2PBGA

6-phospho-beta-d-galactosidase form-b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
468
structure length
468
Chain Sequence
b'MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYCDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 174
structure length 468
sequence length 468
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pbgA00
1BYBA 4PSPA 1GQLA 4AY1A 1C8YA 5A6LA 1CECA 1HNYA 1PBGA 1B3ZA 2D22A 1JAEA 1JD9A 1VEPA 2XSAA 3SUVA 1ITXA 1CYGA 1V6UA 3SCUA 1E6RA 5HDRA 3KZSA 2OYKA 3EBVA 2OWXA 2EPLX 3DHPA 1GUVA 5FIPA 3GH4A 3ZR6A 1R7OA 3VD4A 1ZB5A 2JF6A 1E73M 4WSKA 4C7DA 3WNNA 3VD9A 1CBGA 1JYVA 2J62A 4GIAA 4HMDA 1E6PA 5FOOA 1TFVA 3KEHA 3CHDA 1HXJA 2RGLA 2FGZA 4IPLA 4HTYA 4U3AA 1W3HA 2WLYA 1XC6A 2WZEA 4AMCA 3FAWA 3AROA 4PSRA 1UZ4A 1W9PA 1VJZA 4PMZA 4D1IA 4PMXA 4MB3A 1UH4A 3K46A 1C8QA 3CHFA 1H49A 1OD8A 1JZ2A 4AD5A 4IM4A 5BROA 3ALFA 3ZJ7A 2JEQA 1BAGA 4DWSA 3UETA 1H2JA 1GNXA 1EDQA 2V5DA 1X1NA 3WBEA 1QPKA 1FP9A 1EHNA 1C90A 2O92A 1XGZA 4RE2A 3EMZA 3GNPA 2XFFA 5FCZA 2ZICA 5E6YA 2WSKA 4JZ5A 1E4LA 3N13A 4JFUA 4LYPA 1E56A 2ZX8A 4AW7A 2PBGA 4WKFA 4D6DA 3VM7A 3AXHA 4F79A 2VO5A 4EANA 3WL1A 4XV0A 1V08A 3WDQA 1CGVA 2XHYA 2BXZA 2WVUA 3UG4A 1UA7A 3OGSA 4PRWA 2DT2A 4D6FA 1GONA 3UCQA 2WSPA 4HPHA 3RJXA 3GM8A 2YA0A 3WEMA 1GCYA 3ARTA 1B1YA 1I1WA 1KGWA 3AS3A 1TVNA 5CLWA 4P8UA 5CLTA 1RD6A 4F66A 1MXDA 3QHOA 4OBSA 2YOCA 2G41A 1ZS2A 4CD5A 4CGTA 4PMVA 3WDHA 1KR0A 1XH1A 4W7UA 5A6KA 1WB0A 1JGIA 1MQRA 3MUIA 1QI4A 2E9MA 4MNJA 4GO8A 3KL3A 3HJEA 1E6QM 1ESWA 4H8VA 4KRTA 3BCDA 1B0IA 4P8XA 3SCVA 3SCSA 1Q6CA 1VFMA 3OZOA 3W6LA 3BLPX 3WUBA 4CVUA 3WNOA 3BAIA 3RIKA 3FY1A 3LPFA 2FHBA 4JFSA 3N1AA 4J7RA 5CSUA 3NSMA 4B3KA 2PB1A 4W84A 1E0WA 1WZMA 2ZUTA 2ZX7A 1CWYA 5D9PA 2XG9A 1E72M 9CGTA 2XPKA 3W26A 4QP0A 1CXHA 1OGGA 5BXRA 4J27A 3DYMA 2EXOA 4TXEA 5DF0A 3AIRA 4CCDA 2CKSA 1XSJA 4W8AA 3VGBA 4W85A 3VPLA 2WMJA 3WD4A 4P7RA 1V0MA 1DTUA 3ZT6A 4YHEA 3SCRA 1QBBA 4A3HA 3NDYA 1M53A 1GOQA 3MUZ1 4W5UA 3RO8A 3ARUA 1CIUA 1EQPA 3FN9A 1JD7A 3UG3A 3IJ7A 3OA5A 4QCEA 2BHYA 1ISXA 1TUXA 3WENA 8A3HA 5BYWA 3AZTA 1KXHA 1GQKA 1M03A 5C8BB 1UR1A 1BYDA 1WDSA 3BMVA 1H09A 1VF8A 3CPUA 5LA1A 1JYWA 4P7OA 1JDAA 2NT1A 1QNRA 4F9JA 2VRJA 3AI0A 1J0YA 5I79A 1SYTA 2J75A 4TOQA 3SCPA 2OSWA 3WN6A 1TCMA 2BHUA 4MAVA 2J79A 3OBAA 3F5KA 1U30A 4W8LA 5BCAA 1CGXA 8CGTA 3WF1A 3WDIA 5JUVA 1E0XA 1TZ7A 2VRKA 4D71A 1TMQA 3N18A 2BVYA 3CUJA 4PMNA 3AXIA 5BWFA 2X1IA 6A3HA 3W53A 1Q6EA 3TA9A 4A3YA 3WQ5A 1ITCA 3DYOA 1H11A 2QMJA 4H7VA 1BVZA 1LL4A 3N9KA 5ABGA 2FHFA 1EDGA 3QR3A 4Z2GA 1QOXA 1J11A 4LYQA 2XTKA 1LQ0A 5KZ6A 3LPGA 2W5FA 4ZFMA 3FXYA 1KBKA 4D1JA 1W1YA 4AZ7A 2CHNA 2YDQA 1JNDA 3CLWA 3ZT5A 2A3AA 1C91A 1JG9A 3EDFA 2ZXBA 4Q7NA 4Z2JA 5I24A 1XSIA 5C70A 3GH5A 2VZTA 3J7HA 1B3YA 1MW3A 3W0KA 3F5JA 1F4HA 2C8NA 4E8CA 3A47A 3RM4A 5C71A 5GQBA 2GJRA 1MFUA 3AMDA 3W6MA 3SCWA 2XFRA 2WMFA 2O9RA 4JFWA 3ZIZA 3L4ZA 4B9YA 1I1XA 1UR2A 2BVTA 3ZT7A 5A69A 3ZJ8A 4S3KA 1BYAA 1O6IA 2QHAA 1CXFA 2YL9A 5FL1A 3VGHA 4AD1A 4RE4A 1BGGA 3IAQA 4U33A 2JIEA 2CYGA 2J7EA 2O9PA 3K4AA 3GH7A 2CHOA 1N82A 4LGXA 3W27A 2J47A 3VMOA 5A8MA 1UHVA 2Y2WA 1LF1A 3ECQA 3WQ6A 3L4YA 2W62A 3WIJA 2WLZA 2CITA 1KQYA 2O9TA 3WD0A 3DC0A 2WVTA 3AIBA 3CH9A 3TTSA 1CXEA 5DT5A 4DWSC 2UWFA 1BVNP 4UQEA 1W91A 3S6TA 4GKLA 1Z32X 5A6JA 3AYSA 1IT0A 3BSHA 2Y4SA 2XIIA 5HNNA 2WCAA 2BHZA 4V2XA 2XVNA 2W92A 3WH6A 1WP6A 4HZ6A 2HVMA 5IHSA 1YHTA 3CUHA 4D6EA 4PTVA 3K8LA 3APGA 1B90A 3HN3A 5F7UA 1IZJA 2ZXAA 1CNVA 4OOZA 4JFTA 4BF7A 1BF2A 3NCOA 2XVLA 2MANA 4JFVA 2EPKX 4H2CA 3W28A 3F4VA 5HXMA 2J78A 3EDJA 2WWDA 2DEPA 1SFSA 3UG5A 1VFFA 2A3HA 5LYRA 5M17A 5CPQA 2V3EA 4MJ2A 1D3CA 5A94A 3BMWA 4BQ3A 1ZJBA 4BQ4A 5LA0A 1W2PA 4TVDA 4FLOA 1HJVA 1IV8A 2W91A 2G8ZA 2X0HA 2DSUA 3HU7A 3SUTA 3TTQA 3VO0A 1VEOA 4ZENA 1HKKA 4XUYA 2E3ZA 3PZGA 4U5KA 3T08A 3OB8A 2G3JA 3WL0A 1BTCA 2VZUA 2CBJA 1PX4A 5CG0A 1VBUA 4D6GA 4P8VA 2CCRA 3VMNA 3RCNA 1OT2A 1AQMA 4AISA 2VZVA 4YN5A 3ARWA 3AHYA 4GQRA 1B3VA 3N04A 4PTWA 3VD7A 1OD0A 4ZXLA 1HVXA 1GJWA 3MO4A 4DWSB 3ARQA 4FLSA 4TVUA 3KL5A 3WDPP 1CGTA 5M3WA 1FH9A 1WKYA 2XSBA 2VC9A 3NDZA 4M29A 1GPFA 5GNXA 4M24A 4LQ1A 4M8UA 3SCQA 2WBGA 3VX1A 2E8ZA 1GORA 3SCOA 4BQ2A 1J0JA 5A8NA 1BSIA 3PZNA 4XX6A 1LJYA 4HA3A 1D2KA 1RP9A 2EQDA 1UA3A 4GI9A 1MFVA 3S2CA 3AIVA 1UWQA 1C8XA 5DT7A 4AWEA 5I5RA 1A3HA 5D9NA 3AMLA 4GZIA 4PCSA 4AEEA 1WZKA 2ZX5A 3RILA 2CESA 1UD3A 3WNLA 4GO9A 1WPCA 4HOXA 4MB5A 2XYLA 4GZEA 3NUKA 3VIKA 1NWUA 1ZBCA 4UTFA 1AQHA 3WH8A 3WUGA 1BQCA 1W3JA 2YA1A 3WMCA 2XGIA 3UESA 5A8OA 3QOMA 1P6WA 2D0FA 3VDAA 3ZQ9A 4HZ7A 1GVIA 1MYRA 3QHMA 4URIA 3T09A 2CETA 1CGYA 2ZUSA 3L4VA 4AZCA 4DUVA 2WMGA 1V3LA 5I78A 1OB0A 1LL6A 3NJ3A 3GTNA 3PTQA 4OIFA 4XB3A 1XCWA 4U31A 5IFPA 3TTYA 1E5NA 3AZSA 1V0NA 1JIBA 1B3WA 1IZKA 3I3BA 1R87A 1XH0A 1E40A 4UR9A 2ZUVA 3MSDA 4CU6A 2X0YA 3O6AA 4ML4A 2ZOXA 3GXFA 2ZE0A 1V0LA 2DH2A 3CZEA 1BFNA 5IDIA 4QAWA 2BXYA 1XCXA 3BC9A 2WMIA 1NWRA 1V3IA 2AMGA 2CBIA 4C7FA 1MQPA 3VGFA 2OSYA 4R5EA 3ZM8A 1W32A 2CEQA 1NARA 2J7GA 2WM0A 3BAKA 3WNKA 3FAXA 4X0NA 2D1ZA 1QHPA 4UZUA 1EHAA 1OT1A 4OKDA 1BG4A 1VBRA 