2PBXA

Vibrio cholerae hapr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
IEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQYSNFLTDHIDLDLDVKTNLQTLCKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERGELCEKHDVDNMASLFHGIFYSIFLQVNRLGEQEAVYKLADSYLNMLCIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin/protease regulatory protein
publication title Crystal structure of the Vibrio cholerae Quorum-Sensing Regulatory Protein HapR
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 73
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2pbxA00
2JJ7A 1Z0XA 4AF5A 2HXIA 5DAJA 4M3BA 4ME9A 3MVPA 2UXHA 3IH4A 1JUMA 3CJDA 2G3BA 5CXGA 3KZ9A 3IH3A 5CXIA 4B3AA 3VOKA 3BCGA 4D5CA 2DTZA 3BNIA 2XGCA 5K58A 3O8GA 2QCOA 5EFYA 2HQ5A 2VKEA 2XPWA 5GP9A 3QKXA 3ZQIA 3TP0A 3F0CA 2IEKA 3LSPA 1ZKGA 4UDSA 3ZQFA 4ICHA 3NRGA 4I6ZA 2DG7A 3DCFA 3AQSA 2HKUA 2FQ4A 3VW2A 2QWTA 2FBQA 5IP6A 1Z77A 4D5FA 5IPAA 3BR2A 3KKDA 4MXMA 3BTIA 3KKCA 5IOYA 5F0FA 5GPCA 3EUPA 3BTLA 3QPLA 3LJLA 2PZ9A 2JK3A 5FKNA 2NP5A 2GFNA 1JT0A 3VVZA 2WV1A 2XB5A 1SGMA 5HBUA 4HKUA 5FGLA 1ORKA 2HXOA 5H9TA 2NX4A 3ZQHA 2O7TA 2XRLA 3VW0A 4M3GA 3ZQGA 4MK6A 3ZQLA 3NXCA 2EH3A 5FKKA 4D7NA 2X9DA 5HAWA 3G7RA 3SFIA 3BHQA 2ID3A 4JL3A 3GZIA 3ON4A 3BQYA 1JT6A 2IU5A 5D18A 2F07A 3CCYA 1T56A 3Q0VA 4I76A 1RKWA 2HYTA 2HYJA 2XPUA 3HTJA 3S5RA 5K7ZA 3VP5A 4GCKA 1UI6A 4AC6A 3BJBA 3PPBA 5K7HA 3FK6A 3WHBA 3BRUA 5FMPA 2FD5A 5F27A 1RPWA 3ANGA 4W97A 3PASA 3BR1A 2O7OA 2WGBA 3SDGA 3G1MA 5IOZA 3BR3A 3BT9A 2ZB9A 3LWJA 2NS7A 2REKA 4AUXA 3NPIA 5EZHA 2Y30A 3RH2A 3DEWA 3VOXA 4V2GA 2NP3A 5FKMA 2ZCXA 3WHCA 2G0EA 2WUIA 2GENA 2GUHA 3ANPA 4D7MA 3O60A 4YZEA 1JUSA 2W53A 2UXPA 2OI8A 3DPJA 3B6CA 2YVEA 2QTQA 3IH2A 3GEUA 3HIMA 1VI0A 3HTIA 4GCTA 3Q0WA 3HGGA 2ZCMA 2D6YA 3T6NA 2QOPA 5HSZA 3VVYA 2ZOYA 5F04A 3HTHA 1ZK8A 3KNWA 4AC0A 5CW8A 3CWRA 3E7QA 3TP3A 1QVUA 3FRQA 4M3FA 2UXOA 2GBYA 2DG8A 2RAEA 4XK4A 2G7LA 4GCLA 5EZGA 1T33A 2RHAA 3AQTA 3G1LA 4MO7A 5AQCA 3G1OA 5J3LA 3BQZA 4W1UA 2FJ1A 2TCTA 3VPRA 4DW6A 3LSJA 3JSJA 3BR6A 2ZCNA 3FIWA 4JKZA 3B81A 3VIBA 5D1RA 3VUQA 3NNRA 2X6OA 3BTCA 3VVXA 3B6AA 3HE0A 1U9NA 5K7FA 5C4YA 2IAIA 3FK7A 3O8HA 1RKTA 2VKVA 5FHPA 3P9TA 4B1RA 2Q24A 5F08A 2UXUA 3V78A 3QBMA 2RASA 5D19A 2FX0A 1JTYA 