2PBXA

Vibrio cholerae hapr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
IEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQYSNFLTDHIDLDLDVKTNLQTLCKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERGELCEKHDVDNMASLFHGIFYSIFLQVNRLGEQEAVYKLADSYLNMLCIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Vibrio cholerae Quorum-Sensing Regulatory Protein HapR
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Hemagglutinin/protease regulatory protein
total genus 73
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2pbxA00
2WV1A 3QPLA 4ME9A 2GUHA 4CGRA 3BJBA 4M3EA 5GP9A 4PXIA 3RD3A 3G56A 2EH3A 2FX0A 1JT0A 2G7GA 1JUSA 3F1BA 3CRJA 5J1YA 3S5RA 4ICHA 4JNNA 3BR5A 4KWAA 2TRTA 5HSZA 4D7MA 3Q0WA 4NELA 3HE0A 3HGGA 2RASA 2WUIA 2ZCMA 4I6ZA 2HQ5A 3BCGA 5GPAA 1ORKA 3DPJA 3BTLA 2UXUA 3Q0UA 5DAJA 3BT9A 2FBQA 3VVZA 2XRLA 4GCTA 3ZQLA 2UXPA 3BTCA 3CWRA 3BRUA 3IH2A 5FKOA 2QTQA 4MO7A 5IOYA 3BR2A 3BTIA 3VOKA 3QQAA 1U9OA 3G1LA 4D5CA 5EZGA 2NP5A 5EYRA 5F08A 4NN1A 1QPIA 3SFIA 3VOXA 3COLA 3C2BA 1T56A 2XDNA 3BR3A 3IH4A 1BJZA 4DW6A 3VIBA 2QKOA 2ZCXA 2HXIA 1SGMA 5FGLA 5FKNA 2ID6A 4B3AA 2NX4A 4MXMA 3PASA 4AC6A 2RAEA 3ZQHA 5F1JA 1ZKGA 1T33A 2RHAA 2G7LA 3GZIA 4JKZA 3ON2A 2G0EA 3VP5A 2NS8A 4V2GA 3ON4A 1RKTA 3HTJA 2ID3A 3BR6A 3LSRA 3QBMA 2XGDA 1RPWA 5HAWA 2IU5A 4MK6A 2Y30A 2IBDA 3LHQA 3CJDA 3CCYA 3KZ9A 4JYKA 4GCKA 2QWTA 2XPUA 3WHCA 5D1RA 4AUXA 2HYJA 4I76A 5FKKA 1JUMA 3MVPA 2UXOA 3IUVA 3C07A 4X1EA 3IH3A 2OI8A 3P9TA 3NRGA 5GPCA 3B6CA 3Q0VA 2XPVA 4UDSA 1VI0A 2ZCNA 3AQSA 3VW2A 1RKWA 3V78A 2OPTA 4W1UA 5K7HA 1U9NA 5HBUA 2REKA 3F0CA 2DG7A 2OERA 3KKCA 4M3BA 2DG8A 3VVXA 4M3DA 2XPWA 5F0HA 3TP3A 2QCOA 2JK3A 2UXHA 4B1RA 2GBYA 3SDGA 4AC0A 5D19A 5CXGA 3O60A 3G7RA 2X6OA 3HTHA 4HKUA 3B6AA 3TP0A 3CDLA 2GFNA 2QIBA 3BQZA 4GCLA 5J3LA 4D7NA 1Z0XA 3ANGA 4ACIA 3FK6A 4JL3A 2ZOYA 3HTAA 4G12A 3DEWA 5H9TA 5FMPA 2NP3A 3G1MA 3HGYA 2GENA 2VPRA 3RH2A 4W97A 2G7SA 2O7TA 3VW1A 4ABZA 2ZOZA 1JTXA 2W53A 3LJLA 5F04A 2TCTA 1QVUA 5IPAA 5AQCA 2HXOA 3PM1A 5FKLA 3BQYA 5K58A 4M3GA 2XGCA 5EFYA 3O8HA 2IEKA 2V57A 2JJ7A 3KNWA 1Z77A 2FJ1A 3KKDA 4YZEA 5EZHA 5D18A 2O7OA 4AF5A 2Y2ZA 2FD5A 3NNRA 3AQTA 2G3BA 3LWJA 2Y31A 5CW8A 5F27A 2Q24A 5J1RA 3ZQIA 5CXIA 3VW0A 5J1UA 2XB5A 2PBXA 