5GPRA 1KB3A 1EIBA 4W7WA 4NI3A 5AC4A 3WF2A 1CGUA 1J9YA 1QNOA 4MJ4A 3TONA 2DSKA 2XVKA 2IXVA 2WHLA 4U2YA 1W9XA 4CU8A 1UR8A 4GI8A 1ZJAA 3D3AA 4J3WA 4HMEA 4L4PA 4PBGA 3VIGA 3W38A 1ODZA 4D6JA 2BY1A 2FGLA 5ECUA 4M82A 3OLIA 1JZ5A 2W66A 2TAAA 4UQ9A 1K9DA 2A3BA 2CPUA 1XD1A 4YHGA 1EXPA 1ODUA 4Z2KA 2J8GA 5A2CA 2XWEA 3A4WA 1E15A 1PIFA 1W1PA 3CIVA 4MDPA 4DUWA 1S46A 2D0HA 4UNIA 4RL3A 1WE5A 3WH9A 3T2OA 3GXMA 3MMDA 1MW2A 3M6DA 3W37A 2VX5A 3N17A 1UYQA 5GNZA 1BYCA 1EDTA 4QLLA 3UR8A 1EO5A 2V3GA 4B3LA 4BA0A 4AIOA 3BAWA 2DDXA 2YBTA 1XHGA 4UFJA 4UFMA 1CLXA 2XUCA 4PMDA 1EGZA 3EMQA 1V6XA 2ZIDA 3L2LA 1B9ZA 2VVSA 3OGVA 3RMEA 2YL8A 4JL1A 3UEQA 1L0PA 1V6WA 2YDRA 3VGDA 3M46A 5CXPA 3VDCA 3WD1A 1CTNA 1PZ3A 2WHMA 4V28A 3ARXA 4AZGA 1DWIM 5ABHA 3WMSA 1E3XA 3MV11 4LPCA 3SURA 4Q22A 5A6BD 4AD4A 2D23A 4WLCA 1WDRA 3POCA 3W24A 4W88A 3OG2A 1B31A 3AHXA 3IJ9A 1HN1A 4J3XA 2VURA 2WVVA 3ZMRA 1HIZA 3AFBA 2X2YA 3BAJA 3T2PA 2YLLA 1JFHA 4UFIA 1G94A 1H0IA 5A6SA 1CDGA 3CZLA 1ZU8A 1JZ6A 1AQ0A 4CD7A 4WIWA 2G3IA 2GSJA 1UR9A 4HPGA 6TAAA 2VZSA 2WZHA 4GI6A 3WUFA 4ZXOA 3CZJA 5DFAA 1FH7A 3TOPA 1GOOA 2GVYA 3QHNA 5I23A 4GXPA 2Q8XA 4ZEPA 2CBVA 2WC4A 1NM9A 1UH2A 2BY0A 3ZJKA 1G0CA 2DH3A 4RE3A 1GOKA 4AZ6A 1NP0A 2E8YA 1HJUA 1OGBA 3AMGA 1E6NA 2PF0A 2Y8KA 4FLRA 3KWXA 4P7LA 2DIJA 3CUFA 2XIBA 4PMUA 4WK9A 3EMCA 4V27A 2CIPA 1MW0A 1FFRA 4OBRA 5D8ZA 4HOZA 1R7AA 1UKOA 3U7VA 4EKJA 5A6AA 2WYSA 3RJYA 2G3NA 2E40A 4CD6A 2C0HA 2YA2A 3BXWA 2J7BA 2Y8VA 1FHLA 3L4UA 2GJXA 2WMHA 1K9TA 1VFOA 1HJXA 4UQCA 1QHOA 3VUPA 1W9VA 3VIPA 2YL5A 4TX6A 1KGUA 3AQUA 1HX0A 1OM0A 2JFEX 2WHJA 3PZ9A 1EO7A 2E9LA 2EPMX 1CENA 3EYPA 1E6XM 2NW0A 1HP5A 1KWGA 5CJ5A 2W4XA 3K1DA 1HJWA 3AHZA 2RGMA 2XM1A 1FFQA 1X6LA 3ARPA 2VX7A 4AD0A 1UD4A 3ZOAA 4GINA 4LXFA 3GXIA 4CUCA 2V3DA 2WCSA 3M7SA 3VGEA 1B3XA 5E9AA 1DEDA 1JAKA 2DPEA 1D7FA 1VRXA 3N12A 5E70A 3WEZA 3E1F1 5AYIA 2QV4A 4TVCA 3IJ8A 3THCA 4JL2A 2GDUA 2E4TA 4AZHA 3VDBA 3CO4A 1V03A 3M07A 2ZXDA 3WF3A 3WMBA 1PZ2A 2OWCA 1TA3A 2A3EA 1ZBVA 5IFTA 1W3LA 3WSUA 1UKSA 5FL0A 4W86A 1FA2A 2PWGA 4WJXA 1BG9A 4H41A 1E1FA 1FP8A 3WQWA 1HT6A 2DGAA 4MNLA 2G4FA 3WY1A 4MPKA 1GOIA 4ACYA 1GQIA 1E43A 1EOKA 1UQYA 3A3HA 4MAZA 5DO8A 2OLHA 2JE8A 2D0GA 2DT1A 4JKMA 1UR4A 3WQVA 2HISA 2FHCA 5A6BA 1QI5A 3CZGA 2WKLA 4FK9A 4MB1A 2FH6A 2ZWYA 3FNDA 3BAXA 1UH3A 4WSJA 4CKQA 1VEMA 1W2VA 3VGGA 1H5VA 1ISWA 4KH2A 2BV9A 3KE0A 1UKPA 2XFYA 4D6HA 5M5DA 3SCNA 3BH4A 2PWEA 5EFDA 3WDRA 3WD2A 3VD3A 1CLVA 1QVBA 3AIQA 1UR0A 4QFUA 4AZCB 2CBUA 2W61A 3NSNA 3GNOA 5ABEA 4QLJA 4D6IA 1V0KA 1PEZA 2F2HA 3WNPA 1LL7A 3GBDA 2PWDA 2WC7A 1XD0A 1ZBKA 4X0VA 1E5JA 3VNYA 1E4NA 3WNMA 1QNPA 1G01A 4QDMA 4U5IA 1VFUA 5E6ZA 4UQDA 1OINA 2WVSA 2E0PA 4C7GA 4JIEA 1KXQA 4CCCA 4BCEA 4MNMA 3PZVA 1KGXA 3N11A 1JDCA 3WH7A 2WMIB 2UY2A 3ARZA 3PZOA 2UY5A 1HF6A 4PTMA 2YL6A 1U2YA 1GVYA 4B15A 1CPUA 4AZ5A 1QI3A 3A6OA 4FF5A 2C7FA 3RM8A 2VOTA 1V3HA 3T2QA 3AIEA 3A4AA 3AOFA 4CD8A 2J4GA 1TG7A 1M04A 1BPLB 3N15A 1W9UA 3L4TA 4KMQA 4PMYA 2DSWA 2QF8A 1A47A 2GK1A 4JCMA 4W87A 3CMJA 5EBAA 5EFFA 4JAWA 4IISA 4KRUA 1JZ4A 1VJSA 5GNYA 3FW6A 4N42A 1MQQA 2QMKA 2OYLA 3ZO9A 4JHOA 2YLAA 4S3JA 3LPOA 3K8KA 3VMPA 1UQZA 4N0RA 1JZ7A 1U33A 3VD5A 2Y24A 5BXSA 4ATWA 4FLQA 2CXGA 3CHCA 4HU0A 3KL0A 2ESCA 3B8SA 1DWJM 1H3GA 1WZLA 3TTOA 4XZWA 2CNCA 5I2UA 3O9NA 4P7NA 3VINA 1HKMA 2E9BA 3AMKA 2J8FA 4NF7A 2DT0A 2WAGA 1UOKA 2QPUA 1MW1A 4UCFA 2EPOA 1QHZA 2WPGA 1CXLA 2DT3A 4CCEA 4F9DA 5JIWA 3CHEA 5EB8A 3PTKA 2J74A 4M80A 2EPNA 1JZ3A 4PEEA 3SUWA 4EK7A 5IXEA 2VUYA 1J01A 4J28A 5EMYA 3OLEA 4HMCA 1NWTA 4AC1X 1UWSA 3U57A 3T0AA 2XM2A 4AZBA 1UD6A 2OYMA 3ARSA 2QLYA 3RPMA 2F8QA 1JF5A 3AZRA 4R27A 1C3FA 1KXTA 3G6MA 2WNWA 4QCFA 4F8XA 2J25A 3K8MA 5ABFA 7A3HA 4WKAA 2CKRA 2B31A 3MV01 1XSKA 1GHRA 1ISVA 1C92A 5CPSA 1TR1A 4ZE4A 4HA4A 4ZE5A 4UOJA 4OJYA 5A1AA 1OIMA 3U7BA 5JBFA 3CUGA 3CUIA 3B9DA 2XJ7A 7TAAA 1Q6DA 2WVVB 3WD3A 2BVDA 1WAWA 3TP4A 2WHKA 4J3VA 1ISYA 1KCLA 4UOZA 4NZCA 4PMOA 3BAYA 4JHZA 3PZMA 1PAMA 3U5YA 5CZKA 1J0HA 3OLDA 1PX8A 2VTFA 1LG1A 2JIWA 1B30A 2VQUA 3MU7A 1DWGM 2ZX6A 1E4IA 2IUZA 2OWWA 1V3JA 1QBAA 2EO7A 1CGWA 2V5CA 2GFTA 3W82A 2WW5A 2WZIA 3VIHA 3IANA 4A4AA 3IK2A 2JEPA 5BRQA 1AMYA 1DWFM 3MANA 4OOUA 3D5HA 3BLKA 1O7AA 1F4AA 4U3CA 1GW1A 3FHQA 1QI2A 1R8LA 5BXPA 4DM2A 1DHKA 4X9YA 1VIWA 3VIIA 1ZBWA 1KR1A 3AISA 4D72A 4Z2HA 4UFLA 4AYSA 1CXKA 1SMAA 4HA1A 1QW9A 1GOWA 1PIGA 2W67A 4DUXA 1E6ZA 2DIEA 1AVAA 1YQ2A 5TD4A 3L2MA 1QW8A 2WBKA 1PX3A 4B9ZA 1J0ZA 5FD0A 3BSGA 4ACZA 2Z1KA 1NQ6A 4Z2LA 1JYNA 2WKGA 4LX4A 4TX8A 5CGTA 1LG2A 2DSVA 4BZYA 1JZ8A 2XVGA 1KBBA 2GJXB 2BFGA 2FDMA 3MUY1 3WH5A 4JKKA 1KXVA 7CGTA 1HP4A 1NOFA 2PWHA 3WKZA 1LLOA 3MS8A 1XV8A 2EEXA 1DWAM 4W5ZA 3VDHA 2G3MA 4J3SA 1E6SM 3AS1A 1DWHM 4W8BA 5A95A 1G1YA 1V6VA 1JNEA 1FHDA 2X09A 3WQ8A 1E9LA 4M56A 1VAHA 3WFLA 4EE9A 2BNJA 5CPTA 3W25A 2YBUA 5HPCA 2PWFA 1GQJA 2VRQA 3AS0A 5A8PA 2JF7A 4WF7A 4UFKA 2VCBA 5AYBA 3IAPA 5D9MA 1E4MM 5D4YA 3W4RA 1SR0A 2X8RA 3GXDA 1WZAA 4PTXA 2YJQA 1TA3B 2VT0A 1QI0A 3L4WA 1R86A 5JIPA 2UY3A 1CXIA 1UKQA 2WK2A 4P7QA 5HBFA 4PN2A 1BLIA 3PZTA 1HJQA 4OUEA 5E09A 3G6LA 1RP8A 2FH8A 