3LOCA 4NN1A 1JUPA 5EYRA 1U9OA 3PM1A 2Y2ZA 4X1EA 1QVTA 2XGDA 2I10A 2XGEA 4ACIA 2OERA 3LSRA 3CRJA 1UI5A 4L62A 2UXIA 4CGRA 2NS8A 1A6IA 2OPTA 2ZOZA 1QPIA 3BTJA 4GFKA 3NI7A 5J1RA 5F0HA 2QIBA 3Q0UA 3F1BA 2YVHA 4V2FA 3Q3SA 3COLA 3IUVA 3HGYA 4M3EA 4GFLA 2Y31A 5GPAA 4KWAA 3EGQA 3BR0A 3RD3A 4JYKA 2QKOA 3C2BA 3QQAA 1BJZA 3V6GA 5F0CA 3CDLA 3MNLA 1JTXA 2ID6A 2G7GA 3C07A 2OF7A 2XDNA 4JNNA 2V57A 2PBXA 3VW1A 2G7SA 3G56A 2IBDA 5J1UA 3QPSA 2VPRA 3BR5A 2TRTA 3ON2A 5F1JA 5FKLA 3HTAA 4PXIA 4ABZA 5J1YA 3LHQA 4M3DA 5FKOA 2XPVA 4NELA 4G12A
chains in the Genus database with same CATH superfamily
2JJ7A 1Z0XA 2R7RA 4AF5A 2HXIA 5DAJA 4M3BA 4ME9A 3MVPA 2UXHA 3IH4A 1JUMA 3CJDA 2G3BA 5CXGA 3KZ9A 3IH3A 5CXIA 4B3AA 3VOKA 3BCGA 4D5CA 2DTZA 3BNIA 2XGCA 5K58A 3O8GA 2QCOA 5EFYA 2HQ5A 5CQGA 2VKEA 2XPWA 5GP9A 3QKXA 3ZQIA 3TP0A 3F0CA 2IEKA 3DU6A 3LSPA 1ZKGA 4UDSA 3ZQFA 4ICHA 3NRGA 4I6ZA 2DG7A 3DCFA 3AQSA 2HKUA 2FQ4A 3VW2A 2QWTA 3FHNA 2FBQA 5IP6A 1Z77A 4D5FA 3SWHA 3BR2A 3KKDA 4MXMA 3BTIA 3KKCA 5IOYA 5IPAA 5F0FA 5GPCA 3EUPA 3BTLA 3QPLA 3NS4A 3LJLA 2PZ9A 2JK3A 5FKNA 2NP5A 2GFNA 1JT0A 3VVZA 2WV1A 2XB5A 1SGMA 5HBUA 4HKUA 5FGLA 1ORKA 2HXOA 5H9TA 2NX4A 3ZQHA 2O7TA 2XRLA 3VW0A 4M3GA 3ZQGA 4MK6A 3ZQLA 3NXCA 2EH3A 5FKKA 4D7NA 2X9DA 5HAWA 3G7RA 3SFIA 3BHQA 2ID3A 4JL3A 3GZIA 3ON4A 3BQYA 1JT6A 2IU5A 5D18A 2F07A 3CCYA 1T56A 4OD4A 3Q0VA 4I76A 1RKWA 2HYTA 2HYJA 2XPUA 3HTJA 3S5RA 5K7ZA 4DVYP 3VP5A 4GCKA 1UI6A 4U9LA 4AC6A 3BJBA 3PPBA 5K7HA 3FK6A 3WHBA 3BRUA 5FMPA 2FD5A 5F27A 1RPWA 2A2FX 2B1EA 3ANGA 4W97A 3PASA 3BR1A 2O7OA 2WGBA 3SDGA 3G1MA 5IOZA 3BR3A 3BT9A 2ZB9A 3LWJA 2NS7A 2REKA 2R7TA 4AUXA 3NPIA 5EZHA 2Y30A 4C2MA 3K8PC 3RH2A 3DEWA 3VOXA 2R7UA 4V2GA 2NP3A 5FKMA 2ZCXA 3WHCA 2G0EA 2WUIA 2YVXA 2GENA 2GUHA 3ANPA 4D7MA 3O60A 4YZEA 2R7XA 1JUSA 2W53A 2UXPA 2OI8A 3DPJA 3B6CA 2YVEA 2QTQA 3IH2A 3GEUA 3HIMA 1VI0A 3HTIA 3VTIA 4GCTA 3Q0WA 3HGGA 2ZCMA 2D6YA 2R7SA 3T6NA 2QOPA 5HSZA 3VVYA 2ZOYA 5F04A 3HTHA 1ZK8A 2ZY9A 3KNWA 4AC0A 5CW8A 3CWRA 3E7QA 3KYLA 3TP3A 1QVUA 3FRQA 4M3FA 2UXOA 2GBYA 2DG8A 2R7OA 2RAEA 4XK4A 2G7LA 4GCLA 5EZGA 1T33A 2RHAA 3AQTA 3G1LA 4MO7A 5AQCA 3G1OA 2PFVA 5J3LA 3BQZA 4W1UA 2FJ1A 2R7VA 2TCTA 3VPRA 4DW6A 3LSJA 3JSJA 3BR6A 2ZCNA 3DU5A 3FIWA 4JKZA 3B81A 3VIBA 