3ZQGA 5K7ZA 2PZ9A 3QKXA 4L62A 3FRQA 4GFKA 5F0CA 2WGBA 3E7QA 3BHQA 2HKUA 5F0FA 3O8GA 3LSJA 5FKMA 1JUPA 3HIMA 4GFLA 1JTYA 3V6GA 1UI6A 2UXIA 5C4YA 3EGQA 3PPBA 4XK4A 2HYTA 2NS7A 3QPSA 1QVTA 3VPRA 5IP6A 3HTIA 2X9DA 3VUQA 1UI5A 3T6NA 3FK7A 3ZQFA 2DTZA 2VKEA 3GEUA 4V2FA 3JSJA 3NPIA 3DCFA 5K7FA 3B81A 2YVEA 3WHBA 4D5FA 5FHPA 3G1OA 2VKVA 1JT6A 2I10A 3NI7A 2D6YA 2IAIA 3MNLA 1ZK8A 2ZB9A 3VVYA 3BTJA 5IOZA 3BR0A 3NXCA 2FQ4A 3EUPA 4M3FA 2OF7A 3Q3SA 3BR1A 3FIWA 3ANPA 3LOCA 2XGEA 2QOPA 3BNIA 1A6IA 2YVHA 3LSPA 2F07A
chains in the Genus database with same CATH superfamily
2WV1A 3QPLA 2R7WA 4ME9A 2GUHA 4CGRA 3BJBA 4M3EA 5GP9A 4PXIA 4C2MA 2YVXA 3RD3A 3G56A 2EH3A 2FX0A 1JT0A 2G7GA 2FJI1 1JUSA 3F1BA 3CRJA 5J1YA 2PFVA 3S5RA 4ICHA 4JNNA 3BR5A 4KWAA 2TRTA 5HSZA 4WIBA 4D7MA 3Q0WA 4NELA 3HE0A 3HGGA 2RASA 2WUIA 2ZCMA 3DU6A 4I6ZA 2HQ5A 3BCGA 5GPAA 1ORKA 3DPJA 3BTLA 2UXUA 3Q0UA 5DAJA 3BT9A 2FBQA 2B3WA 3VVZA 2XRLA 4GCTA 3ZQLA 2UXPA 3BTCA 3CWRA 3BRUA 3IH2A 5FKOA 2QTQA 4MO7A 5IOYA 3BR2A 3BTIA 3VOKA 3QQAA 1U9OA 3G1LA 4D5CA 5EZGA 2NP5A 5EYRA 5F08A 4NN1A 4U9NA 1QPIA 3SFIA 3VOXA 3COLA 3C2BA 1T56A 2XDNA 3BR3A 3IH4A 1BJZA 4DW6A 3VIBA 2QKOA 2ZCXA 2R7RA 2HXIA 2ZY9A 1SGMA 5FGLA 5FKNA 2ID6A 2R7OA 4B3AA 2NX4A 4MXMA 2B1EA 3PASA 4AC6A 2RAEA 3SWHA 2R7SA 3ZQHA 5F1JA 1ZKGA 1T33A 2RHAA 2G7LA 3GZIA 4DVYP 4JKZA 4OD5A 3ON2A 2G0EA 3VP5A 2NS8A 4V2GA 3ON4A 1RKTA 4OD4A 3HTJA 2ID3A 3BR6A 3LSRA 3QBMA 2XGDA 1RPWA 5HAWA 2IU5A 4MK6A 2Y30A 2IBDA 3LHQA 3CJDA 3CCYA 3KZ9A 4JYKA 4GCKA 2QWTA 2XPUA 3WHCA 2R7XA 5D1RA 4AUXA 2HYJA 4I76A 5FKKA 1JUMA 3MVPA 2UXOA 3IUVA 3C07A 4X1EA 3IH3A 2OI8A 3P9TA 3NRGA 3NS4A 5GPCA 3B6CA 3Q0VA 2XPVA 4UDSA 1VI0A 2ZCNA 3AQSA 3VW2A 1RKWA 3V78A 2OPTA 4W1UA 5K7HA 2A2FX 1U9NA 5HBUA 2REKA 3F0CA 2DG7A 2OERA 3KKCA 4M3BA 2DG8A 3DU5A 3VVXA 4M3DA 2XPWA 5F0HA 3TP3A 2QCOA 2JK3A 2UXHA 4B1RA 2GBYA 3SDGA 2R7TA 5CQGA 4AC0A 5D19A 5CXGA 3O60A 3G7RA 2X6OA 3HTHA 4HKUA 3B6AA 3TP0A 3CDLA 2GFNA 2QIBA 3BQZA 4GCLA 5J3LA 4D7NA 1Z0XA 3ANGA 4ACIA 3FK6A 4JL3A 2ZOYA 3HTAA 4G12A 3DEWA 5H9TA 5FMPA 2NP3A 3G1MA 3HGYA 2GENA 2VPRA 3RH2A 4W97A 2G7SA 2O7TA 3VW1A 4ABZA 2ZOZA 3K8PC 1JTXA 2W53A 3LJLA 5F04A 2TCTA 1QVUA 5IPAA 5AQCA 2HXOA 2R7QA 3PM1A 5FKLA 3BQYA 5K58A 4M3GA 2XGCA 5EFYA 3O8HA 