2PBPA

Crystal structure of enoyl-coa hydrates subunit i (gk_2039) from geobacillus kaustophilus hta426
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
b'FVSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLIVASSAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase subunit I
publication title Crystal structure of ENOYL-CoA hydrates subunit I (gk_2039) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 92
structure length 255
sequence length 255
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2pbpA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2pbpA01
3BEZA 2PG8A 5KDRA 3ZWCA 2A7KA 2F6QA 4K3WA 2VSUE 3QMJA 1WZ8A 3Q0JA 3T3WA 5DTWA 3GF3A 3L3SA 3K8XA 4U18A 1HNOA 1SG4A 4WYOB 2GTRA 4OMRA 5DU8A 3H0QA 1TYFA 2DUBA 4KNPA 2ZL3A 3H81A 3H0JA 4RCNA 2A81A 3P5MA 2F9IA 3MYBA 2UZFA 4IZCA 1XNVA 3ST9A 3U9SB 3HLN1 3QXZA 2X58A 2VREA 4HNKA 3NJBA 4QIIA 1X0UA 3IB9A 4U19A 4KD6A 3MT6A 3RSTA 3HE2A 2FZSA 2J5IB 3T8BA 1YG8A 2ZQRA 4HC8A 1XNWA 4ZDBA 2FBMA 4I42A 1K39A 4FN8A 3VIVA 1W2XA 1WDLA 5G1RA 3R0OA 4ZDEA 4ASIA 3SWXA 5KDRB 2VSSF 5E0NX 3P85A 1PIXA 4IZDA 3HINA 4ELXA 4ZDDA 3T88A 4YLHA 4B3HA 2BZRA 3TT7A 3R9QA 5DU4A 1N6DA 3H02A 4NEKA 4Q1IA 2HW5A 1ON9A 3I47A 4U0GA 2F9IB 3TRRA 1RJNA 1N6EA 4JFCA 4I4ZA 4U0GH 1DCIA 4B3IA 3R9TA 3OMEA 5JBXA 3T89A 3Q7HA 3H0UA 3IBBA 3PEAA 4FNBA 3QK8A 4GM2A 1YG6A 4FZWA 5DUFA 4WZ8B 4I52A 1EF9A 2PBPA 4K2NA 4JYLA 2Q2XA 3PZKA 3RSIA 3M6NA 3BPPA 2VSUC 1HNUA 2F9YA 4JVTA 3OC7A 5INFA 4B3JA 5INIA 3JU1A 2J5SA 4JOTA 2QQ3A 4MXIA 2EJ5A 2Q34A 3QKAA 4U1AA 1TG6A 2ZL4A 3DJAA 4FZWC 4ELSA 3U9TB 4ZDFA 4LK5A 5DZKA 4K29A 1SZOA 4EMLA 4JCQA 5E0SA 3PE8A 1UYTA 3TVWA 1OD4A 2D3TA 5E0SH 2F6IA 3R9SA 4FN7A 2ZL0A 3Q1TA 4KWBA 4NNQA 4WCZA 4L8KA 3QXIA 2F9YB 3QYRA 4FJWD 4Z0MA 4ELWA 1UYSA 5DUCA 2VSUF 1MJ3A 2WTBA 3KTJA 1O8UA 2VSUA 3DORA 3STAA 4JSBA 1WDMA 1FC7A 4JCTA 4JYJA 3ZWAA 1Q51A 2CE3A 3IAVA 3K50A 3FF6A 2C8TA 3FDUA 5CTCA 1XX4A 4KPKA 3TLFA 3KTGA 3N6RB 4JWVA 2PPYA 3GMAA 3R6HA 1FCFA 4OG1A 1ON3A 5DTPA 4MOUA 1VRGA 4L6WA 1PJHA 3P2LA 1UYRA 4OLQA 1EF8A 3OT6A 3V5EA 3HRXA 2VSSE 3H0SA 2ZL2A 1OD2A 3GF7A 2X24A 4JCRA 4G2RA 4Q0GA 4U0HA 3NJDA 2ZQQA 3ZW8A 3KTIA 1JXZA 4IZBA 3QREA 5DU6A 1NZYA 2VX2A 3GLMA 3ISAA 