5D1RA 2B3WA 3VUQA 3NNRA 2X6OA 3BTCA 3VVXA 3B6AA 3HE0A 1U9NA 5K7FA 5C4YA 4WIBA 2IAIA 3FK7A 3O8HA 1RKTA 2R7WA 2VKVA 2FJI1 5FHPA 3P9TA 4B1RA 2Q24A 5F08A 2UXUA 3V78A 3QBMA 4IRVA 2RASA 5D19A 2FX0A 1JTYA 3LOCA 4U9NA 4NN1A 1JUPA 5EYRA 1U9OA 3PM1A 4OD5A 2Y2ZA 4X1EA 1QVTA 2XGDA 2I10A 2XGEA 4ACIA 2OERA 3LSRA 3CRJA 1UI5A 4L62A 2UXIA 4CGRA 2NS8A 1A6IA 2OPTA 2ZOZA 1QPIA 3BTJA 4GFKA 3NI7A 5J1RA 5F0HA 2QIBA 3Q0UA 3F1BA 2YVHA 4V2FA 3Q3SA 3COLA 3IUVA 3HGYA 4M3EA 4GFLA 2Y31A 5GPAA 4KWAA 3EGQA 3BR0A 3RD3A 4JYKA 2QKOA 3C2BA 3QQAA 1BJZA 3V6GA 5F0CA 3CDLA 3MNLA 1JTXA 2ID6A 2G7GA 3C07A 2OF7A 2XDNA 2R7QA 4JNNA 2V57A 2PBXA 3VW1A 2G7SA 3G56A 2IBDA 5J1UA 3QPSA 2VPRA 3BR5A 2TRTA 3ON2A 5F1JA 5FKLA 3HTAA 4PXIA 4ABZA 5J1YA 3LHQA 4M3DA 5FKOA 2XPVA 4NELA 4G12A
chains in the Genus database with same CATH topology
2JJ7A 1Z0XA 4AF5A 2HXIA 5DAJA 4M3BA 4ME9A 3MVPA 2UXHA 3IH4A 1JUMA 3CJDA 2G3BA 5CXGA 3KZ9A 3IH3A 5CXIA 4B3AA 3VOKA 3BCGA 4D5CA 2DTZA 3BNIA 2XGCA 5K58A 3O8GA 2QCOA 5EFYA 2HQ5A 2VKEA 2XPWA 5GP9A 3QKXA 3ZQIA 3TP0A 3F0CA 2IEKA 3LSPA 1ZKGA 4UDSA 3ZQFA 4ICHA 3NRGA 4I6ZA 2DG7A 3DCFA 3AQSA 2HKUA 2FQ4A 3VW2A 2QWTA 2FBQA 5IP6A 1Z77A 4D5FA 5IPAA 3BR2A 3KKDA 4MXMA 3BTIA 3KKCA 5IOYA 5F0FA 5GPCA 3EUPA 3BTLA 3QPLA 3LJLA 2PZ9A 2JK3A 5FKNA 2NP5A 2GFNA 1JT0A 3VVZA 2WV1A 2XB5A 1SGMA 5HBUA 4HKUA 5FGLA 1ORKA 2HXOA 5H9TA 2NX4A 3ZQHA 2O7TA 2XRLA 3VW0A 4M3GA 3ZQGA 4MK6A 3ZQLA 3NXCA 2EH3A 5FKKA 4D7NA 2X9DA 5HAWA 3G7RA 3SFIA 3BHQA 2ID3A 4JL3A 3GZIA 3ON4A 3BQYA 1JT6A 2IU5A 5D18A 2F07A 3CCYA 1T56A 3Q0VA 4I76A 1RKWA 2HYTA 2HYJA 2XPUA 3HTJA 3S5RA 5K7ZA 3VP5A 4GCKA 1UI6A 4AC6A 3BJBA 3PPBA 5K7HA 3FK6A 3WHBA 3BRUA 5FMPA 2FD5A 5F27A 1RPWA 3ANGA 4W97A 3PASA 3BR1A 2O7OA 2WGBA 3SDGA 3G1MA 5IOZA 3BR3A 3BT9A 2ZB9A 3LWJA 2NS7A 2REKA 4AUXA 3NPIA 5EZHA 2Y30A 3RH2A 3DEWA 3VOXA 4V2GA 2NP3A 5FKMA 2ZCXA 3WHCA 2G0EA 2WUIA 2GENA 2GUHA 3ANPA 4D7MA 3O60A 4YZEA 1JUSA 2W53A 2UXPA 2OI8A 3DPJA 3B6CA 2YVEA 2QTQA 3IH2A 3GEUA 3HIMA 1VI0A 3HTIA 4GCTA 3Q0WA 3HGGA 2ZCMA 2D6YA 3T6NA 2QOPA 5HSZA 3VVYA 2ZOYA 5F04A 3HTHA 1ZK8A 3KNWA 4AC0A 5CW8A 3CWRA 3E7QA 3TP3A 1QVUA 3FRQA 4M3FA 2UXOA 2GBYA 2DG8A 2RAEA 4XK4A 2G7LA 4GCLA 5EZGA 1T33A 2RHAA 3AQTA 3G1LA 4MO7A 5AQCA 3G1OA 5J3LA 3BQZA 4W1UA 2FJ1A 2TCTA 