2PBXA

Vibrio cholerae hapr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
b'IEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQYSNFLTDHIDLDLDVKTNLQTLCKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERGELCEKHDVDNMASLFHGIFYSIFLQVNRLGEQEAVYKLADSYLNMLCIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin/protease regulatory protein
molecule tags Transcription
source organism Vibrio cholerae
publication title Crystal structure of the Vibrio cholerae Quorum-Sensing Regulatory Protein HapR
pubmed doi rcsb
total genus 73
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2pbxA00
2FD5A 3PPBA 1QPIA 2XGDA 3ZQLA 3HGGA 3ZQGA 4GFLA 1JT6A 3C07A 5J1UA 4M3EA 5D18A 4M3DA 1JUMA 5EZHA 2QOPA 5J1RA 5EZGA 3HE0A 5FMPA 2G3BA 4D5FA 4AUXA 2ID6A 2GUHA 3VOKA 2F07A 4D5CA 1A6IA 2Y31A 2UXUA 5F1JA 5F27A 5HAWA 4V2FA 5F0CA 3E7QA 2Y2ZA 4GCKA 5FKKA 4W97A 3VW0A 3KKCA 3T6NA 2NX4A 1UI5A 3FIWA 3HTHA 1ZK8A 1JTXA 2IBDA 2O7TA 2TRTA 5AQCA 3BR0A 2XGEA 2XPWA 4UDSA 3O60A 2QKOA 3KKDA 2Q24A 3GEUA 3BHQA 2ID3A 5J3LA 1QVUA 2FQ4A 3BR2A 1T56A 2IAIA 3VOXA 3NPIA 3LSJA 2OI8A 2VKEA 1T33A 3AQTA 2WV1A 2REKA 2ZOZA 2ZB9A 4YZEA 5FKMA 2GFNA 3F1BA 2Y30A 2G7GA 2QWTA 2NP3A 3QBMA 2OERA 3EGQA 3LSRA 3GZIA 5IP6A 3WHCA 2XDNA 1RPWA 2WGBA 4L62A 2ZCXA 5D1RA 2HYTA 5GPCA 2X6OA 3BJBA 1SGMA 2JJ7A 3NI7A 4NELA 4AF5A 2DG8A 2QTQA 3HTIA 4I76A 1ZKGA 3HTAA 1RKWA 3G1LA 3QPSA 1JUSA 2UXPA 3FRQA 5F04A 5CXIA 2PBXA 3BR1A 5C4YA 3ON4A 1UI6A 1BJZA 3BRUA 3VIBA 3RH2A 1JT0A 2UXIA 2TCTA 2JK3A 4D7NA 3IUVA 2G7SA 3ZQIA 5GPAA 2ZCMA 3G1MA 5F0FA 3ZQFA 4JKZA 2XGCA 4JYKA 2XPUA 4JNNA 5FGLA 3BTJA 3LOCA 2HYJA 2ZOYA 4GCTA 2I10A 5EYRA 3FK7A 4MK6A 3O8GA 2OPTA 2EH3A 3BNIA 3WHBA 2V57A 3BQYA 2OF7A 1RKTA 2XB5A 2G7LA 3VW1A 5HBUA 3VUQA 2YVEA 4M3GA 3AQSA 3CCYA 3IH2A 4I6ZA 5IOZA 3BTIA 5F08A 3VVZA 2WUIA 2FBQA 4D7MA 3ANGA 4M3FA 1VI0A 2RHAA 3BTLA 1QVTA 2O7OA 3QQAA 2X9DA 4HKUA 3VP5A 2RAEA 3DPJA 5DAJA 2W53A 2UXOA 2HKUA 3PM1A 3VVYA 