2AAAA 5CQ1A 4AEFA 1MVYA 4W93A 5IHRA 4H8UA 3AYRA 2XWDA 1LWJA 4PCTA 1W3KA 3VIOA 4L4OA 4MDOA 1R85A 3AXXA 3WF0A 4GZJA 1J12A 1J0IA 3VVGA 3AIUA 3II1A 4XZBA 1UD2A 1KQZA 1MWOA 4JCLA 1HJSA 1JI2A 1H41A 2XGBA 1I75A 1KCKA 2WWCA 1UWUA 2V3FA 5A2BA 3ARVA 3CZ8A 1HKJA 4LYRA 2QPSA 1DP0A 2ZX9A 3SEPA 1WDQA 1NP2A 3GZAA 4UQAA 2D20A 2DQXA 5M03A 4K68A 3VIJA 5HOSA 3GDBA 4NRSA 2WCGA 1Q6FA 3MKKA 1UWTA 3CGTA 4J3UA 4MNKA 1HKIA 1W1TA 4YPJA 1VENA 1US2A 4AIUA 4MADA 4HU8A 1KWKA 3UERA 1NOUA 3MMUA 4PUEA 1TE1A 4PUDA 5FKYA 4UZSA 3AMCA 2VCCA 3WF4A 2WMKA 3PZUA 1Q6GA 3THDA 2ZUMA 3W29A 1GHSA 4UQBA 1JFXA 1OWQA 3MMWA 2D24A 3MUAA 4EAMA 5D9OA 4Y7EA 4D6CA 2PI6A 4E8DA 1PJ9A 2VI0A 3AS2A 4AIEA 1W9BM 3RM9A 5A6MA 3VNZA 2ZWZA 3I3DA 1EA9C 4GQQA 1QNSA 4M81A 3HMCA 1GJUA 2VJXA 3ZJ6A 3CZKA 3F5LA 4IPNB 2F61A 2GK1B 1K9FA 3CBWA 3LMYA 1EH9A 2XVPA 3PN8A 4TTUA 3WEOA 5I77A 1OIFA 2VCAA 5HPOA 5JBDA 4W7VA 5CSYA 3CTTA 1C7SA 3EDEA 1FH8A 3K4DA 2YKKA 1V3KA 4KWUA 4E4PA 3NIYA 3O2LA 1V02A 3GNRA 2DSZA 2Y5EA 2O9OA 3OIHA 3DECA 2NSXA 4CN1A 1Q4NX 2VX4A 3AHVA 2UY4A 1VB9A 5D8WA 2J77A 2VVNA 3AIWA 2W63A 2JALA 5E0FA 3WUEA 5BRPA 1CEOA 5A2AA 1V6YA 4P8WA 1H1NA 3PTMA 1HVQA 2IXUA 4JKLA 3AICA 5CGMA 2VQTA 3NSXA 2Z1SA 4AZIA 3DHUA 1NH6A 4KGLA 1E1EA 2YDSA 3QOKA 4PYSA 3WDJA 4UOQA 2VMFA 4HP5A 1OCQA 3EDDA 3I3EA 4DM1A 3ZSTA 1TVPA 1RH9A 3OLGA 2OSXA 3LPPA 3VU2A 1HL9A 3T0DA 5KEZA 3PHAA 1M01A 1US3A 2BY2A 3ARRA 2D3LA 4FMVA 1E3ZA 1W9DM 3FHAA 3OGRA 2VNCA 4NSBA 5DEZA 5BXTA 5AC5A 2PBOA 5ABFB 4TUFA 3PZIA 3SUSA 1E55A 4CN6A 1FOBA 2GDVA 4H8HA 4AD2A 1OBAA 5JBEA 3BCFA 4ATLA 1UZ1A 1J18A 3VM5A 1WNOA 4Z2IA 1OGSA 1ZL1A 3ARYA 3AJ7A 3VTRA 4GPNA 1OSEA 1J10A 4M1RA 1CZ1A 1QNQA 1G5AA 1GOMA 3VIFA 3WQ4A 1JYXA 1V02E 1WDPA 2VZOA 2VR4A 2EJ1A 1PPIA 4PMRA 1ISZA 1UG6A 1XYZA 4DWSD 5DMYA 1L8NA 3B9EA 1JL8A 2BY3A 3PBGA 2BS9A 4H04A 2VX6A 4QLKA 1BGAA 3SIMA 1E71M 1UWIA 1M7XA 2ZUUA 3VIMA 3MSGA 3AHTA 1H4PA 3VOCA 4AXNA 2VL4A 4E2OA 2EBNA 1EQCA 4W89A 1UD8A 4TTGA 3PZQA 1UUQA 3EDKA 5E0CA 1E0VA 2CERA 1JXJA 1NOWA 3UR7A 4HOWA 1V3MA 4CD4A 1B2YA 1Y7VA 1G9HA 1XYFA 2J7FA 4MB4A 1K9EA 2WXDM 5I6SA 3GBEA 4WKHA 1WO2A 3SCTA 1SMDA 4PMQA 2D3NA 5A3HA 2GJPA 2ZUWA 4CVWA 1C93A 4ATDA 1WCGA 1KFWA 2YIHA 2J7CA 3WFZA 1HL8A 5I0DA 4MTVA 4BS0A 5A8QA 3L4XA 1X6NA 4B16A 6CGTA 1C7TA 3RDKA 1MXGA 4ACZB 2X05A 3T0BA 4BQ5A 2WC3A 1JDDA 3JUGA 1JXKA 3DYPA 3OZPA 2VR5A 2GUYA 1ECEA 1EOMA 2ZUNA 3CMGA 4HZ8A 4IUGA 3VKKA 3SUUA 3POHA 1LWHA 2WANA 5LA2A 2ZXQA 1UWRA 4NRRA 5I3DA 4CU7A 1GZJA 3ZR5A 1E70M 1K6AA 2A3CA 4U2ZA 2J7HA 2PC8A 3VX0A 2V38A 3WBAA 3NYDA 4KGJA 1XRVA 2WB5A 3WELA 1W1VA 4CN4A 3A4XA 1JF6A 1J0KA 3QGVA 3ZSSA 1UKTA 3GYCA 1UD5A 2NT0A 3BGAA 3W81A 1RPKA 3B9AA 3U5UA 5AY7A 1NWSA 2J7DA 1H0GA 3ALGA 4J3TA 3VILA 4OZOA 4AD3A 1XH2A 2D2OA 4UFHA 2AOSA 1JI1A 1BHGA
chains in the Genus database with same CATH superfamily
3MO7A 3WJSA 3QZEA 4O11A 5A6LA 5K9XA 1EL3A 2PDKA 4WCJA 5JU6A 3BZJA 3GG7A 1JAEA 1VEPA 2MNRA 3V18A 2AGKA 3SJNA 4AHQA 1V6UA 4DBEA 1E6RA 1DVJA 2OWXA 3CNYA 3W2KA 2ZTKA 3UCDA 2DZVA 1RY0A 2ZZ3A 4KQNA 2OCZA 4C7DA 1TWIA 2QZRA 3VD9A 1DTNA 2J62A 2YB4A 4GIAA 1ZPTA 4I9AA 4MGGA 3CHDA 1Z41A 1X6UA 1HXJA 2Q8LA 3GU9A 1X1ZA 4DLFA 1XC6A 3PVFA 4AMCA 1G4PA 3FAWA 3WK3A 3AROA 4PSRA 4D1IA 4GVFA 1TV2A 1C8QA 4HHPA 3UJSA 3CHFA 4K7VA 3VE7A 1OD8A 1JZ2A 5G4WA 3BCJA 4IM4A 4ZGYA 5BROA 3BW3A 1BAGA 3TQ0A 2X41A 1PCKA 1SZRA 3B8WA 4I5RA 4FNTA 2E6YA 1EUAA 4RV8A 1GKPA 1EHNA 4WJEA 5BU9A 3NQMA 4IQLA 4RE2A 1PDYA 3UVIA 4NIRA 3CAQA 5AYYA 2ZICA 5E6YA 4JZ5A 5HJLA 2QCGA 1PKLA 1ADOA 3C86A 4LYPA 2V5BA 2A7NA 1A0EA 4AW7A 3BLFA 1KFJA 1U83A 4BF5A 1S1RA 1M7OA 4F79A 3LM7A 4BK9A 4XV0A 3TH6A 3PBMA 2BXZA 1FWNA 3WQDA 1X97A 1CB7B 3P3BA 4AY7A 1XLBA 1EP3A 2ZRUA 4GUIA 1ZUAX 1VCGA 1W1IE 2P76A 1GCYA 2DQWA 1B1YA 2ZRWA 5EMKA 3SECA 2I7GA 5CLTA 4F66A 3LD5A 4QM1A 3THAA 2G41A 4CD5A 4CGTA 3WDHA 3RRAA 3IS4A 1UBSA 5A6KA 1ENUA 1WB0A 1MQRA 3MUIA 5H8UA 3PPGA 3R0UA 1YTKA 1JPIA 4GO8A 5LNWA 1ADSA 1ESWA 3I6RA 3N2BA 3KM8A 3LHWA 3BCDA 3KBVA 4B3ZA 4NHVA 1HL2A 3OZOA 3W6LA 3NZ1A 3GTHA 3WNOA 2E5CA 4DYKA 4RDZA 3S8HA 4QJ3B 2R6OA 4JFSA 3N1AA 4O18A 4J7RA 5CSUA 4IIBA 3N6QA 1RR2A 4NG3A 3V0UA 4QX4A 1NF0A 2ZUTA 3N2TA 1FWIC 4DO4A 2DUXA 5K7JA 1E72M 1ZNNA 9CGTA 4YL2A 3O06A 1O4UA 3V3WA 3DYMA 2EXOA 4AMAA 2UZ9A 1W5PA 4NKCA 3AIRA 4CCDA 2CKSA 5CAKA 4W85A 3TN6A 4FXFA 1V0MA 1DTUA 4QR6A 4YHEA 4I8DA 1GOQA 4WD0A 4L4LA 2JBMA 1EQPA 4GQ0A 3P67A 4QCEA 4HK5A 3A5FA 2Y7GA 3IRSA 1P0KA 3RFAA 3WENA 1A50A 4YCPA 3AZTA 1KXHA 1GQKA 1WAUA 1F05A 2Y1HA 3BMVA 4V1YA 5LA1A 1KCXA 3E0VA 1XS2A 2VRJA 3AI0A 4FPSA 3N3TA 1TSIA 2PDMA 3CQIA 1UMYA 3I4KA 1H60A 2WNZA 4QITA 3WN6A 3AO0A 3M0LA 2BHUA 4MAVA 2V5KA 4NAFB 1OADA 5BCAA 1CGXA 2YZ5A 1E0XA 1TZ7A 2VRKA 1TMQA 3BGJA 5CZSA 2X1IA 1Q13A 1JVNA 5K4ZA 1OEPA 1ITCA 2Z2BA 1A3XA 2H8XA 3E74A 4RXFA 1EDGA 1U5VA 5I3KA 4Z2GA 1SJDA 3DESA 5DQPA 4PB4A 3I7RA 2XN2A 1LQ0A 5KZ6A 2W5FA 1TREA 3UZWA 3FXYA 4D1JA 1RZMA 1W1YA 2H6RA 5LGXA 4GOAA 3LCGA 3ZT5A 3JVAA 1C91A 1R46A 2TMDA 4Q7NA 1Q7QA 3NQVA 2QCEA 2VZTA 4O28A 3VKJA 3RU8X 1B3YA 1MW3A 1S5TA 2CZFA 3A47A 2GSEA 1ZRQA 3LU2A 5BOEA 4Q33A 3PSWA 5GQBA 2GJRA 3W2MA 