 4WSKA 1TCMA 1E6QM 2B31A 2GK1B 1KXTA 3WNMA 5HBFA 2HISA 3F5KA 4KGJA 4EAMA 4BCEA 2MANA 5CSUA 2YL9A 3VDCA 3VMPA 4PTXA 1KB3A 1BFNA 4X0NA 5A8OA 1E0VA 2VQUA 5A94A 2PWHA 3T2PA 2JIEA 4P7NA 2EJ1A 4M24A 4M80A 1TMQA 1BTCA 1EHNA 1GQIA 2VX6A 1U33A 5A6BA 3GH5A 3TP4A 1UR4A 3ZOAA 1V08A 3WDRA 5CJ5A 4V27A 4TX8A 4U5IA 5CPTA 1PJ9A 2PBGA 1BAGA 2GVYA 2XTKA 4KWUA 1CZ1A 1E55A 5DT7A 2WVTA 4AXNA 2CERA 3CMJA 3WDQA 1ZBWA 2OYKA 5BXPA 2VRKA 3A4WA 2QPSA 4HMCA 2Q8XA 4FF5A 4P8VA 2YIHA 4A4AA 3T2OA 1UA3A 3VINA 4UTFA 1V6XA 1TA3A 4P8WA 3BMVA 1WO2A 1GPFA 1FOBA 1UZ1A 2W5FA 3DYOA 1IV8A 1CXFA 5BXSA 5GNXA 4KRUA 3MU7A 1FFQA 3VU2A 4AEFA 3RM9A 1EDTA 4RE2A 1GUVA 2V3FA 2X2YA 5FIPA 3UG4A 2WANA 1OGGA 1TVPA 1OT1A 4D72A 3SCPA 5BRQA 1C3FA 2ZUNA 1B31A 2OWCA 4B3KA 1QHPA 1PZ3A 5A6JA 1V02E 6TAAA 3WH8A 3AIQA 2J7EA 3AMGA 3CHFA 4H04A 5IXEA 2X05A 1W3HA 3IAQA 1W9VA 4HP5A 1MW2A 4UR9A 1UKQA 5DMYA 1GHSA 3NSXA 4CU6A 3VGHA 4L4PA 2CIPA 1LG2A 4PMVA 3VD9A 3AI0A 3OG2A 3SCNA 3W29A 3WQ4A 2V5DA 2VR5A 4UQEA 3WEOA 1SR0A 1C91A 4J3XA 2ZUTA 4AD3A 4AD1A 1JNDA 4UFIA 3WNPA 2QLYA 3NSMA 1UZ4A 2OYLA 3G6LA 4HMDA 2C0HA 4TTUA 3VPLA 3WD0A 4JFTA 3WF4A 4J28A 1KBKA 2CBUA 5CQ1A 3A6OA 1YHTA 5JUVA 4MDPA 1W9XA 4DWSC 1GQLA 3AIVA 4MNKA 2YBUA 4CKQA 2EPKX 1WCGA 2X0HA 1V6VA 1K6AA 3ZJKA 3PN8A 4D6IA 3VM5A 4F79A 3UETA 5JBEA 1C90A 1UR0A 1V0NA 2JALA 4FLRA 4ZENA 3QOKA 2BS9A 2PWDA 1KXQA 4PN2A 5LA2A 5E6ZA 5LYRA 4H8VA 1MW0A 4JCLA 1XH1A 5D9OA 3MANA 2G41A 1X6NA 5JIWA 1GOMA 4WJXA 2E8ZA 4TTGA 3B9EA 5HNNA 1E3XA 1TA3B 1ISVA 3OZOA 1JYWA 2DSZA 4JHZA 2J4GA 4J3VA 2VJXA 3ZT5A 2CBIA 1J0YA 4W7UA 1J0KA 3FN9A 4HOXA 4BF7A 1B30A 3GNRA 3OB8A 4MADA 2WCAA 3S6TA 2NT1A 3WUBA 3F4VA 1O7AA 3M6DA 2JFEX 2WVSA 1PX3A 2E9MA 3W53A 3GXIA 1ZBCA 4WKHA 5ABGA 5HDRA 1E70M 2WMHA 2ZX6A 2PWEA 4PSRA 4EKJA 5D9PA 1E6ZA 1JZ2A 1TZ7A 2J8FA 2DIEA 3WENA 5I2UA 4GKLA 3AMCA 4PUEA 3AYSA 3ARSA 2XM2A 4YHGA 3CPUA 3K4AA 3UESA 3WQ8A 1MFUA 1OIMA 5IFTA 5HPOA 1JXJA 1EOMA 5A6SA 4GI9A 2JF6A 4PMNA 2A3EA 1ZBVA 3VGEA 4KGLA 1XGZA 5AC5A 1ITXA 4H41A 3MV11 2GK1A 4MNLA 1HKMA 1PPIA 2VZUA 7A3HA 2WW5A 2D0FA 3RDKA 2DH2A 2AAAA 2V3EA 1BGAA 1E5NA 3MV01 4ZXLA 4PSPA 3POHA 4B16A 1JI1A 1UD3A 3UG5A 3CZKA 4UZUA 3QHOA 1DEDA 4W8LA 2WKLA 3EDJA 2XIBA 1CECA 3SUSA 1E1EA 1FFRA 2O9PA 1HIZA 1X1NA 1W2VA 1V3JA 2ZUMA 4XUYA 2G3JA 3CZEA 3GH7A 5CPSA 1UWRA 1NWSA 2J79A 4R5EA 1EXPA 1V0KA 4MNMA 3FHQA 3ECQA 5ABFA 1XSIA 4ACZB 1KWGA 2DDXA 4GZIA 2D24A 3AROA 1E4MM 3SCRA 1F4HA 5C71A 4AZCB 5E6YA 4GQQA 4UFHA 2D3LA 1G9HA 1DWAM 1UH4A 3W27A 1KGUA 2J77A 4UOQA 2YL6A 1QVBA 4V2XA 4A3YA 1G1YA 3FNDA 4KMQA 2OWWA 2WPGA 1OSEA 4GI6A 1HKIA 3OLIA 3MMDA 1WZLA 3WKZA 4JFUA 4HZ8A 3W28A 1ESWA 4JCMA 3AS1A 1QPKA 3GXFA 5JIPA 2YLLA 4M82A 5E0CA 5GNYA 1PX4A 5A95A 2ESCA 3WUGA 1QNQA 2CITA 5DEZA 2WWDA 2E9BA 3ZT6A 1XYFA 4MB1A 1H49A 2VUYA 1HVXA 4W85A 1CNVA 3WBAA 3TOPA 1FHLA 5LA1A 2BY1A 4Q7NA 4F8XA 3DYPA 1W9DM 3N17A 5C70A 1EDGA 4PCTA 1HF6A 4OKDA 2CHOA 1VBRA 1GHRA 2O9RA 1VJZA 3OGRA 3VIPA 3WIJA 2DQXA 4W93A 4JFWA 1Q6EA 4AZ6A 3W24A 4FK9A 3WSUA 3I3EA 3WL1A 4B3LA 1GOWA 4PMQA 4N42A 1J01A 4NRSA 2PI6A 8CGTA 2EO7A 1D3CA 1WDPA 2A3BA 2F61A 3AHZA 1BLIA 4UQBA 4Z2HA 2A3HA 3AICA 1KGWA 1VB9A 1CPUA 1H2JA 5I78A 3WQ5A 3ZT7A 1EOKA 1GVIA 4UNIA 5KZ6A 3BAKA 4AIOA 1GJUA 1CGYA 1WE5A 4UCFA 2VURA 1JFXA 1JZ5A 1XSJA 4QLLA 3DECA 1WKYA 1DTUA 5CG0A 3GH4A 4V28A 3CIVA 2YA2A 3SUUA 3U7BA 3AZSA 1E4LA 1UR1A 4PMXA 2W91A 2IXUA 1ISYA 1EA9C 2W4XA 4CCEA 5ABFB 4W88A 1OD0A 5HXMA 3NIYA 1V0MA 2XVGA 1B3XA 1VFMA 4DM1A 4B9YA 2CKSA 4QP0A 3LMYA 5A2BA 3EDFA 1PEZA 1ECEA 3KWXA 3GBEA 3THDA 3VGDA 4BQ5A 4WK9A 4QLJA 1JDDA 1KXVA 4D6DA 3ZIZA 3A47A 5KEZA 1HNYA 1VRXA 4AISA 3W37A 2EBNA 3GNOA 2WNWA 2IUZA 3WF3A 4D1IA 4HMEA 1LF1A 4LGXA 1DWGM 1BF2A 4UFLA 1H0IA 3AZTA 3VO0A 1JAKA 5EFDA 1GNXA 5A8MA 1RH9A 4HZ7A 4TUFA 3NYDA 2AMGA 4UQ9A 1FH7A 3UEQA 3VILA 4MDOA 1L0PA 3ZJ7A 2EPNA 2G3IA 2BY3A 5DO8A 4PUDA 2GSJA 4MAZA 4Y7EA 4E8CA 3WFLA 1HJVA 1E4NA 1W1VA 2G4FA 3AXXA 1HX0A 3SEPA 4QLKA 1WDQA 4MB5A 4GXPA 1FA2A 5F7UA 4U33A 2CBVA 1DWIM 3TTSA 4AY1A 2WC3A 1UD4A 1MQPA 4AZHA 4AWEA 3BAIA 5CGMA 2ZX5A 4S3JA 1JI2A 3HJEA 3SUVA 4PMDA 2V38A 4AEEA 1Q6DA 2WXDM 1BGGA 1JZ3A 1BG4A 1AVAA 3DHUA 1B3WA 3VDAA 4UFKA 4Q22A 1FH9A 1J10A 1M03A 4AW7A 4B15A 4YHEA 2ZE0A 4LX4A 1ISZA 2GJRA 1CXIA 2VL4A 1J12A 4H8HA 2WMJA 1C7TA 1WZAA 1E9LA 1UA7A 1UQZA 2BFGA 2D3NA 4ATWA 4CCDA 2VX7A 3BCDA 1CYGA 1NWTA 3UG3A 2J78A 1P6WA 1UKTA 1V6YA 1C93A 3T09A 2W67A 5IFPA 1QW9A 5I3DA 4PMZA 2NT0A 5D4YA 1HP5A 1GQKA 3CUGA 3K4DA 2HVMA 2XGBA 5ABHA 1E56A 4ATLA 4FLSA 1C7SA 1KXHA 1WAWA 3BGAA 1IZJA 2DGAA 2VCCA 1BVNP 3EDDA 5E9AA 3WF2A 5A6MA 3BCFA 4DUWA 3VIKA 2D20A 2VNCA 3WH7A 1WB0A 4UQAA 3SCQA 4NSBA 1CTNA 4KH2A 2Z1SA 1SFSA 1BVZA 2V5CA 3BMWA 2GDUA 3W82A 2J75A 2DEPA 4D6JA 2XVKA 4D6HA 4HPHA 1US2A 2BY0A 3CZJA 3N13A 3MKKA 4Z2LA 4JL1A 1JZ7A 1XSKA 1AQ0A 3OLGA 1H5VA 3AHYA 3W6MA 1ZJAA 3VNZA 