3VPRA 5GP9A 4NN1A 2GBYA 2D6YA 3G1OA 3CJDA 4DW6A 3HTJA 3KNWA 4ACIA 4ME9A 3IH4A 1Z77A 3LSPA 3C2BA 2YVHA 2HQ5A 2NP5A 2QCOA 2HXOA 3HIMA 3NXCA 3BR3A 5IPAA 3VW2A 3G7RA 4GFKA 3LWJA 3CWRA 3QPLA 4B3AA 2IU5A 5D19A 3COLA 5CXGA 2VKVA 3HGYA 3ANPA 5CW8A 3Q0VA 3TP3A 3DEWA 3V6GA 3NNRA 5IOYA 4AC0A 3NRGA 4G12A 3LJLA 2G0EA 1ORKA 3BQZA 3DCFA 3G56A 4JL3A 3IH3A 3TP0A 2NS8A 1JTYA 3B6CA 3B81A 4MXMA 2QIBA 4X1EA 4ICHA 4AC6A 5F0HA 3ON2A 3RD3A 3VVXA 4W1UA 3O8HA 3MVPA 3QKXA 5FHPA 3Q0UA 3SFIA 3MNLA 2GENA 4GCLA 2DTZA 2PZ9A 3CDLA 1U9NA 5J1YA 4ABZA 4KWAA 3CRJA 1JUPA 2FX0A 3B6AA 5FKNA 4PXIA 3Q0WA 4M3BA 2NS7A 2VPRA 5FKOA 2XRLA 3F0CA 2RASA 3FK6A 2DG7A 3EUPA 3KZ9A 3BT9A 4MO7A 2XPVA 2HXIA 3S5RA 5K7FA 5EFYA 2ZCNA 5K58A 4V2GA 3BR5A 4CGRA 3PASA 4B1RA 3P9TA 3BCGA 3LHQA 5K7ZA 1U9OA 3BR6A 2FJ1A 2IEKA 5H9TA 5K7HA 3V78A 5FKLA 4XK4A 3SDGA 1Z0XA 3Q3SA 3ZQHA 3BTCA 5HSZA 3JSJA 2UXHA
chains in the Genus database with same CATH superfamily
2R7VA 2FD5A 3PPBA 1QPIA 2XGDA 3ZQLA 3HGGA 3ZQGA 4GFLA 1JT6A 3C07A 5J1UA 4M3EA 5D18A 4M3DA 2ZY9A 1JUMA 5EZHA 2QOPA 5J1RA 5EZGA 3HE0A 5FMPA 4OD4A 2G3BA 4D5FA 4AUXA 4U9LA 2R7XA 2ID6A 2GUHA 3VOKA 2F07A 4D5CA 1A6IA 2Y31A 2UXUA 5F1JA 5F27A 5HAWA 4V2FA 3DU6A 5F0CA 3E7QA 2Y2ZA 4GCKA 5FKKA 4W97A 3VW0A 3KKCA 3T6NA 2NX4A 1UI5A 3FIWA 3HTHA 1ZK8A 2B3WA 4DVYP 1JTXA 2IBDA 2O7TA 2TRTA 5AQCA 3BR0A 2XGEA 2XPWA 4UDSA 3O60A 2QKOA 4OD5A 3KKDA 2Q24A 3GEUA 2R7WA 3BHQA 2ID3A 5J3LA 1QVUA 2FQ4A 3BR2A 1T56A 2IAIA 3VOXA 3NPIA 3LSJA 2OI8A 2VKEA 3KYLA 1T33A 3AQTA 4U9NA 2WV1A 2REKA 2ZOZA 2ZB9A 4YZEA 5FKMA 2GFNA 3F1BA 2Y30A 2G7GA 2QWTA 2NP3A 3QBMA 2OERA 3EGQA 3LSRA 3GZIA 5IP6A 3WHCA 2XDNA 1RPWA 2WGBA 4L62A 2ZCXA 5D1RA 2HYTA 5GPCA 2X6OA 3BJBA 1SGMA 2JJ7A 3NI7A 2R7OA 2PFVA 4NELA 4AF5A 2DG8A 2QTQA 3HTIA 4I76A 1ZKGA 3HTAA 1RKWA 3G1LA 3QPSA 1JUSA 2UXPA 3FRQA 5F04A 5CXIA 2PBXA 3BR1A 5C4YA 3ON4A 1UI6A 1BJZA 3BRUA 3VIBA 3RH2A 1JT0A 2UXIA 2TCTA 2JK3A 4D7NA 3IUVA 2G7SA 3ZQIA 5GPAA 2B1EA 