2IEKA 2V57A 2JJ7A 3KNWA 1Z77A 2FJ1A 3KKDA 4YZEA 5EZHA 5D18A 2O7OA 4AF5A 2Y2ZA 2FD5A 3NNRA 3AQTA 2G3BA 3LWJA 2Y31A 5CW8A 5F27A 2Q24A 5J1RA 3ZQIA 5CXIA 3VW0A 5J1UA 4IRVA 2XB5A 2PBXA 3ZQGA 5K7ZA 2PZ9A 3QKXA 4L62A 3FRQA 4GFKA 5F0CA 2WGBA 3E7QA 3VTIA 3BHQA 2HKUA 5F0FA 3O8GA 3LSJA 5FKMA 1JUPA 3HIMA 4GFLA 1JTYA 3V6GA 1UI6A 2UXIA 5C4YA 3EGQA 3PPBA 4XK4A 2HYTA 2NS7A 3QPSA 1QVTA 3VPRA 5IP6A 3HTIA 2X9DA 3VUQA 1UI5A 3T6NA 3FK7A 3ZQFA 2DTZA 2VKEA 3GEUA 4V2FA 3JSJA 3NPIA 3DCFA 5K7FA 3B81A 2YVEA 3WHBA 4D5FA 3FHNA 5FHPA 2R7VA 3G1OA 2VKVA 1JT6A 2I10A 3NI7A 2D6YA 2IAIA 3MNLA 3KYLA 1ZK8A 2ZB9A 3VVYA 3BTJA 5IOZA 3BR0A 3NXCA 2FQ4A 3EUPA 4M3FA 2OF7A 3Q3SA 3BR1A 3FIWA 3ANPA 3LOCA 2XGEA 2QOPA 3BNIA 1A6IA 2YVHA 2R7UA 4U9LA 3LSPA 2F07A
chains in the Genus database with same CATH topology
2WV1A 3QPLA 4ME9A 2GUHA 4CGRA 3BJBA 4M3EA 5GP9A 4PXIA 3RD3A 3G56A 2EH3A 2FX0A 1JT0A 2G7GA 1JUSA 3F1BA 3CRJA 5J1YA 3S5RA 4ICHA 4JNNA 3BR5A 4KWAA 2TRTA 5HSZA 4D7MA 3Q0WA 4NELA 3HE0A 3HGGA 2RASA 2WUIA 2ZCMA 4I6ZA 2HQ5A 3BCGA 5GPAA 1ORKA 3DPJA 3BTLA 2UXUA 3Q0UA 5DAJA 3BT9A 2FBQA 3VVZA 2XRLA 4GCTA 3ZQLA 2UXPA 3BTCA 3CWRA 3BRUA 3IH2A 5FKOA 2QTQA 4MO7A 5IOYA 3BR2A 3BTIA 3VOKA 3QQAA 1U9OA 3G1LA 4D5CA 5EZGA 2NP5A 5EYRA 5F08A 4NN1A 1QPIA 3SFIA 3VOXA 3COLA 3C2BA 1T56A 2XDNA 3BR3A 3IH4A 1BJZA 4DW6A 3VIBA 2QKOA 2ZCXA 2HXIA 1SGMA 5FGLA 5FKNA 2ID6A 4B3AA 2NX4A 4MXMA 3PASA 4AC6A 2RAEA 3ZQHA 5F1JA 1ZKGA 1T33A 2RHAA 2G7LA 3GZIA 4JKZA 3ON2A 2G0EA 3VP5A 2NS8A 4V2GA 3ON4A 1RKTA 3HTJA 2ID3A 3BR6A 3LSRA 3QBMA 2XGDA 1RPWA 5HAWA 2IU5A 4MK6A 2Y30A 2IBDA 3LHQA 3CJDA 3CCYA 3KZ9A 4JYKA 4GCKA 2QWTA 2XPUA 3WHCA 5D1RA 4AUXA 2HYJA 4I76A 5FKKA 1JUMA 3MVPA 2UXOA 3IUVA 3C07A 4X1EA 3IH3A 2OI8A 3P9TA 3NRGA 5GPCA 3B6CA 3Q0VA 2XPVA 4UDSA 1VI0A 2ZCNA 3AQSA 3VW2A 1RKWA 3V78A 2OPTA 4W1UA 5K7HA 1U9NA 5HBUA 2REKA 3F0CA 2DG7A 2OERA 3KKCA 4M3BA 2DG8A 3VVXA 4M3DA 2XPWA 5F0HA 3TP3A 2QCOA 2JK3A 2UXHA 4B1RA 2GBYA 3SDGA 4AC0A 5D19A 5CXGA 3O60A 3G7RA 2X6OA 3HTHA 4HKUA 3B6AA 3TP0A 3CDLA 2GFNA 2QIBA 3BQZA 4GCLA 5J3LA 4D7NA 1Z0XA 3ANGA 4ACIA 3FK6A 4JL3A 2ZOYA 3HTAA 4G12A 3DEWA 5H9TA 5FMPA 2NP3A 3G1MA 3HGYA 2GENA 2VPRA 3RH2A 4W97A 2G7SA 2O7TA 3VW1A 4ABZA 2ZOZA 1JTXA 2W53A 3LJLA 5F04A 2TCTA 1QVUA 5IPAA 