4DWSA 1SMAA 2BV9A 4OBSA 3G6MA 3CO4A 4CD5A 4XX6A 3KL0A 3WMSA 2X8RA 1CDGA 2W92A 3PZMA 3K8MA 1K9TA 3AISA 4PTWA 1NARA 1JAEA 4M1RA 2UY2A 4W5ZA 2VOTA 1GOQA 2X1IA 5D8WA 2UWFA 7CGTA 3PZUA 1E6RA 1ITCA 6CGTA 1OD8A 2BNJA 2X09A 3VD5A 5I24A 5BXTA 1QNPA 2GJPA 3CZ8A 2J7HA 2Z1KA 4BQ3A 1JF6A 1UWSA 1EDQA 1MQRA 4Z2JA 1V3LA 2BHZA 2CEQA 1IT0A 3ARVA 1XD0A 2D1ZA 2QV4A 3WFZA 3AS0A 3AFBA 2DT2A 1GVYA 1OWQA 3MSDA 1VEOA 3AOFA 3WNLA 2XHYA 3W81A 5EFFA 2W66A 1M7XA 4UOJA 5E70A 4MB3A 1QHOA 2ZUVA 2YA1A 1B9ZA 3U7VA 2TAAA 2XFYA 3AHVA 1B3VA 1CGVA 4U5KA 3RIKA 4MPKA 5A2CA 3UCQA 5BWFA 4UZSA 1Q6CA 3OZPA 1HN1A 2NSXA 4PBGA 4QCEA 3FW6A 4DUVA 1MWOA 1QI2A 4PMYA 3SURA 1V0LA 1WP6A 4AD4A 1JZ4A 1MQQA 4IPNB 3VVGA 4MB4A 4AIUA 3WEMA 3FAWA 3NCOA 4IUGA 1HKKA 1VFUA 2F8QA 1JYXA 2DH3A 2QPUA 1J0JA 1W9BM 2FDMA 1SMDA 3IJ7A 4N0RA 4AZ5A 2CYGA 1M01A 4W87A 1CXHA 1LL6A 2PF0A 1TFVA 4S3KA 5A6BD 3NDZA 4IISA 4K68A 3L4VA 1UR2A 3PZIA 1ZS2A 1C8XA 3PHAA 4NF7A 3SCOA 3WN6A 5I77A 2YDSA 5CZKA 1EQCA 2GDVA 4AYSA 3WF1A 3IJ8A 3CTTA 1LWHA 4BQ2A 3PZTA 2FHCA 1R85A 1DHKA 1NP2A 3L4ZA 4XZBA 1LWJA 3ZR6A 1XC6A 2C8NA 5A3HA 1GOIA 1N82A 1QI3A 1W1PA 2A3CA 2WMIB 1GW1A 4QDMA 5AC4A 5E09A 1EO7A 4W84A 2YA0A 1OGSA 2DT1A 4AD0A 4BQ4A 3TA9A 3UR7A 2FGLA 2ZXAA 2X0YA 1S46A 2D23A 3VM7A 2UY5A 4CN1A 1UD5A 1W3KA 1UYQA 2CBJA 3EBVA 1C8QA 1W2PA 1JFHA 4LYRA 2VVSA 1KBBA 1JYNA 2YLAA 4R27A 1H09A 1J18A 4W8BA 1E6PA 5A69A 3A4XA 3AQUA 4PTMA 4HA4A 2ZXQA 3BLKA 3VIGA 3ZMRA 3E1F1 1W9UA 3M07A 2QMJA 4OOZA 3AIRA 3AMLA 1JD7A 4GIAA 3PZQA 3AIWA 3GYCA 2Y4SA 3ARZA 4HPGA 4GO9A 2WM0A 4KRTA 2VQTA 4MTVA 3ZSSA 3MUY1 3TTYA 9CGTA 3GTNA 2OLHA 4U2ZA 4W5UA 1JDAA 4UQDA 3WL0A 4JIEA 4CCCA 1NOUA 2EQDA 5DF0A 2WZIA 4P7QA 2WCGA 2C7FA 1CIUA 1GORA 4OZOA 3GXDA 4CVUA 1V03A 3VTRA 3AXIA 3T2QA 3AIBA 2BVTA 4GO8A 2ZX8A 3PZ9A 1E5JA 5GQBA 2VRQA 4BA0A 2VVNA 4DWSB 1H11A 4CD6A 3LPPA 3GNPA 3A4AA 4D6EA 1UUQA 1I75A 1QNOA 4AMCA 1HKJA 4AD2A 3ARRA 1UWQA 1OM0A 1E6XM 1UR9A 2FHBA 5LA0A 4NZCA 1WPCA 2WMGA 1WZKA 1HVQA 3VMNA 3WQ6A 2XYLA 2CPUA 4OBRA 3AMKA 3QHMA 2XIIA 4AZBA 1UOKA 5A1AA 4BZYA 1HL8A 1X6LA 4C7FA 3FHAA 3BAYA 3WH5A 1A47A 1B2YA 3L2MA 1BHGA 3HMCA 3T08A 3SUTA 5EB8A 1G01A 2JIWA 2WWCA 2ZXDA 1A3HA 5CLWA 2V3GA 1JG9A 3CBWA 3CZGA 3N18A 4J27A 3CH9A 4P7LA 3ZQ9A 1PIFA 3EDEA 1J0ZA 3ALFA 4JFVA 4PCSA 3MUAA 3BSGA 4AZGA 4CU7A 4HA3A 3BLPX 1TR1A 3LPGA 5GNZA 3WNNA 3SCSA 1JNEA 5A2AA 1U30A 1Y7VA 2E3ZA 1G5AA 3ZJ6A 2D2OA 2J7GA 5IDIA 1W1YA 1LLOA 4CU8A 2VI0A 3N12A 3GM8A 3T0AA 4ZE5A 3UERA 3WD2A 2G3MA 2RGLA 3SCWA 4DM2A 3AS2A 3QHNA 3RILA 4ZFMA 1K9DA 1J0IA 3N11A 3WDHA 3F5LA 3WH6A 1XV8A 2PBOA 1AQHA 3J7HA 4XB3A 1E0XA 1E73M 2VZOA 4B9ZA 1CLXA 1C92A 5A6AA 3CZLA 3N1AA 3VD3A 1UD2A 4P8XA 4W8AA 4J3TA 4CN4A 4CD7A 5GPRA 3ZO9A 2GJXA 4M81A 1HJXA 3ARUA 1LJYA 1M53A 1WDRA 4HOWA 3BC9A 4PEEA 1VIWA 1KR1A 4W89A 2CNCA 4MAVA 1ODZA 3D3AA 1IZKA 2DSWA 1DP0A 1TG7A 2WSKA 1CGWA 1L8NA 2XSAA 3WD3A 4XZWA 5I5RA 1B1YA 2G3NA 1GZJA 4CN6A 1E43A 4H8UA 2BHUA 2NW0A 2ZUSA 4PRWA 3K8LA 5A8QA 1E40A 3VGBA 2ZOXA 1B0IA 3CUHA 2VR4A 4J3WA 2VTFA 1CWYA 2JEQA 3SUWA 1UH2A 5I23A 3APGA 1OCQA 3EDKA 1EHAA 3SIMA 2J47A 2ZUWA 2VCAA 5ABEA 1I1WA 3MS8A 5ECUA 1HJQA 3NSNA 3LPFA 5I79A 5A6KA 3W38A 2O9TA 4GZEA 4E4PA 4NI3A 1VFFA 3U5UA 1ISWA 2EPMX 2VC9A 5CPQA 3KZSA 1HXJA 1UQYA 1KR0A 3WH9A 1Q4NX 4WLCA 3UR8A 3O6AA 4TX6A 1R87A 1ZBKA 1E15A 2DSVA 5D9NA 5M17A 1G0CA 1EGZA 3W26A 1FH8A 1MVYA 2CESA 2J7BA 4M56A 4MJ4A 5FCZA 3NJ3A 1R7AA 1V02A 2FH6A 3W6LA 3U57A 1HT6A 2XWEA 2J7FA 2WHKA 4D1JA 4J3SA 5E0FA 3VGGA 1GOKA 2ZWYA 5AY7A 1MW3A 2BVYA 2YL8A 2J7DA 1UHVA 5C8BB 2PB1A 1MXGA 3BAWA 1DWHM 3T0BA 2VZVA 1JDCA 1FHDA 3VIJA 3PZVA 4HTYA 4JFSA 4U3CA 2DSKA 1RP9A 1KWKA 1XRVA 4P7OA 1UKOA 4H2CA 4U3AA 5IHRA 1GOOA 1CGXA 4X0VA 4F9DA 3MUIA 2PWFA 4PMRA 4Z2KA 1E6NA 3ARYA 4D71A 4WIWA 1AQMA 1CENA 5DFAA 3ARTA 3VIIA 1QBBA 2WVVB 1MW1A 1GCYA 4LYPA 5CGTA 1VBUA 2VCBA 3PTKA 4FMVA 5HPCA 1W3LA 2E8YA 2QF8A 2JE8A 4JZ5A 4GINA 3AIUA 1NM9A 2PWGA 3MO4A 2YL5A 3CUIA 4PMOA 4Z2GA 1PZ2A 6A3HA 3TTOA 4DUXA 1UR8A 1JZ6A 2XSBA 4JHOA 3NUKA 5AYBA 2FH8A 3WD1A 3KE0A 3IK2A 5FL0A 2D0GA 1XCWA 1CLVA 2D22A 1G94A 2O92A 2E9LA 3N15A 4M8UA 4PMUA 3EYPA 5FD0A 2E40A 4JKKA 3BAXA 3CUJA 3WDJA 3HU7A 3VKKA 4HZ6A 1KCLA 2WK2A 1W3JA 3WMCA 1MXDA 5IHSA 2QMKA 1TVNA 1CBGA 3DC0A 2BHYA 2Y8VA 1JD9A 2CETA 1UKSA 5EMYA 4X9YA 3SCVA 2XM1A 4AC1X 3VMOA 3BXWA 3ZM8A 1XHGA 4ML4A 3WD4A 3WUEA 4XV0A 1TE1A 3MSGA 2DSUA 3N9KA 4W86A 1B3YA 1CGUA 3PTMA 3OA5A 3VDBA 4H7VA 3F5JA 3VIMA 2E0PA 3CGTA 3VX1A 3AHXA 1FP9A 5CXPA 2XFRA 4C7GA 1Q6FA 1H0GA 1HJWA 5AYIA 2WZEA 2J74A 1MFVA 4WKAA 2WYSA 1NWUA 1V6WA 4GPNA 1E4IA 1NWRA 4GZJA 3M46A 4EK7A 2WMKA 3AS3A 1WZMA 1I1XA 4A3HA 1NOFA 3RCNA 1CGTA 1BSIA 1UWTA 1GONA 2J25A 3B8SA 1AMYA 2WSPA 2VMFA 3RMEA 1CEOA 1CXLA 2BVDA 3DYMA 5CLTA 3KL3A 3QR3A 3BAJA 1R86A 4PYSA 1LG1A 3OGSA 2XUCA 4C7DA 3O9NA 4J3UA 1W91A 1ZB5A 1TUXA 2ZX7A 5BCAA 4UOZA 