5IKLB 3TDCA 4JJTA 5C9GA 3T8AA 3HP0A 1J7XA 5FUSA 4RYFA 4ZDCA 4QFEA 2J5II 1EY3A 3M6MA 5G1QA 3KQFA 1WDKA 3ZW9A 4GHNA 3U9RB 5DZKH 4RYFH 4ZU2A 4QIJA 3KTHA 3LAOA 2A7SA 4MI2A 1XNYA 2J5GA 3LKEA 3GKBA 4DI1A 1RJMA 3QWDA 3TV5A 3G64A 2W3PA 5C90A 1N6FA 2J5GD 1UIYA 4FB8A 1FC6A 3ZWBA 2VSSA 2IEXA 4F47A 1DUBA 5JBWA 5KJPA 1NZYB 3RRVA 3MFMA 1UYVA 4FNDA 2DEOA 3BF0A 1HZDA 1Y7OA 1Q52A 5INGA 1K32A 3Q0GA 5DL1A 3TZ3A 1FC9A 2NP9A 5G1SA 3SLLA 3TT6A 2J5IA 2Q35A 3TVUA 2FW2A 5FIFA 4JCSA 5DKPA 2CBYA 5CTBA 3WG5A 3PGQA 3V5IA 4EMMA 4EMPA 1XO6A 5MGBA 3MOYA 3KTKA
chains in the Genus database with same CATH superfamily
3BEZA 2PG8A 1UX4A 3L8JA 5KDRA 3ZWCA 2A7KA 2F6QA 4K3WA 2VSUE 3QMJA 1WZ8A 3Q0JA 3T3WA 5DTWA 3W8HB 3GF3A 3L3SA 3K8XA 4U18A 1HNOA 1SG4A 4WYOB 2GTRA 4OMRA 5DU8A 3H0QA 1TYFA 2DUBA 4KNPA 2ZL3A 3H81A 3H0JA 4RCNA 2A81A 3P5MA 2F9IA 3MYBA 2UZFA 4IZCA 1XNVA 3ST9A 3U9SB 3HLN1 3QXZA 2X58A 2VREA 4HNKA 3NJBA 4QIIA 1X0UA 3IB9A 4U19A 4KD6A 3MT6A 3RSTA 3HE2A 2FZSA 2J5IB 3T8BA 1YG8A 2ZQRA 4HC8A 1XNWA 4ZDBA 2FBMA 4I42A 1K39A 4FN8A 3VIVA 1W2XA 1WDLA 5G1RA 3BPTA 3ADDA 3R0OA 4ZDEA 4ASIA 3SWXA 5KDRB 2VSSF 5E0NX 3P85A 1PIXA 4IZDA 3HINA 4ELXA 4ZDDA 3T88A 4YLHA 4B3HA 1UX5A 2BZRA 3TT7A 3R9QA 5DU4A 1N6DA 3H02A 4NEKA 4Q1IA 2HW5A 1ON9A 3I47A 4U0GA 2F9IB 3TRRA 1RJNA 4NARA 1N6EA 3AM1A 4JFCA 4I4ZA 4U0GH 1DCIA 4B3IA 3R9TA 3OMEA 5JBXA 5HUQA 3T89A 3Q7HA 3H0UA 3IBBA 3PEAA 4FNBA 3QK8A 3W8IB 4GM2A 1YG6A 4FZWA 5DUFA 4WZ8B 4I52A 1EF9A 2PBPA 4K2NA 4JYLA 2Q2XA 3PZKA 1Y64B 3RSIA 3M6NA 3BPPA 2VSUC 1HNUA 2F9YA 3RQFA 4JVTA 3OC7A 5INFA 4B3JA 5INIA 3JU1A 2J5SA 4JOTA 2QQ3A 4MXIA 2EJ5A 2Q34A 3QKAA 4U1AA 1TG6A 2ZL4A 3DJAA 4FZWC 4ELSA 3U9TB 4ZDFA 4LK5A 5DZKA 4K29A 1SZOA 4EMLA 4JCQA 5E0SA 3ADBA 3PE8A 3A4LA 1UYTA 3TVWA 1OD4A 2D3TA 5E0SH 4HDTA 3A4MA 3AJMA 2F6IA 3R9SA 4FN7A 2ZL0A 3Q1TA 4KWBA 4NNQA 4WCZA 4L8KA 3IRBA 3QXIA 2F9YB 3QYRA 4FJWD 4Z0MA 4ELWA 1UYSA 5DUCA 2VSUF 1MJ3A 2WTBA 3KTJA 1O8UA 2VSUA 3DORA 3STAA 4JSBA 1WDMA 1FC7A 3O4XE 4JCTA 4JYJA 3ADCA 3ZWAA 1Q51A 2CE3A 3IAVA 3K50A 3FF6A 2C8TA 3FDUA 5CTCA 1XX4A 4KPKA 3TLFA 3KTGA 3N6RB 4JWVA 2PPYA 3GMAA 3R6HA 1FCFA 3RQEA 4OG1A 1ON3A 5DTPA 4MOUA 1VRGA 4L6WA 1PJHA 3P2LA 1UYRA 4OLQA 1EF8A 3OT6A 3V5EA 