3VPRA 4DW6A 3LSJA 3JSJA 3BR6A 2ZCNA 3FIWA 4JKZA 3B81A 3VIBA 5D1RA 3VUQA 3NNRA 2X6OA 3BTCA 3VVXA 3B6AA 3HE0A 1U9NA 5K7FA 5C4YA 2IAIA 3FK7A 3O8HA 1RKTA 2VKVA 5FHPA 3P9TA 4B1RA 2Q24A 5F08A 2UXUA 3V78A 3QBMA 2RASA 5D19A 2FX0A 1JTYA 3LOCA 4NN1A 1JUPA 5EYRA 1U9OA 3PM1A 2Y2ZA 4X1EA 1QVTA 2XGDA 2I10A 2XGEA 4ACIA 2OERA 3LSRA 3CRJA 1UI5A 4L62A 2UXIA 4CGRA 2NS8A 1A6IA 2OPTA 2ZOZA 1QPIA 3BTJA 4GFKA 3NI7A 5J1RA 5F0HA 2QIBA 3Q0UA 3F1BA 2YVHA 4V2FA 3Q3SA 3COLA 3IUVA 3HGYA 4M3EA 4GFLA 2Y31A 5GPAA 4KWAA 3EGQA 3BR0A 3RD3A 4JYKA 2QKOA 3C2BA 3QQAA 1BJZA 3V6GA 5F0CA 3CDLA 3MNLA 1JTXA 2ID6A 2G7GA 3C07A 2OF7A 2XDNA 4JNNA 2V57A 2PBXA 3VW1A 2G7SA 3G56A 2IBDA 5J1UA 3QPSA 2VPRA 3BR5A 2TRTA 3ON2A 5F1JA 5FKLA 3HTAA 4PXIA 4ABZA 5J1YA 3LHQA 4M3DA 5FKOA 2XPVA 4NELA 4G12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ7 A;  1Z0X A;  4AF5 A;  2HXI A;  5DAJ A;  4M3B A;  4ME9 A;  3MVP A;  2UXH A;  3IH4 A;  1JUM A;  3CJD A;  2G3B A;  5CXG A;  3KZ9 A;  3IH3 A;  5CXI A;  4B3A A;  3VOK A;  3BCG A;  4D5C A;  2DTZ A;  3BNI A;  2XGC A;  5K58 A;  3O8G A;  2QCO A;  5EFY A;  2HQ5 A;  2VKE A;  2XPW A;  5GP9 A;  3QKX A;  3ZQI A;  3TP0 A;  3F0C A;  2IEK A;  3LSP A;  1ZKG A;  4UDS A;  3ZQF A;  4ICH A;  3NRG A;  4I6Z A;  2DG7 A;  3DCF A;  3AQS A;  2HKU A;  2FQ4 A;  3VW2 A;  2QWT A;  2FBQ A;  5IP6 A;  1Z77 A;  4D5F A;  5IPA A;  3BR2 A;  3KKD A;  4MXM A;  3BTI A;  3KKC A;  5IOY A;  5F0F A;  5GPC A;  3EUP A;  3BTL A;  3QPL A;  3LJL A;  2PZ9 A;  2JK3 A;  5FKN A;  2NP5 A;  2GFN A;  1JT0 A;  3VVZ A;  2WV1 A;  2XB5 A;  1SGM A;  5HBU A;  4HKU A;  5FGL A;  1ORK A;  2HXO A;  5H9T A;  2NX4 A;  3ZQH A;  2O7T A;  2XRL A;  3VW0 A;  4M3G A;  3ZQG A;  4MK6 A;  3ZQL A;  3NXC A;  2EH3 A;  5FKK A;  4D7N A;  2X9D A;  5HAW A;  3G7R A;  3SFI A;  3BHQ A;  2ID3 A;  4JL3 A;  3GZI A;  3ON4 A;  3BQY A;  1JT6 A;  2IU5 A;  5D18 A;  2F07 A;  3CCY A;  1T56 A;  3Q0V A;  4I76 A;  1RKW A;  2HYT A;  2HYJ A;  2XPU A;  3HTJ A;  3S5R A;  5K7Z A;  3VP5 A;  4GCK A;  1UI6 A;  4AC6 A;  3BJB A;  3PPB A;  5K7H A;  3FK6 A;  3WHB A;  3BRU A;  5FMP A;  2FD5 A;  5F27 A;  1RPW A;  3ANG A;  4W97 A;  3PAS A;  3BR1 A;  2O7O A;  2WGB A;  3SDG A;  3G1M A;  5IOZ A;  3BR3 A;  3BT9 A;  2ZB9 A;  3LWJ A;  2NS7 A;  