3WNKA 3EMCA 3CHDA 1CXKA 4OOUA 4QCFA 4W7WA 4U31A 5FL1A 1U2YA 1ODUA 4UFJA 1JZ8A 1EQPA 2PC8A 2WCSA 1E71M 4FLOA 1XD1A 1NQ6A 1V6UA 3GXMA 2UY4A 2ZICA 1XH2A 3SCUA 3D5HA 3K1DA 1QNRA 3SCTA 3ARPA 3BH4A 1KQYA 5M3WA 4P8UA 1VF8A 3VNYA 1XH0A 3THCA 1OBAA 4TXEA 4EE9A 1R7OA 1OT2A 5HOSA 2CCRA 4HA1A 2WZHA 2UY3A 1MYRA 1HP4A 5JBFA 4WSJA 1H41A 1H3GA 3MMUA 4P7RA 3PZGA 1LL4A 5BYWA 5I0DA 1HJUA 3VGFA 2A3AA 2O9OA 1YQ2A 2WMIA 3VD4A 4LPCA 3RM8A 1PAMA 5EBAA 3K8KA 3BSHA 2VO5A 4JKMA 1FP8A 1QOXA 4J7RA 1Q6GA 4QAWA 2Y5EA 1VEMA 3CHCA 2W62A 5BROA 3JUGA 3PZOA 4W7VA 4BS0A 3VX0A 1XYZA 3AYRA 1LL7A 4RE4A 2VRJA 3ARQA 2WC7A 3WQWA 2ZWZA 5FOOA 1VEPA 4CD4A 1BPLB 2VX4A 2YDQA 3ARXA 1E72M 1UD8A 3OLDA 1W32A 2WC4A 5CSYA 1RP8A 3VIOA 4D6FA 2WHLA 1KFWA 3GDBA 2DIJA 3WMBA 2G8ZA 1XCXA 1QW8A 1US3A 3QGVA 3WUFA 2YOCA 4RE3A 3WNOA 1JL8A 3II1A 1ZU8A 4RL3A 2WBKA 5DT5A 5M5DA 3QOMA 1VAHA 2XVNA 3AMDA 1SYTA 2WB5A 2GFTA 4AZ7A 1K9EA 1JXKA 1QI0A 4CVWA 1EH9A 5A6LA 3ZSTA 1H1NA 2WHMA 3TTQA 1HL9A 4MJ2A 5I6SA 4UFMA 1D7FA 2WBGA 8A3HA 4JKLA 2DPEA 1Z32X 1BYDA 3VOCA 2WHJA 1QI5A 1UWUA 4UQCA 3WELA 3B9DA 5FKYA 4D6GA 4E8DA 3PBGA 1QHZA 1D2KA 2XGIA 1QNSA 2WLYA 3AHTA 2JEPA 3L4UA 2Y24A 1J0HA 3WBEA 3NDYA 2XWDA 1J9YA 4DWSD 2RGMA 2YBTA 3PZNA 2ZX9A 1V3IA 3OLEA 3A3HA 2WVVA 3I3BA 4PTVA 4GI8A 3MUZ1 3FXYA
chains in the Genus database with same CATH superfamily
1UH3A 4XBJA 4NAEA 3L5MA 3M0IA 3RX2A 1JGIA 4GNJA 3GLCA 3LV6A 7TAAA 4Q4OA 3DOPA 2F6KA 4CEXC 2IXVA 2ODOA 4Y9PA 4V33A 4C6MA 4HOZA 4M6UA 1RUSA 3IANA 1ICQA 1CXEA 3W0KA 3GBDA 1TPDA 1XXXA 5C2CA 2JKPA 4Q7BA 1XISA 1J2BA 3MMWA 2YKKA 2PZ0A 2XPKA 3DGBA 4AVOA 4RPQA 4Y9AA 3GHUA 2J88A 1KFJA 1VPYA 4RJEA 4D6CA 1HJSA 3GK0A 1KM3A 1G6CA 1UJQA 2WKGA 2XVLA 5ENLA 2IPGA 1TWWA 5DY3A 3L4TA 3OEXA 2BZNA 3NG3A 2XJ7A 1B3ZA 1E0WA 4XO6A 2BMBA 3PPGA 4ZOAA 3CH0A 3GU2A 1GQJA 4XAPA 3P8IA 1TYGA 1VC4A 2V5JA 2XGZA 4NX5A 2XDFA 2V3DA 4E2OA 3BJFA 3TMLA 3EGJA 3STGA 3E5PA 5K7JA 2F2HA 2X0SA 3T0CA 3HM7A 4HU0A 3VC5A 4M51A 3CT2A 4ORIA 2OTDA 3ICJA 2INEA 2VT0A 2PRLA 5FEZA 4FNRA 5BXRA 1OINA 3VNKA 1OB0A 3POCA 2CKRA 1HGYA 2KX9A 4RDYA 1IEQA 2HCVA 2NQ9A 4EANA 1BYBA 4HHHA 2WMFA 2WAGA 3VD7A 2Z00A 2CZDA 3GFYA 3ENLA 3C2OA 2HXUA 3IAPA 3W25A 1XCFA 4MY8A 4I7WA 3VNIA 4EF8A 3GG8A 3RU8X 3EB2A 5D30A 1KM0A 4HT3A 4BHYA 3CNYA 4LOCA 3MP5A 2OOFA 1JPMA 1WKDA 4MZ8A 3UR2A 4F9JA 3HA1A 1V3MA 3ID7A 1U5VA 1XBYA 1E3ZA 3TFXA 4Z17A 3CLMA 4GOAA 3VDHA 3WY1A 1UD6A 1K77A 1YDYA 4MFDA 4K1GA 2JF7A 2J7CA 4TOQA 5KSWA 3SZ8A 4IP4A 3JW7A 2QJMA 2HNHA 2WVUA 4AZIA 4WVXA 5REQB 2YGYA 4RK8A 3VUPA 3VA8A 4LXFA 4NZ3A 3WX7A 5LXEA 4LY4A 1XRTA 2OEJA 1PWLA 1A80A 3M7SA 3LPOA 4CNTA 4MF4A 4GIRA 2B31A 2OGYA 5C6MA 4UTUA 3CV6A 1IT8A 1KXTA 1KBLA 4GY0A 2P3ZA 4KGJA 5H2ZA 4Z42C 1PO9A 3FX4A 2I9UA 2YL9A 4QJ3B 4ZQRA 3W1TA 1UIOA 3AC0A 1KB3A 1X8CA 1BFNA 2ZA3A 4X0NA 2PMQA 4C5ZA 5HNRA 3G1RA 5DELA 2GDQA 3W2NA 4OT7A 4M80A 1TMQA 3ZOAA 3SSJA 4F2UA 2HXTA 1V08A 4L6OA 4JTDA 5HJLA 1H7OA 2PS2A 4FR6A 1W5PA 1BAGA 3L5AA 3R94A 4R9OA 4IGMA 1CZ1A 2O56A 3EAUA 3WDQA 2OYKA 1TE6A 2Q8XA 2NVCA 4NAFB 1M1BA 5U7SA 4RNFA 2XIJA 3STFA 2PF8A 4UTFA 1LCOA 5FAJA 1WO2A 3UG8A 5DN1A 1GPFA 1UZ1A 4C1KA 2W5FA 3DYOA 4WOQA 1OFEA 3CEPA 5JXQA 3N3MA 3DU0A 3MU7A 1O1HA 3OODA 4HN4A 1GUVA 2HK0A 2WANA 1OGGA 5CGQA 3CMFA 2QJNA 3PULA 1XFCA 1OT1A 1ITUA 2H8XA 5BRQA 5DY2A 3GR8A 3C4UA 4B3KA 2OODA 2HE5A 6TAAA 5I3IA 2J7EA 3CHFA 3MI3A 1ZCOA 3IAQA 2X05A 1W9VA 1EP2A 1KM2A 3TW7A 4JD4A 3S1UA 3VGHA 4AX7A 3G2GA 3VD9A 3NQ8A 1LOSA 3OG2A 1OFAA 4JYDA 3WEOA 4DNMA 1S5TA 1HFBA 4YCOA 6REQB 3WNPA 1F73A 3TIMA 4XQ6A 2OYLA 2ISWA 1SJBA 3BZJA 1H7PA 3WD0A 3WLKX 1SJCA 1W17A 5CQ1A 1EWEA 3QTPA 3C3NA 2DZTA 1VD6A 3TA6A 1GQLA 2FB3A 3LCIA 3F2BA 4CKQA 4UMAA 2EPKX 4MKVA 4NY2A 3LU2A 3VCRA 4BEQA 1DJWA 3VM5A 4F79A 3SDOA 1C90A 1UZHA 1TELA 2Z1BA 4GUGA 4ZENA 1YNYA 2C19A 1QPRA 1MDLA 4QG6A 3W7OA 2A3LA 4PN2A 2Z2BA 5MHBA 2E1DA 1EYEA 2CLFA 4ZBCA 4F0MA 3QM3A 4KIRA 2I16A 1CT5A 1UROA 5D9OA 4R3UA 4LCQA 3P7YA 3B9EA 1ZP3A 5HNNA 2J8TA 3Q4DA 4JDBA 3B0XA 3RGTA 1GYLA 1E3XA 1TA3B 1ISVA 4DBSA 3ITYA 1EJTC 3DCPA 3OZOA 2DSZA 1JYWA 1OADA 3VZZA 2J4GA 4P61A 3LBMA 3CIXA 1O5KA 4HIBA 3R0DA 3LK6A 1J0KA 3ZLGA 4I8YA 3WCZA 4O1EA 4HOXA 3PB2A 4BF7A 1B30A 3SJ3A 4C6LA 3FK4A 5G5IA 3LRKA 2WCAA 1Z3NA 4HK6A 3M5ZA 2NT1A 3WUBA 3M6DA 4GMEA 3GVGA 4AF0B 3GXIA 4WKHA 1RPXA 2V5KA 4NZJA 4ZQNA 1SZFA 4FF7A 2PWEA 1XIGA 4EKJA 1JZ2A 3O16A 3QVQA 1N8IA 2DIEA 2EJAA 3WENA 5I2UA 2MUCA 3AMCA 1KFEA 3ARSA 2DZVA 3P0WA 3WQGA 3H21A 4RR4A 1AODA 4JPGA 3TROA 2P3EA 1QO2A 1QAPA 1YE4A 3W7DA 3CM4A 3UCDA 1TTJA 2A3EA 4QSFA 3VGEA 4KGLA 1XGZA 3QY6A 5AC5A 3MV11 3BQ5A 3GHSA 4LV9A 1TTIA 1JDFA 2HS6A 4GE8A 3RDKA 3TLLA 2AAAA 1E5NA 3MV01 3QMSA 1L6YA 3W02A 1A3XA 1JI1A 2QUUA 4N02A 4W8LA 4DB7A 3E9AA 3NDOA 1AJ0A 2B0MA 3HV8A 4Q6XA 4ZOBA 1BVWA 2XIBA 3OZMA 4NAEB 1WXYA 1TKKA 3FOKA 4M6QA 1FFRA 3MZNA 1X1NA 4D8ZA 1V3JA 2ZUMA 3DZ1A 