2PBXA

Vibrio cholerae hapr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
IEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQYSNFLTDHIDLDLDVKTNLQTLCKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERGELCEKHDVDNMASLFHGIFYSIFLQVNRLGEQEAVYKLADSYLNMLCIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin/protease regulatory protein
publication title Crystal structure of the Vibrio cholerae Quorum-Sensing Regulatory Protein HapR
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 73
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2pbxA00
4D7NA 3G7RA 4W1UA 2O7TA 3CJDA 2IBDA 5H9TA 3G1OA 1BJZA 3F0CA 3MVPA 3O8HA 1T33A 4GFLA 3T6NA 4AC6A 2XDNA 2YVEA 2FBQA 5K7FA 3B81A 2QIBA 2UXUA 3COLA 2WV1A 3NI7A 5EZGA 2XGCA 3ZQFA 2RHAA 3LOCA 4XK4A 1RKWA 4CGRA 3BJBA 3HTJA 2FQ4A 3EUPA 3CRJA 4W97A 2NS7A 3HTAA 2ZOZA 3KZ9A 5EFYA 4V2FA 1U9OA 3HGGA 5F0CA 4D5FA 5J1RA 4ABZA 2Q24A 3AQSA 5K58A 4V2GA 2IAIA 1UI6A 2OERA 4AC0A 2QCOA 4M3EA 2UXIA 3BT9A 3LSJA 2X6OA 3BR6A 3ON2A 5IPAA 2XPUA 2O7OA 5EYRA 2XRLA 4JKZA 2QWTA 4M3BA 5GPCA 3B6CA 3VOXA 4UDSA 1Z77A 5FKLA 5AQCA 1RKTA 3TP3A 4GFKA 3NNRA 4ICHA 3S5RA 1JT6A 2ZCMA 3G56A 4B1RA 4D7MA 2QOPA 2XPWA 2UXOA 3ZQHA 3LJLA 2RASA 3VW0A 5D19A 3NXCA 2HXOA 3QQAA 2ZOYA 3BR5A 3Q0UA 3EGQA 2QTQA 4MK6A 3VVYA 2FJ1A 3PASA 1JT0A 4AF5A 2Y30A 5HBUA 3O60A 3FIWA 3PPBA 3HIMA 5FKKA 1JTYA 3HTIA 3NPIA 4G12A 5F0FA 2ID6A 3KKCA 3IUVA 3LWJA 2YVHA 2FD5A 1JUMA 5F27A 2G3BA 1QVTA 2TCTA 1RPWA 1T56A 3PM1A 3GEUA 5IOZA 3LSPA 2IU5A 3Q0VA 3Q0WA 4M3FA 4GCTA 4NN1A 5D18A 3KNWA 5FKMA 5CW8A 3B6AA 3QBMA 1Z0XA 4AUXA 2NP5A 3HGYA 5FKOA 5IOYA 2DG7A 3ANGA 5C4YA 2HYTA 3RH2A 2G0EA 3VOKA 5DAJA 4X1EA 4L62A 3LHQA 5K7ZA 2Y31A 3V78A 4JYKA 5F0HA 2W53A 2OF7A 4GCKA 3BR0A 1SGMA 2X9DA 3VVXA 2GBYA 4D5CA 3V6GA 3E7QA 5GP9A 5EZHA 1JUSA 5HSZA 2IEKA 3CWRA 2GENA 2HXIA 5CXGA 2F07A 3DEWA 3VVZA 2VKEA 3F1BA 3SDGA 1ZK8A 2GFNA 3BTCA 2UXPA 1U9NA 2DG8A 4I6ZA 3P9TA 4B3AA 2ZCNA 3BHQA 3CCYA 5F04A 1QVUA 2ZCXA 3FK7A 4PXIA 3RD3A 5FHPA 3VUQA 4JNNA 1VI0A 3BR1A 3G1MA 2G7LA 2XB5A 1QPIA 3AQTA 3FRQA 3C2BA 4M3DA 5CXIA 3ZQIA 2NX4A 2OPTA 3HE0A 3ON4A 2HKUA 1UI5A 2FX0A 3KKDA 5GPAA 4KWAA 3BQYA 4ME9A 3BR3A 5F1JA 3VW1A 4JL3A 3C07A 3CDLA 2G7GA 5FKNA 2G7SA 3WHBA 3VP5A 2Y2ZA 4NELA 2HQ5A 