3HRXA 2VSSE 3H0SA 2ZL2A 1OD2A 3GF7A 2X24A 4JCRA 4G2RA 4Q0GA 4U0HA 3NJDA 2ZQQA 3ZW8A 3KTIA 1JXZA 4IZBA 3QREA 5DU6A 3RQGA 1NZYA 2VX2A 3GLMA 3ISAA 2P63A 5IKLB 3TDCA 4JJTA 5C9GA 3T8AA 3HP0A 1J7XA 5FUSA 4RYFA 4ZDCA 4QFEA 2J5II 1EY3A 3M6MA 5G1QA 3KQFA 3A4NA 1WDKA 3ZW9A 4GHNA 3U9RB 5DZKH 4RYFH 4ZU2A 4QIJA 3KTHA 3LAOA 2A7SA 4MI2A 1XNYA 2J5GA 3LKEA 3GKBA 4DI1A 1RJMA 3QWDA 3TV5A 3G64A 4J2UA 2W3PA 5C90A 1N6FA 2J5GD 1UIYA 4FB8A 1FC6A 3ZWBA 2VSSA 2IEXA 4F47A 1DUBA 5JBWA 5KJPA 1NZYB 3RRVA 3MFMA 1UYVA 4FNDA 2DEOA 3BF0A 1HZDA 1Y7OA 1Q52A 5INGA 3L8IA 1K32A 3Q0GA 2YJGA 5DL1A 3TZ3A 1FC9A 2NP9A 5G1SA 3SLLA 3TT6A 2J5IA 2Q35A 3TVUA 2FW2A 5FIFA 4JCSA 5DKPA 2CBYA 5CTBA 3WG5A 4GEHB 3PGQA 3V5IA 4EMMA 4EMPA 1XO6A 5MGBA 3MOYA 3KTKA
chains in the Genus database with same CATH topology
3BEZA 2PG8A 5KDRA 3ZWCA 2A7KA 2F6QA 4K3WA 2VSUE 3QMJA 1WZ8A 3Q0JA 3T3WA 5DTWA 3GF3A 3L3SA 3K8XA 4U18A 1HNOA 1SG4A 4WYOB 2GTRA 4OMRA 5DU8A 3H0QA 1TYFA 2DUBA 4KNPA 2ZL3A 3H81A 3H0JA 4RCNA 2A81A 3P5MA 2F9IA 3MYBA 2UZFA 4IZCA 1XNVA 3ST9A 3U9SB 3HLN1 3QXZA 2X58A 2VREA 4HNKA 3NJBA 4QIIA 1X0UA 3IB9A 4U19A 4KD6A 3MT6A 3RSTA 3HE2A 2FZSA 2J5IB 3T8BA 1YG8A 2ZQRA 4HC8A 1XNWA 4ZDBA 2FBMA 4I42A 1K39A 4FN8A 3VIVA 1W2XA 1WDLA 5G1RA 3BPTA 3R0OA 4ZDEA 4ASIA 3SWXA 5KDRB 2VSSF 5E0NX 3P85A 1PIXA 4IZDA 3HINA 4ELXA 4ZDDA 3T88A 4YLHA 4B3HA 2BZRA 3TT7A 3R9QA 5DU4A 1N6DA 3H02A 4NEKA 4Q1IA 2HW5A 1ON9A 3I47A 4U0GA 2F9IB 3TRRA 1RJNA 4NARA 1N6EA 4JFCA 4I4ZA 4U0GH 1DCIA 4B3IA 3R9TA 3OMEA 5JBXA 5HUQA 3T89A 3Q7HA 3H0UA 3IBBA 3PEAA 4FNBA 3QK8A 4GM2A 1YG6A 4FZWA 5DUFA 4WZ8B 4I52A 1EF9A 2PBPA 4K2NA 4JYLA 2Q2XA 3PZKA 3RSIA 3M6NA 3BPPA 2VSUC 1HNUA 2F9YA 4JVTA 3OC7A 5INFA 4B3JA 5INIA 3JU1A 2J5SA 4JOTA 2QQ3A 4MXIA 2EJ5A 2Q34A 3QKAA 4U1AA 1TG6A 2ZL4A 3DJAA 4FZWC 4ELSA 3U9TB 4ZDFA 4LK5A 5DZKA 4K29A 1SZOA 4EMLA 4JCQA 5E0SA 3PE8A 1UYTA 3TVWA 1OD4A 2D3TA 5E0SH 4HDTA 2F6IA 3R9SA 4FN7A 2ZL0A 3Q1TA 4KWBA 4NNQA 4WCZA 4L8KA 3QXIA 2F9YB 3QYRA 4FJWD 4Z0MA 4ELWA 1UYSA 5DUCA 2VSUF 1MJ3A 2WTBA 3KTJA 1O8UA 2VSUA 3DORA 3STAA 4JSBA 1WDMA 1FC7A 4JCTA 4JYJA 3ZWAA 1Q51A 2CE3A 3IAVA 3K50A 3FF6A 2C8TA 3FDUA 5CTCA 1XX4A 4KPKA 3TLFA 3KTGA 3N6RB 4JWVA 2PPYA 3GMAA 3R6HA 1FCFA 4OG1A 