2REK A;  4AUX A;  3NPI A;  5EZH A;  2Y30 A;  3RH2 A;  3DEW A;  3VOX A;  4V2G A;  2NP3 A;  5FKM A;  2ZCX A;  3WHC A;  2G0E A;  2WUI A;  2GEN A;  2GUH A;  3ANP A;  4D7M A;  3O60 A;  4YZE A;  1JUS A;  2W53 A;  2UXP A;  2OI8 A;  3DPJ A;  3B6C A;  2YVE A;  2QTQ A;  3IH2 A;  3GEU A;  3HIM A;  1VI0 A;  3HTI A;  4GCT A;  3Q0W A;  3HGG A;  2ZCM A;  2D6Y A;  3T6N A;  2QOP A;  5HSZ A;  3VVY A;  2ZOY A;  5F04 A;  3HTH A;  1ZK8 A;  3KNW A;  4AC0 A;  5CW8 A;  3CWR A;  3E7Q A;  3TP3 A;  1QVU A;  3FRQ A;  4M3F A;  2UXO A;  2GBY A;  2DG8 A;  2RAE A;  4XK4 A;  2G7L A;  4GCL A;  5EZG A;  1T33 A;  2RHA A;  3AQT A;  3G1L A;  4MO7 A;  5AQC A;  3G1O A;  5J3L A;  3BQZ A;  4W1U A;  2FJ1 A;  2TCT A;  3VPR A;  4DW6 A;  3LSJ A;  3JSJ A;  3BR6 A;  2ZCN A;  3FIW A;  4JKZ A;  3B81 A;  3VIB A;  5D1R A;  3VUQ A;  3NNR A;  2X6O A;  3BTC A;  3VVX A;  3B6A A;  3HE0 A;  1U9N A;  5K7F A;  5C4Y A;  2IAI A;  3FK7 A;  3O8H A;  1RKT A;  2VKV A;  5FHP A;  3P9T A;  4B1R A;  2Q24 A;  5F08 A;  2UXU A;  3V78 A;  3QBM A;  2RAS A;  5D19 A;  2FX0 A;  1JTY A;  3LOC A;  4NN1 A;  1JUP A;  5EYR A;  1U9O A;  3PM1 A;  2Y2Z A;  4X1E A;  1QVT A;  2XGD A;  2I10 A;  2XGE A;  4ACI A;  2OER A;  3LSR A;  3CRJ A;  1UI5 A;  4L62 A;  2UXI A;  4CGR A;  2NS8 A;  1A6I A;  2OPT A;  2ZOZ A;  1QPI A;  3BTJ A;  4GFK A;  3NI7 A;  5J1R A;  5F0H A;  2QIB A;  3Q0U A;  3F1B A;  2YVH A;  4V2F A;  3Q3S A;  3COL A;  3IUV A;  3HGY A;  4M3E A;  4GFL A;  2Y31 A;  5GPA A;  4KWA A;  3EGQ A;  3BR0 A;  3RD3 A;  4JYK A;  2QKO A;  3C2B A;  3QQA A;  1BJZ A;  3V6G A;  5F0C A;  3CDL A;  3MNL A;  1JTX A;  2ID6 A;  2G7G A;  3C07 A;  2OF7 A;  2XDN A;  4JNN A;  2V57 A;  2PBX A;  3VW1 A;  2G7S A;  3G56 A;  2IBD A;  5J1U A;  3QPS A;  2VPR A;  3BR5 A;  2TRT A;  3ON2 A;  5F1J A;  5FKL A;  3HTA A;  4PXI A;  4ABZ A;  5J1Y A;  3LHQ A;  4M3D A;  5FKO A;  2XPV A;  4NEL A;  4G12 A; 
#chains in the Genus database with same CATH topology