2ZCMA 3G1MA 5F0FA 3ZQFA 4JKZA 2XGCA 4JYKA 2XPUA 4JNNA 5FGLA 3BTJA 3LOCA 3FHNA 2HYJA 2ZOYA 4GCTA 2I10A 5EYRA 3FK7A 4MK6A 3O8GA 2OPTA 2EH3A 3BNIA 3WHBA 2V57A 3BQYA 2OF7A 1RKTA 2XB5A 2G7LA 3VW1A 5HBUA 3VUQA 2YVEA 4M3GA 3AQSA 3CCYA 3IH2A 4I6ZA 5IOZA 3BTIA 5F08A 3VVZA 2WUIA 2FBQA 4D7MA 3ANGA 4M3FA 1VI0A 2RHAA 3BTLA 1QVTA 2O7OA 3QQAA 2X9DA 2R7QA 4HKUA 3VP5A 2RAEA 3DPJA 4WIBA 5DAJA 2W53A 2UXOA 2HKUA 3PM1A 3VVYA 3VPRA 4IRVA 5GP9A 4NN1A 3NS4A 2GBYA 2D6YA 3G1OA 3CJDA 4DW6A 3HTJA 3KNWA 4ACIA 4ME9A 3IH4A 1Z77A 3LSPA 3C2BA 2YVHA 2HQ5A 2NP5A 2QCOA 2HXOA 3HIMA 3NXCA 3BR3A 5IPAA 3VW2A 3G7RA 4GFKA 3LWJA 3CWRA 3QPLA 4B3AA 2IU5A 5D19A 3COLA 5CXGA 2VKVA 3HGYA 3ANPA 5CW8A 3Q0VA 3TP3A 3DEWA 3V6GA 3NNRA 5IOYA 4AC0A 3NRGA 4G12A 3LJLA 2R7RA 2G0EA 1ORKA 3BQZA 3DCFA 3G56A 4JL3A 3IH3A 3TP0A 2NS8A 1JTYA 3B6CA 3B81A 4MXMA 2QIBA 4X1EA 2R7TA 3K8PC 4ICHA 4AC6A 5F0HA 3ON2A 3RD3A 3VVXA 3SWHA 4W1UA 3O8HA 3MVPA 3QKXA 5FHPA 3Q0UA 3SFIA 3MNLA 2GENA 4GCLA 2DTZA 2PZ9A 3CDLA 1U9NA 5J1YA 4ABZA 4KWAA 3CRJA 1JUPA 5CQGA 2FX0A 2YVXA 3B6AA 5FKNA 4PXIA 3Q0WA 4M3BA 2NS7A 2FJI1 2VPRA 2R7UA 5FKOA 2A2FX 2XRLA 3F0CA 2RASA 3FK6A 2DG7A 3EUPA 3KZ9A 3BT9A 4MO7A 2XPVA 2HXIA 3S5RA 5K7FA 5EFYA 3VTIA 2ZCNA 5K58A 4V2GA 3BR5A 4CGRA 3PASA 4B1RA 3P9TA 3DU5A 3BCGA 3LHQA 1U9OA 5K7ZA 3BR6A 2FJ1A 2IEKA 5H9TA 5K7HA 4C2MA 3V78A 5FKLA 4XK4A 3SDGA 1Z0XA 3Q3SA 2R7SA 3ZQHA 3BTCA 5HSZA 3JSJA 2UXHA
chains in the Genus database with same CATH topology
2FD5A 3PPBA 1QPIA 2XGDA 3ZQLA 3HGGA 3ZQGA 4GFLA 1JT6A 3C07A 5J1UA 4M3EA 5D18A 4M3DA 1JUMA 5EZHA 2QOPA 5J1RA 5EZGA 3HE0A 5FMPA 2G3BA 4D5FA 4AUXA 2ID6A 2GUHA 3VOKA 2F07A 4D5CA 1A6IA 2Y31A 2UXUA 5F1JA 5F27A 5HAWA 4V2FA 5F0CA 3E7QA 2Y2ZA 4GCKA 5FKKA 4W97A 3VW0A 3KKCA 3T6NA 2NX4A 1UI5A 3FIWA 3HTHA 1ZK8A 1JTXA 2IBDA 2O7TA 2TRTA 5AQCA 3BR0A 2XGEA 2XPWA 4UDSA 3O60A 2QKOA 3KKDA 2Q24A 3GEUA 3BHQA 2ID3A 5J3LA 1QVUA 2FQ4A 3BR2A 1T56A 2IAIA 3VOXA 3NPIA 3LSJA 2OI8A 2VKEA 1T33A 