1F8MA 1QUMA 1E9YB 4B9YA 2R1KA 5TBOA 2BVTA 3GXPA 2WSYA 3ZT7A 1BYAA 2BTMA 1CXFA 5I3HA 4XUGA 3UWYA 4AD1A 3P8JA 2JIEA 1DJGA 5K2ZA 2HNHA 2O9PA 3O16A 3ERPA 4LGXA 1QPQA 5A8MA 3NQAA 1ONEA 3L4YA 2W62A 5E0KA 3V4BA 2O9TA 4H00A 4Z1YA 1DJWA 3W7KA 4UQEA 1K6WA 1KV5A 4GKLA 2DW6A 5A6JA 3AYSA 2Y4SA 4G2DA 4LY4A 2XU2A 4V2XA 5AFDA 4ORMA 2W92A 1O12A 1W5NA 1FXPA 5IHSA 4D6EA 2A3LA 4PTVA 4ZOAA 1XXXA 4IFOA 5F7UA 1IZJA 4NP7A 4TMCA 2O7SA 4OOZA 1ML1A 4H1ZA 1M7PA 2EPKX 4LTSA 2PDWA 2VGIA 3QZAA 3KCJA 5BNKA 3IRDA 3LRLA 3DUGA 3MBDA 2WWDA 2DEPA 4FXRA 1SFSA 2BODX 1WOAA 3UG5A 1FUYA 2A3HA 4PTNA 1P7TB 4JTRA 1XDMA 3RR1A 1GVEA 2V3EA 4MJ2A 3R8GA 4E3VA 1ME9A 3RUBL 1ZJBA 4H9MA 5LA0A 1KRMA 1R9XA 3G1FA 4JQAA 3C8NA 3VO0A 1V7YA 3LUTA 3LY0A 4ZENA 5KETA 3PZGA 3KP1A 1L2UA 2VYOA 1VFSA 3OB8A 4XKYB 1W31A 1O94A 3W7NA 3NQEA 1K70A 2BMBA 4S3CA 4M7SA 5KTLA 4O52A 5CBBA 2CCRA 1VBGA 1AQMA 4UNKA 4AISA 5CC5A 1O60A 1XBYA 4YN5A 1I2RA 3AHYA 4KF1A 4GQRA 3VD7A 4PTWA 3R43A 4QAIA 2G3FA 1GYMA 1LCOA 1PO9A 1HVXA 4DWSB 2HDJA 3LNMA 3T55A 4PFMA 3WDPP 1CGTA 1T96A 3NA8A 4E38A 2XSBA 3SW6A 4IIFA 4M29A 1GPFA 2YCLB 2WBGA 3M0YA 1L6YA 1GORA 4DBSA 4BQ2A 3CL7A 4B5WA 5FEXA 2NZLA 1J0JA 5A8NA 1Y5VA 1VKFA 3PZNA 1LJYA 4MZ8A 4HA3A 1Y5WA 2JKPA 3NQ7A 4OV4A 1UA3A 2Y85A 4GI9A 4IXHA 3G8EA 1B5TA 3T1GA 1RBAA 5DT7A 1OY0A 1HZYA 4ZO8A 1A3HA 3HIJA 5D9NA 4OFCA 4EXBA 3GIYA 4GZIA 3KOWA 3RILA 2GWGA 4KS0A 1TCDA 2CESA 2DUZA 3S1VA 3WNLA 4MB5A 4MJMA 1ZJHA 4IWWA 4GZEA 4RW3A 1H1ZA 1LOLA 1TE6A 1NWUA 3ORWA 1ZBCA 3UD6A 3WH8A 3UZYA 7ODCA 4JPGA 5F2IA 3UESA 3UJFA 4JD4A 4D8ZA 3OU8A 4ZQPA 1RSCA 4HZ7A 2D73A 1CGYA 4DUVA 4CQDA 2AQOA 1KD0A 1ZZMA 1OB0A 1OVDA 3H23A 3F4CA 1XCWA 4DYEA 3TTYA 1JIBA 1XYAA 4H01A 1XIGA 2BGQA 2FB3A 4HB7A 3UPWA 2ZZ6A 4CU6A 2V30A 2PEVA 3SGGA 3TLQA 4I6KA 4FSAA 5A8GA 3W1NA 3CZEA 4GIYA 3T78A 4GY0A 3ITXA 3BG9A 1NWRA 3AYVA 1V3IA 2O4MA 4AVOA 4O13A 2CBIA 3BICA 1MQPA 1EF2A 1ZFJA 2Z6IA 4R5EA 3DFOA 4ASTA 1F74A 2J7GA 4J4KA 4UZUA 1EHAA 2QGYA 4OKDA 3SY1A 1KB3A 2ZZ5A 1V93A 5CC6A 5GJMA 5JH2A 1IIHA 2IXVA 2WHLA 5HNUA 2GSHA 3QY7A 3FYYA 1ODZA 5G1MA 2FGLA 2UBPC 5ECUA 6ALDA 4KWVA 4M82A 3OLIA 1XLMA 2W66A 2ISSA 3ZR4A 4H19A 1K9DA 1XD1A 1EXPA 1LP6A 4NJJA 3OJGA 3ENLA 2GUBA 4QQ3A 1XINA 3QFEA 3EX1A 1KM5A 1PIFA 3VNMA 2D0HA 2QNEA 4UNIA 4RL3A 3T2OA 2EAWA 3GXMA 4YVXA 3R89A 4F2BA 2XISA 4QS6A 3HM7A 4QEEA 2YGYA 3MMDA 4Q4KA 3W23A 1MW2A 4JX4A 3W37A 4LV9A 2HEJA 3WBXA 1UYQA 1KFBA 5GNZA 4BA0A 2V3GA 2Y61A 4B3LA 5LIWX 3BV7A 3PJXA 1XHGA 4CNTA 3F03K 4JOMA 2XUCA 1GOXA 1EGZA 3MYOA 2ZIDA 3APYA 4Y8EA 2I17A 1B9ZA 4JTGA 4Y2WA 3OGVA 2Z2UA 4L80A 1GYLA 4OE7A 3UJRA 2RJGA 1S2CA 1PZ3A 3LX9A 4V28A 4UTHA 3MQTA 1Q4WA 1QXLA 3C5QA 5DRCA 1F5ZA 2D23A 4AU0A 1FWWA 3AHXA 4S39A 4J3XA 1FTXA 2B7QA 3PNUA 2PTYA 2WVVA 2YXOA 3AFBA 1B9BA 1V8EA 1TYGA 1W1B1 5A5WA 2ISFA 2DIKA 3WQEA 1Q3NA 5A6SA 1B54A 1L9WA 3EX6A 4PUKA 2PDXA 5EGRA 1R38A 4YNGA 4WIWA 3INPA 3VAVA 2ZRYA 2QCFA 1MDLA 4HPGA 1RLDA 2WZHA 1J4EA 1YPFA 1LBFA 4GI6A 5AHEA 3WUFA 4ZXOA 2FPYA 5T26A 5AC7A 1I2PA 3NO1A 1ZQ5A 2ICSA 2Q8XA 4UBPC 3CAKA 1ZLPA 3ZJKA 2DH3A 4HQVA 1GOKA 2PWVA 1NP0A 2ZA3A 5LIKX 4O0QA 2OZ8A 1E6NA 3M5XA 1IWAA 3KRBA 4Z0JA 3U6WA 3CUFA 1IXNA 1JPKA 1TX2A 1R5YA 4PODA 3PPHA 1P1MA 2PDBA 4LUSA 3W2JA 2OG9A 1OX4B 3UXIA 4OBRA 2PSNA 4LAUA 3G1DA 2QJIA 4HOZA 2FPTA 4C1NB 2HPMA 1UKOA 3P7YA 4WZHA 4EKJA 5A6AA 1D8CA 3RJYA 5MKGA 1TRDA 1MXSA 9XIMA 2C0HA 2YA2A 5G2HA 4Z0SA 3VOGA 1FHLA 2WMHA 1QHOA 3VUPA 5D33A 4G6CA 4Q7BA 3W83A 3LTSA 2G50A 3OOQA 1UUOA 2Z2AA 3OP2A 3Q2DA 4KWSA 3EYPA 2NW0A 3K1DA 4JX6A 1HJWA 3VNIA 5H1WA 3W75A 4ZQMA 3RPTA 2TODA 4AD0A 1J8VA 1IXOA 3ZOAA 1EC9A 3GXIA 4WSHA 2PCEA 3M7SA 1B3XA 3Q45A 5E9AA 3TJ4A 1HKWA 2DPEA 2X1UA 2ZRZA 2ABAA 4TVCA 1A0CA 3G3MA 3IJ8A 3A12A 1LRNA 3LCXA 4JL2A 2E4TA 4AZHA 4O57A 3VDBA 3FEMA 3H54A 3CO4A 3FA5A 4ZOCA 3WF3A 2VEPA 1Z6KA 3WMBA 2CLOA 3HB9A 3QRHA 3GIPA 1ZBVA 3UGVA 4WJXA 1JJKA 1R3VA 2QULA 2PODA 3WY1A 3TJXA 1GPWA 4A3QA 3W00A 3QQ0A 5DO8A 4GACA 4DF2A 2DT1A 4M5PA 2B7PA 1UR4A 5ENLA 2FHCA 3CZGA 4MB1A 3FNDA 4WSJA 4A3RA 1W2VA 2QXWA 4KH2A 3DX5A 2BV9A 3KE0A 2OO6A 5HK4A 4HJWA 5M5DA 3TW9A 4Z17A 2PWEA 4XAPA 5EFDA 3WDRA 4NXKA 4IJRA 4F2UA 1CLVA 5BWAA 4QFUA 1QVBA 1GVOA 1I9CB 3FGCB 4DI9A 2CBUA 4ZFCA 4XVEA 4J9JA 3V1PA 2IKJA 1PV8A 2FZNA 3PM6A 2HSAA 5BRBA 3GBDA 1ZBKA 1E4NA 3RR4A 3WNMA 5LXXA 4AG0A 1VFUA 5E6ZA 1M5WA 1AH3A 1M9HA 4C7GA 1SW0A 1KGXA 3N11A 1JDCA 1TZ9A 2XSXA 2WMIB 3K4WA 2UY5A 1HF6A 1JCJA 3DFQA 3S5YA 1L6WA 3E02A 4L1WA 1CPUA 4GVGA 4GQBA 2FJUB 5FJTA 4C6FA 3C52A 4YU1A 3RM8A 5AZ0A 1V3HA 4F0LA 2VENA 4A05A 2J4GA 3SM0A 2JK2A 5H6HA 2E68A 4S38A 4US5A 3G5EA 3QXBA 2GGJA 1JCMP 2QF8A 4ADTA 4JCMA 4IISA 3UU0A 2FYMA 5FF4A 3IGUA 1G4SA 3LEPA 4GYJA 4UTJA 3LPOA 1UQZA 4N0RA 4AQLA 1I2QA 3MHFA 1G7UA 3L65A 2Y24A 5BXSA 4GNVA 1K8XA 3KL0A 4HHMA 3JU2A 2Q8ZA 4FX7A 4MWAA 3LERA 3B0VC 3G3DA 1HKMA 3PP7A 2E9BA 1MRQA 3S5ZA 3UWEA 2DT0A 1WXYA 2PTXA 3KOXA 1SJBA 4FR1A 1RHCA 2A5HA 1CXLA 2DT3A 1A5BA 3W7CA 5TAOA 4FA3A 5J5DA 1JZ3A 2EPNA 3LSCA 3SUWA 1ZJIA 1KW1A 2VUYA 1J01A 4J28A 3O6YX 3H4WA 1ECQA 2EKCA 1UWSA 4B5XA 3PANA 3U57A 1GKQA 3P93A 1FCVA 3T0AA 1I4NA 4LB3A 3UW6A 