1ON3A 5DTPA 4MOUA 1VRGA 4L6WA 1PJHA 3P2LA 1UYRA 4OLQA 1EF8A 3OT6A 3V5EA 3HRXA 2VSSE 3H0SA 2ZL2A 1OD2A 3GF7A 2X24A 4JCRA 4G2RA 4Q0GA 4U0HA 3NJDA 2ZQQA 3ZW8A 3KTIA 1JXZA 4IZBA 3QREA 5DU6A 1NZYA 2VX2A 3GLMA 3ISAA 5IKLB 3TDCA 4JJTA 5C9GA 3T8AA 3HP0A 1J7XA 5FUSA 4RYFA 4ZDCA 4QFEA 2J5II 1EY3A 3M6MA 5G1QA 3KQFA 1WDKA 3ZW9A 4GHNA 3U9RB 5DZKH 4RYFH 4ZU2A 4QIJA 3KTHA 3LAOA 2A7SA 4MI2A 1XNYA 2J5GA 3LKEA 3GKBA 4DI1A 1RJMA 3QWDA 3TV5A 3G64A 4J2UA 2W3PA 5C90A 1N6FA 2J5GD 1UIYA 4FB8A 1FC6A 3ZWBA 2VSSA 2IEXA 4F47A 1DUBA 5JBWA 5KJPA 1NZYB 3RRVA 3MFMA 1UYVA 4FNDA 2DEOA 3BF0A 1HZDA 1Y7OA 1Q52A 5INGA 1K32A 3Q0GA 2YJGA 5DL1A 3TZ3A 1FC9A 2NP9A 5G1SA 3SLLA 3TT6A 2J5IA 2Q35A 3TVUA 2FW2A 5FIFA 4JCSA 5DKPA 2CBYA 5CTBA 3WG5A 3PGQA 3V5IA 4EMMA 4EMPA 1XO6A 5MGBA 3MOYA 3KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEZ A;  2PG8 A;  5KDR A;  3ZWC A;  2A7K A;  2F6Q A;  4K3W A;  2VSU E;  3QMJ A;  1WZ8 A;  3Q0J A;  3T3W A;  5DTW A;  3GF3 A;  3L3S A;  3K8X A;  4U18 A;  1HNO A;  1SG4 A;  4WYO B;  2GTR A;  4OMR A;  5DU8 A;  3H0Q A;  1TYF A;  2DUB A;  4KNP A;  2ZL3 A;  3H81 A;  3H0J A;  4RCN A;  2A81 A;  3P5M A;  2F9I A;  3MYB A;  2UZF A;  4IZC A;  1XNV A;  3ST9 A;  3U9S B;  3HLN 1;  3QXZ A;  2X58 A;  2VRE A;  4HNK A;  3NJB A;  4QII A;  1X0U A;  3IB9 A;  4U19 A;  4KD6 A;  3MT6 A;  3RST A;  3HE2 A;  2FZS A;  2J5I B;  3T8B A;  1YG8 A;  2ZQR A;  4HC8 A;  1XNW A;  4ZDB A;  2FBM A;  4I42 A;  1K39 A;  4FN8 A;  3VIV A;  1W2X A;  1WDL A;  5G1R A;  3R0O A;  4ZDE A;  4ASI A;  3SWX A;  5KDR B;  2VSS F;  5E0N X;  3P85 A;  1PIX A;  4IZD A;  3HIN A;  4ELX A;  4ZDD A;  3T88 A;  4YLH A;  4B3H A;  2BZR A;  3TT7 A;  3R9Q A;  5DU4 A;  1N6D A;  3H02 A;  4NEK A;  4Q1I A;  2HW5 A;  1ON9 A;  3I47 A;  4U0G A;  2F9I B;  3TRR A;  1RJN A;  1N6E A;  4JFC A;  4I4Z A;  4U0G H;  1DCI A;  4B3I A;  3R9T A;  3OME A;  5JBX A;  3T89 A;  3Q7H A;  3H0U A;  3IBB A;  3PEA A;  4FNB A;  3QK8 A;  4GM2 A;  1YG6 A;  4FZW A;  5DUF A;  4WZ8 B;  4I52 A;  1EF9 A;  2PBP A;  4K2N A;  4JYL A;  2Q2X A;  3PZK A;  3RSI A;  3M6N A;  3BPP A;  2VSU C;  1HNU A;  2F9Y A;  4JVT A;  3OC7 A;  5INF A;  4B3J A;  5INI A;  3JU1 A;  2J5S A;  4JOT A;  2QQ3 A;  4MXI A;  