5J1YA 2JK3A 3VIBA 4I76A 2ZB9A 3ZQLA 3Q3SA 2VPRA 3ANPA 5F08A 2GUHA 3IH3A 3BTLA 3G1LA 2PBXA 3GZIA 4GCLA 2D6YA 2PZ9A 2UXHA 1ZKGA 3HTHA 5FGLA 1JTXA 2WGBA 2XGEA 3BNIA 3NRGA 3JSJA 4DW6A 2QKOA 3QKXA 3BCGA 3SFIA 2DTZA 2V57A 3QPLA 5J1UA 3IH4A 2XPVA 2XGDA 4YZEA 2RAEA 3DPJA 5HAWA 2EH3A 2HYJA 3MNLA 2OI8A 2ID3A 4MO7A 2WUIA 5K7HA 3BRUA 4ACIA 2JJ7A 3VPRA 4MXMA 3VW2A 5IP6A 2NP3A 3BR2A 3BTJA 3DCFA 2REKA 2I10A 1ORKA 5D1RA 3LSRA 2NS8A 2TRTA 3ZQGA 2VKVA 5FMPA 1A6IA 3FK6A 3TP0A 5J3LA 3IH2A 3BQZA 3BTIA 4HKUA 3WHCA 1JUPA 3O8GA 4M3GA 3QPSA
chains in the Genus database with same CATH superfamily
4D7NA 3G7RA 4W1UA 2O7TA 3CJDA 2IBDA 5H9TA 3G1OA 1BJZA 3F0CA 3MVPA 3O8HA 1T33A 4GFLA 3T6NA 3KYLA 4AC6A 2XDNA 2YVEA 2FBQA 5K7FA 3B81A 2QIBA 2UXUA 2R7VA 3COLA 2WV1A 3NI7A 5EZGA 2XGCA 3ZQFA 2RHAA 2R7TA 3LOCA 4XK4A 1RKWA 4CGRA 3BJBA 3HTJA 2FQ4A 3EUPA 3CRJA 4W97A 2NS7A 3HTAA 2ZOZA 3KZ9A 5EFYA 4V2FA 1U9OA 3HGGA 5F0CA 3FHNA 4D5FA 5J1RA 4ABZA 2Q24A 3AQSA 5K58A 4OD4A 4V2GA 2IAIA 1UI6A 2OERA 4AC0A 2R7RA 2QCOA 4M3EA 2UXIA 3BT9A 3LSJA 2X6OA 2ZY9A 3BR6A 3ON2A 5IPAA 2XPUA 2O7OA 2B1EA 5EYRA 2XRLA 4JKZA 2QWTA 4M3BA 5GPCA 3B6CA 3VOXA 4UDSA 1Z77A 5FKLA 5AQCA 1RKTA 3TP3A 4GFKA 3NNRA 4ICHA 3S5RA 1JT6A 2ZCMA 3G56A 4B1RA 4D7MA 2QOPA 2XPWA 2UXOA 3ZQHA 3LJLA 2RASA 3VW0A 5D19A 3NXCA 2HXOA 3QQAA 2ZOYA 3BR5A 3Q0UA 3EGQA 2QTQA 4MK6A 3VVYA 2FJ1A 3PASA 1JT0A 4C2MA 2B3WA 4AF5A 2Y30A 5HBUA 3O60A 3FIWA 3PPBA 3HIMA 5FKKA 1JTYA 3HTIA 3NPIA 4G12A 5F0FA 2ID6A 3KKCA 2A2FX 3IUVA 3LWJA 2YVHA 2FD5A 1JUMA 5F27A 2G3BA 1QVTA 2TCTA 3VTIA 1RPWA 2R7OA 1T56A 3PM1A 3GEUA 5IOZA 3LSPA 2IU5A 3Q0VA 3Q0WA 4M3FA 4GCTA 3SWHA 4NN1A 5D18A 4IRVA 3KNWA 5FKMA 5CW8A 3B6AA 3QBMA 1Z0XA 4AUXA 2NP5A 3HGYA 5FKOA 5IOYA 3NS4A 2DG7A 3ANGA 5C4YA 2HYTA 3RH2A 2G0EA 3VOKA 5DAJA 4X1EA 4L62A 2R7UA 3LHQA 5K7ZA 2Y31A 3V78A 4JYKA 5F0HA 2W53A 2OF7A 4GCKA 3BR0A 1SGMA 2X9DA 3VVXA 2GBYA 4D5CA 3V6GA 3E7QA 3K8PC 5GP9A 5EZHA 1JUSA 5HSZA 2IEKA 3CWRA 2GENA 2HXIA 5CXGA 2F07A 3DEWA 3VVZA 2VKEA 3F1BA 3SDGA 1ZK8A 2GFNA 3BTCA 2UXPA 1U9NA 2DG8A 4I6ZA 3P9TA 4B3AA 2ZCNA 3BHQA 3CCYA 5F04A 1QVUA 2ZCXA 3FK7A 4PXIA 3RD3A 5FHPA 4JNNA 1VI0A 3VUQA 3BR1A 3G1MA 2G7LA 2XB5A 1QPIA 4OD5A 3AQTA 3FRQA 3C2BA 4DVYP 4M3DA 2YVXA 5CXIA 3ZQIA 2NX4A 2OPTA 