3ARSA 2F8QA 2XZ9A 3BGGA 3DENA 3URNA 3HQOA 3NQDA 1K1DA 4F8XA 2I9EA 2BX7A 1T40A 1NELA 1YTDA 2B31A 3VC6A 1XSKA 1E9IA 3QLDA 3FA4A 2FTYA 3ANUA 2ZE3A 5AZ1A 3NL2A 2GGIA 1OIMA 3U7BA 3CUGA 4HHHA 3KRUA 4JBRA 2ZVRA 3H6OA 3W85A 1Q6DA 1L6FA 2PUZA 3LDVA 4WUIA 1V79A 2WHKA 4J3VA 3D47A 2H8ZA 3GFYA 2ADAA 3BAYA 4JHZA 1PAMA 1J0HA 2J6XA 1PX8A 2VTFA 4OV9A 4LUYA 2VQUA 1FWEC 3MU7A 2ZX6A 1WKDA 2OWWA 1QBAA 5I3IA 4DBWA 2YCJA 4LJ3A 1CGWA 2V5CA 4DIAA 3HGOA 1KC7A 1S3HA 3IVUA 2Y7EA 1KO0A 4XK2A 3RXZA 1AMYA 1DWFM 4OOUA 1LRQA 5F4WA 3D5HA 3BLKA 1QI2A 5BXPA 3LB0A 4QGCA 3KP0A 3PR2A 3ITGA 4X9YA 3TMLA 3VIIA 4TIMA 1ZBWA 1KR1A 4Q4OA 4PUWA 3VFLA 4AYSA 3PULA 1AUSL 2BWGA 1DIOA 4KKXA 2DIEA 5BOOA 4H6EA 4IIDA 1YQ2A 5TD4A 3MWAA 5HQEA 2OFJA 4B9ZA 1OYBA 3QPZA 2O56A 3NNTA 1OJXA 1RJQA 4Z2LA 3SO7A 3N6HA 4UWMA 2Y70A 4YIWA 5SWUA 1JZ8A 3GVVA 5CG7A 2GJXB 3WH5A 1R3WA 1F3WA 1XBVA 1HP4A 2Q3RA 2PZ0A 1LLOA 3MS8A 5AHLA 2WO5A 3E38A 5FESA 1LUCB 1W0MA 4LBUA 4ZA0A 2EGZA 4NX0A 1TPVA 4QJ5B 1G1YA 1V6VA 2R1MA 1FHDA 4ICNA 3JS3A 1FDZA 2ISDA 4M56A 3MSRA 5DMNA 2V5LA 3WFLA 4EE9A 4FAMA 4C1KA 5HPCA 1GQJA 4WF7A 1FWJC 5E9XA 3IAPA 6PTDA 3HTWA 4IMAA 1S5WA 3N2OA 5TNVA 3GXDA 4Q4PA 3KVLA 2YJQA 2VT0A 4NZ3A 2OELA 5CZJA 2VR2A 4ERAA 1K8ZA 1BLIA 3PZTA 1HJQA 3IIVA 5E09A 3CUZA 3R4IA 2J66A 3HJZA 2VFDA 1RP8A 3KBNA 5CQ1A 1EX1A 4XZNX 4AEFA 5GVJA 2XWDA 4PCTA 4Q8TA 3VIOA 2EG8A 3S47A 3GXNA 4N2YA 1J0IA 3VVGA 4ZQNA 3II1A 4KCWA 5HNRA 3A13A 4TMBA 4KEZA 1UD2A 2VKZG 3W7OA 4EPKA 3MT1A 4O1DA 4O54A 1M3UA 3UVAA 1H41A 4J1OA 3W7IA 2V2HA 2WWCA 7TIMA 4LVFA 4LYRA 3FEQA 2QPSA 4MWAC 3GUWA 3U4FA 2VOMA 3KDNA 2D20A 1DYSA 3IJDA 1XIMA 4ALDA 2G5WA 5HOSA 2BLEA 3GDBA 3COTA 4NRSA 1Q6FA 4J3UA 3REQA 2GYIA 3G22A 3K13A 4YPJA 4MADA 1RA5A 3S9ZA 1YXDA 3GDRA 4ZBCA 1EX5A 3FA3A 3WF4A 4Q8QA 1Q6GA 5XIAA 1GHSA 4UQBA 1Z3NA 3G0XA 4AX7A 1BSLA 5HAOA 2D24A 3UA3A 1POJA 3KHDA 3G24A 2PI6A 3B8VA 1PJ9A 4N9EA 5LNUA 1QAPA 4JTFA 3RM9A 5A6MA 3VNZA 2ZWZA 4B5SA 1QNSA 4L56A 2H3BA 2GVGA 2E5DA 3ZVHB 3DHFA 4MFDA 3THUA 3F5LA 1Y0EA 3CC1A 1PHQA 3EWZA 3O07A 3QTGA 1OIFA 4EF9A 4Q8NA 5JBDA 3O8AA 2QKFA 3EXRA 4W7VA 3CTTA 1LROA 3EX2A 4E4PA 1BF6A 4LS2A 5DY3A 1XX1A 2P8BA 3W7LA 2O9OA 3DECA 3DU0A 4WEVX 3QY8A 4CN1A 5IOBA 3SGUA 1VB9A 4O17A 2I9UA 1J96A 4UTIA 4K8GA 1VFLA 1A4MA 1A5KC 4LAZA 5AHMA 5E0FA 1CEOA 5A2AA 4NL1A 1NJJA 4ZZ9A 5D32A 4JKLA 5CGMA 3EOEA 4WJ8A 2VQTA 2Z1SA 1E1EA 3RGTA 1E9ZB 4PYSA 2H9AB 3W2NA 1OCQA 4UNLA 4Y8FA 2CZDA 3AC0A 3GAYA 4LBSA 1M01A 1US3A 3LA4A 1DHPA 1O5QA 5E1QA 2D3LA 4S3BA 4ADUA 2XH0A 3FHAA 3NQ8A 3OGRA 1DE6A 1PYMA 3C56A 4TUFA 1YKWA 4AD2A 4ENLA 1IEQA 3O6CA 5EY5A 4S3FA 4LS0A 5REQB 3ARYA 3VTRA 3R0DA 5JXQA 3W2LA 3NOYA 1G5AA 3VIFA 2Q3OA 1V02E 2VZOA 2VR4A 4Q8OA 5F2MA 1J79A 1QATA 4DWSD 1L8NA 3LZ5A 3B9EA 3MY9A 3USZA 1KCZA 1IYXA 3CWOX 3NXLA 1KM1A 4JIPA 1UWIA 4FB7A 3H7UA 2R91A 3VIMA 3MSGA 4CQ8A 1P43A 4S3AA 2QDDA 3VOCA 2VL4A 4H6QA 1EQCA 3QV8A 1UD8A 4XQ6A 1PKYA 1NOWA 3G1RA 4CD4A 5L6UA 1ICPA 1Y7VA 1G9HA 4LV4A 3S5NA 1AW2A 3W7PA 1SMDA 4PMQA 1TV4A 2D3NA 2XN0A 2GJPA 1WCGA 3OVPA 2YIHA 3OZMA 5I0DA 4XWUA 4MTVA 3TYDA 3MI2A 3VOIA 1C7TA 1WXZA 1MXGA 4O50A 1DXIA 4S2BA 3R8RA 3GFZA 4UCGA 5KINA 3ID7A 1XYLA 3LLFA 3JUGA 1H51A 4QJ1A 4PE8A 4XZLX 3QGKC 2VR5A 3Q94A 1PSCA 3DHDA 4XBJA 1EOMA 1KBIA 1WDWA 1W54A 2Y8UA 4Y9MA 4HZ8A 4HSHA 3VKKA 4BEUA 1PB0A 1UC5A 6ENLA 3RX3A 2WANA 5IM51 4ROQA 1OC7A 4NRRA 5I3DA 2Z28A 2X7VA 2OQHA 1ZHAA 1J6OA 5EKYA 1O66A 4GRSA 1XRVA 2WB5A 1W1VA 4JQ4A 4CN4A 1XG4A 1ITUA 1UKTA 4GYFA 1F2JA 3U5UA 3VOFA 1Q8AA 3ABZA 2PS2A 1H0GA 3A23A 4OZOA 1XH2A 1JI1A 3WLPA 4PSPA 1GQLA 4AY1A 1C8YA 1JDEA 1PBGA 3LYEA 2XSAA 3CQHA 5CBIA 3CXOA 1TV5A 3EBVA 2EPLX 4I5UA 1GUVA 1CLKA 1XKJA 3GH4A 4W9TA 3ZR6A 1ZB5A 2FZ9A 1CBGA 4FNUA 1E6PA 3TSMA 5DANA 4Q4SA 1NU5A 3C2EA 2FGZA 1GEQA 3V0SA 2WLYA 5HWMA 1UZ4A 1W9PA 4DB7A 2HBVA 1U22A 1UH4A 3QKEA 3GDTA 4WGHA 4AD5A 2BOEX 2QCLA 1FWHC 3ALFA 3ZJ7A 3UETA 1H2JA 1YDOA 2V5DA 3H2OA 3WBEA 1QPKA 2PAJA 5U7SA 3LNPA 2DY3A 2HS6A 1XGZA 3LTYA 3GNPA 2NV9A 2WSKA 3RPDA 1E4LA 1XICA 3CO8A 3SADA 5KZDA 1TJ2A 2PBGA 1JCXA 1E0TA 4WKFA 4IOTA 2VO5A 4EANA 3WL1A 2NWRA 2XHYA 4KIEA 2WVUA 1X39A 1UA7A 3OGSA 1XRFA 4D6FA 3N4EA 1EWDA 1GONA 3AJXA 3L23A 3UCQA 4M6PA 3H12A 2TRSA 3S1XA 2YA0A 3ARTA 1I1WA 3HGSA 1TVNA 5CLWA 4H9YA 2ZC1A 3IV3A 3UWVA 4OBSA 1W56A 4X9SA 1LRTA 4F40A 3LRMA 4JHMA 3VNKA 2NQHA 1XH1A 3N2MA 4QG9A 4XIMA 3IJQA 4MNJA 3KL3A 4H8VA 4P8XA 3SCVA 3SCSA 3BLPX 3WUBA 5I02A 1EJSC 3FY1A 3MW7A 3IIOA 1GYNA 3L0GA 3NSMA 4PUNA 4XBSA 4B3KA 4MVAA 3HG2A 2X1TA 1E0WA 2ZX7A 2DW7A 2Z00A 3I6TA 4OWGA 2P0OA 4IGHA 1ONXA 5DXYA 2B81A 2PFHA 4QP0A 1OGGA 3HQPA 1MZHA 4J27A 5RUBA 5DF0A 4YS1A 3EB3A 3Q4DA 4W8AA 4GYKA 3M41A 3TYEA 2NQ9A 2WMJA 3Q37A 4TU1A 3WD4A 3H70A 2BP1A 4ADSA 1SZFA 1M53A 3TR2A 3DXIA 5D30A 1LDCA 2LLEA 3EKZA 1YDYA 3MWCA 2IPJA 4WY0A 5BYWA 4JYFA 1TPFA 2WJEA 2PA6A 1H09A 3RLVA 1AZ2A 4RK8A 2QEZA 5CPNA 4PL2A 1J0YA 1SYTA 4TOQA 1JCTA 4OT7A 2ALRA 6TIMA 4QXIA 2GGEA 3EKGA 3F5KA 2PRHA 2OLSA 1F3EA 1VGAA 8CGTA 3WF1A 4D71A 1NQKA 3GNXA 3N18A 3DH7A 5BWFA 6A3HA 2Z29A 3TA9A 2E77A 3FDKA 4H7VA 5HWJA 3E49A 4JTCA 1AL8A 3WLHA 3BANA 5HANA 4RZBA 