2EJ5 A;  2Q34 A;  3QKA A;  4U1A A;  1TG6 A;  2ZL4 A;  3DJA A;  4FZW C;  4ELS A;  3U9T B;  4ZDF A;  4LK5 A;  5DZK A;  4K29 A;  1SZO A;  4EML A;  4JCQ A;  5E0S A;  3PE8 A;  1UYT A;  3TVW A;  1OD4 A;  2D3T A;  5E0S H;  2F6I A;  3R9S A;  4FN7 A;  2ZL0 A;  3Q1T A;  4KWB A;  4NNQ A;  4WCZ A;  4L8K A;  3QXI A;  2F9Y B;  3QYR A;  4FJW D;  4Z0M A;  4ELW A;  1UYS A;  5DUC A;  2VSU F;  1MJ3 A;  2WTB A;  3KTJ A;  1O8U A;  2VSU A;  3DOR A;  3STA A;  4JSB A;  1WDM A;  1FC7 A;  4JCT A;  4JYJ A;  3ZWA A;  1Q51 A;  2CE3 A;  3IAV A;  3K50 A;  3FF6 A;  2C8T A;  3FDU A;  5CTC A;  1XX4 A;  4KPK A;  3TLF A;  3KTG A;  3N6R B;  4JWV A;  2PPY A;  3GMA A;  3R6H A;  1FCF A;  4OG1 A;  1ON3 A;  5DTP A;  4MOU A;  1VRG A;  4L6W A;  1PJH A;  3P2L A;  1UYR A;  4OLQ A;  1EF8 A;  3OT6 A;  3V5E A;  3HRX A;  2VSS E;  3H0S A;  2ZL2 A;  1OD2 A;  3GF7 A;  2X24 A;  4JCR A;  4G2R A;  4Q0G A;  4U0H A;  3NJD A;  2ZQQ A;  3ZW8 A;  3KTI A;  1JXZ A;  4IZB A;  3QRE A;  5DU6 A;  1NZY A;  2VX2 A;  3GLM A;  3ISA A;  5IKL B;  3TDC A;  4JJT A;  5C9G A;  3T8A A;  3HP0 A;  1J7X A;  5FUS A;  4RYF A;  4ZDC A;  4QFE A;  2J5I I;  1EY3 A;  3M6M A;  5G1Q A;  3KQF A;  1WDK A;  3ZW9 A;  4GHN A;  3U9R B;  5DZK H;  4RYF H;  4ZU2 A;  4QIJ A;  3KTH A;  3LAO A;  2A7S A;  4MI2 A;  1XNY A;  2J5G A;  3LKE A;  3GKB A;  4DI1 A;  1RJM A;  3QWD A;  3TV5 A;  3G64 A;  2W3P A;  5C90 A;  1N6F A;  2J5G D;  1UIY A;  4FB8 A;  1FC6 A;  3ZWB A;  2VSS A;  2IEX A;  4F47 A;  1DUB A;  5JBW A;  5KJP A;  1NZY B;  3RRV A;  3MFM A;  1UYV A;  4FND A;  2DEO A;  3BF0 A;  1HZD A;  1Y7O A;  1Q52 A;  5ING A;  1K32 A;  3Q0G A;  5DL1 A;  3TZ3 A;  1FC9 A;  2NP9 A;  5G1S A;  3SLL A;  3TT6 A;  2J5I A;  2Q35 A;  3TVU A;  2FW2 A;  5FIF A;  4JCS A;  5DKP A;  2CBY A;  5CTB A;  3WG5 A;  3PGQ A;  3V5I A;  4EMM A;  4EMP A;  1XO6 A;  5MGB A;  3MOY A;  3KTK A; 
#chains in the Genus database with same CATH topology