3QY7A 5CG7A 4S3EA 3MWAA 2DVXA 4LUJA 4GD0A 4GH3A 1NWSA 2J79A 2DP3A 3QPEA 1V0KA 3PSVA 2IKGA 3D6NA 4NU7A 3QLLA 1XSIA 4Z1YA 4ACZB 4GZIA 4DLMA 1MRQA 4KIEA 4D8LA 3ITTA 1A5MC 2YFNA 4AZCB 4WSHA 5E6YA 1EZ2A 4FB7A 3NQAA 1K4HA 2O55A 2ISDA 3UWZA 1DWAM 4E0CA 1EJVC 3UPWA 1S1PA 4WDXA 5KMYA 4A3YA 4KMQA 4US5D 3Q65A 4C5YA 3TQ0A 3OLIA 3MMDA 1Z69A 1WZLA 2GOKA 3WKZA 3W7LA 4OV4A 3W28A 3T55A 5MKGA 2YLLA 2NX9A 4M82A 1QATA 5E0CA 3M0MA 5A95A 5FF0A 1QO5A 3ZR4A 1RV8A 2CITA 2WWDA 1VCFA 2ISSA 1VQTA 3V1PA 1LROA 1HVXA 2PCEA 3WBAA 3BZGA 3TYCA 5C70A 1XR2A 2F6XA 2CHOA 1VBRA 2O9RA 3F7JA 4Q8VA 1G4PA 4W93A 1X7IA 1Q6EA 3TWAA 1KW1A 1E9YB 3HZ3A 4IFOA 3B0YA 4AZ6A 5D05A 4ROPA 3LCXA 3WSUA 2NXHA 1TREA 7ODCA 1GOWA 2CLOA 2HROA 3NQ2A 2PI6A 2OKOA 1OG0A 3LA4A 1SFJA 1WDPA 3P5YA 1A0DA 1KTCA 5D2WA 4HNTA 1KGWA 3VDGA 4KWOA 1JUBA 3VKDA 5I78A 4ZO8A 2GWNA 1F6PA 4YWIA 3EXSA 4JTGA 3S3GA 1GVIA 1NDVA 4NUWA 1CX9A 2V69A 4UCFA 4DJDD 3WFAA 1JFXA 1JZ5A 4IIBA 1XSJA 3S47A 3NOYA 3DECA 2Y8UA 3SRHA 5CG0A 4OECA 3U0HA 2ALDA 1R47A 2G37A 3N4FA 1UR1A 4PMXA 3QH2A 2IXUA 4O16A 2W4XA 2PWVA 2PC4A 5ABFB 1SPQA 3VKCA 5HXMA 4CNNA 4Q8TA 9XIMA 4B5SA 4DM1A 4QP0A 4LUTB 2GQ8A 3CV7A 1PEZA 1ADSA 4H7CA 4DXVA 3KWXA 4I5RA 3QPYA 3LS9A 3W86A 2C91A 4WK9A 2P8CA 3G1SA 3MCOA 1K03A 2I56A 5F1VA 2VWTA 1PHWA 3QQ0A 4IX2A 5H1WA 5KEZA 2PDJA 1VRXA 3G5EA 1IHIA 5LNWA 1XM3A 3E12A 3AZTA 4JTIA 4Q4RA 5A8MA 3SRKA 3UXAA 1RH9A 1SZNA 2QEZA 4TUFA 1FH7A 1Z89A 3ZJ7A 1KLZA 2PU1A 2BY3A 4PUDA 5LHFA 5AC7A 4Y7EA 1BKHA 3WFLA 1HJVA 5H6HA 4C91A 3PUDA 5F7UA 4GBUA 4AY1A 3GUWA 5HANA 4Z1AA 4DXKA 1DJHA 4A29A 3UGRA 3HJEA 3MYOA 1T96A 4LS2A 3CTLA 4WOZA 1Q6DA 4HYVA 2YZRA 4IXHA 1BG4A 1AVAA 3DHUA 3GHTA 4UFKA 5FJRA 3BE7A 4Q22A 2W9MA 3O3RA 4JQ2A 4AW7A 2VELA 4B15A 3R11A 4QS6A 1KKOA 4FOUA 2GJRA 2VL4A 2RDXA 2FZ8A 3BTNA 5I3HA 1F61A 4KEUA 1A0EA 2VX7A 3EKLA 3CL6A 1NWTA 1VCVA 4QISA 3RLGA 4GNVA 1LZOA 1UKTA 3CB3A 3MZ2A 3T09A 4PMZA 4LSBA 2NT0A 4IHCA 1UUMA 1NFGA 3K4DA 4GWEA 4ZQMA 2NV9A 4LAZA 1WAWA 2IKJA 1IZJA 1HO4A 5A6MA 3GTFA 3LEPA 3VIKA 2RHGA 3DFSA 3WH7A 1WB0A 2XIOA 4K2SA 5CC6A 4KH2A 1SFSA 1BVZA 3E0FA 3B4YA 1P1MA 2J75A 1VRDA 1TWIA 4HPHA 3T9PA 4JL1A 2ADAA 3PPCA 1XSKA 5D03A 2BLEA 3OLGA 1EEPA 4KFNA 2OXNA 4KWWA 3KUMA 3QXBA 3W2UA 4LYKA 3G6MA 3IUHA 4GKTA 3W2LA 3SGGA 4XX6A 1DHPA 1B9BA 2GOUA 2X8RA 2W92A 3M0ZA 1YEYA 2YBVA 1KFCA 1J5SA 4M1RA 1QOQA 4PFMA 1GOQA 1TJ2A 1DXIA 2NQHA 7CGTA 1YADA 2JBMA 5TF0A 2IPJA 1KO0A 2BNJA 2XU2A 5BXTA 4DJEC 2GJPA 4E2BA 3TYUA 1WDDA 1W3IA 1KTBA 4BQ3A 3QC0A 1UWSA 2HVNA 1V3LA 2CEQA 2F7FA 1XD0A 2PD9A 4FXFA 5EA9A 3W00A 2DT2A 1OWQA 3N25A 4LUSB 3AOFA 4AB4A 3DKJA 3WK1A 2W66A 4BI5A 3I6TA 4S3DA 2ZUVA 4DLFA 2TAAA 3HPSA 2UZ9A 3RIKA 2V0TA 3ZVIA 1Q6CA 2W6RA 3NXFA 1RY0A 3TEVA 4FPSA 4QCEA 1ZALA 1MWOA 4PMYA 4IWWA 1V0LA 2PLJA 5CBJA 3NO1A 5I02A 1TV4A 1JCLA 4O11A 3VVGA 4ONVA 2IQ0A 4POCA 1GWJA 3NCOA 4Q8QA 1Q5MA 5H8UA 3HF3A 3TZFA 4KKXA 1W9BM 1FTXA 3BK0A 5AOUA 2GPTA 4W87A 3A21A 2X41A 4JNMA 1XDLA 3I7RA 1VFTA 4FX6M 4G2DA 1RQBA 3NDZA 4O14A 2BSLA 5BZAA 3PZIA 3SCOA 2YDSA 1DVJA 4BEUA 1TJRA 3CTTA 2FZDA 2J27A 3L4ZA 4OE7A 4XZBA 1K02A 4LALA 3LHVA 1GOIA 3LHWA 2ISVA 2OEKA 1N82A 2PEVA 2TODA 4GIYA 5EMLA 1R3RA 5E09A 5AC4A 1TMHA 2YA0A 1OGSA 3MA8A 4CNPA 3TW6A 2FMOA 1SO4A 1YIXA 4F0SA 4LY8A 1SFTA 1UD5A 3HMJG 1UYQA 3N73A 4EPDC 2QT3A 3KP1A 3EBVA 2PLKA 1CB2A 1A53A 4Q4KA 3KCJA 3RRXA 2O7SA 4HA0A 3LGEA 3UJ2A 3S5ZA 5A69A 3A4XA 1XKJA 3PNUA 1PCKA 3VIGA 1A5CA 1DJGA 2Y7FA 1W9UA 5CC7A 4BK9A 3N9SA 1JD7A 4LB3A 1K70A 3PZQA 1DJIA 2FLIA 4HPGA 3CT7A 5G1MA 4KRTA 1OG6A 3NPUA 2VQTA 3N34A 3ZSSA 5DCEA 2XZ9A 1KD0A 1JDAA 1XLCA 4O19A 4JIEA 4UQDA 3O0KA 1NOUA 5DF0A 4PUWA 3BOXA 3HTWA 2XSXA 3GXDA 1QPOA 2ZX8A 3L0GA 1E5JA 2A6LA 5GQBA 1ONXA 4YJ5A 4G6CA 3W71A 4QRNA 2ZYFA 1VBHA 5A6TC 3V3WA 4CD6A 3LPPA 4P2VA 4O52A 2DZWA 4ZOEA 3CWOX 1UUQA 2ACQA 2B7NA 3D0CA 4HK5A 1DJXA 2ZRZA 2H9AB 3S6OA 4LW7A 2FHBA 3BGJA 5LA0A 1FRBA 1WPCA 3QPZA 2GSHA 1TZ9A 5HA7A 3AMKA 3TU9A 1OFOA 1WBHA 3QHMA 1EUNA 4HTBA 3W7KA 3P8JA 1IIHA 1X6LA 4FR1A 2H3DA 4MM1A 3FHAA 1A47A 4OFCA 3UZXA 3HMCA 3T08A 4L64A 3SUTA 5EB8A 1G01A 3W1RA 1ENUA 3CBWA 3W07A 3N18A 5JH2A 2ABBA 4LV4A 1ZRQA 2WNZA 3EDEA 4JN7A 1JCTA 4PCSA 3MUAA 1P0DA 4AZGA 3NL3A 5GNZA 3W83A 3DBPA 1Y7VA 2YB1A 3UGVA 4RCXA 4WXZA 5J5RA 2J7GA 3KVMA 4YTRA 3T0AA 2Y88A 3WD2A 2RGLA 1AG1O 3I65A 5L6UA 3MT1A 3RILA 1J0IA 1XV8A 3J7HA 4JY9A 2VZOA 3MW7A 3SO7A 1CI1A 3N1AA 4G7FA 2CLMA 1KA9F 1UD2A 4J3TA 4Z0SA 4CN4A 2DJLA 2GJXA 3R58A 4M81A 5FJOA 2HPMA 1GQNA 2RH9A 1VIWA 5F1UA 3CAWA 4CNOA 4JX6A 4MAVA 3SFKA 1IZKA 2PGRA 4GI4A 4UTTC 2PAJA 2ZVRA 4QE1A 3MKCA 2BHUA 1PXGA 4A8RA 1F5ZA 1VKFA 3EA2A 1X7FA 3GFZA 4IG2A 1GKQA 1UH2A 4F4RA 5XIMA 4XZLX 3EDKA 4A22A 1EHAA 1W8GA 3UQNA 2Q01A 3EPNA 2VCAA 5GJMA 1BXBA 1I1WA 5ECUA 3NSNA 1YPFA 2O9TA 3PP7A 4NI3A 1VFFA 4DJDA 1ELSA 1ISWA 3KS6A 3F2DA 5D02A 5CPQA 2GSEA 3H7RA 4IFKA 1R87A 