3AQTA 2WV1A 2REKA 2ZOZA 2ZB9A 4YZEA 5FKMA 2GFNA 3F1BA 2Y30A 2G7GA 2QWTA 2NP3A 3QBMA 2OERA 3EGQA 3LSRA 3GZIA 5IP6A 3WHCA 2XDNA 1RPWA 2WGBA 4L62A 2ZCXA 5D1RA 2HYTA 5GPCA 2X6OA 3BJBA 1SGMA 2JJ7A 3NI7A 4NELA 4AF5A 2DG8A 2QTQA 3HTIA 4I76A 1ZKGA 3HTAA 1RKWA 3G1LA 3QPSA 1JUSA 2UXPA 3FRQA 5F04A 5CXIA 2PBXA 3BR1A 5C4YA 3ON4A 1UI6A 1BJZA 3BRUA 3VIBA 3RH2A 1JT0A 2UXIA 2TCTA 2JK3A 4D7NA 3IUVA 2G7SA 3ZQIA 5GPAA 2ZCMA 3G1MA 5F0FA 3ZQFA 4JKZA 2XGCA 4JYKA 2XPUA 4JNNA 5FGLA 3BTJA 3LOCA 2HYJA 2ZOYA 4GCTA 2I10A 5EYRA 3FK7A 4MK6A 3O8GA 2OPTA 2EH3A 3BNIA 3WHBA 2V57A 3BQYA 2OF7A 1RKTA 2XB5A 2G7LA 3VW1A 5HBUA 3VUQA 2YVEA 4M3GA 3AQSA 3CCYA 3IH2A 4I6ZA 5IOZA 3BTIA 5F08A 3VVZA 2WUIA 2FBQA 4D7MA 3ANGA 4M3FA 1VI0A 2RHAA 3BTLA 1QVTA 2O7OA 3QQAA 2X9DA 4HKUA 3VP5A 2RAEA 3DPJA 5DAJA 2W53A 2UXOA 2HKUA 3PM1A 3VVYA 3VPRA 5GP9A 4NN1A 2GBYA 2D6YA 3G1OA 3CJDA 4DW6A 3HTJA 3KNWA 4ACIA 4ME9A 3IH4A 1Z77A 3LSPA 3C2BA 2YVHA 2HQ5A 2NP5A 2QCOA 2HXOA 3HIMA 3NXCA 3BR3A 5IPAA 3VW2A 3G7RA 4GFKA 3LWJA 3CWRA 3QPLA 4B3AA 2IU5A 5D19A 3COLA 5CXGA 2VKVA 3HGYA 3ANPA 5CW8A 3Q0VA 3TP3A 3DEWA 3V6GA 3NNRA 5IOYA 4AC0A 3NRGA 4G12A 3LJLA 2G0EA 1ORKA 3BQZA 3DCFA 3G56A 4JL3A 3IH3A 3TP0A 2NS8A 1JTYA 3B6CA 3B81A 4MXMA 2QIBA 4X1EA 4ICHA 4AC6A 5F0HA 3ON2A 3RD3A 3VVXA 4W1UA 3O8HA 3MVPA 3QKXA 5FHPA 3Q0UA 3SFIA 3MNLA 2GENA 4GCLA 2DTZA 2PZ9A 3CDLA 1U9NA 5J1YA 4ABZA 4KWAA 3CRJA 1JUPA 2FX0A 3B6AA 5FKNA 4PXIA 3Q0WA 4M3BA 2NS7A 2VPRA 5FKOA 2XRLA 3F0CA 2RASA 3FK6A 2DG7A 3EUPA 3KZ9A 3BT9A 4MO7A 2XPVA 2HXIA 3S5RA 5K7FA 5EFYA 2ZCNA 5K58A 4V2GA 3BR5A 4CGRA 3PASA 4B1RA 3P9TA 3BCGA 3LHQA 5K7ZA 1U9OA 3BR6A 2FJ1A 2IEKA 5H9TA 5K7HA 3V78A 5FKLA 4XK4A 3SDGA 1Z0XA 3Q3SA 3ZQHA 3BTCA 5HSZA 3JSJA 2UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  3PPB A;  1QPI A;  2XGD A;  3ZQL A;  3HGG A;  3ZQG A;  4GFL A;  1JT6 A;  3C07 A;  5J1U A;  4M3E A;  5D18 A;  4M3D A;  1JUM A;  5EZH A;  2QOP A;  5J1R A;  5EZG A;  3HE0 A;  5FMP