 3BEZ A;  2PG8 A;  1UX4 A;  3L8J A;  5KDR A;  3ZWC A;  2A7K A;  2F6Q A;  4K3W A;  2VSU E;  3QMJ A;  1WZ8 A;  3Q0J A;  3T3W A;  5DTW A;  3W8H B;  3GF3 A;  3L3S A;  3K8X A;  4U18 A;  1HNO A;  1SG4 A;  4WYO B;  2GTR A;  4OMR A;  5DU8 A;  3H0Q A;  1TYF A;  2DUB A;  4KNP A;  2ZL3 A;  3H81 A;  3H0J A;  4RCN A;  2A81 A;  3P5M A;  2F9I A;  3MYB A;  2UZF A;  4IZC A;  1XNV A;  3ST9 A;  3U9S B;  3HLN 1;  3QXZ A;  2X58 A;  2VRE A;  4HNK A;  3NJB A;  4QII A;  1X0U A;  3IB9 A;  4U19 A;  4KD6 A;  3MT6 A;  3RST A;  3HE2 A;  2FZS A;  2J5I B;  3T8B A;  1YG8 A;  2ZQR A;  4HC8 A;  1XNW A;  4ZDB A;  2FBM A;  4I42 A;  1K39 A;  4FN8 A;  3VIV A;  1W2X A;  1WDL A;  5G1R A;  3BPT A;  3ADD A;  3R0O A;  4ZDE A;  4ASI A;  3SWX A;  5KDR B;  2VSS F;  5E0N X;  3P85 A;  1PIX A;  4IZD A;  3HIN A;  4ELX A;  4ZDD A;  3T88 A;  4YLH A;  4B3H A;  1UX5 A;  2BZR A;  3TT7 A;  3R9Q A;  5DU4 A;  1N6D A;  3H02 A;  4NEK A;  4Q1I A;  2HW5 A;  1ON9 A;  3I47 A;  4U0G A;  2F9I B;  3TRR A;  1RJN A;  4NAR A;  1N6E A;  3AM1 A;  4JFC A;  4I4Z A;  4U0G H;  1DCI A;  4B3I A;  3R9T A;  3OME A;  5JBX A;  5HUQ A;  3T89 A;  3Q7H A;  3H0U A;  3IBB A;  3PEA A;  4FNB A;  3QK8 A;  3W8I B;  4GM2 A;  1YG6 A;  4FZW A;  5DUF A;  4WZ8 B;  4I52 A;  1EF9 A;  2PBP A;  4K2N A;  4JYL A;  2Q2X A;  3PZK A;  1Y64 B;  3RSI A;  3M6N A;  3BPP A;  2VSU C;  1HNU A;  2F9Y A;  3RQF A;  4JVT A;  3OC7 A;  5INF A;  4B3J A;  5INI A;  3JU1 A;  2J5S A;  4JOT A;  2QQ3 A;  4MXI A;  2EJ5 A;  2Q34 A;  3QKA A;  4U1A A;  1TG6 A;  2ZL4 A;  3DJA A;  4FZW C;  4ELS A;  3U9T B;  4ZDF A;  4LK5 A;  5DZK A;  4K29 A;  1SZO A;  4EML A;  4JCQ A;  5E0S A;  3ADB A;  3PE8 A;  3A4L A;  1UYT A;  3TVW A;  1OD4 A;  2D3T A;  5E0S H;  4HDT A;  3A4M A;  3AJM A;  2F6I A;  3R9S A;  4FN7 A;  2ZL0 A;  3Q1T A;  4KWB A;  4NNQ A;  4WCZ A;  4L8K A;  3IRB A;  3QXI A;  2F9Y B;  3QYR A;  4FJW D;  4Z0M A;  4ELW A;  1UYS A;  5DUC A;  2VSU F;  1MJ3 A;  2WTB A;  3KTJ A;  1O8U A;  2VSU A;  3DOR A;  3STA A;  4JSB A;  1WDM A;  1FC7 A;  3O4X E;  4JCT A;  4JYJ A;  3ADC A;  3ZWA A;  1Q51 A;  2CE3 A;  3IAV A;  3K50 A;  3FF6 A;  2C8T A;  3FDU A;  5CTC A;  1XX4 A;  4KPK A;  3TLF A;  3KTG A;  3N6R B;  4JWV A;  2PPY A;  3GMA A;  3R6H A;  1FCF A;  3RQE A;  4OG1 A;  1ON3 A;  5DTP A;  4MOU A;  1VRG A;  4L6W A;  1PJH A;  3P2L A;  1UYR A;  4OLQ A;  1EF8 A;  3OT6 A;  3V5E A;  3HRX A;  2VSS E;  3H0S A;  2ZL2 A;  1OD2 A;  3GF7 A;  2X24 A;  4JCR A;  4G2R A;  4Q0G A;  4U0H A;  3NJD