1POKA 3W9ZA 3IK4A 4LYQA 1XRSA 4YWIA 2XTKA 4ZFMA 1TRIA 5G4EA 3ZVIA 1KBKA 1KFEA 2CHNA 4NAEB 3N4FA 4OECA 4GE8A 4MY8A 4M6QA 4YYCA 1QOPA 9RUBA 2ZXBA 4IGSA 4Z2JA 3LQLA 4FZIA 3CQ0A 5I24A 4E4FA 1IIGA 3J7HA 4EAYA 5LSMA 2CW6A 1F4HA 3BG3A 1F61A 4E8CA 4YTQA 3RM4A 1BXBA 3AMDA 5HJXA 4JICA 4HZMA 4Q8UA 3N2XA 1FKXA 2ACRA 4MF4A 4PCNA 2O9RA 4JFWA 4IL2A 2PU1A 3LMZA 3TXVA 4DZ5A 3I65A 6REQA 5A69A 2C14A 3NZGA 1KM2A 3TDFA 3IAQA 4UTTA 1M41A 3S9YA 3PBYA 3GH7A 2CHOA 1R47A 2FZDA 1N2VA 1QCWA 3VMOA 3F4NA 4ZQRA 2QUUA 2Y2WA 4GZ7A 1H1YA 3WIJA 2CITA 5AHIA 1KQYA 3WD0A 1KFKA 3N4AA 3TTSA 5DT5A 3QQ1A 1BVNP 4X63A 1W91A 4WQ6A 3LM3A 4K37A 1Z32X 2R1LA 2RKXA 2QUMA 1ZENA 5JMUA 3O0FA 5F2LA 2BHZA 4KEUA 1WP6A 4HZ6A 2ACUA 2HVMA 5JQ9A 3WLSA 1AD4A 1XG3A 1TR9A 3DZ1A 4FX6M 4WDUA 4GUFA 3K8LA 3APGA 4DNHA 2Y7DA 2CLEA 2OGJA 5HR7A 4LNYA 1FWRA 2A79A 4HU3A 4JIIX 4JFTA 2XVLA 4JFVA 2IW0A 1PL9A 1MZRA 3EWXA 3AXKA 2J78A 1YPXA 3EDJA 1TIWA 4X22A 3TJIA 3E0WA 4R34A 3FV9A 2CFFA 2IPWA 1IHIA 5LYRA 2G96A 4LVBA 5M17A 4BQ3A 1KKOA 2A4AA 3EXTA 3A9BA 3BUVA 4FLOA 4XD6A 1IV8A 2W91A 3F1QA 2X0HA 3SUTA 3TTQA 3TW6A 4I9MA 3NQ6A 1NTHA 1HKKA 3MI3A 2QCCA 3BZGA 3W07A 4YLWA 3T08A 4ROPA 3KTXA 2VZUA 3GU1A 3Q65A 1PX4A 5CG0A 3T6CA 4HNOA 4IQEA 4D6GA 3BJSA 2QJGA 4P8VA 4RNJA 1VCFA 3GD6A 4R88A 3GK0A 1EEXA 3NWRA 1WX0A 3ARWA 2GUUA 5D02A 2X40A 1IR2A 3EGJA 1T5AA 4ZXLA 1ZAIA 3CM4A 1OK6A 1WKYA 1RVGA 2VC9A 2HK0A 5EA9A 5GNXA 5I07A 4M24A 4LQ1A 3R25A 4X61A 3VX1A 3EWBX 1BSIA 3ANYA 5DY2A 2E6AA 3LCLA 3BOXA 3LGGA 1Z42A 3TWBA 1D2KA 2EQDA 1XFCA 3GHSA 3AIVA 1UROA 1UWQA 1C8XA 4AWEA 4Q8PA 4PH6A 4L64A 3H2MA 3ZXWA 3WLLA 4PCSA 1CW2A 4ZOBA 4E6MA 3QLLA 2CLHA 1GT8A 3FK4A 1BXCA 1VC4A 3UG8A 3N9RA 3GW0A 5DCDA 5AOUA 4UTFA 1AQHA 3SRKA 2BZNA 1W3JA 2YA1A 2A7RA 1XIJA 4DN1A 5A8OA 4MYAA 1ZTVA 1P6WA 4AWUA 2D0FA 3ZQ9A 3QHMA 4R33A 4AX6A 3OHIA 4AZCA 1XR2A 3RU6A 1PHWA 2E25A 2HK1A 2FMNA 2ZBTA 3NJ3A 3GTNA 3PTQA 4GQGA 3MMTA 2P8CA 4AEOA 3BJTA 3AZSA 1B3WA 3MI6A 3I3BA 4JN6A 5D04C 1XH0A 2YCKX 1Q5MA 1ZP4A 3VNJA 9XIAA 1V0LA 2PDYA 3GXTA 1W5QA 2BXYA 5HMSA 2H3DA 5CSSA 5K3VA 1J2BA 1O5RA 2VFIA 2X1RA 5HMDA 2OSYA 3DN5A 1BWLA 3DBNA 3WNKA 4C6DA 4FOUA 1OT1A 3T07A 4ZO7A 3QW3A 3TCSA 4NI3A 1R3QA 5AC4A 3N6JA 1XW8A 4MJ4A 4UTTC 3TLLA 1EF3A 1W1ZA 5CPLA 2DSKA 4GMEA 2XN1A 3ISIX 1CCWB 1GW9A 2RDUA 3BLDA 4C65A 4U2YA 5J04A 1ZJAA 1LT8A 2GDQA 1WYIA 2ZADA 5C5YA 1F6KA 2V63A 4HMEA 3Q58A 3W38A 4K39A 1UUMA 2V82A 4A35A 3U2EA 3CWNA 1YBQA 3H4XA 3G1HA 2OJPA 1RQHA 4UQ9A 1FDYA 2ZCGA 1L2QA 3KBMA 1ODUA 4N7QA 4IH3A 4G7EA 4ZSUA 1XWYA 2J8GA 1JPMA 5A2CA 1IXQA 3KX6A 4I6VA 4N9DA 4MDPA 1UMLA 1WKFA 4JQ2A 2HROA 4DUWA 1WE5A 2VDHA 3WH9A 4L7ZA 2Y89A 3F2BA 2OQYA 1TPUA 2J27A 3W1AA 3TK7A 3P74A 4FXJA 3GDMA 1EXBA 4QLLA 1SW7A 1EO5A 3E5PA 4NNCA 2DDXA 1OCNA 4UFJA 4C6PA 3U2OA 1GWJA 4QDPA 2QDHA 2Q71A 1D9EA 4IMDA 1TTIA 2VVSA 3M5VA 3RMEA 4GG9A 3UEQA 1I0DA 1L0PA 4YTTA 3M46A 4WR3A 2R14A 2NUWA 1GQNA 3HV9A 3IGHX 4YMZA 5G2IA 1CTNA 2Z1BA 4HJFA 1VLIA 3FKKA 3ARXA 2V0TA 4BI6A 4QDWA 1EJWC 2X42A 3MV11 5A6BD 1WDRA 4O19A 3POCA 3OG2A 1B4EA 2C13A 1VPXA 3IJ9A 1HN1A 5CKSA 1TV7A 3ZMRA 3M44A 2P88A 1M68A 2FIQA 1SJCA 2YW4A 2YLLA 3T40A 3NXFA 4RNHA 1I2NA 3B97A 2A6NA 1TPDA 4Z1BA 3KLLA 2NWSA 1JRBA 1G94A 1ZU8A 1JZ6A 1UPMB 2BOFX 2GSJA 3TJLA 2VZSA 3CZJA 4P61A 1Z48A 1VJIA 3QHNA 1G7VA 1G4EA 1JRCA 4DNMA 3NQFA 3BO9A 2WC4A 3DFSA 3TFCA 5KSWA 2DUAA 2PF0A 2V81A 1XKYA 1RA0A 4LC8A 2XIBA 1DXFA 3NO3A 1P6CA 4V27A 3LBOA 4JIQA 2CIPA 5MF5A 4XSMA 1MW0A 3ITOA 5D8ZA 3CV1A 1JPDX 4CD6A 1HQTA 3BXWA 4HKPA 2C91A 3ICJA 5DCBA 1K9TA 1W3NA 1LOSA 4DYJA 2YBVA 1FHUA 2YL5A 1KGUA 5FSEC 3STPA 4L9XA 1OM0A 2ZC8A 1YE4A 2CU0A 1EO7A 2E9LA 3BLEA 4QG6A 3NQGA 5L9FA 1E6XM 4AVFA 1KWGA 2W4XA 4U28A 1GVSA 1SSDA 2PDCA 4J3ZA 2PD5A 3E0FA 3TKFA 4GINA 2V3DA 3VGEA 3VFCA 1VRXA 5E70A 1R3RA 3E1F1 4HD5A 3THCA 3RF9A 1TJRA 4EWJA 4DAIA 3DFYA 3M07A 3V75A 2ZXDA 4ZSTA 4IT1A 4AUBA 3LV6A 4KESA 2OWCA 1TA3A 4V33A 5IFTA 3USBA 1UKSA 1I8JA 1BG9A 2C1IA 1E1FA 4UTKA 3TAKA 3WLOA 2DGAA 4MNLA 4LSBA 1PDZA 3L9CA 4PFHA 2I5GA 3R0KA 1EOKA 4PB3A 3QMRA 3KS5A 3KBJA 1YDNA 4NI8A 1AH0A 4G9PA 2JKEA 3W1TA 1UASA 1OYCA 1QI5A 1HFBA 2WKLA 3VZYA 2ZWYA 3BAXA 4CKQA 3ITVA 1IT8A 3VGGA 1BTMA 1ISWA 3QYQA 3A64A 2AAMA 4AWTA 3EWWA 2WQDA 1S5VA 5EMLA 4H83A 3IJLA 3URAA 1AD1A 1JUEA 3H53A 3C0JA 1HO4A 3L2IA 3AIQA 2C1HA 1KA9F 2GOUA 5LIYX 3NSNA 1K8CA 3TQKA 4NXSA 3SGZA 1AZ1A 2F2HA 1PEZA 1K7EA 2IPGA 2PWDA 2WC7A 1XD0A 3CYJA 4X0VA 4O0KA 4TQTA 4MY1A 1IEVA 2R1PA 3TWAA 4U5IA 4UQDA 1OINA 2E0PA 7REQA 4BCEA 4MNMA 2OEKA 4AAJA 3WH7A 1OFOA 2UY2A 3ARZA 2A85A 3KOZA 5FF0A 2NX9A 4F4RA 2YL6A 1U2YA 3EB2A 4FF7A 5I03A 4B15A 3NQBA 4GBDA 4C90A 2HE8A 4XTIA 3KXQA 2BBFA 1C9DA 4MY9A 2RFGA 1FRBA 3SR7A 5D2TA 3SFWA 4BFAA 4CD8A 3PY2A 3N15A 5D09A 4RZ5A 4EPEC 5HINA 4KMQA 2CLIA 1IEIA 2DSWA 1A47A 4Q6JA 4DZIA 1GTEA 3KLKA 3PTDA 4W87A 4QHRA 3WJYA 3UXKA 3UT0A 3FW6A 4HU4A 2OYLA 1UC4A 3NYZA 3ZO9A 4JHOA 2DP3A 2YLAA 2PDIA 3K8KA 3VMPA 5LXEA 3FLUA 5AVNA 3QH2A 1JZ7A 1R2RA 2CWXA 5K9DA 3B0UX 3VD5A 1T7LA 2IPFA 4ATWA 2IKIA 2ESCA 2R82A 4KEMA 2Z1XA 2NXIA 4P7NA 8RUCA 1IGSA 4ZL1A 2AQVA 3CJPA 2Z7KA 2QPUA 