5AQCA 2HXOA 3PM1A 5FKLA 3BQYA 5K58A 4M3GA 2XGCA 5EFYA 3O8HA 2IEKA 2V57A 2JJ7A 3KNWA 1Z77A 2FJ1A 3KKDA 4YZEA 5EZHA 5D18A 2O7OA 4AF5A 2Y2ZA 2FD5A 3NNRA 3AQTA 2G3BA 3LWJA 2Y31A 5CW8A 5F27A 2Q24A 5J1RA 3ZQIA 5CXIA 3VW0A 5J1UA 2XB5A 2PBXA 3ZQGA 5K7ZA 2PZ9A 3QKXA 4L62A 3FRQA 4GFKA 5F0CA 2WGBA 3E7QA 3BHQA 2HKUA 5F0FA 3O8GA 3LSJA 5FKMA 1JUPA 3HIMA 4GFLA 1JTYA 3V6GA 1UI6A 2UXIA 5C4YA 3EGQA 3PPBA 4XK4A 2HYTA 2NS7A 3QPSA 1QVTA 3VPRA 5IP6A 3HTIA 2X9DA 3VUQA 1UI5A 3T6NA 3FK7A 3ZQFA 2DTZA 2VKEA 3GEUA 4V2FA 3JSJA 3NPIA 3DCFA 5K7FA 3B81A 2YVEA 3WHBA 4D5FA 5FHPA 3G1OA 2VKVA 1JT6A 2I10A 3NI7A 2D6YA 2IAIA 3MNLA 1ZK8A 2ZB9A 3VVYA 3BTJA 5IOZA 3BR0A 3NXCA 2FQ4A 3EUPA 4M3FA 2OF7A 3Q3SA 3BR1A 3FIWA 3ANPA 3LOCA 2XGEA 2QOPA 3BNIA 1A6IA 2YVHA 3LSPA 2F07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WV1 A;  3QPL A;  4ME9 A;  2GUH A;  4CGR A;  3BJB A;  4M3E A;  5GP9 A;  4PXI A;  3RD3 A;  3G56 A;  2EH3 A;  2FX0 A;  1JT0 A;  2G7G A;  1JUS A;  3F1B A;  3CRJ A;  5J1Y A;  3S5R A;  4ICH A;  4JNN A;  3BR5 A;  4KWA A;  2TRT A;  5HSZ A;  4D7M A;  3Q0W A;  4NEL A;  3HE0 A;  3HGG A;  2RAS A;  2WUI A;  2ZCM A;  4I6Z A;  2HQ5 A;  3BCG A;  5GPA A;  1ORK A;  3DPJ A;  3BTL A;  2UXU A;  3Q0U A;  5DAJ A;  3BT9 A;  2FBQ A;  3VVZ A;  2XRL A;  4GCT A;  3ZQL A;  2UXP A;  3BTC A;  3CWR A;  3BRU A;  3IH2 A;  5FKO A;  2QTQ A;  4MO7 A;  5IOY A;  3BR2 A;  3BTI A;  3VOK A;  3QQA A;  1U9O A;  3G1L A;  4D5C A;  5EZG A;  2NP5 A;  5EYR A;  5F08 A;  4NN1 A;  1QPI A;  3SFI A;  3VOX A;  3COL A;  3C2B A;  1T56 A;  2XDN A;  3BR3 A;  3IH4 A;  1BJZ A;  4DW6 A;  3VIB A;  2QKO A;  2ZCX A;  2HXI A;  1SGM A;  5FGL A;  5FKN A;  2ID6 A;  4B3A A;  2NX4 A;  4MXM A;  3PAS A;  4AC6 A;  2RAE A;  3ZQH A;  5F1J A;  1ZKG A;  1T33 A;  2RHA A;  2G7L A;  3GZI A;  4JKZ A;  3ON2 A;  2G0E A;  3VP5 A;  2NS8 A;  4V2G A;  3ON4 A;  1RKT A;  3HTJ A;  2ID3 A;  3BR6 A;  3LSR A;  3QBM A;  2XGD A;  1RPW A;  5HAW A;  2IU5 A;  4MK6 A;  2Y30 A;  2IBD A;  3LHQ A;  3CJD A;  3CCY A;  3KZ9 A;  4JYK A;  4GCK A;  2QWT A;  2XPU A;  3WHC A;  5D1R A;  4AUX A;  2HYJ A;  4I76 A;  5FKK A;  1JUM A;  3MVP A;  2UXO A;  3IUV A;  3C07 A;  4X1E A;  3IH3 A;  2OI8 A;  3P9T A;  3NRG A;  5GPC A;  3B6C A;  3Q0V A;  2XPV A;  