A;  2ZQQ A;  3ZW8 A;  3KTI A;  1JXZ A;  4IZB A;  3QRE A;  5DU6 A;  3RQG A;  1NZY A;  2VX2 A;  3GLM A;  3ISA A;  2P63 A;  5IKL B;  3TDC A;  4JJT A;  5C9G A;  3T8A A;  3HP0 A;  1J7X A;  5FUS A;  4RYF A;  4ZDC A;  4QFE A;  2J5I I;  1EY3 A;  3M6M A;  5G1Q A;  3KQF A;  3A4N A;  1WDK A;  3ZW9 A;  4GHN A;  3U9R B;  5DZK H;  4RYF H;  4ZU2 A;  4QIJ A;  3KTH A;  3LAO A;  2A7S A;  4MI2 A;  1XNY A;  2J5G A;  3LKE A;  3GKB A;  4DI1 A;  1RJM A;  3QWD A;  3TV5 A;  3G64 A;  4J2U A;  2W3P A;  5C90 A;  1N6F A;  2J5G D;  1UIY A;  4FB8 A;  1FC6 A;  3ZWB A;  2VSS A;  2IEX A;  4F47 A;  1DUB A;  5JBW A;  5KJP A;  1NZY B;  3RRV A;  3MFM A;  1UYV A;  4FND A;  2DEO A;  3BF0 A;  1HZD A;  1Y7O A;  1Q52 A;  5ING A;  3L8I A;  1K32 A;  3Q0G A;  2YJG A;  5DL1 A;  3TZ3 A;  1FC9 A;  2NP9 A;  5G1S A;  3SLL A;  3TT6 A;  2J5I A;  2Q35 A;  3TVU A;  2FW2 A;  5FIF A;  4JCS A;  5DKP A;  2CBY A;  5CTB A;  3WG5 A;  4GEH B;  3PGQ A;  3V5I A;  4EMM A;  4EMP A;  1XO6 A;  5MGB A;  3MOY A;  3KTK A; 
#chains in the Genus database with same CATH homology
 3BEZ A;  2PG8 A;  5KDR A;  3ZWC A;  2A7K A;  2F6Q A;  4K3W A;  2VSU E;  3QMJ A;  1WZ8 A;  3Q0J A;  3T3W A;  5DTW A;  3GF3 A;  3L3S A;  3K8X A;  4U18 A;  1HNO A;  1SG4 A;  4WYO B;  2GTR A;  4OMR A;  5DU8 A;  3H0Q A;  1TYF A;  2DUB A;  4KNP A;  2ZL3 A;  3H81 A;  3H0J A;  4RCN A;  2A81 A;  3P5M A;  2F9I A;  3MYB A;  2UZF A;  4IZC A;  1XNV A;  3ST9 A;  3U9S B;  3HLN 1;  3QXZ A;  2X58 A;  2VRE A;  4HNK A;  3NJB A;  4QII A;  1X0U A;  3IB9 A;  4U19 A;  4KD6 A;  3MT6 A;  3RST A;  3HE2 A;  2FZS A;  2J5I B;  3T8B A;  1YG8 A;  2ZQR A;  4HC8 A;  1XNW A;  4ZDB A;  2FBM A;  4I42 A;  1K39 A;  4FN8 A;  3VIV A;  1W2X A;  1WDL A;  5G1R A;  3BPT A;  3R0O A;  4ZDE A;  4ASI A;  3SWX A;  5KDR B;  2VSS F;  5E0N X;  3P85 A;  1PIX A;  4IZD A;  3HIN A;  4ELX A;  4ZDD A;  3T88 A;  4YLH A;  4B3H A;  2BZR A;  3TT7 A;  3R9Q A;  5DU4 A;  1N6D A;  3H02 A;  4NEK A;  4Q1I A;  2HW5 A;  1ON9 A;  3I47 A;  4U0G A;  2F9I B;  3TRR A;  1RJN A;  4NAR A;  1N6E A;  4JFC A;  4I4Z A;  4U0G H;  1DCI A;  4B3I A;  3R9T A;  3OME A;  5JBX A;  5HUQ A;  3T89 A;  3Q7H A;  3H0U A;  3IBB A;  3PEA A;  4FNB A;  3QK8 A;  4GM2 