4C6CA 1ZBKA 2DZXA 1G0CA 1EGZA 3IVUA 4DF0A 3W26A 5TBOA 1I45A 2QQ6A 3A3WA 4JTKA 2CW6A 2DUXA 5FCZA 3FJLA 1VS1A 3NJ3A 1R7AA 1IR2A 1TWDA 1AW2A 1MMFA 4O0KA 2J7FA 2WHKA 5LSMA 4S38A 3REQB 1MW3A 2PA6A 3KDNA 1OF8A 1ONRA 3NEVA 5C8BB 2O7QA 3C3UA 1XLBA 3NL6A 2Q6ZA 2YB4A 3IGHX 3EOSA 4G1NA 5K2ZA 3TXVA 1MI3A 1B4EA 1RP9A 4DVOA 3OZYA 1UKOA 4U3AA 4X60A 1GOOA 4G7EA 3HIJA 1CGXA 3MUIA 2I9EA 4PMRA 3V5FA 1VFLA 3ARYA 1AQMA 3VIIA 4FAMA 1GCYA 3QFEA 2Y85A 4KF1A 3AALA 4XZIA 2FTWA 1WXZA 5HPCA 2E8YA 2GVLA 3HG5A 1NM9A 2YL5A 2QAPA 1FHUA 1UP0A 1HW6A 3TTOA 6A3HA 2XSBA 4QG9A 4K39A 1S5WA 5AYBA 2ZKMX 2FH8A 2HTMA 3VAVA 3KE0A 3VE9A 3IK2A 2E6YA 1XCWA 4RDWA 4LTSA 3HG3A 2FQIA 4M8UA 1AH3A 3EYPA 4NZ1A 2E40A 4JKKA 1MXSA 4OVXA 3BAXA 3VKKA 2XZ7A 1KCLA 2PGFA 1A49A 3WMCA 3AWNA 3KHDA 1CBGA 3CL8A 4QR6A 3QJAA 4IL2A 5EMYA 1UKSA 3G1YA 1O12A 1IR1A 1DJYA 4YLWA 3THUA 3BXWA 3L2IA 3CXOA 1XHGA 3WUEA 1P0EA 1SZGA 1PKYA 4W86A 1ONWA 1CGUA 4H7VA 4DWDA 3M1ZA 2H8ZA 3VX1A 3BMXA 3GAYA 1NVMA 3CPGA 2O0TA 4ENLA 4E4FA 2WYSA 3TAOA 2PDGA 1NWUA 4CQBA 4LB4A 2NWSA 2GYIA 3UXKA 3EX4A 3M46A 2WMKA 1GKPA 1ZQ5A 3CAKA 1WZMA 4HU4A 4A3HA 5DMNA 3L21A 1UIPA 4U28A 1BSIA 2J25A 3B8SA 4H9XA 3W76A 3FGCA 5BW6A 2OT0A 2VMFA 3CC1A 4LUTA 1CXLA 2E25A 1O5RA 3KOFA 3KL3A 2CFFA 4RKAA 2DVTA 1K8XA 3MQTA 3OGSA 2XUCA 2ONEA 2ZX7A 4YS1A 4UOZA 3CHDA 4O4WA 4IQJA 1CXKA 4OQVA 4OOUA 4QCFA 1ODUA 4PMJA 1EQPA 3P84A 1TPH1 4F3HA 1EF2A 1NTHA 1Y0EA 1OYBA 2UY4A 2Z25A 3HV9A 4B2DA 1XH2A 3K1DA 5BWAA 3BURA 5I00A 1ZJIA 3BH4A 4IJCA 2PGWA 5M3WA 3VNYA 3CIWA 3CAQA 3LRLA 4RXFA 4EE9A 1LYXA 3TK7A 3TMQA 3H53A 5JBFA 4WSJA 2Y70A 3PZGA 4UMCA 3SN0A 1HJUA 3VGFA 2WMIA 3G77A 3TH6A 4QSHA 2Q8ZA 1PAMA 3BQ6A 4IJRA 1OFQA 3PUOA 4AXKA 4H00A 1AJZA 5CCZA 1FP8A 1Q6GA 1VEMA 3R5EA 4KWSA 4ZQCA 3C0LA 4W7VA 3KXQA 1XYZA 3AYRA 3NQFA 3C2EA 2VRJA 1H5YA 4GNKB 4L7ZA 3MP4A 3E0LA 2VEPA 1BPLB 2PWUA 2VX4A 4ZTYA 4J5NA 1KM1A 3A5FA 4BWLA 4M5PA 3OLDA 4KW2A 4Q7IA 2PTYA 4HHLA 1H7XA 3WZ0E 1T99A 4D6FA 4DYJA 3WMBA 3ITOA 4GXMA 3WUFA 5DXYA 2OCZA 5DT5A 1XLLA 3EWZA 3G18A 4ZA0A 4NL1A 1QI0A 3OYZA 3WLTA 4L9ZA 3ZSTA 1H1NA 2WHMA 2OGJA 2OJPA 1GW9A 5DCBA 1LRQA 1EGMA 4KQNA 3LLDA 4M6VA 4U10A 5AB3A 1FDYA 8A3HA 3WBYA 2LLEA 4IFRA 1Z32X 1BYDA 1WBJA 2WHJA 4S2BA 4LCRA 4JTFA 3W7MA 1XPYA 1TTQA 2Z0IA 2J9XA 1K8CA 2ZQ0A 5AFDA 3WLHA 5A8GA 4K1WA 3KFTA 1LUCB 1ZP4A 3GVWA 3WBEA 3NDYA 3HQOA 3W01A 1RD5A 4AWSA 3SRFA 3WQDA 4HNNA 2WSQA 3E2VA 5JVLA 2RGMA 3SI9A 3ZWSA 1OVDA 4QEHA 1GGOA 3PZNA 1GVRA 4PTVA 2FZNA 3MUZ1 1U33A 2RDWA 1JIBA 4DBWA 1ZAJA 3N04A 4XAZA 3T42A 5JBDA 2QZRA 1WV2A 3PUEA 3TJIA 2GQAA 3CLWA 1LQ0A 1UZDA 3PTQA 1BG9A 1D8WA 1ML1A 2B7PA 4I6VA 3IUDA 1RJRA 4YIWA 4FLQA 3C8NA 4NYUA 3L4WA 1KCKA 2ZDSA 3OBAA 3SB0A 2YXOA 1DV7A 4FA3A 3RJYA 1M68A 4HSOA 4PZVA 1WNOA 3EB4A 5FJJA 3C61A 3EMZA 3K30A 1H4PA 3TUUA 1O5XA 1UG6A 4S39A 5T8GA 4EIVA 2ZIDA 1EJXC 2J8GA 3T4CA 3H2OA 1YXDA 1G4SA 4ADTA 4YVPA 2OEMA 3AIEA 1EGVA 2Z4GA 5J04A 4NZ4A 3BLEA 3IJ9A 4JL2A 1OGBA 4H9VA 3NR0A 3VKBA 2PDPA 3BOFA 4Z2IA 4CD8A 4JX4A 4JHMA 3EOLA 1QOPA 5I07A 3WLIA 1IXNA 2FPVA 3GZAA 2W63A 3WLJA 3D46A 3ALGA 4Q8UA 1KQZA 2EKGA 1QI4A 2C16A 3C6CA 1L6SA 3AJ7A 4R53A 3URAA 1ZL1A 4A3RA 1PWMA 3T1GA 2ZUUA 1A4LA 4YPJA 4AD5A 3TSMA 4GG9A 2R91A 2RUSA 3TN6A 5DRIA 3C2RA 1XLFA 4MY1A 1SVDA 2XFFA 3BANA 4NRRA 4CCZA 2E28A 3FAXA 1QW7A 2A2IA 3ZJ8A 1UOZA 4ATDA 2PDHA 2EPLX 1B3OA 2BY2A 4XAYA 1LRNA 1A50A 1RJQA 3OIHA 2OYMA 4XSMA 4HN8A 3VOJA 4WY0B 4DELA 3CK5A 2ZZ1A 4I7UA 3WQCA 1EL3A 3WQVA 4CUCA 3B8IA 3QKEA 3OTRA 1ISXA 3SBFA 3MWCA 4UTMA 1XG4A 1HQTA 1V93A 4LYQA 1XG3A 3F03K 4L1WA 4JXCA 2Y5SA 2OMAA 1U22A 3CQHA 1NOWA 4N9BA 1XX1A 3T0DA 4GABA 4X9SA 1U83A 4MZYA 3RG6A 3WF0A 1QK2A 2X7VA 1XIBA 4AHQA 4CGTA 4AIEA 1AD4A 3WBWA 4KCVA 3NZQA 2QJHA 3TONA 3LHZA 3CUFA 3CMGA 5HJYA 1K9FA 3GD6A 4QG8A 4AC7C 1QDSA 2DT0A 4ACZA 4NNAA 4HMNA 1E1CB 3WDIA 1LBFA 3N6JA 2OSYA 3GU9A 4YN5A 1F4AA 3RITA 3UYCA 1H62A 1BQCA 4OUIA 4JTRA 5K9XA 1UWIA 1AA1B 1QPQA 1GG1A 4XIMA 2GK1B 1QR7A 3IIOA 3W7RA 3F5KA 5CPOA 4BCEA 3N4EA 4WY0F 4LAKA 5CSUA 2NWRA 3VDCA 3L0NA 4PRRA 3SFWA 3F4CA 2ISFA 2GUBA 4QEEA 4N4PA 3TC6A 2VQUA 4PUJA 5A94A 2VDIA 1NJJA 4ADUA 4QTGA 4EXBA 2W3ZA 4A3QA 4P7NA 2X7WA 4M24A 5A6BA 2WSRA 3TP4A 3SN1A 1X8FA 2BGQA 1EJRC 1K7XA 3PY2A 2PBGA 4OU1A 4KWUA 5DT7A 3IV3A 3VKJA 3TKFA 2JGQA 5TQLA 3HJZA 2QPSA 4P8VA 2VHLA 2QDDA 3L0KA 3DAQA 1JUEA 3LUTA 1UA3A 3VOGA 3W1UA 2QIIA 4D9PA 3CYVA 4ZB5A 4GVIA 1W54A 3U2EA 5FI8A 4NT0A 3VU2A 1NEYA 3RM9A 1GOXA 2IKIA 1EDTA 4Y8EA 2Y6ZA 4I5UA 2V3FA 2Z7GA 4XKYA 2X2YA 3QRHA 5FIPA 2VEKA 3LTPA 5ECVA 1BKSA 3SCPA 4PR4A 4AMAA 2ZUNA 1ZNNA 3UP8A 5A6JA 1V02E 2PDQA 4G5DA 4H04A 3MP3A 1EP1A 1SZRA 1EF3A 2REQB 5F4SA 2ZRYA 4DO7A 1MW2A 3OBEA 1GHSA 3NSXA 4CU6A 4GCAA 5HQMA 4PMVA 3SCNA 2V5DA 2DUZA 1C91A 5DX7A 3LYEA 1AK5A 4J3XA 5IDZA 3KW3A 4AD1A 1JNDA 4AVNA 1T8XA 4O50A 2QLYA 2R94A 4MG4A 3NSMA 3TR9A 1EJUC 4EWJA 2C0HA 