3UA4A 3P84A 3D6NA 4FXSA 1SM9A 4QSFA 4CCEA 3HPXA 2PRLA 1Q85A 4H6RA 2J74A 3STGA 4M80A 1EIXA 2Z24A 4O1EA 4EK7A 3O05A 3RK8A 4HMCA 5D38A 2Z7GA 1EB3A 3TW7A 3VNLA 1QW7A 3C2OA 5LHEA 3DGRA 4AZBA 1IT7A 1P4CA 4PB5A 3AZRA 3XISA 1KXTA 4ZTXA 1Q2RA 4QE4A 2WNWA 4L4MA 3ITLA 5ABFA 7A3HA 3LG3A 4UTMA 3OBKA 4RZ4A 3MV01 1GHRA 3ITTA 2E6DA 2POTA 2FVMA 3W76A 5CPSA 4HA4A 1H7RA 3TOYA 2Z1WA 5TQLA 2QIIA 1Q45A 3IARA 3PC0A 4KCTA 2WVVB 1WAWA 3W7HA 5D2WA 3ZS4A 4JNZA 4HK6A 3B0XA 1KCLA 2I5IA 3M0JA 4UOZA 5C55A 4NZCA 4PMOA 3F2DA 3DI0A 4PMJA 1DWGM 1JUKA 3NPUA 4QBXA 4ZB2A 2HE5A 1SSGA 3QPEA 5B80A 4PULA 3KFTA 3S0CA 1YADA 2OEJA 4F0KA 4I3GA 2WZIA 3VIHA 3W1QA 3IANA 1HO1A 1LORA 4UMCA 1A5MC 1QO5A 2QT3A 1XJBA 3VDGA 4Y6GA 1O7AA 1Q2SA 1F4AA 4TV6A 1R8LA 2PGRA 2GVLA 4DM2A 4LC6A 2BDQA 5DRIA 1VIWA 1NDWA 1H7XA 4H2HA 1YYAA 1XI3A 3RG6A 3O1NA 1SMAA 3UR5A 4DWDA 1E6ZA 3NGFA 5CC3A 3NVDA 2G37A 4UTUA 3L2MA 1QW8A 2WBKA 1T99A 1PS9A 4LUSB 1J0ZA 3H2FA 3PS7A 1B57A 2OOGA 4ACZA 1NQ6A 3RLUA 1XLJA 1YW1A 2ZFAA 4LX4A 4TX8A 3TU9A 3LHZA 5MKGB 1T8QA 3GTFA 4DUOA 3RO6A 5BW6A 1U1HA 3PUEA 2NQZA 2VFFA 3S1GA 5FF7A 2PWHA 2VGBA 4WOQA 1AFSA 3SI9A 3AS1A 1RK6A 2P10A 4LVGA 4A8LA 3M43A 4XD3A 3H55A 2BG5A 1P5BA 1B3OA 1T41A 2HS8A 2X09A 1LBLA 2QVHA 4LAOA 3VUSA 3W25A 2YBUA 2Q09A 5C2GA 2JF7A 1GVRA 4UFKA 4S23A 3BDKA 1A5OC 3GTIA 1X8FA 1SR0A 2HZGA 1WZAA 5CSRA 2PLKA 2OGYA 1R2SA 4UXDA 1QI0A 3L4WA 5JIPA 2UY3A 1AL7A 1CXIA 1IR1A 1EJXC 2VGFA 1R2TA 5HBFA 3AU6A 1YE6A 4OUEA 2QJJA 2QCNA 4KFNA 4QNWA 4NJHA 2NX1A 1V7AA 2AAAA 3STFA 1F8IA 4W93A 5IHRA 4H8UA 2GVJA 4IG2A 3TR9A 1R85A 3AXXA 3WF0A 1J12A 3P0XA 3AIUA 3EA3A 3QV9A 4XZBA 1BQGA 1ME7A 1X8CA 1MWOA 3AALA 3DAQA 4HYRA 4NJKA 4F0RA 3GVRA 4PRTA 1RQEA 1TV3A 1UWUA 4YYFA 2I1OA 3UJEA 1UIPA 1HKJA 3FKRA 4FS9A 4OVXA 3SEPA 1PIIA 2PC4A 1WDQA 4DF1A 3T8QA 4U10A 3GZAA 3L67A 1SFJA 2ZZ2A 4M3PA 1FXQA 3BLOA 1UWTA 3CGTA 4MNKA 4C6EA 1VENA 5C54A 5DLCA 4H7ZA 4AH7A 1KWKA 4N9BA 4K7YA 3MMUA 1AQFA 4PUEA 1TE1A 4UZSA 3GE7A 4IHCA 4EWND 4YVVA 3PZUA 1DQUA 3M0MA 3W29A 3BSMA 1JFXA 3EAUA 3MMWA 2NVAA 3IIPA 5G2WA 3IVTA 4Y7EA 1TJPA 3M9YA 4ZQOA 5HR6A 3EEZA 4K3ZA 2VI0A 1F3XA 4DQWA 4O1FA 4AIEA 5IDZA 3LK6A 4US6A 1UCWA 3I3DA 3ITCA 3QMSA 3H2NA 3HMCA 1GJUA 2VJXA 3GKAA 3ZJ6A 2PF8A 4IPNB 1LQ2A 2B7NA 1K9FA 3DC8A 4FIQA 1EH9A 4TTUA 4TX9A 2VCAA 4QS5A 1P6BA 3EDEA 3LCIA 3K4DA 4KWUA 1V3KA 3GVWA 3D46A 2ZA2A 3HFYA 4Y9OA 3NIYA 4IMEA 1EGMA 4HN8A 1V02A 3GNRA 3UJ2A 2IKHA 2GPTA 2R24A 3T0TA 1FWCC 2Q02A 3N25A 1GG0A 4MWAB 3AIWA 2Q6ZA 3IUIA 2JALA 4P8WA 1UP2A 4DBDA 1Z89A 1XLAA 4KGLA 2YDSA 3AUJA 5XIMA 4E0CA 1FDJA 3B4YA 2OOFA 4LW7A 4NT0A 1TVLA 4WVXA 4B2DD 2VHLA 3BW4A 3I3EA 4DM1A 1L6GA 2QDEA 4HIBA 1AG1O 3E2QA 3DKLA 2OSXA 4R53A 1HL9A 4GUHA 5KEZA 3MSYA 5LNRA 3ARRA 1DBTA 4FMVA 3WLQA 1FWGC 3UWUA 5AC5A 3KVJA 3SUSA 4B5TA 4YXGA 5C2XA 1FOBA 2GDVA 4GCAA 4H8HA 5AC6A 4ATLA 3LBMA 3C3NA 3GLCA 1HGWA 1X1OA 4XSLA 2AL2A 1QJWA 3AJ7A 2D69A 3W74A 4GPNA 4RR4A 4M1RA 3GSMA 1OHLA 3H26A 4D2JA 1WDPA 2IQ0A 2EJ1A 3NEHA 4LEFA 4PMRA 1ISZA 3NAVA 1XYZA 1XISA 3UWQA 4C6LA 1UP0A 4H04A 3SIMA 2ALDA 2IS7A 4EXQA 2PLMA 3VCNA 3CQJA 4K2SA 3S1UA 7PTDA 3QEZA 4E2OA 2X16A 3P0WA 2QUVA 4PC8A 4TTGA 4O15A 3NFUA 1EBGA 5CJNA 4IICA 5E0CA 1JXJA 4Z1DA 3RHGA 1V3MA 1QWKA 1XYFA 5ECVA 1K9EA 5D2VA 4NNAA 3EWDA 1EJUC 2H90A 4KCUA 5A3HA 1OFRA 1TPC1 4LS1A 4IP5A 3G0SA 1BXNA 1PCWA 3M4HA 4JGDA 1XPGA 5A8QA 1QTWA 4B16A 1ITQA 1V51A 2YX0A 4DI8A 1Q6QA 3I4EA 4GD0A 1SZEA 3WG6A 4C5YA 4QRNA 1JXKA 2GUYA 4GABA 4YWSA 2HXUA 2ZUNA 1GEHA 1SU5A 3GQYA 2BVWA 1RBOB 3SUUA 4DJFA 1YNQA 4GVIA 1LWHA 1QT1A 2ZXQA 4I8YA 2A2IA 1TB3A 1UWRA 3E9AA 4QE5A 4CU7A 4HNTA 8XIMA 3ZR5A 3IIZA 1S38A 1E70M 2VC5A 1G6CA 1K6AA 4MKVA 5FJPA 3NYDA 4KGJA 2F9RA 4E2VA 3A4XA 3HA1A 4H6KA 1R6WA 1A3WA 1J0KA 3QGVA 1IF2A 1TZZA 1XIFA 5F2GA 1NWSA 3W1PA 1O5KA 3DIPA 3ALGA 3SRHA 1PWLA 3TX9A 1MEHA 3CTLA 5AKQA 1CGVA 3ZJ8A 3MJMA 1MMFA 1BHGA 1QOQA 3KTSA 1ONWA 4BKNA 1CECA 1HNYA 1B3ZA 2D22A 3SUVA 3HPSA 2VWTA 1CYGA 3UP8A 2GGHA 1W17A 5HDRA 2OYKA 4IIHA 1K4GA 5FIPA 4RDYA 1F7BA 3LCFA 1R7OA 3VD4A 1AH4A 4WSKA 4MWAE 3QW4B 1L6SA 3VCCA 5FOOA 1TFVA 3KEHA 5FEWA 3N9SA 3WK2A 5I09A 4IPLA 5IRPA 4HTYA 1B4KA 3T44A 5BMWA 2WZEA 2C79A 3H24A 4PMZA 4PMXA 2DZTA 1S39A 4MB3A 2RJHA 3OQ8A 4QJ4B 3NGJA 2PDPA 4KPLA 3K46A 3MZNA 4GH3A 2CLLA 2OLAA 2PLJA 4FI4A 3HBLA 1GNXA 1EDQA 1X1NA 4DY1A 1C90A 1XBZA 1MUCA 2R1NA 4C6NA 2XFFA 4O12A 5FCZA 4C6JA 4IJBA 3REQB 3N13A 4JFUA 2F84A 1T6MA 1E56A 4N4QA 5CC7A 4ECLA 4P5UA 3BLIA 3VK5A 1V08A 1HGYA 2EKGA 3UG4A 4PRWA 1Q8JA 3GYEA 3A4JA 3C6CA 4IPIA 1A49A 3M47A 3M5ZA 4HPHA 2DZAA 5G5IA 3GM8A 1H61A 4JR5A 3WEMA 2INZA 1G69A 1KGWA 3AS3A 3ELFA 4RDWA 5J8LA 4P8UA 2C16A 1MXDA 3SRFA 1LWIA 8XIAA 3QHOA 5BU6A 5AECA 3W7EA 3KOFA 1JGIA 2E9MA 3GHRA 1E6QM 4KRTA 3FS2A 1B0IA 1M7JA 1P0NA 2E5BA 1TELA 3S6OA 1FWDC 3HQNA 4CVUA 5GJNA 2O7QA 3MCOA 1RY8A 1EYWA 4UR8A 4GNJA 3T8LA 7XIMA 1O5XA 1TPEA 3GHTA 4NVTA 1A5NC 3WQGA 1WZMA 1KKRA 5D9PA 2F6UA 3OIXA 2XG9A 1YNYA 3TSDA 3W26A 3LHUA 1K77A 4BEQA 1LLWA 5BXRA 4E5TA 2IQTA 3WJWA 5T9CE 1US0A 3LTPA 4IP7A 3VPLA 1E1CA 4OGZA 3WX7A 1E0UA 1NDYA 3ZT6A 3SCRA 1QBBA 3RX2A 4L6OA 3NDYA 