 2JJ7 A;  1Z0X A;  2R7R A;  4AF5 A;  2HXI A;  5DAJ A;  4M3B A;  4ME9 A;  3MVP A;  2UXH A;  3IH4 A;  1JUM A;  3CJD A;  2G3B A;  5CXG A;  3KZ9 A;  3IH3 A;  5CXI A;  4B3A A;  3VOK A;  3BCG A;  4D5C A;  2DTZ A;  3BNI A;  2XGC A;  5K58 A;  3O8G A;  2QCO A;  5EFY A;  2HQ5 A;  5CQG A;  2VKE A;  2XPW A;  5GP9 A;  3QKX A;  3ZQI A;  3TP0 A;  3F0C A;  2IEK A;  3DU6 A;  3LSP A;  1ZKG A;  4UDS A;  3ZQF A;  4ICH A;  3NRG A;  4I6Z A;  2DG7 A;  3DCF A;  3AQS A;  2HKU A;  2FQ4 A;  3VW2 A;  2QWT A;  3FHN A;  2FBQ A;  5IP6 A;  1Z77 A;  4D5F A;  3SWH A;  3BR2 A;  3KKD A;  4MXM A;  3BTI A;  3KKC A;  5IOY A;  5IPA A;  5F0F A;  5GPC A;  3EUP A;  3BTL A;  3QPL A;  3NS4 A;  3LJL A;  2PZ9 A;  2JK3 A;  5FKN A;  2NP5 A;  2GFN A;  1JT0 A;  3VVZ A;  2WV1 A;  2XB5 A;  1SGM A;  5HBU A;  4HKU A;  5FGL A;  1ORK A;  2HXO A;  5H9T A;  2NX4 A;  3ZQH A;  2O7T A;  2XRL A;  3VW0 A;  4M3G A;  3ZQG A;  4MK6 A;  3ZQL A;  3NXC A;  2EH3 A;  5FKK A;  4D7N A;  2X9D A;  5HAW A;  3G7R A;  3SFI A;  3BHQ A;  2ID3 A;  4JL3 A;  3GZI A;  3ON4 A;  3BQY A;  1JT6 A;  2IU5 A;  5D18 A;  2F07 A;  3CCY A;  1T56 A;  4OD4 A;  3Q0V A;  4I76 A;  1RKW A;  2HYT A;  2HYJ A;  2XPU A;  3HTJ A;  3S5R A;  5K7Z A;  4DVY P;  3VP5 A;  4GCK A;  1UI6 A;  4U9L A;  4AC6 A;  3BJB A;  3PPB A;  5K7H A;  3FK6 A;  3WHB A;  3BRU A;  5FMP A;  2FD5 A;  5F27 A;  1RPW A;  2A2F X;  2B1E A;  3ANG A;  4W97 A;  3PAS A;  3BR1 A;  2O7O A;  2WGB A;  3SDG A;  3G1M A;  5IOZ A;  3BR3 A;  3BT9 A;  2ZB9 A;  3LWJ A;  2NS7 A;  2REK A;  2R7T A;  4AUX A;  3NPI A;  5EZH A;  2Y30 A;  4C2M A;  3K8P C;  3RH2 A;  3DEW A;  3VOX A;  2R7U A;  4V2G A;  2NP3 A;  5FKM A;  2ZCX A;  3WHC A;  2G0E A;  2WUI A;  2YVX A;  2GEN A;  2GUH A;  3ANP A;  4D7M A;  3O60 A;  4YZE A;  2R7X A;  1JUS A;  2W53 A;  2UXP A;  2OI8 A;  3DPJ A;  3B6C A;  2YVE A;  2QTQ A;  3IH2 A;  3GEU A;  3HIM A;  1VI0 A;  3HTI A;  3VTI A;  4GCT A;  3Q0W A;  3HGG A;  2ZCM A;  2D6Y A;  2R7S A;  3T6N A;  2QOP A;  5HSZ A;  3VVY A;  2ZOY A;  5F04 A;  3HTH A;  1ZK8 A;  2ZY9 A;  3KNW A;  4AC0 A;  5CW8 A;  3CWR A;  3E7Q A;  3KYL A;  3TP3 A;  1QVU A;  3FRQ A;  4M3F A;  2UXO A;  2GBY A;  2DG8 A;  2R7O A;  2RAE A;  4XK4 A;  2G7L A;  4GCL A;  5EZG A;  1T33 A;  2RHA A;  3AQT A;  3G1L A;  4MO7 A;  5AQC A;  3G1O A;  2PFV A;  5J3L A;  3BQZ A;  4W1U A;  2FJ1 A;  2R7V A;  2TCT A;  3VPR A;  4DW6 A;  3LSJ A;  3JSJ A;  3BR6 A;  2ZCN A;  3DU5 A;  3FIW A;  4JKZ A;  3B81 A;  3VIB A;  5D1R A;  2B3W A;  3VUQ A;  3NNR A;  2X6O A;  3BTC A;  3VVX A;  3B6A A;  3HE0 