3HE0A 3ON4A 2R7QA 2HKUA 1UI5A 2FX0A 3KKDA 5GPAA 4KWAA 2PFVA 3BQYA 4ME9A 3BR3A 5F1JA 3VW1A 4JL3A 3C07A 3CDLA 2G7GA 4U9NA 5FKNA 2G7SA 3WHBA 3VP5A 2Y2ZA 4NELA 2HQ5A 2FJI1 5J1YA 2JK3A 3VIBA 4I76A 2ZB9A 3ZQLA 3Q3SA 2VPRA 3ANPA 5F08A 3DU6A 2GUHA 3IH3A 3BTLA 3G1LA 2PBXA 3GZIA 4GCLA 2R7WA 2D6YA 2PZ9A 2R7SA 2UXHA 1ZKGA 3HTHA 5FGLA 1JTXA 2WGBA 2XGEA 3BNIA 3NRGA 3JSJA 4DW6A 2QKOA 3QKXA 3BCGA 3SFIA 2DTZA 2V57A 3QPLA 5J1UA 3IH4A 2XPVA 2XGDA 4YZEA 2RAEA 3DPJA 5HAWA 2EH3A 2HYJA 3MNLA 2OI8A 2ID3A 4MO7A 2WUIA 5K7HA 3BRUA 4ACIA 2JJ7A 3DU5A 3VPRA 4MXMA 3VW2A 5IP6A 2NP3A 3BR2A 3BTJA 3DCFA 4U9LA 2REKA 2I10A 1ORKA 5D1RA 3LSRA 2NS8A 2TRTA 3ZQGA 2VKVA 2R7XA 5FMPA 1A6IA 3FK6A 3TP0A 5J3LA 3IH2A 3BQZA 3BTIA 4HKUA 5CQGA 4WIBA 3WHCA 1JUPA 3O8GA 4M3GA 3QPSA
chains in the Genus database with same CATH topology
4D7NA 3G7RA 4W1UA 2O7TA 3CJDA 2IBDA 5H9TA 3G1OA 1BJZA 3F0CA 3MVPA 3O8HA 1T33A 4GFLA 3T6NA 4AC6A 2XDNA 2YVEA 2FBQA 5K7FA 3B81A 2QIBA 2UXUA 3COLA 2WV1A 3NI7A 5EZGA 2XGCA 3ZQFA 2RHAA 3LOCA 4XK4A 1RKWA 4CGRA 3BJBA 3HTJA 2FQ4A 3EUPA 3CRJA 4W97A 2NS7A 3HTAA 2ZOZA 3KZ9A 5EFYA 4V2FA 1U9OA 3HGGA 5F0CA 4D5FA 5J1RA 4ABZA 2Q24A 3AQSA 5K58A 4V2GA 2IAIA 1UI6A 2OERA 4AC0A 2QCOA 4M3EA 2UXIA 3BT9A 3LSJA 2X6OA 3BR6A 3ON2A 5IPAA 2XPUA 2O7OA 5EYRA 2XRLA 4JKZA 2QWTA 4M3BA 5GPCA 3B6CA 3VOXA 4UDSA 1Z77A 5FKLA 5AQCA 1RKTA 3TP3A 4GFKA 3NNRA 4ICHA 3S5RA 1JT6A 2ZCMA 3G56A 4B1RA 4D7MA 2QOPA 2XPWA 2UXOA 3ZQHA 3LJLA 2RASA 3VW0A 5D19A 3NXCA 2HXOA 3QQAA 2ZOYA 3BR5A 3Q0UA 3EGQA 2QTQA 4MK6A 3VVYA 2FJ1A 3PASA 1JT0A 4AF5A 2Y30A 5HBUA 3O60A 3FIWA 3PPBA 3HIMA 5FKKA 1JTYA 3HTIA 3NPIA 4G12A 5F0FA 2ID6A 3KKCA 3IUVA 3LWJA 2YVHA 2FD5A 1JUMA 5F27A 2G3BA 1QVTA 2TCTA 1RPWA 1T56A 3PM1A 3GEUA 5IOZA 3LSPA 2IU5A 3Q0VA 3Q0WA 4M3FA 4GCTA 4NN1A 5D18A 3KNWA 5FKMA 5CW8A 3B6AA 3QBMA 1Z0XA 4AUXA 2NP5A 3HGYA 5FKOA 5IOYA 2DG7A 3ANGA 5C4YA 2HYTA 3RH2A 2G0EA 3VOKA 5DAJA 4X1EA 4L62A 3LHQA 5K7ZA 2Y31A 3V78A 4JYKA 5F0HA 2W53A 2OF7A 4GCKA 3BR0A 1SGMA 2X9DA 3VVXA 2GBYA 4D5CA 3V6GA 3E7QA 5GP9A 5EZHA 1JUSA 5HSZA 2IEKA 3CWRA 2GENA 2HXIA 5CXGA 2F07A 3DEWA 3VVZA 2VKEA 3F1BA 3SDGA 1ZK8A 2GFNA 3BTCA 2UXPA 1U9NA 2DG8A 4I6ZA 3P9TA 4B3AA 2ZCNA 3BHQA 3CCYA 5F04A 1QVUA 2ZCXA 3FK7A 4PXIA 3RD3A 5FHPA 3VUQA 4JNNA 