4UDS A;  1VI0 A;  2ZCN A;  3AQS A;  3VW2 A;  1RKW A;  3V78 A;  2OPT A;  4W1U A;  5K7H A;  1U9N A;  5HBU A;  2REK A;  3F0C A;  2DG7 A;  2OER A;  3KKC A;  4M3B A;  2DG8 A;  3VVX A;  4M3D A;  2XPW A;  5F0H A;  3TP3 A;  2QCO A;  2JK3 A;  2UXH A;  4B1R A;  2GBY A;  3SDG A;  4AC0 A;  5D19 A;  5CXG A;  3O60 A;  3G7R A;  2X6O A;  3HTH A;  4HKU A;  3B6A A;  3TP0 A;  3CDL A;  2GFN A;  2QIB A;  3BQZ A;  4GCL A;  5J3L A;  4D7N A;  1Z0X A;  3ANG A;  4ACI A;  3FK6 A;  4JL3 A;  2ZOY A;  3HTA A;  4G12 A;  3DEW A;  5H9T A;  5FMP A;  2NP3 A;  3G1M A;  3HGY A;  2GEN A;  2VPR A;  3RH2 A;  4W97 A;  2G7S A;  2O7T A;  3VW1 A;  4ABZ A;  2ZOZ A;  1JTX A;  2W53 A;  3LJL A;  5F04 A;  2TCT A;  1QVU A;  5IPA A;  5AQC A;  2HXO A;  3PM1 A;  5FKL A;  3BQY A;  5K58 A;  4M3G A;  2XGC A;  5EFY A;  3O8H A;  2IEK A;  2V57 A;  2JJ7 A;  3KNW A;  1Z77 A;  2FJ1 A;  3KKD A;  4YZE A;  5EZH A;  5D18 A;  2O7O A;  4AF5 A;  2Y2Z A;  2FD5 A;  3NNR A;  3AQT A;  2G3B A;  3LWJ A;  2Y31 A;  5CW8 A;  5F27 A;  2Q24 A;  5J1R A;  3ZQI A;  5CXI A;  3VW0 A;  5J1U A;  2XB5 A;  2PBX A;  3ZQG A;  5K7Z A;  2PZ9 A;  3QKX A;  4L62 A;  3FRQ A;  4GFK A;  5F0C A;  2WGB A;  3E7Q A;  3BHQ A;  2HKU A;  5F0F A;  3O8G A;  3LSJ A;  5FKM A;  1JUP A;  3HIM A;  4GFL A;  1JTY A;  3V6G A;  1UI6 A;  2UXI A;  5C4Y A;  3EGQ A;  3PPB A;  4XK4 A;  2HYT A;  2NS7 A;  3QPS A;  1QVT A;  3VPR A;  5IP6 A;  3HTI A;  2X9D A;  3VUQ A;  1UI5 A;  3T6N A;  3FK7 A;  3ZQF A;  2DTZ A;  2VKE A;  3GEU A;  4V2F A;  3JSJ A;  3NPI A;  3DCF A;  5K7F A;  3B81 A;  2YVE A;  3WHB A;  4D5F A;  5FHP A;  3G1O A;  2VKV A;  1JT6 A;  2I10 A;  3NI7 A;  2D6Y A;  2IAI A;  3MNL A;  1ZK8 A;  2ZB9 A;  3VVY A;  3BTJ A;  5IOZ A;  3BR0 A;  3NXC A;  2FQ4 A;  3EUP A;  4M3F A;  2OF7 A;  3Q3S A;  3BR1 A;  3FIW A;  3ANP A;  3LOC A;  2XGE A;  2QOP A;  3BNI A;  1A6I A;  2YVH A;  3LSP A;  2F07 A; 
#chains in the Genus database with same CATH topology