3VPLA 1ZENA 1HUVA 4PC8A 4TO8A 3A6OA 5JUVA 4MDPA 1VR6A 4TMBA 4GC3A 4Q6JA 1W1IE 2X1TA 1TIWA 1WCGA 5EMKA 3WLOA 3EA3A 3R0KA 7PTDA 4GVGA 4FHAA 1QK0A 3UNDA 4YVXA 1UR0A 3UU0A 1V0NA 4QGCA 3KM8A 2OO6A 3S5NA 5E6ZA 1A3WA 2NQLA 3U4FA 4JCLA 1D9EA 1ZUAX 1GTEA 4DN1A 2G41A 5JIWA 4NJJA 3T8QA 3DFTA 1Q65A 1X39A 3LQGA 4GYJA 2EF9A 1NY1A 2EG8A 2WKJA 5F4XA 1F2JA 1B5TA 2BOGX 3ZT5A 2CBIA 3FXGA 4NZ5A 2P76A 3K2GA 4Q4QA 3GNRA 2E5DA 4HPJA 4AWTA 3OB8A 2YCLB 1VFSA 3LSCA 3F4VA 1O7AA 3G3MA 2JFEX 2WVSA 4XZNX 1PX3A 2E9MA 3W53A 3ATZA 2GQ3A 5ABGA 5HDRA 1E70M 3PBVA 3UZZA 2ZX6A 1LM1A 3ZS4A 1XLMA 5JMUA 1XQKA 2QGHA 1TZ7A 2J8FA 4I5XA 5MKGB 3GWQA 5G2HA 2F6UA 1MFUA 1OIMA 2J9ZA 4AWUA 4K8EA 1JXJA 2BVWA 1EOMA 5A6SA 2Q8LA 1S2TA 1Z6KA 4PMNA 1PTGA 3WLPA 3XINA 1Z7AA 1ZBVA 1IWBA 2R1NA 3FLUA 1FUYA 4XD4A 2VENA 1HKMA 3M43A 4LBSA 5LGXA 1KFLA 2D0FA 2DH2A 5EMUA 1THFD 2PD5A 1UD3A 3CZKA 4UZUA 3SAZA 1DEDA 3L23A 1TJPA 1K3UA 3U8GA 1AL8A 2MNRA 1E1EA 4MMWA 4ORMA 1RBLA 4MJMA 3KBJA 1W2VA 4UTLA 1RZMA 2G3JA 2RDUA 2IW0A 3V36A 4OWGA 4CQCA 4IIFA 3QTGA 1EXPA 3H4XA 4QNWA 4EPEC 3E49A 4XZ9A 3BW3A 3P0XA 3G1XA 4IFKB 3QSRA 3PFMA 4GVHA 1Y5VA 5AZ1A 2NXGA 1TPC1 4UFHA 3W2JA 4JQAA 4ZSUA 1G9HA 5DCDA 1UH4A 1EJWC 3W27A 2NQJA 4UOQA 4N4QA 4M7TA 3LNMA 1EIXA 3EX3A 1YDNA 1G1YA 5C54A 5I03A 4MYXA 3R43A 2WPGA 1OSEA 3KCOA 3NPWA 1HKIA 3FVDA 4N2YA 5HINA 1AQFA 4JIPA 4QIUA 4NVTA 2PFHA 4JCMA 1QPKA 4YTTA 2DW7A 3LX9A 5JIPA 2FTPA 2X30A 5F2GA 3W70A 2QCNA 4QE4A 1PX4A 3W87A 3SRDA 2Z27A 1A5OC 2E9BA 4HPNA 1CNVA 3V0TA 3TOPA 5E1QA 1OX5A 2D2GA 4GJ1A 5CKSA 3DYPA 1W9DM 1EDGA 4QDWA 4PCTA 1AH0A 4QJ1A 2YCEA 4OHQA 4OKDA 1H50A 1TRIA 1GHRA 3LG3A 3MY9A 4KEZA 1VJZA 2NLIA 4JFWA 3V4BA 3PG9A 2OVLA 1I0BA 1MNSA 3W24A 4G7EB 1O1ZA 1LQ2A 2EG6A 4NYYA 3WL1A 1UP2A 4B3LA 1OC7A 4PMQA 4XVEA 3I7QA 2C71A 4N42A 6PTDA 4NRSA 1L6GA 1XIFA 4Q3MA 4AG0A 1D3CA 4MVAA 3W7JA 2OQYA 3THAA 2PSNA 1BLIA 4ASTA 4UQBA 2ZC1A 4A8LA 3WQ5A 3C0JA 3ZT7A 3GXPA 3VOFA 3P60A 1EOKA 4L65A 5KZ6A 1XP3A 4AIOA 2ZE3A 4IUOA 4I90A 4UIOA 1GJUA 5CEWA 1CGYA 3DIPA 1WE5A 1L2UA 3BGGA 3H2FA 3QLDA 3PR2A 3N6HA 3GH4A 3CIVA 2H3BA 4KBXA 2YA2A 2Y61A 3U7BA 1XLAA 4DJEA 1S3TC 2RJGA 1VP5A 1R0MA 3TZNA 4CCEA 2QCGA 3I6EA 3NIYA 1V0MA 5CBIA 5E93A 2XVGA 3R12A 3O0FA 4LNCA 2R1PA 3GXTA 3LMYA 1R3VA 3KTXA 4MFEA 4MWAA 4QLJA 3A4JA 2ZZ7A 1IZCA 1R3WA 4K7VA 3EX6A 1RCOB 2EBNA 3GNOA 5HMEA 2WNWA 5EMJA 1ICSA 1TV3A 1YXYA 3T40A 3DFPA 4HMEA 1BF2A 3QYQA 1GNXA 3M0XA 1Q7ZA 5KINA 4UQ9A 3NO3A 3VILA 4MDOA 3EPMA 1L0PA 3VUSA 4TX9A 2EPNA 1R46A 3NVTA 3R6IA 2E5CA 3FA3A 1E4NA 3PBYA 3W7HA 1K8ZA 1W1VA 3K5XA 1HX0A 4DHGA 4GXPA 1E0UA 3S0CA 2CBVA 2P1FA 5LGZA 1RHCA 2OOGA 1UD4A 1MQPA 1OX6A 2DZAA 4JTUA 1XJBA 3NYZA 3MJMA 5CGMA 2ZX5A 4S3JA 4YU1A 1JI2A 4DBUA 1EBHA 4PMDA 6TIMA 4AEOA 2WXDM 2GGEA 2CU0A 4K8HA 3WQEA 1EJ7L 1BEUA 3G1VA 2ZE0A 5AVHA 3MHUA 1C7TA 5BOOA 3V0UA 4Z1DA 2BFGA 4MSSA 4CCDA 4PL2A 1NFPA 2J78A 2V5LA 4PA8A 4XBSA 2PRMA 5D2VA 4F40A 5IFPA 5I3DA 1GQKA 4HSNA 4ZOCA 1XLKA 2XGBA 4S3GA 1C7SA 1TB3A 4C6NA 2DGAA 3GNNA 3WF2A 1FWTA 3BCFA 4IMGA 5AC8A 4UQAA 4NSBA 3SY8A 3O1NA 4HKPA 3E96A 5C7HA 4D6JA 4D6HA 2BY0A 4X63A 3CZJA 2PGEA 1OC5A 2GGJA 4Z2LA 1V8EA 1NF7A 1H5VA 1SU5A 3NZ1A 3NTYA 3W6MA 1ZJAA 4LFYA 4FNUA 1I2OA 1KKRA 3RUBL 3R89A 4LUYA 3WYZA 2JGYA 1EYWA 2FPTA 5HNTA 3QMTA 2QULA 3UD6A 4PTWA 2UY2A 3GDTA 3VC6A 1A5KC 3TYZA 2P53A 2ZA2A 1DIOA 3PZUA 3N2MA 4QNEA 1OD8A 3HPAA 3VD5A 5I24A 3E0VA 3STEA 5F2IA 4JTSA 2J7HA 3HPFA 2Z1KA 4TV6A 3GDRA 1LLZA 2GVEA 4JYEA 4X2PA 1EDQA 1VHNA 4GGBA 1MQRA 1J4EA 2BHZA 3KVKA 2D1ZA 4HQVA 3LBCA 3AFBA 1R2RA 1EZWA 3TCSA 3A64A 1V79A 4UOJA 3UZJA 4AQLA 3HURA 4MKSA 4MB3A 4O8RA 1YTKA 3W1PA 3R8RA 4PGLA 1B9ZA 2G97A 4BY3A 2XFYA 3AHVA 4AHOA 2AL1A 5BMXA 3NPVA 3PUGA 2WOQA 2PDXA 5F2MA 3UCQA 5BWFA 1RXOB 2QVNA 4L9XA 1RAKA 2QXWA 3MJYA 2NSXA 2PDUA 3OVGA 1REQA 3INPA 2XH2A 5DXXA 1RA0A 1MRAA 4K6AA 5LIUX 5M1TA 4E5TA 4IIGA 1M41A 4AD4A 1JZ4A 5D32A 2EGZA 1FQ0A 2C6QA 4D2JA 5CSRA 1WKFA 4IPNB 3RN6A 4MB4A 3P82A 3R13A 3BV4A 3S9ZA 1NFBA 1VFUA 2QPUA 2WQDA 1GZGA 1UMLA 3G8EA 4AZ5A 4E38A 2CYGA 2HSAA 3LZ3A 1DYSA 4NXSA 4DBEA 5LKYA 1U1UA 5A6BD 4JEQA 3EEGA 4IISA 1M9HA 3NAVA 3PHAA 3WN6A 4NF7A 3JS3A 1FKXA 3MVIA 3ZVHB 4MOZA 3B04A 3B06A 3LHUA 2GDVA 1R5YA 3TX9A 5KITA 4H7ZA 3IGSA 3K1GA 3PZTA 4Q4MA 3EA1A 1WOAA 1DKWA 1Z9AA 1LWJA 1UJPA 3N9RA 2C8NA 4H6RA 4ZR8A 5A3HA 1QI3A 1H1ZA 2A3CA 1RCXB 4QDMA 1EO7A 1IXPA 2DT1A 3BWWA 4IJBA 3TA9A 3UR7A 4UR8A 2FGLA 3KOYA 1D3HA 2A5HA 3WG6A 1S46A 2D23A 3BLOA 3VM7A 2PDWA 3MSRA 3M0LA 4GC4A 4MJZA 5FEPA 4UXDA 1KC7A 1W2PA 1JFHA 4EPKA 4O15A 2QNEA 4R27A 3E38A 3BCJA 2OX4A 3W88A 4O1AA 1Q6RA 4Z1BA 2A6NA 4PTMA 2ZXQA 4RNHA 3ZMRA 2X42A 1MNZA 3M07A 3R4IA 1X6UA 3AIRA 2V2DA 1DTNA 5I3KA 1UMYA 2PDYA 3AIWA 3ARZA 3GYCA 1F7BA 3S8HA 3GG7A 1RBAA 3MUY1 2PP1A 9CGTA 2OLHA 4QROA 4EPBC 2EQDA 4P7QA 3V7PA 1X1ZA 4JTLA 4E8GA 3TOYA 1GORA 2C1GA 4CVUA 1V03A 3SECA 