1VI0A 3BR1A 3G1MA 2G7LA 2XB5A 1QPIA 3AQTA 3FRQA 3C2BA 4M3DA 5CXIA 3ZQIA 2NX4A 2OPTA 3HE0A 3ON4A 2HKUA 1UI5A 2FX0A 3KKDA 5GPAA 4KWAA 3BQYA 4ME9A 3BR3A 5F1JA 3VW1A 4JL3A 3C07A 3CDLA 2G7GA 5FKNA 2G7SA 3WHBA 3VP5A 2Y2ZA 4NELA 2HQ5A 5J1YA 2JK3A 3VIBA 4I76A 2ZB9A 3ZQLA 3Q3SA 2VPRA 3ANPA 5F08A 2GUHA 3IH3A 3BTLA 3G1LA 2PBXA 3GZIA 4GCLA 2D6YA 2PZ9A 2UXHA 1ZKGA 3HTHA 5FGLA 1JTXA 2WGBA 2XGEA 3BNIA 3NRGA 3JSJA 4DW6A 2QKOA 3QKXA 3BCGA 3SFIA 2DTZA 2V57A 3QPLA 5J1UA 3IH4A 2XPVA 2XGDA 4YZEA 2RAEA 3DPJA 5HAWA 2EH3A 2HYJA 3MNLA 2OI8A 2ID3A 4MO7A 2WUIA 5K7HA 3BRUA 4ACIA 2JJ7A 3VPRA 4MXMA 3VW2A 5IP6A 2NP3A 3BR2A 3BTJA 3DCFA 2REKA 2I10A 1ORKA 5D1RA 3LSRA 2NS8A 2TRTA 3ZQGA 2VKVA 5FMPA 1A6IA 3FK6A 3TP0A 5J3LA 3IH2A 3BQZA 3BTIA 4HKUA 3WHCA 1JUPA 3O8GA 4M3GA 3QPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7N A;  3G7R A;  4W1U A;  2O7T A;  3CJD A;  2IBD A;  5H9T A;  3G1O A;  1BJZ A;  3F0C A;  3MVP A;  3O8H A;  1T33 A;  4GFL A;  3T6N A;  4AC6 A;  2XDN A;  2YVE A;  2FBQ A;  5K7F A;  3B81 A;  2QIB A;  2UXU A;  3COL A;  2WV1 A;  3NI7 A;  5EZG A;  2XGC A;  3ZQF A;  2RHA A;  3LOC A;  4XK4 A;  1RKW A;  4CGR A;  3BJB A;  3HTJ A;  2FQ4 A;  3EUP A;  3CRJ A;  4W97 A;  2NS7 A;  3HTA A;  2ZOZ A;  3KZ9 A;  5EFY A;  4V2F A;  1U9O A;  3HGG A;  5F0C A;  4D5F A;  5J1R A;  4ABZ A;  2Q24 A;  3AQS A;  5K58 A;  4V2G A;  2IAI A;  1UI6 A;  2OER A;  4AC0 A;  2QCO A;  4M3E A;  2UXI A;  3BT9 A;  3LSJ A;  2X6O A;  3BR6 A;  3ON2 A;  5IPA A;  2XPU A;  2O7O A;  5EYR A;  2XRL A;  4JKZ A;  2QWT A;  4M3B A;  5GPC A;  3B6C A;  3VOX A;  4UDS A;  1Z77 A;  5FKL A;  5AQC A;  1RKT A;  3TP3 A;  4GFK A;  3NNR A;  4ICH A;  3S5R A;  1JT6 A;  2ZCM A;  3G56 A;  4B1R A;  4D7M A;  2QOP A;  2XPW A;  2UXO A;  3ZQH A;  3LJL A;  2RAS A;  3VW0 A;  5D19 A;  3NXC A;  2HXO A;  3QQA A;  2ZOY A;  3BR5 A;  3Q0U A;  3EGQ A;  2QTQ A;  4MK6 A;  3VVY A;  2FJ1 A;  3PAS A;  1JT0 A;  4AF5 A;  2Y30 A;  5HBU A;  3O60 A;  3FIW A;  3PPB A;  3HIM A;  5FKK A;  1JTY A;  3HTI A;  3NPI A;  4G12 A;  5F0F A;  2ID6 A;  3KKC A;  3IUV A;  3LWJ A;  2YVH A;  2FD5 A;  1JUM A;  5F27 A;  2G3B A;  1QVT A;  2TCT A;  1RPW A;  1T56 A;  3PM1 A;  3GEU A;  5IOZ A;  3LSP A;  2IU5 A;  3Q0V A;  3Q0W A;  4M3F A;  4GCT