A;  1U9N A;  5K7F A;  5C4Y A;  4WIB A;  2IAI A;  3FK7 A;  3O8H A;  1RKT A;  2R7W A;  2VKV A;  2FJI 1;  5FHP A;  3P9T A;  4B1R A;  2Q24 A;  5F08 A;  2UXU A;  3V78 A;  3QBM A;  4IRV A;  2RAS A;  5D19 A;  2FX0 A;  1JTY A;  3LOC A;  4U9N A;  4NN1 A;  1JUP A;  5EYR A;  1U9O A;  3PM1 A;  4OD5 A;  2Y2Z A;  4X1E A;  1QVT A;  2XGD A;  2I10 A;  2XGE A;  4ACI A;  2OER A;  3LSR A;  3CRJ A;  1UI5 A;  4L62 A;  2UXI A;  4CGR A;  2NS8 A;  1A6I A;  2OPT A;  2ZOZ A;  1QPI A;  3BTJ A;  4GFK A;  3NI7 A;  5J1R A;  5F0H A;  2QIB A;  3Q0U A;  3F1B A;  2YVH A;  4V2F A;  3Q3S A;  3COL A;  3IUV A;  3HGY A;  4M3E A;  4GFL A;  2Y31 A;  5GPA A;  4KWA A;  3EGQ A;  3BR0 A;  3RD3 A;  4JYK A;  2QKO A;  3C2B A;  3QQA A;  1BJZ A;  3V6G A;  5F0C A;  3CDL A;  3MNL A;  1JTX A;  2ID6 A;  2G7G A;  3C07 A;  2OF7 A;  2XDN A;  2R7Q A;  4JNN A;  2V57 A;  2PBX A;  3VW1 A;  2G7S A;  3G56 A;  2IBD A;  5J1U A;  3QPS A;  2VPR A;  3BR5 A;  2TRT A;  3ON2 A;  5F1J A;  5FKL A;  3HTA A;  4PXI A;  4ABZ A;  5J1Y A;  3LHQ A;  4M3D A;  5FKO A;  2XPV A;  4NEL A;  4G12 A; 
#chains in the Genus database with same CATH homology
 2JJ7 A;  1Z0X A;  4AF5 A;  2HXI A;  5DAJ A;  4M3B A;  4ME9 A;  3MVP A;  2UXH A;  3IH4 A;  1JUM A;  3CJD A;  2G3B A;  5CXG A;  3KZ9 A;  3IH3 A;  5CXI A;  4B3A A;  3VOK A;  3BCG A;  4D5C A;  2DTZ A;  3BNI A;  2XGC A;  5K58 A;  3O8G A;  2QCO A;  5EFY A;  2HQ5 A;  2VKE A;  2XPW A;  5GP9 A;  3QKX A;  3ZQI A;  3TP0 A;  3F0C A;  2IEK A;  3LSP A;  1ZKG A;  4UDS A;  3ZQF A;  4ICH A;  3NRG A;  4I6Z A;  2DG7 A;  3DCF A;  3AQS A;  2HKU A;  2FQ4 A;  3VW2 A;  2QWT A;  2FBQ A;  5IP6 A;  1Z77 A;  4D5F A;  5IPA A;  3BR2 A;  3KKD A;  4MXM A;  3BTI A;  3KKC A;  5IOY A;  5F0F A;  5GPC A;  3EUP A;  3BTL A;  3QPL A;  3LJL A;  2PZ9 A;  2JK3 A;  5FKN A;  2NP5 A;  2GFN A;  1JT0 A;  3VVZ A;  2WV1 A;  2XB5 A;  1SGM A;  5HBU A;  4HKU A;  5FGL A;  1ORK A;  2HXO A;  5H9T A;  2NX4 A;  3ZQH A;  2O7T A;  2XRL A;  3VW0 A;  4M3G A;  3ZQG A;  4MK6 A;  3ZQL A;  3NXC A;  2EH3 A;  5FKK A;  4D7N A;  2X9D A;  5HAW A;  3G7R A;  3SFI A;  3BHQ A;  2ID3 A;  4JL3 A;  3GZI A;  3ON4 A;  3BQY A;  1JT6 A;  2IU5 A;  5D18 A;  2F07 A;  3CCY A;  1T56 A;  3Q0V A;  4I76 A;  1RKW A;  2HYT A;  2HYJ A;  