3MUZ1 4W5UA 3RO8A 1CIUA 1PTAA 5FJIA 1UW9A 2WOQA 1NF7A 3IJ7A 3OA5A 1ISXA 3VOJA 1EP1A 4GUGA 3VXGA 8A3HA 4B4FA 2ODOA 1S2AA 1M03A 5DX7A 5C8BB 4O0ZA 4CNUA 3EX4A 1ZAHA 1BYDA 1WDSA 1S2TA 5D2YA 1VF8A 1JYWA 3FJLA 2VP8A 4P7OA 1JDAA 1QNRA 2J75A 3IUDA 3LGEA 1TCMA 3VC5A 1J2WA 3P82A 1U30A 4IF2A 3URBA 3LI1A 3G8RA 2BVYA 3CUJA 4PMNA 4ES4A 4DJFC 3BV4A 4I7UA 3BOFA 3MZ2A 2NVCA 4GC4A 3W53A 3EA2A 5CJMA 3W1UA 2GQ8A 3DYOA 1H11A 2QMJA 1VRDA 1LL4A 3TN5A 2ZA1A 4ICCX 3R2GA 3OVQA 3QR3A 3MP3A 2PGFA 3OZYA 4ICMA 1QK2A 5FJRA 4K38A 5FA5A 1QOXA 1J11A 3C3UA 3QY6A 4RNIA 3LPGA 1EC8A 2A0NA 4AZ7A 2YDQA 2O0TA 4L1GA 4WHBA 1FWBC 3BW2A 5J5RA 2A3AA 4M7TA 5JVLA 1JG9A 1YX1A 3SN1A 4ORIA 3GH5A 3B8TA 3KCLA 2D2GA 1QNVA 4AHPA 2WV8A 2OKOA 3W6MA 3SCWA 2WMFA 3L0KA 3P2VA 3ZIZA 4MOZA 1FWFC 3WK1A 4POCA 1OF8A 1NFBA 4XZMX 3W73A 1O6IA 2QCDA 2QHAA 3WK0A 4Q3MA 2ANUA 2QPXA 3VGHA 1H7WA 1BGGA 3UPBA 2ZVIA 4MLRA 1NEYA 4C6MA 2J7EA 3L0NA 1EFZA 5I3FA 5CAHA 4CNOA 4D8LA 2J47A 3N14A 3OEXA 4KWOA 1UHVA 4NJIA 1YLVA 3P81A 1LF1A 3ECQA 3ZZ1A 3TROA 2WLZA 3GDKA 4JYEA 2HVOA 2GJNA 4H7CA 4O10A 3DC0A 1QO2A 2FZBA 3AIBA 3CH9A 1ELSA 1LYXA 2UWFA 2Z25A 4JTTA 3S6TA 3NPXA 3BSHA 2OODA 4RPPA 2XIIA 3C2YA 3B8IA 4GIEA 3R12A 5FEPA 2XVNA 4IPPA 2QCMA 3KRZA 4B5NA 1EC7A 4K8EA 1TPWA 1YHTA 1CX9A 3CUHA 1QASA 4BR1A 3DG6A 1B90A 3H21A 2QUTA 1PXGA 2ZXAA 1CNVA 4P2VA 2TYSA 4PBEA 2Y88A 4KRZA 2MANA 4H2CA 4BI7A 1XLDA 3F4VA 2ATMA 1D3GA 3LXBA 4K8HA 1VFFA 2WSQA 3ME3A 5CPQA 4LAMA 5M1TA 3BMWA 4GBUA 3MTWA 3MCMA 1GJPA 1UR3M 2QJHA 4HBKA 4BQ4A 2I56A 1W2PA 3TN4A 1HJVA 2G8ZA 2DSUA 4PZVA 5KITA 4NAEA 4XUYA 2E3ZA 3W7MA 2E09A 4U5KA 2NQLA 3MJYA 2G3JA 3RMJA 3I7QA 3S42A 3PFRA 3CB8A 4J2PA 1VBUA 4IGMA 3KDOA 3MBFA 3RCNA 1OT2A 2NUXA 1FWTA 1YDVA 5HMEA 2VZVA 5B7YA 3PF3A 1B3VA 4Z1AA 3P14A 3W84A 1QR7A 1TIMA 1GJWA 3MO4A 3IWPA 3P80A 4FLSA 3KL5A 1V5XA 1FH9A 1EP2A 1IE7C 3NDZA 3W1XA 4M8UA 3L5LA 3SCQA 2E8ZA 3SCOA 3FYOA 4IMFA 4A8IA 3W72A 2NQ5A 1MFVA 3S2CA 4H3DA 1U5HA 3B8UA 4Y9AA 3LXAA 2X7WA 3K1GA 4C6BA 1WZKA 4XAYA 5C9RA 3KOYA 2O55A 4LALA 4GO9A 4LANA 5AYXA 4HOXA 2XYLA 3PPCA 1J6PA 4M0XA 1DJXA 3NUKA 3VIKA 4NZ5A 3WUGA 3K5XA 1LOQA 2VM8A 1QU4A 3QOMA 1SO3A 4Q6XA 2F6KA 3VDAA 3WLTA 1GVIA 4URIA 2CETA 2REQA 2ZUSA 2C18A 3L4VA 4A21A 2PTZA 1V3LA 4D9PA 3S5OA 4OIFA 1JCYA 2QQ6A 3KHJA 1E5NA 1V0NA 1R87A 4YTRA 4DAFA 1E40A 1OC6A 4UR9A 3CH0A 3SAZA 4H9TA 2X0YA 3O6AA 3LHTA 4ML4A 1EZ2A 3NURA 3HFTA 4NZ1A 2ZE0A 1MUWA 4JEQA 1FY6A 3QMTA 2P50A 3TN3A 3GR4A 2Y62A 5IDIA 4QAWA 3BC9A 1R9ZA 5D03A 3P61A 2OZ0A 2A21A 3SY5A 1KM6A 3QSTA 1NARA 2WM0A 3FAXA 2WJDA 3KBSA 4UMBA 4NNBA 1UPPA 3M16A 5DBTA 5I00A 1BG4A 1EIBA 1SQ7A 2FFCA 4W7WA 2ZZ7A 3WF2A 4FALA 2F6XA 1CGUA 1QNOA 1CB2A 3M5YA 2XVKA 2YB1A 4WY0B 3ABXA 3WZ0E 4XISA 3STEA 4GI8A 4EVZA 2PMQA 2Z4GA 3D3AA 4J3WA 3V5FA 4PBGA 4L4PA 2Z0IA 3VIGA 1D3HA 4LWWA 4D6JA 4DHGA 3NL6A 3TQPA 1XLFA 4AF0A 1JZ5A 2TAAA 1NIUA 3E96A 4YHGA 5G1TA 2YW3A 1MO0A 1XLLA 3G2GA 4M6UA 4FOJA 4IUOA 2NX3A 1KRAC 1E15A 2XFWA 5TIMA 2VWSA 2CLMA 3DBPA 1MRAA 4KEVA 4OTKA 1YTEA 4XZHA 2AKMA 3VZZA 1DJIA 2VX5A 2ZDSA 3OVGA 1BYCA 2INEA 4R7OA 3UR8A 2DZWA 3B8DA 5CBJA 1UJPA 4XAFA 1CLXA 7ENLA 4PMDA 3GVQA 1V6XA 3AWOA 3B05A 2ASHA 2X1SA 2YL8A 4DJED 4D8AA 2YDRA 2OT1A 2QYGA 4HK7A 4I7WA 2VD9A 3WD1A 4XAGA 1JEZA 3CAWA 2WHMA 4JTKA 3FIGA 3L7RA 4DO5A 1C29A 6REQB 4AZGA 5ABHA 3WMSA 3H8AA 4AIBA 1OFAA 3SURA 4WLCA 3GG0A 3LRKA 3W24A 4W88A 3GZ3A 2VURA 4YVPA 3P8IA 2EF9A 4ZB0A 3QF0A 2X2YA 4JIHA 3LLXA 1H0IA 5B7ZA 2V68A 1CDGA 3CZLA 2VXNA 2F2KA 2G3IA 4LUTA 1UR9A 3M0VA 1Y5XA 1Z9AA 6TAAA 3V35A 3W3OA 3EKLA 3TOPA 2GVYA 2OZ3A 4REQA 4GXPA 3A3XA 2V69A 2CBVA 4ZTYA 4G1NA 2OQLA 2RHGA 1NM9A 3KAOA 1UH2A 4AZ6A 4M19A 1HJUA 4O1CA 3TTEA 1OGBA 1VFTA 1EPXA 4FLRA 2IQDA 4LBRA 2DIJA 4GX9A 2KZHA 1TX0A 4PMUA 3QGAC 4L6DA 1TJ0A 3EMCA 3UQNA 3LCWA 3T7VA 2J9ZA 1FFRA 2G97A 2OO0A 3NZPA 3R5EA 2GLKA 2WYSA 1RCQA 3QTPA 5ABTA 4US5D 3MYPA 3L4UA 3FJ4A 3RAOA 3GTXA 1HJXA 2GWNA 4HCLA 1W9VA 4Z1CA 1TWDA 4TX6A 5HJYA 1H7OA 1HX0A 3AQUA 2Y6ZA 4Y9NA 3N2CA 3PZ9A 1CENA 3NG3A 3WQPA 1LBMA 2ATSA 1HP5A 3KS6A 3AHZA 2RGMA 3XIMA 2VFGA 1ME8A 4FO4A 3CMFA 1FVPA 4JTHA 4GY7A 1S5MA 4LXFA 1XIDA 4MWAD 1DEDA 2Y0FA 3V5CA 3WEZA 4RW5A 1JULA 5AYIA 2QV4A 4JQ1A 4QG8A 1QFEA 5BMXA 2EG6A 1PZ2A 4KT2A 3LHVA 1REQA 1W3LA 4Q8WA 3WSUA 5FACA 5FL0A 1W8GA 1P48A 4W86A 2PWGA 4HSNA 5F4XA 2WJFA 4JN8A 4H41A 4UB9A 1A80A 3WQWA 1HT6A 2VFHA 2G4FA 4MPKA 4DRSA 4I9TA 1QDSA 3SQMA 3CV2A 4ZR8A 1GQIA 4RX0A 3O0KA 1UQYA 1DIKA 4MAZA 3TVAA 3G77A 1FKWA 4ZCWA 2D0GA 2HISA 4FK9A 4L6HA 3VABA 4N6EA 4IZGA 2YZRA 3H7RA 1H5VA 2RDTA 2WZTA 1KBJA 2PDFA 2W3ZA 1UKPA 2XFYA 4NX5A 1BD0A 3BH4A 3DFNA 4CQBA 3TEVA 1QMLA 3WD2A 3QV7A 3VD3A 4L9ZA 4HPJA 4ZMGA 4AZCB 2W61A 4INFA 1WA3A 1XLIA 3B04A 5BZAA 4K36A 2FDSA 4AB4A 3N34A 4LU0A 3GRIA 5ABEA 4QLJA 1DXEA 4D6IA 4ERIA 1V0KA 4LVAA 3JRKA 3PPFA 3WNPA 3M6YA 3HG5A 3HPFA 3TYBA 1E5JA 3VNYA 1LZOA 1QNPA 1G01A 2YFNA 3NQ2A 4OU1A 4QDMA 1NSJA 3VI2A 3BARA 3TYCA 1AJZA 1NY1A 3EA1A 4MYXA 3SZ8A 1XPYA 1IEWA 2BASA 2VDGA 3RYSA 4F0MA 4LH8A 4IP4A 1WQ5A 2DFAA 1YXCA 4AZ5A 1XLKA 5U4NA 3SN4A 4ZODA 4GGBA 3UBPC 4FF5A 2C7FA 2VOTA 1SFLA 3W86A