A;  4NN1 A;  5D18 A;  3KNW A;  5FKM A;  5CW8 A;  3B6A A;  3QBM A;  1Z0X A;  4AUX A;  2NP5 A;  3HGY A;  5FKO A;  5IOY A;  2DG7 A;  3ANG A;  5C4Y A;  2HYT A;  3RH2 A;  2G0E A;  3VOK A;  5DAJ A;  4X1E A;  4L62 A;  3LHQ A;  5K7Z A;  2Y31 A;  3V78 A;  4JYK A;  5F0H A;  2W53 A;  2OF7 A;  4GCK A;  3BR0 A;  1SGM A;  2X9D A;  3VVX A;  2GBY A;  4D5C A;  3V6G A;  3E7Q A;  5GP9 A;  5EZH A;  1JUS A;  5HSZ A;  2IEK A;  3CWR A;  2GEN A;  2HXI A;  5CXG A;  2F07 A;  3DEW A;  3VVZ A;  2VKE A;  3F1B A;  3SDG A;  1ZK8 A;  2GFN A;  3BTC A;  2UXP A;  1U9N A;  2DG8 A;  4I6Z A;  3P9T A;  4B3A A;  2ZCN A;  3BHQ A;  3CCY A;  5F04 A;  1QVU A;  2ZCX A;  3FK7 A;  4PXI A;  3RD3 A;  5FHP A;  3VUQ A;  4JNN A;  1VI0 A;  3BR1 A;  3G1M A;  2G7L A;  2XB5 A;  1QPI A;  3AQT A;  3FRQ A;  3C2B A;  4M3D A;  5CXI A;  3ZQI A;  2NX4 A;  2OPT A;  3HE0 A;  3ON4 A;  2HKU A;  1UI5 A;  2FX0 A;  3KKD A;  5GPA A;  4KWA A;  3BQY A;  4ME9 A;  3BR3 A;  5F1J A;  3VW1 A;  4JL3 A;  3C07 A;  3CDL A;  2G7G A;  5FKN A;  2G7S A;  3WHB A;  3VP5 A;  2Y2Z A;  4NEL A;  2HQ5 A;  5J1Y A;  2JK3 A;  3VIB A;  4I76 A;  2ZB9 A;  3ZQL A;  3Q3S A;  2VPR A;  3ANP A;  5F08 A;  2GUH A;  3IH3 A;  3BTL A;  3G1L A;  2PBX A;  3GZI A;  4GCL A;  2D6Y A;  2PZ9 A;  2UXH A;  1ZKG A;  3HTH A;  5FGL A;  1JTX A;  2WGB A;  2XGE A;  3BNI A;  3NRG A;  3JSJ A;  4DW6 A;  2QKO A;  3QKX A;  3BCG A;  3SFI A;  2DTZ A;  2V57 A;  3QPL A;  5J1U A;  3IH4 A;  2XPV A;  2XGD A;  4YZE A;  2RAE A;  3DPJ A;  5HAW A;  2EH3 A;  2HYJ A;  3MNL A;  2OI8 A;  2ID3 A;  4MO7 A;  2WUI A;  5K7H A;  3BRU A;  4ACI A;  2JJ7 A;  3VPR A;  4MXM A;  3VW2 A;  5IP6 A;  2NP3 A;  3BR2 A;  3BTJ A;  3DCF A;  2REK A;  2I10 A;  1ORK A;  5D1R A;  3LSR A;  2NS8 A;  2TRT A;  3ZQG A;  2VKV A;  5FMP A;  1A6I A;  3FK6 A;  3TP0 A;  5J3L A;  3IH2 A;  3BQZ A;  3BTI A;  4HKU A;  3WHC A;  1JUP A;  3O8G A;  4M3G A;  3QPS A; 
#chains in the Genus database with same CATH topology