 2WV1 A;  3QPL A;  2R7W A;  4ME9 A;  2GUH A;  4CGR A;  3BJB A;  4M3E A;  5GP9 A;  4PXI A;  4C2M A;  2YVX A;  3RD3 A;  3G56 A;  2EH3 A;  2FX0 A;  1JT0 A;  2G7G A;  2FJI 1;  1JUS A;  3F1B A;  3CRJ A;  5J1Y A;  2PFV A;  3S5R A;  4ICH A;  4JNN A;  3BR5 A;  4KWA A;  2TRT A;  5HSZ A;  4WIB A;  4D7M A;  3Q0W A;  4NEL A;  3HE0 A;  3HGG A;  2RAS A;  2WUI A;  2ZCM A;  3DU6 A;  4I6Z A;  2HQ5 A;  3BCG A;  5GPA A;  1ORK A;  3DPJ A;  3BTL A;  2UXU A;  3Q0U A;  5DAJ A;  3BT9 A;  2FBQ A;  2B3W A;  3VVZ A;  2XRL A;  4GCT A;  3ZQL A;  2UXP A;  3BTC A;  3CWR A;  3BRU A;  3IH2 A;  5FKO A;  2QTQ A;  4MO7 A;  5IOY A;  3BR2 A;  3BTI A;  3VOK A;  3QQA A;  1U9O A;  3G1L A;  4D5C A;  5EZG A;  2NP5 A;  5EYR A;  5F08 A;  4NN1 A;  4U9N A;  1QPI A;  3SFI A;  3VOX A;  3COL A;  3C2B A;  1T56 A;  2XDN A;  3BR3 A;  3IH4 A;  1BJZ A;  4DW6 A;  3VIB A;  2QKO A;  2ZCX A;  2R7R A;  2HXI A;  2ZY9 A;  1SGM A;  5FGL A;  5FKN A;  2ID6 A;  2R7O A;  4B3A A;  2NX4 A;  4MXM A;  2B1E A;  3PAS A;  4AC6 A;  2RAE A;  3SWH A;  2R7S A;  3ZQH A;  5F1J A;  1ZKG A;  1T33 A;  2RHA A;  2G7L A;  3GZI A;  4DVY P;  4JKZ A;  4OD5 A;  3ON2 A;  2G0E A;  3VP5 A;  2NS8 A;  4V2G A;  3ON4 A;  1RKT A;  4OD4 A;  3HTJ A;  2ID3 A;  3BR6 A;  3LSR A;  3QBM A;  2XGD A;  1RPW A;  5HAW A;  2IU5 A;  4MK6 A;  2Y30 A;  2IBD A;  3LHQ A;  3CJD A;  3CCY A;  3KZ9 A;  4JYK A;  4GCK A;  2QWT A;  2XPU A;  3WHC A;  2R7X A;  5D1R A;  4AUX A;  2HYJ A;  4I76 A;  5FKK A;  1JUM A;  3MVP A;  2UXO A;  3IUV A;  3C07 A;  4X1E A;  3IH3 A;  2OI8 A;  3P9T A;  3NRG A;  3NS4 A;  5GPC A;  3B6C A;  3Q0V A;  2XPV A;  4UDS A;  1VI0 A;  2ZCN A;  3AQS A;  3VW2 A;  1RKW A;  3V78 A;  2OPT A;  4W1U A;  5K7H A;  2A2F X;  1U9N A;  5HBU A;  2REK A;  3F0C A;  2DG7 A;  2OER A;  3KKC A;  4M3B A;  2DG8 A;  3DU5 A;  3VVX A;  4M3D A;  2XPW A;  5F0H A;  3TP3 A;  2QCO A;  2JK3 A;  2UXH A;  4B1R A;  2GBY A;  3SDG A;  2R7T A;  5CQG A;  4AC0 A;  5D19 A;  5CXG A;  3O60 A;  3G7R A;  2X6O A;  3HTH A;  4HKU A;  3B6A A;  3TP0 A;  3CDL A;  2GFN A;  2QIB A;  3BQZ A;  4GCL A;  5J3L A;  4D7N A;  1Z0X A;  3ANG A;  4ACI A;  3FK6 A;  4JL3 A;  2ZOY A;  3HTA A;  4G12 A;  3DEW A;  5H9T A;  5FMP A;  2NP3 A;  3G1M A;  3HGY A;  2GEN A;  2VPR A;  3RH2 A;  4W97 A;  2G7S A;  2O7T A;  3VW1 A;  4ABZ A;  2ZOZ A;  3K8P C;  1JTX A;  2W53 A;  3LJL A;  5F04 A;  2TCT A;  1QVU A;  5IPA A;  5AQC A;  2HXO A;  2R7Q A;  3PM1 A;  5FKL A;  3BQY A;  5K58 A;  4M3G A;  2XGC A;  5EFY A;  3O8H A;  2IEK A;  2V57 A;  2JJ7 A;  3KNW A;  1Z77 A;  2FJ1 A;  