1FWBC 3AIBA 4GO8A 2OZ3A 5G4WA 4GA8A 1I0DA 3UWQA 1RK5A 4UR7A 3W7EA 2YR1A 1FWJC 4FNSA 1I75A 1QNOA 4AD2A 1UR9A 4J2MA 2IS7A 2WMGA 3VMNA 4LAMA 2OKTA 3ZLFA 1ECQA 3WQ6A 1ME9A 4QAIA 1PV8A 3M47A 4OBRA 1OCBA 3GHRA 4N9EA 4LCSA 5A1AA 2AL2B 1NQKA 4BZYA 4Q4SA 3DESA 4C6FA 1HL8A 2ZZ6A 1OY0A 3BAYA 1KM4A 1BHGA 3BG5A 4O8AA 2ZXDA 3IJLA 1A4MA 2WQPA 4DX3A 1IIGA 2Z6JA 4P7LA 5CZ0A 3USBA 1LTDA 1XIEA 3PVFA 2CWNA 3SCSA 4PUUA 1TO3A 2OLSA 2ZRWA 2ABAA 1S2AA 3DEQA 1EKOA 1W1YA 1LLOA 2G3MA 3SCWA 3QHNA 4PUNA 3LCLA 3T78A 2C0AA 3S5OA 3NM1A 1VYRA 3OJGA 1W1ZA 5EL1A 4XB3A 1E0XA 1YNPA 3VFCA 4N7QA 2FZMA 1JPDX 1C92A 2HK1A 5M2FX 4CD7A 4JQ3A 3ARUA 1W37A 3VNJA 3D3FA 3BC9A 3TCEA 4PCFA 4DZIA 1KR1A 4W89A 3MHFA 4GX8A 1DP0A 2IKHA 2WSKA 4C6KA 1X97A 5J8LA 3WD3A 1XYAA 4XIAA 1B1YA 1XIHA 1KFKA 1GZJA 5C55A 4CN6A 1E43A 1Q63A 5CH9A 4DUOA 2W27A 2B81A 1FY6A 3NQVA 1E40A 2VKZG 2ZOXA 1B0IA 3FV9A 3CUHA 4IF2A 2VR4A 2VTFA 2JEQA 5I23A 4XTIA 3THQA 1GVFA 5CAKA 1I2QA 3H2AA 5ABEA 2ZZ4A 1J8VA 1HJQA 5TNVA 4JIRA 4GZEA 3W72A 4E4PA 1WA3A 5AHLA 3P93A 3U9IA 4FOKA 2QVHA 4UNLA 1JDEA 3KZSA 1HXJA 3BLIA 3TQVA 4WLCA 3UR8A 3LTSA 1E15A 1A5NC 3O7UA 5D9NA 4KT2A 2NSOA 4O4VA 2PDBA 1XBZA 4M3PA 1XLDA 1Q6LA 4W9TA 2OZ8A 2OFJA 4QJ4B 1EJSC 3BPWA 4Y9OA 4RZ5A 1V02A 3WLSA 2FH6A 1VLWA 3U57A 1R2SA 2XWEA 3ITGA 3EOUA 1C8VA 4LVFA 1O60A 3VGGA 1GOKA 1OC6A 5AY7A 1S39A 5HMSA 3MHGA 2QCEA 4E2DA 3BUVA 4H1ZA 2YL8A 1MXGA 3PS7A 3T0BA 1DXFA 3Q58A 1POKA 1JDCA 1FHDA 4L4LA 1Y5WA 4O1FA 3I6RA 2C79A 5H8MA 4U3CA 2DSKA 2HRWA 1KWKA 2AQVA 4HYWA 1XIIA 1J93A 3K13A 4A21A 4DO4A 4F9DA 2PWFA 3OHIA 3T81A 3C0SA 3BLDA 1CENA 1XYBA 1IEIA 3LQLA 1QBBA 1MW1A 3NNTA 4UTHA 5CGTA 4KERA 1X96A 2VCBA 4GGHA 4LUIA 9RUBA 2PDKA 3N29A 1W3LA 2AKZA 2QF8A 3LNPA 3AIUA 1OCJA 3MO4A 1I2RA 2WO5A 1PZ2A 1UR8A 5HATA 3L65A 1G69A 3H22A 2FFCA 1PB0A 4Q32A 3WD1A 4DZAA 1EP3A 2D0GA 2C3ZA 1LT7A 3UZWA 2E9LA 3N15A 1KRAC 3CUJA 4IMDA 2ON3A 3NZPA 1Q13A 3ISIX 1W3JA 1MXDA 4H6EA 3DFYA 3DC0A 3EWYA 1S5MA 4PB5A 2Y8VA 5KETA 3BLFA 1FXPA 4CLMA 2P88A 4X9YA 1I2PA 3QV6A 3SCVA 3KP0A 1RY8A 4A2RA 3BW4A 4ZGYA 2I5QA 4YTUA 2QYGA 4B5TA 4WCJA 3FJ6A 3M5YA 2DSUA 5IM51 3N9KA 2ZA1A 3OIXA 1B3YA 3PTMA 5FAGA 3F5JA 2E0PA 4QS5A 3CGTA 5LIWX 4K38A 2VGBA 1H0GA 4YXGA 3PG8A 3ANYA 2VDGA 4GIEA 3E3HA 2WZEA 3UY7A 3QBUA 1TV7A 1UWAA 1V6WA 1XLHA 3M64A 3UW6A 1XYLA 4GPNA 3LHYA 4JDYA 3ELFA 5CJMA 3CQJA 3UWEA 3WK0A 3RCNA 1UWTA 2EKCA 1GONA 1MEIA 4YMZA 2BVDA 4W4QA 3QR3A 3BAJA 3B9OA 3F4NA 1LG1A 2QCCA 3O9NA 5CZJA 5K3VA 3W75A 3WNKA 3MDUA 4DJFA 4DY1A 1U2YA 5CC5A 1NQ6A 5HK4A 3P3BA 5A5WA 2XISA 1F05A 1Q85A 3SCTA 4L56A 3SJNA 3ARPA 5DMLA 3NZRA 4IP5A 4GCXA 4H3DA 1KLYA 3S83A 4O0QA 4P8UA 3M5VA 1NDWA 1MUWA 1VF8A 1YMYA 3GO2A 4US6A 1XH0A 3H8AA 3THCA 2Q3RA 2NQ5A 1OT2A 2V81A 5HOSA 3MBFA 4YNGA 3KBSA 1H41A 1G7UA 3QR1A 1QXLA 4P7RA 4HHPA 1LL4A 5GVJA 4MUZA 1YQ2A 4LPCA 5KZDA 4F0RA 5EBAA 3U4AA 4GQ0A 2CC0A 3UT0A 1GKRA 3K8KA 4RE0A 2D73A 2E6FA 1W5NA 2X1RA 4JKMA 4J7RA 4QAWA 2Y5EA 2W62A 3VFLA 3PZOA 1XQLA 1DORA 3VX0A 1SR9A 3HQPA 1LL7A 2VD9A 4JBRA 4GYFA 4RE4A 4J3ZA 1XUUA 4BR1A 2GWGA 3WQWA 4TMCA 2ZWZA 4O0ZA 1OZQA 3GW3A 1VEPA 3NQCA 1DJZA 2YDQA 3ARXA 1AW1A 1PTAA 1W32A 2WC4A 4GQGA 1RP8A 5K4ZA 2DIJA 1XLIA 2CHRA 2BASA 4HNVA 4YVVA 4CNSA 3L66A 2J24A 2G8ZA 1OCNA 2YOCA 1JL8A 3II1A 1ZU8A 1H61A 4JTTA 4WX2A 4ZZ9A 1S38A 4Z0JA 2J6XA 3AMDA 4CQDA 1SYTA 2WB5A 4E6MA 3P2VA 2HBXA 1XYMA 5REQA 3PWAA 5HJXA 4ZSTA 4NG3A 5EMMA 2YCIX 4Q8NA 1D7FA 2WBGA 2HZGA 3M4HA 3STCA 2XH7A 1RR2A 2DPEA 2RAGA 3IIVA 2F9RA 1QI5A 2CZVA 4XKYB 3VZXA 2AQOA 4D6GA 3UPMA 3PBGA 3HG2A 4GFIA 4L9YA 3RFAA 4PBFA 3EWCA 1D2KA 2WLYA 3AHTA 4RV8A 3L4UA 1J0HA 1PE1A 2E09A 2YCJA 2XWDA 4GYKA 1UC5A 3QGAC 4LANA 3AO0A 1OF6A 3BG3A 2QDGA 2OELA 1F07A 2A1YA 3G1HA 3I3BA 4D8AA 4GI8A 5G1TA 1W9PA 4QQUA 3JRKA 3EWBX 2W61A 2VFDA 2CXGA 4LF1A 3UPBA 5D09A 3CB8A 4ACYA 2YDRA 1YBQB 4JN8A 3O2LA 3WO8A 1N8WA 4QX4A 4MWAC 1QBAA 3PM6A 4F66A 2QIWA 3EMQA 3DC8A 1HO1A 4IIEA 5HQLA 3T6CA 3MBDA 2X16A 4DIAA 1YKWA 2V5BA 3KVLA 4R33A 1W8SA 4URIA 4L61A 3OPSA 1YPIA 2VDHA 1JGMA 1BWVA 1TRDA 3DFQA 4K37A 2DVUA 1AL7A 4FNTA 3BDKA 2XVPA 2XINA 4M29A 3FYPA 1WX0A 3FVMA 3GDLA 2OSXA 2GJXB 5LNUA 2D0HA 5HUOA 1FCUA 2DT3A 1FCVA 3AXHA 2FGZA 1O5QA 4ZE4A 1KGXA 4QXIA 1D3GA 3DHDA 4S3CA 2Y8KA 4WKFA 4LT9A 3CQIA 4O1CA 2Z2AA 4ES4A 1JYVA 1V3KA 3I3DA 5LIKX 1C8YA 3LCWA 1F76A 3GAKA 4Q4PA 3FJ4A 1TUFA 3UF9A 4IGSA 1EIBA 2WZMA 4WUIA 1I60A 3VIFA 1JF5A 3L4XA 3W4RA 3G1DA 3L4YA 2VM8A 3P80A 3TJ4A 3MKVA 2BDQA 1VCGA 4LVAA 4NNBA 4GQRA 1WDSA 3VIHA 3E2RA 4OUEA 2OSWA 1VYSX 3VE7A 3Q37A 2F84A 1S5VA 3CHEA 1ALDA 3T0TA 3DI1A 3S1XA 3B0VC 5C2XA 1PIGA 3TXZA 7ENLA 2YZ5A 4TVCA 1V3HA 4LEQA 1EO5A 3RO8A 4U2YA 1EC8A 3B9AA 3A13A 4R9XA 1S3HA 3ARWA 4KEMA 4L5ZA 4FX7A 1R8LA 1Z42A 5EYWA 4A8NA 3WBXA 3V1HA 4LQ1A 3O6DA 2Z1VA 1TSIA 1BRLA 1PX8A 1XIJA 1O6IA 3QF0A 3GVQA 4IM4A 3VI2A 1DWFM 3DHPA 2JKEA 4DF2A 5C9RA 1OFBA 