 4D7N A;  3G7R A;  4W1U A;  2O7T A;  3CJD A;  2IBD A;  5H9T A;  3G1O A;  1BJZ A;  3F0C A;  3MVP A;  3O8H A;  1T33 A;  4GFL A;  3T6N A;  3KYL A;  4AC6 A;  2XDN A;  2YVE A;  2FBQ A;  5K7F A;  3B81 A;  2QIB A;  2UXU A;  2R7V A;  3COL A;  2WV1 A;  3NI7 A;  5EZG A;  2XGC A;  3ZQF A;  2RHA A;  2R7T A;  3LOC A;  4XK4 A;  1RKW A;  4CGR A;  3BJB A;  3HTJ A;  2FQ4 A;  3EUP A;  3CRJ A;  4W97 A;  2NS7 A;  3HTA A;  2ZOZ A;  3KZ9 A;  5EFY A;  4V2F A;  1U9O A;  3HGG A;  5F0C A;  3FHN A;  4D5F A;  5J1R A;  4ABZ A;  2Q24 A;  3AQS A;  5K58 A;  4OD4 A;  4V2G A;  2IAI A;  1UI6 A;  2OER A;  4AC0 A;  2R7R A;  2QCO A;  4M3E A;  2UXI A;  3BT9 A;  3LSJ A;  2X6O A;  2ZY9 A;  3BR6 A;  3ON2 A;  5IPA A;  2XPU A;  2O7O A;  2B1E A;  5EYR A;  2XRL A;  4JKZ A;  2QWT A;  4M3B A;  5GPC A;  3B6C A;  3VOX A;  4UDS A;  1Z77 A;  5FKL A;  5AQC A;  1RKT A;  3TP3 A;  4GFK A;  3NNR A;  4ICH A;  3S5R A;  1JT6 A;  2ZCM A;  3G56 A;  4B1R A;  4D7M A;  2QOP A;  2XPW A;  2UXO A;  3ZQH A;  3LJL A;  2RAS A;  3VW0 A;  5D19 A;  3NXC A;  2HXO A;  3QQA A;  2ZOY A;  3BR5 A;  3Q0U A;  3EGQ A;  2QTQ A;  4MK6 A;  3VVY A;  2FJ1 A;  3PAS A;  1JT0 A;  4C2M A;  2B3W A;  4AF5 A;  2Y30 A;  5HBU A;  3O60 A;  3FIW A;  3PPB A;  3HIM A;  5FKK A;  1JTY A;  3HTI A;  3NPI A;  4G12 A;  5F0F A;  2ID6 A;  3KKC A;  2A2F X;  3IUV A;  3LWJ A;  2YVH A;  2FD5 A;  1JUM A;  5F27 A;  2G3B A;  1QVT A;  2TCT A;  3VTI A;  1RPW A;  2R7O A;  1T56 A;  3PM1 A;  3GEU A;  5IOZ A;  3LSP A;  2IU5 A;  3Q0V A;  3Q0W A;  4M3F A;  4GCT A;  3SWH A;  4NN1 A;  5D18 A;  4IRV A;  3KNW A;  5FKM A;  5CW8 A;  3B6A A;  3QBM A;  1Z0X A;  4AUX A;  2NP5 A;  3HGY A;  5FKO A;  5IOY A;  3NS4 A;  2DG7 A;  3ANG A;  5C4Y A;  2HYT A;  3RH2 A;  2G0E A;  3VOK A;  5DAJ A;  4X1E A;  4L62 A;  2R7U A;  3LHQ A;  5K7Z A;  2Y31 A;  3V78 A;  4JYK A;  5F0H A;  2W53 A;  2OF7 A;  4GCK A;  3BR0 A;  1SGM A;  2X9D A;  3VVX A;  2GBY A;  4D5C A;  3V6G A;  3E7Q A;  3K8P C;  5GP9 A;  5EZH A;  1JUS A;  5HSZ A;  2IEK A;  3CWR A;  2GEN A;  2HXI A;  5CXG A;  2F07 A;  3DEW A;  3VVZ A;  2VKE A;  3F1B A;  3SDG A;  1ZK8 A;  2GFN A;  3BTC A;  2UXP A;  1U9N A;  2DG8 A;  4I6Z A;  3P9T A;  4B3A A;  2ZCN A;  3BHQ A;  3CCY A;  5F04 A;  1QVU A;  2ZCX A;  3FK7 A;  4PXI A;  3RD3 A;  5FHP A;  4JNN A;  1VI0 A;  3VUQ A;  3BR1 A;  3G1M A;  2G7L A;  2XB5 A;  1QPI A;  4OD5 A;  3AQT A;  3FRQ A;  3C2B A;  4DVY P;  4M3D A;  2YVX A;  5CXI A;  3ZQI A;  2NX4 A;  2OPT A;  3HE0 A;  3ON4 A;  2R7Q A;  2HKU A;  1UI5 A;  2FX0 A;  3KKD A;  5GPA A;  4KWA