3KKD A;  4YZE A;  5EZH A;  5D18 A;  2O7O A;  4AF5 A;  2Y2Z A;  2FD5 A;  3NNR A;  3AQT A;  2G3B A;  3LWJ A;  2Y31 A;  5CW8 A;  5F27 A;  2Q24 A;  5J1R A;  3ZQI A;  5CXI A;  3VW0 A;  5J1U A;  4IRV A;  2XB5 A;  2PBX A;  3ZQG A;  5K7Z A;  2PZ9 A;  3QKX A;  4L62 A;  3FRQ A;  4GFK A;  5F0C A;  2WGB A;  3E7Q A;  3VTI A;  3BHQ A;  2HKU A;  5F0F A;  3O8G A;  3LSJ A;  5FKM A;  1JUP A;  3HIM A;  4GFL A;  1JTY A;  3V6G A;  1UI6 A;  2UXI A;  5C4Y A;  3EGQ A;  3PPB A;  4XK4 A;  2HYT A;  2NS7 A;  3QPS A;  1QVT A;  3VPR A;  5IP6 A;  3HTI A;  2X9D A;  3VUQ A;  1UI5 A;  3T6N A;  3FK7 A;  3ZQF A;  2DTZ A;  2VKE A;  3GEU A;  4V2F A;  3JSJ A;  3NPI A;  3DCF A;  5K7F A;  3B81 A;  2YVE A;  3WHB A;  4D5F A;  3FHN A;  5FHP A;  2R7V A;  3G1O A;  2VKV A;  1JT6 A;  2I10 A;  3NI7 A;  2D6Y A;  2IAI A;  3MNL A;  3KYL A;  1ZK8 A;  2ZB9 A;  3VVY A;  3BTJ A;  5IOZ A;  3BR0 A;  3NXC A;  2FQ4 A;  3EUP A;  4M3F A;  2OF7 A;  3Q3S A;  3BR1 A;  3FIW A;  3ANP A;  3LOC A;  2XGE A;  2QOP A;  3BNI A;  1A6I A;  2YVH A;  2R7U A;  4U9L A;  3LSP A;  2F07 A; 
#chains in the Genus database with same CATH homology
 2WV1 A;  3QPL A;  4ME9 A;  2GUH A;  4CGR A;  3BJB A;  4M3E A;  5GP9 A;  4PXI A;  3RD3 A;  3G56 A;  2EH3 A;  2FX0 A;  1JT0 A;  2G7G A;  1JUS A;  3F1B A;  3CRJ A;  5J1Y A;  3S5R A;  4ICH A;  4JNN A;  3BR5 A;  4KWA A;  2TRT A;  5HSZ A;  4D7M A;  3Q0W A;  4NEL A;  3HE0 A;  3HGG A;  2RAS A;  2WUI A;  2ZCM A;  4I6Z A;  2HQ5 A;  3BCG A;  5GPA A;  1ORK A;  3DPJ A;  3BTL A;  2UXU A;  3Q0U A;  5DAJ A;  3BT9 A;  2FBQ A;  3VVZ A;  2XRL A;  4GCT A;  3ZQL A;  2UXP A;  3BTC A;  3CWR A;  3BRU A;  3IH2 A;  5FKO A;  2QTQ A;  4MO7 A;  5IOY A;  3BR2 A;  3BTI A;  3VOK A;  3QQA A;  1U9O A;  3G1L A;  4D5C A;  5EZG A;  2NP5 A;  5EYR A;  5F08 A;  4NN1 A;  1QPI A;  3SFI A;  3VOX A;  3COL A;  3C2B A;  1T56 A;  2XDN A;  3BR3 A;  3IH4 A;  1BJZ A;  4DW6 A;  3VIB A;  2QKO A;  2ZCX A;  2HXI A;  1SGM A;  5FGL A;  5FKN A;  2ID6 A;  4B3A A;  2NX4 A;  4MXM A;  3PAS A;  4AC6 A;  2RAE A;  3ZQH A;  5F1J A;  1ZKG A;  1T33 A;  2RHA A;  2G7L A;  3GZI A;  4JKZ A;  3ON2 A;  2G0E A;  3VP5 A;  2NS8 A;  4V2G A;  3ON4 A;  1RKT A;  3HTJ A;  2ID3 A;  3BR6 A;  3LSR A;  3QBM A;  2XGD A;  1RPW A;  5HAW