3HN3A 5HWMA 3WDPP 1T0OA 1W1TA 5DLCA 2EPOA 4MHBA 1VJSA 3NM3A 3FYOA 1XUZA 4C65A 3I4EA 1B4KA 2GUUA 3CQ0A 2WLZA 1YDOA 2E4TA 1ZAIA 3U5YA 2WM1A 2CHNA 4IMEA 4G1KA 2OR2A 2FDSA 5AZ0A 3G24A 3GC2A 2GVGA 3PK7A 2FFIA 2UV8G 1L6FA 3Q45A 4M1BA 2QHAA 4BI7A 4RZ4A 3PNZA 2XN1A 4F0KA 3L2LA 1KBJA 4JAWA 4LBRA 1TCMA 4QBXA 1KM5A 1PZ0A 3TE9A 3VYLA 1ITQA 4O53A 3WNMA 2HISA 4Y2WA 3NEHA 3TFCA 4WRHA 4AIBA 1E0VA 4LC6A 4LU0A 3T2PA 3C0QA 2QCLA 4H8NA 2EJ1A 5FEXA 1EHNA 2QDHA 1SJAA 1UR4A 3GIYA 1W1A1 1B57A 3W2MA 3QY8A 4QQ3A 4V27A 1YPXA 4L1XA 3BL3A 4U5IA 5D2XA 4IT1A 1PJ9A 3NQ6A 1M5WA 1MZHA 1TWSA 1XINA 4LWWA 5LNSA 2WVTA 4O10A 3S6DA 1HKVA 1OK4A 1ZBWA 4FF5A 4A4AA 3U6WA 1JCNA 1KCXA 2XIMA 3F2CA 3TAKA 4P8WA 4XAFA 3BMVA 3E5BA 3FDKA 2HV5A 1FOBA 2VC7A 4BI6A 1IV8A 1CXFA 3IJIA 4Z1CA 3WJYA 3Q2DA 5BXSA 1P0BA 5GNXA 2FKPA 4DPPA 3IJ6A 2DY3A 4AEFA 3UJEA 3GY1A 4M6PA 2VXNA 2XN2A 2BG5A 5EU9A 4D72A 2VEFA 3QR0A 4S2CA 1C3FA 4EF9A 4C6JA 1QHPA 4HK7A 3AIQA 4MY9A 1AJ2A 4UR9A 1OK6A 1FWEC 1FWHC 3ZYZA 2CIPA 1LG2A 1R6WA 4J40A 3AI0A 2A4AA 4KCUA 5G4EA 3W29A 1GPWA 3VXGA 4UQEA 3CU2A 3V75A 1SR0A 1NDYA 1R9XA 2G5WA 3DN5A 4AD3A 2FJUB 1P6CA 1Q8AA 1RK6A 1VBJA 4IQEA 3G6LA 4BF5A 2ALRA 3RU6A 4HMDA 2NQZA 4K36A 3WF4A 1U5HA 2CBUA 3ITVA 4UB9A 4JR5A 1K1DA 6ENLA 1YLVA 3RPTA 4JTCA 2YBUA 3KRBA 2A7NA 2WJEA 2X0HA 1V6VA 1O66A 3UZ5A 3PN8A 3CPRA 5AYXA 3IWPA 3DX5A 3UETA 5JBEA 3B8UA 2JALA 5GJPA 3URBA 2BXVA 3QOKA 2PWDA 5LA2A 5TIMA 1XGEA 3L12A 2ZRUA 2WSYA 1MW0A 1IGWA 4HNLA 4ICCX 1JCYA 3EX2A 4S1FA 1X6NA 2ATSA 4WJXA 2BWGA 4XK2A 2E8ZA 2INZA 5HWNA 3HQ1A 2QJGA 1GJPA 3GIQA 4KWVA 1P5BA 1GG0A 3RXZA 2I17A 4JHZA 3FJNA 4J3VA 4I8DA 3G0UA 2RJHA 3EZ4A 4W7UA 2Z29A 3TV8A 1W5MA 1R2TA 5AN7A 4HNUA 1XPGA 2NUYA 4MADA 3S6TA 4PEKA 2GGGA 1ZY9A 5EPDA 4C6QA 2BTMA 2IPWA 3UXIA 1YXCA 3PPFA 1ZBCA 3CYJA 1PS9A 3IJDA 1A5SA 2WMHA 4PSRA 3IGUA 1S2UA 3KHJA 3MI2A 5FJUA 5D9PA 1E6ZA 4Q8PA 2GJNA 3C8FA 2YW4A 4ZQPA 1PDZA 3Q67A 4AHPA 2ZZ2A 3OQ8A 4YHGA 2DORA 3K4AA 3SM0A 3CQKA 3UESA 1QWKA 3HG4A 3KBMA 5IFTA 1UPPA 4GI9A 2OPJA 2FGBA 3N14A 2V67A 1M65A 3IUIA 4TV5A 2GK1A 3ABXA 4MNLA 1MUCA 2VZUA 2D2HA 2WW5A 1WUEA 3TLQA 2V3EA 3L9CA 1BGAA 3C2FA 5I06A 4ZFCA 3POHA 4B16A 3FS2A 3UG5A 3QHOA 3LZ5A 3A9IA 3EDJA 1OHLA 2FIQA 2VEMA 1CECA 5BNKA 1TV2A 2NUWA 3SQSA 5AC6A 3NPXA 4CEUC 4FS9A 1FWIC 4AY8A 4XUYA 1IEXA 3GVVA 3CZEA 1TPFA 3TN4A 2HPIA 2GL5A 4R5EA 1R3TA 3VNLA 4H6KA 3P62A 3ECQA 1KCZA 1KWGA 2DDXA 2QR6A 1E4MM 3SCRA 2WJDA 1TQJA 1F4HA 3M0VA 4NAFA 5C71A 3M41A 4R88A 3ITCA 3QV9A 4PB3A 2D3LA 4A3UA 3JR2A 3NQEA 1KGUA 3DBNA 5LZLA 1W5QA 3CWNA 3CL7A 2GVJA 3S1GA 2DZPA 4RLIA 4GI6A 3RR1A 4EXQA 2VGIA 4JFUA 4HZ8A 3N4AA 3AS1A 4FP1A 2AKMA 2R1LA 3WQFA 3M0HA 4JOMA 5L9FA 1XYFA 1S5NA 1TMLA 1H49A 2ACSA 5LA1A 2Z1XA 1WUFA 4NHVA 3N17A 1ZCCA 1FHVA 1TV5A 5K9CA 3VIPA 4OBTA 3WIJA 3WJWA 1D8CA 4EAYA 3GSMA 5IBXC 1SO3A 4H01A 1PZ1A 4V1XA 4FO4A 3LENA 5C7VA 3T7VA 3I3EA 1UC4A 3TQKA 2TSYA 3UWVA 5CSSA 5DANA 4KETA 1JQVA 1SSGA 2EO7A 5U4NA 3TDFA 3ZVHA 2F61A 3AHZA 4DJED 2A3HA 1KV5A 3AICA 4DF1A 1YNQA 4WQ6A 3A22A 1U5JA 3BAKA 3URQA 3S1VA 1TPWA 2VURA 4K3ZA 3LGDA 1WKYA 1DTUA 4V28A 3R79A 4TU1A 1FWSA 3PJUA 3AZSA 3CASA 1ISYA 3XIMA 1O94A 4W88A 1TPVA 5BU9A 2CKSA 5A2BA 1BWKA 1ECEA 4PODA 4XVDA 4NZFA 3NGFA 2ATMA 4BQ5A 3WLNA 1OABA 1P1XA 1JDDA 1KXVA 3TYBA 4D6DA 3ZIZA 4JEJA 1HNYA 4AISA 1VPQA 1OFDA 2ICSA 4D1IA 4LGXA 1DWGM 4UFLA 1QCWA 1RLDA 1JAKA 4DRSA 2AGKA 3MVTA 3UEQA 4B5UA 3KRUA 4PRTA 5AHNA 3LY0A 4LS1A 1I8JA 4IMCA 5T9BG 2G3IA 5DO8A 1DPMA 3FCPA 3E2SA 2YCLA 3KX6A 2G4FA 3AXXA 3H26A 4MB5A 1FWGC 4A35A 1ZSXA 1GK8A 1FA2A 8RUCA 2P8BA 4U33A 1DWIM 4C1LA 3DXIA 2X1UA 1BXCA 2WC3A 2E1WA 1EX1A 3LERA 4B90A 4AWEA 3BAIA 4BFAA 1GYMA 5FSEC 7REQB 3GFXA 2V38A 4AEEA 4C1NA 1LUCA 3BVJA 3IRSA 1JZ3A 1KBIA 1B3WA 5AVNA 5KTLA 3HFYA 2KZHA 2ASHA 1ISZA 3AYTA 1J12A 2BGSA 1YTDA 4H8HA 3FA5A 1WZAA 3UXDA 1E9LA 1UA7A 3F1QA 3W1MA 2QS8A 3TW9A 1RSCA 1UQZA 2D3NA 4ATWA 3BCDA 1CYGA 1F6KA 3UG3A 3T4WA 1S2CA 1EX5A 1MEWA 4LH8A 2DJXA 1A0CA 4PTNA 4UWMA 1C93A 4IGNA 3IRDA 1PKMA 4XISA 2W67A 3GZ3A 4E2VA 1QW9A 3GB6A 2A85A 4XTDA 3V35A 4C90A 5DRCA 4ATLA 4FLSA 1KXHA 4QDPA 4H6QA 4UTTA 3QC3A 2QUVA 2VCCA 2VUNA 5E9AA 4UCGA 4MLRA 1Q2RA 3RLVA 3EWDA 2D20A 2VNCA 3SCQA 3IIXA 4J9JA 4PH6A 1CTNA 2V9DA 2VGGA 1KM6A 1WXJA 2XVKA 3S4TA 4PUMA 3TYDA 4RXGA 3N13A 1G4EA 5LNVA 3BG9A 2BP1A 1AQ0A 2GQ9A 3CUXA 1DJNA 3N19B 4O1DA 2ZADA 3W7PA 1SMAA 4GXWA 2BV9A 4OBSA 1BF6A 3CO4A 3E0IA 5I3JA 4CD5A 5FF3A 3O06A 3TNOA 3WMSA 1CDGA 2HMCA 1IEWA 1K9TA 2WNQA 5KZEA 4GUHA 3UVIA 4NXKA 2X1IA 1I2NA 5D8WA 1XLGA 4F2BA 5K9DA 1E6RA 1Q8JA 1YRRA 3VNDA 6CGTA 4RZ6A 1RBOB 3KAOA 1ZFJA 1QNPA 2FJKA 4LC8A 4PCNA 3A24A 3VOHA 1K4GA 3APYA 3LCGA 2NVDA 1JF6A 1J5TA 4Z2JA 4YTSA 1PVNA 3ZLHA 3WFZA 2QV4A 2PDIA 1GVYA 1FWNA 1ME8A 3IPWA 1ME7A 3WNLA 5EFFA 5CC3A 3HQNA 1TIMA 1N7KA 2V2HA 3U7VA 3UFYA 3W7CA 4LRSA 1CGVA 1XIMA 4I9AA 1U1JA 3W22A