A;  2PFV A;  3BQY A;  4ME9 A;  3BR3 A;  5F1J A;  3VW1 A;  4JL3 A;  3C07 A;  3CDL A;  2G7G A;  4U9N A;  5FKN A;  2G7S A;  3WHB A;  3VP5 A;  2Y2Z A;  4NEL A;  2HQ5 A;  2FJI 1;  5J1Y A;  2JK3 A;  3VIB A;  4I76 A;  2ZB9 A;  3ZQL A;  3Q3S A;  2VPR A;  3ANP A;  5F08 A;  3DU6 A;  2GUH A;  3IH3 A;  3BTL A;  3G1L A;  2PBX A;  3GZI A;  4GCL A;  2R7W A;  2D6Y A;  2PZ9 A;  2R7S A;  2UXH A;  1ZKG A;  3HTH A;  5FGL A;  1JTX A;  2WGB A;  2XGE A;  3BNI A;  3NRG A;  3JSJ A;  4DW6 A;  2QKO A;  3QKX A;  3BCG A;  3SFI A;  2DTZ A;  2V57 A;  3QPL A;  5J1U A;  3IH4 A;  2XPV A;  2XGD A;  4YZE A;  2RAE A;  3DPJ A;  5HAW A;  2EH3 A;  2HYJ A;  3MNL A;  2OI8 A;  2ID3 A;  4MO7 A;  2WUI A;  5K7H A;  3BRU A;  4ACI A;  2JJ7 A;  3DU5 A;  3VPR A;  4MXM A;  3VW2 A;  5IP6 A;  2NP3 A;  3BR2 A;  3BTJ A;  3DCF A;  4U9L A;  2REK A;  2I10 A;  1ORK A;  5D1R A;  3LSR A;  2NS8 A;  2TRT A;  3ZQG A;  2VKV A;  2R7X A;  5FMP A;  1A6I A;  3FK6 A;  3TP0 A;  5J3L A;  3IH2 A;  3BQZ A;  3BTI A;  4HKU A;  5CQG A;  4WIB A;  3WHC A;  1JUP A;  3O8G A;  4M3G A;  3QPS A; 
#chains in the Genus database with same CATH homology
 4D7N A;  3G7R A;  4W1U A;  2O7T A;  3CJD A;  2IBD A;  5H9T A;  3G1O A;  1BJZ A;  3F0C A;  3MVP A;  3O8H A;  1T33 A;  4GFL A;  3T6N A;  4AC6 A;  2XDN A;  2YVE A;  2FBQ A;  5K7F A;  3B81 A;  2QIB A;  2UXU A;  3COL A;  2WV1 A;  3NI7 A;  5EZG A;  2XGC A;  3ZQF A;  2RHA A;  3LOC A;  4XK4 A;  1RKW A;  4CGR A;  3BJB A;  3HTJ A;  2FQ4 A;  3EUP A;  3CRJ A;  4W97 A;  2NS7 A;  3HTA A;  2ZOZ A;  3KZ9 A;  5EFY A;  4V2F A;  1U9O A;  3HGG A;  5F0C A;  4D5F A;  5J1R A;  4ABZ A;  2Q24 A;  3AQS A;  5K58 A;  4V2G A;  2IAI A;  1UI6 A;  2OER A;  4AC0 A;  2QCO A;  4M3E A;  2UXI A;  3BT9 A;  3LSJ A;  2X6O A;  3BR6 A;  3ON2 A;  5IPA A;  2XPU A;  2O7O A;  5EYR A;  2XRL A;  4JKZ A;  2QWT A;  4M3B A;  5GPC A;  3B6C A;  3VOX A;  4UDS A;  1Z77 A;  5FKL A;  5AQC A;  1RKT A;  3TP3 A;  4GFK A;  3NNR A;  4ICH A;  3S5R A;  1JT6 A;  2ZCM A;  3G56 A;  4B1R A;  4D7M A;  2QOP A;  2XPW A;  2UXO A;  3ZQH A;  3LJL A;  2RAS A;  3VW0 A;  5D19 A;  3NXC A;  2HXO A;  3QQA A;  2ZOY A;  3BR5 A;  3Q0U A;  3EGQ A;  2QTQ A;  4MK6 A;  3VVY A;  2FJ1 A;  3PAS A;  1JT0 A;  4AF5 A;  2Y30 A;  5HBU A;  