A;  2IU5 A;  4MK6 A;  2Y30 A;  2IBD A;  3LHQ A;  3CJD A;  3CCY A;  3KZ9 A;  4JYK A;  4GCK A;  2QWT A;  2XPU A;  3WHC A;  5D1R A;  4AUX A;  2HYJ A;  4I76 A;  5FKK A;  1JUM A;  3MVP A;  2UXO A;  3IUV A;  3C07 A;  4X1E A;  3IH3 A;  2OI8 A;  3P9T A;  3NRG A;  5GPC A;  3B6C A;  3Q0V A;  2XPV A;  4UDS A;  1VI0 A;  2ZCN A;  3AQS A;  3VW2 A;  1RKW A;  3V78 A;  2OPT A;  4W1U A;  5K7H A;  1U9N A;  5HBU A;  2REK A;  3F0C A;  2DG7 A;  2OER A;  3KKC A;  4M3B A;  2DG8 A;  3VVX A;  4M3D A;  2XPW A;  5F0H A;  3TP3 A;  2QCO A;  2JK3 A;  2UXH A;  4B1R A;  2GBY A;  3SDG A;  4AC0 A;  5D19 A;  5CXG A;  3O60 A;  3G7R A;  2X6O A;  3HTH A;  4HKU A;  3B6A A;  3TP0 A;  3CDL A;  2GFN A;  2QIB A;  3BQZ A;  4GCL A;  5J3L A;  4D7N A;  1Z0X A;  3ANG A;  4ACI A;  3FK6 A;  4JL3 A;  2ZOY A;  3HTA A;  4G12 A;  3DEW A;  5H9T A;  5FMP A;  2NP3 A;  3G1M A;  3HGY A;  2GEN A;  2VPR A;  3RH2 A;  4W97 A;  2G7S A;  2O7T A;  3VW1 A;  4ABZ A;  2ZOZ A;  1JTX A;  2W53 A;  3LJL A;  5F04 A;  2TCT A;  1QVU A;  5IPA A;  5AQC A;  2HXO A;  3PM1 A;  5FKL A;  3BQY A;  5K58 A;  4M3G A;  2XGC A;  5EFY A;  3O8H A;  2IEK A;  2V57 A;  2JJ7 A;  3KNW A;  1Z77 A;  2FJ1 A;  3KKD A;  4YZE A;  5EZH A;  5D18 A;  2O7O A;  4AF5 A;  2Y2Z A;  2FD5 A;  3NNR A;  3AQT A;  2G3B A;  3LWJ A;  2Y31 A;  5CW8 A;  5F27 A;  2Q24 A;  5J1R A;  3ZQI A;  5CXI A;  3VW0 A;  5J1U A;  2XB5 A;  2PBX A;  3ZQG A;  5K7Z A;  2PZ9 A;  3QKX A;  4L62 A;  3FRQ A;  4GFK A;  5F0C A;  2WGB A;  3E7Q A;  3BHQ A;  2HKU A;  5F0F A;  3O8G A;  3LSJ A;  5FKM A;  1JUP A;  3HIM A;  4GFL A;  1JTY A;  3V6G A;  1UI6 A;  2UXI A;  5C4Y A;  3EGQ A;  3PPB A;  4XK4 A;  2HYT A;  2NS7 A;  3QPS A;  1QVT A;  3VPR A;  5IP6 A;  3HTI A;  2X9D A;  3VUQ A;  1UI5 A;  3T6N A;  3FK7 A;  3ZQF A;  2DTZ A;  2VKE A;  3GEU A;  4V2F A;  3JSJ A;  3NPI A;  3DCF A;  5K7F A;  3B81 A;  2YVE A;  3WHB A;  4D5F A;  5FHP A;  3G1O A;  2VKV A;  1JT6 A;  2I10 A;  3NI7 A;  2D6Y A;  2IAI A;  3MNL A;  1ZK8 A;  2ZB9 A;  3VVY A;  3BTJ A;  5IOZ A;  3BR0 A;  3NXC A;  2FQ4 A;  3EUP A;  4M3F A;  2OF7 A;  3Q3S A;  3BR1 A;  3FIW A;  3ANP A;  3LOC A;  2XGE A;  2QOP A;  3BNI A;  1A6I A;  2YVH A;  3LSP A;  2F07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...