A;  1YG6 A;  4FZW A;  5DUF A;  4WZ8 B;  4I52 A;  1EF9 A;  2PBP A;  4K2N A;  4JYL A;  2Q2X A;  3PZK A;  3RSI A;  3M6N A;  3BPP A;  2VSU C;  1HNU A;  2F9Y A;  4JVT A;  3OC7 A;  5INF A;  4B3J A;  5INI A;  3JU1 A;  2J5S A;  4JOT A;  2QQ3 A;  4MXI A;  2EJ5 A;  2Q34 A;  3QKA A;  4U1A A;  1TG6 A;  2ZL4 A;  3DJA A;  4FZW C;  4ELS A;  3U9T B;  4ZDF A;  4LK5 A;  5DZK A;  4K29 A;  1SZO A;  4EML A;  4JCQ A;  5E0S A;  3PE8 A;  1UYT A;  3TVW A;  1OD4 A;  2D3T A;  5E0S H;  4HDT A;  2F6I A;  3R9S A;  4FN7 A;  2ZL0 A;  3Q1T A;  4KWB A;  4NNQ A;  4WCZ A;  4L8K A;  3QXI A;  2F9Y B;  3QYR A;  4FJW D;  4Z0M A;  4ELW A;  1UYS A;  5DUC A;  2VSU F;  1MJ3 A;  2WTB A;  3KTJ A;  1O8U A;  2VSU A;  3DOR A;  3STA A;  4JSB A;  1WDM A;  1FC7 A;  4JCT A;  4JYJ A;  3ZWA A;  1Q51 A;  2CE3 A;  3IAV A;  3K50 A;  3FF6 A;  2C8T A;  3FDU A;  5CTC A;  1XX4 A;  4KPK A;  3TLF A;  3KTG A;  3N6R B;  4JWV A;  2PPY A;  3GMA A;  3R6H A;  1FCF A;  4OG1 A;  1ON3 A;  5DTP A;  4MOU A;  1VRG A;  4L6W A;  1PJH A;  3P2L A;  1UYR A;  4OLQ A;  1EF8 A;  3OT6 A;  3V5E A;  3HRX A;  2VSS E;  3H0S A;  2ZL2 A;  1OD2 A;  3GF7 A;  2X24 A;  4JCR A;  4G2R A;  4Q0G A;  4U0H A;  3NJD A;  2ZQQ A;  3ZW8 A;  3KTI A;  1JXZ A;  4IZB A;  3QRE A;  5DU6 A;  1NZY A;  2VX2 A;  3GLM A;  3ISA A;  5IKL B;  3TDC A;  4JJT A;  5C9G A;  3T8A A;  3HP0 A;  1J7X A;  5FUS A;  4RYF A;  4ZDC A;  4QFE A;  2J5I I;  1EY3 A;  3M6M A;  5G1Q A;  3KQF A;  1WDK A;  3ZW9 A;  4GHN A;  3U9R B;  5DZK H;  4RYF H;  4ZU2 A;  4QIJ A;  3KTH A;  3LAO A;  2A7S A;  4MI2 A;  1XNY A;  2J5G A;  3LKE A;  3GKB A;  4DI1 A;  1RJM A;  3QWD A;  3TV5 A;  3G64 A;  4J2U A;  2W3P A;  5C90 A;  1N6F A;  2J5G D;  1UIY A;  4FB8 A;  1FC6 A;  3ZWB A;  2VSS A;  2IEX A;  4F47 A;  1DUB A;  5JBW A;  5KJP A;  1NZY B;  3RRV A;  3MFM A;  1UYV A;  4FND A;  2DEO A;  3BF0 A;  1HZD A;  1Y7O A;  1Q52 A;  5ING A;  1K32 A;  3Q0G A;  2YJG A;  5DL1 A;  3TZ3 A;  1FC9 A;  2NP9 A;  5G1S A;  3SLL A;  3TT6 A;  2J5I A;  2Q35 A;  3TVU A;  2FW2 A;  5FIF A;  4JCS A;  5DKP A;  2CBY A;  5CTB A;  3WG5 A;  3PGQ A;  3V5I A;  4EMM A;  4EMP A;  1XO6 A;  5MGB A;  3MOY A;  3KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...