3O60 A;  3FIW A;  3PPB A;  3HIM A;  5FKK A;  1JTY A;  3HTI A;  3NPI A;  4G12 A;  5F0F A;  2ID6 A;  3KKC A;  3IUV A;  3LWJ A;  2YVH A;  2FD5 A;  1JUM A;  5F27 A;  2G3B A;  1QVT A;  2TCT A;  1RPW A;  1T56 A;  3PM1 A;  3GEU A;  5IOZ A;  3LSP A;  2IU5 A;  3Q0V A;  3Q0W A;  4M3F A;  4GCT A;  4NN1 A;  5D18 A;  3KNW A;  5FKM A;  5CW8 A;  3B6A A;  3QBM A;  1Z0X A;  4AUX A;  2NP5 A;  3HGY A;  5FKO A;  5IOY A;  2DG7 A;  3ANG A;  5C4Y A;  2HYT A;  3RH2 A;  2G0E A;  3VOK A;  5DAJ A;  4X1E A;  4L62 A;  3LHQ A;  5K7Z A;  2Y31 A;  3V78 A;  4JYK A;  5F0H A;  2W53 A;  2OF7 A;  4GCK A;  3BR0 A;  1SGM A;  2X9D A;  3VVX A;  2GBY A;  4D5C A;  3V6G A;  3E7Q A;  5GP9 A;  5EZH A;  1JUS A;  5HSZ A;  2IEK A;  3CWR A;  2GEN A;  2HXI A;  5CXG A;  2F07 A;  3DEW A;  3VVZ A;  2VKE A;  3F1B A;  3SDG A;  1ZK8 A;  2GFN A;  3BTC A;  2UXP A;  1U9N A;  2DG8 A;  4I6Z A;  3P9T A;  4B3A A;  2ZCN A;  3BHQ A;  3CCY A;  5F04 A;  1QVU A;  2ZCX A;  3FK7 A;  4PXI A;  3RD3 A;  5FHP A;  3VUQ A;  4JNN A;  1VI0 A;  3BR1 A;  3G1M A;  2G7L A;  2XB5 A;  1QPI A;  3AQT A;  3FRQ A;  3C2B A;  4M3D A;  5CXI A;  3ZQI A;  2NX4 A;  2OPT A;  3HE0 A;  3ON4 A;  2HKU A;  1UI5 A;  2FX0 A;  3KKD A;  5GPA A;  4KWA A;  3BQY A;  4ME9 A;  3BR3 A;  5F1J A;  3VW1 A;  4JL3 A;  3C07 A;  3CDL A;  2G7G A;  5FKN A;  2G7S A;  3WHB A;  3VP5 A;  2Y2Z A;  4NEL A;  2HQ5 A;  5J1Y A;  2JK3 A;  3VIB A;  4I76 A;  2ZB9 A;  3ZQL A;  3Q3S A;  2VPR A;  3ANP A;  5F08 A;  2GUH A;  3IH3 A;  3BTL A;  3G1L A;  2PBX A;  3GZI A;  4GCL A;  2D6Y A;  2PZ9 A;  2UXH A;  1ZKG A;  3HTH A;  5FGL A;  1JTX A;  2WGB A;  2XGE A;  3BNI A;  3NRG A;  3JSJ A;  4DW6 A;  2QKO A;  3QKX A;  3BCG A;  3SFI A;  2DTZ A;  2V57 A;  3QPL A;  5J1U A;  3IH4 A;  2XPV A;  2XGD A;  4YZE A;  2RAE A;  3DPJ A;  5HAW A;  2EH3 A;  2HYJ A;  3MNL A;  2OI8 A;  2ID3 A;  4MO7 A;  2WUI A;  5K7H A;  3BRU A;  4ACI A;  2JJ7 A;  3VPR A;  4MXM A;  3VW2 A;  5IP6 A;  2NP3 A;  3BR2 A;  3BTJ A;  3DCF A;  2REK A;  2I10 A;  1ORK A;  5D1R A;  3LSR A;  2NS8 A;  2TRT A;  3ZQG A;  2VKV A;  5FMP A;  1A6I A;  3FK6 A;  3TP0 A;  5J3L A;  3IH2 A;  3BQZ A;  3BTI A;  4HKU A;  3WHC A;  1JUP A;  3O8G A;  4M3G A;  3QPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...