2XPU A;  3HTJ A;  3S5R A;  5K7Z A;  3VP5 A;  4GCK A;  1UI6 A;  4AC6 A;  3BJB A;  3PPB A;  5K7H A;  3FK6 A;  3WHB A;  3BRU A;  5FMP A;  2FD5 A;  5F27 A;  1RPW A;  3ANG A;  4W97 A;  3PAS A;  3BR1 A;  2O7O A;  2WGB A;  3SDG A;  3G1M A;  5IOZ A;  3BR3 A;  3BT9 A;  2ZB9 A;  3LWJ A;  2NS7 A;  2REK A;  4AUX A;  3NPI A;  5EZH A;  2Y30 A;  3RH2 A;  3DEW A;  3VOX A;  4V2G A;  2NP3 A;  5FKM A;  2ZCX A;  3WHC A;  2G0E A;  2WUI A;  2GEN A;  2GUH A;  3ANP A;  4D7M A;  3O60 A;  4YZE A;  1JUS A;  2W53 A;  2UXP A;  2OI8 A;  3DPJ A;  3B6C A;  2YVE A;  2QTQ A;  3IH2 A;  3GEU A;  3HIM A;  1VI0 A;  3HTI A;  4GCT A;  3Q0W A;  3HGG A;  2ZCM A;  2D6Y A;  3T6N A;  2QOP A;  5HSZ A;  3VVY A;  2ZOY A;  5F04 A;  3HTH A;  1ZK8 A;  3KNW A;  4AC0 A;  5CW8 A;  3CWR A;  3E7Q A;  3TP3 A;  1QVU A;  3FRQ A;  4M3F A;  2UXO A;  2GBY A;  2DG8 A;  2RAE A;  4XK4 A;  2G7L A;  4GCL A;  5EZG A;  1T33 A;  2RHA A;  3AQT A;  3G1L A;  4MO7 A;  5AQC A;  3G1O A;  5J3L A;  3BQZ A;  4W1U A;  2FJ1 A;  2TCT A;  3VPR A;  4DW6 A;  3LSJ A;  3JSJ A;  3BR6 A;  2ZCN A;  3FIW A;  4JKZ A;  3B81 A;  3VIB A;  5D1R A;  3VUQ A;  3NNR A;  2X6O A;  3BTC A;  3VVX A;  3B6A A;  3HE0 A;  1U9N A;  5K7F A;  5C4Y A;  2IAI A;  3FK7 A;  3O8H A;  1RKT A;  2VKV A;  5FHP A;  3P9T A;  4B1R A;  2Q24 A;  5F08 A;  2UXU A;  3V78 A;  3QBM A;  2RAS A;  5D19 A;  2FX0 A;  1JTY A;  3LOC A;  4NN1 A;  1JUP A;  5EYR A;  1U9O A;  3PM1 A;  2Y2Z A;  4X1E A;  1QVT A;  2XGD A;  2I10 A;  2XGE A;  4ACI A;  2OER A;  3LSR A;  3CRJ A;  1UI5 A;  4L62 A;  2UXI A;  4CGR A;  2NS8 A;  1A6I A;  2OPT A;  2ZOZ A;  1QPI A;  3BTJ A;  4GFK A;  3NI7 A;  5J1R A;  5F0H A;  2QIB A;  3Q0U A;  3F1B A;  2YVH A;  4V2F A;  3Q3S A;  3COL A;  3IUV A;  3HGY A;  4M3E A;  4GFL A;  2Y31 A;  5GPA A;  4KWA A;  3EGQ A;  3BR0 A;  3RD3 A;  4JYK A;  2QKO A;  3C2B A;  3QQA A;  1BJZ A;  3V6G A;  5F0C A;  3CDL A;  3MNL A;  1JTX A;  2ID6 A;  2G7G A;  3C07 A;  2OF7 A;  2XDN A;  4JNN A;  2V57 A;  2PBX A;  3VW1 A;  2G7S A;  3G56 A;  2IBD A;  5J1U A;  3QPS A;  2VPR A;  3BR5 A;  2TRT A;  3ON2 A;  5F1J A;  5FKL A;  3HTA A;  4PXI A;  4ABZ A;  5J1Y A;  3LHQ A;  4M3D A;  5FKO A;  2XPV A;  4NEL A;  4G12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...