A;  2G3B A;  4D5F A;  4AUX A;  2ID6 A;  2GUH A;  3VOK A;  2F07 A;  4D5C A;  1A6I A;  2Y31 A;  2UXU A;  5F1J A;  5F27 A;  5HAW A;  4V2F A;  5F0C A;  3E7Q A;  2Y2Z A;  4GCK A;  5FKK A;  4W97 A;  3VW0 A;  3KKC A;  3T6N A;  2NX4 A;  1UI5 A;  3FIW A;  3HTH A;  1ZK8 A;  1JTX A;  2IBD A;  2O7T A;  2TRT A;  5AQC A;  3BR0 A;  2XGE A;  2XPW A;  4UDS A;  3O60 A;  2QKO A;  3KKD A;  2Q24 A;  3GEU A;  3BHQ A;  2ID3 A;  5J3L A;  1QVU A;  2FQ4 A;  3BR2 A;  1T56 A;  2IAI A;  3VOX A;  3NPI A;  3LSJ A;  2OI8 A;  2VKE A;  1T33 A;  3AQT A;  2WV1 A;  2REK A;  2ZOZ A;  2ZB9 A;  4YZE A;  5FKM A;  2GFN A;  3F1B A;  2Y30 A;  2G7G A;  2QWT A;  2NP3 A;  3QBM A;  2OER A;  3EGQ A;  3LSR A;  3GZI A;  5IP6 A;  3WHC A;  2XDN A;  1RPW A;  2WGB A;  4L62 A;  2ZCX A;  5D1R A;  2HYT A;  5GPC A;  2X6O A;  3BJB A;  1SGM A;  2JJ7 A;  3NI7 A;  4NEL A;  4AF5 A;  2DG8 A;  2QTQ A;  3HTI A;  4I76 A;  1ZKG A;  3HTA A;  1RKW A;  3G1L A;  3QPS A;  1JUS A;  2UXP A;  3FRQ A;  5F04 A;  5CXI A;  2PBX A;  3BR1 A;  5C4Y A;  3ON4 A;  1UI6 A;  1BJZ A;  3BRU A;  3VIB A;  3RH2 A;  1JT0 A;  2UXI A;  2TCT A;  2JK3 A;  4D7N A;  3IUV A;  2G7S A;  3ZQI A;  5GPA A;  2ZCM A;  3G1M A;  5F0F A;  3ZQF A;  4JKZ A;  2XGC A;  4JYK A;  2XPU A;  4JNN A;  5FGL A;  3BTJ A;  3LOC A;  2HYJ A;  2ZOY A;  4GCT A;  2I10 A;  5EYR A;  3FK7 A;  4MK6 A;  3O8G A;  2OPT A;  2EH3 A;  3BNI A;  3WHB A;  2V57 A;  3BQY A;  2OF7 A;  1RKT A;  2XB5 A;  2G7L A;  3VW1 A;  5HBU A;  3VUQ A;  2YVE A;  4M3G A;  3AQS A;  3CCY A;  3IH2 A;  4I6Z A;  5IOZ A;  3BTI A;  5F08 A;  3VVZ A;  2WUI A;  2FBQ A;  4D7M A;  3ANG A;  4M3F A;  1VI0 A;  2RHA A;  3BTL A;  1QVT A;  2O7O A;  3QQA A;  2X9D A;  4HKU A;  3VP5 A;  2RAE A;  3DPJ A;  5DAJ A;  2W53 A;  2UXO A;  2HKU A;  3PM1 A;  3VVY A;  3VPR A;  5GP9 A;  4NN1 A;  2GBY A;  2D6Y A;  3G1O A;  3CJD A;  4DW6 A;  3HTJ A;  3KNW A;  4ACI A;  4ME9 A;  3IH4 A;  1Z77 A;  3LSP A;  3C2B A;  2YVH A;  2HQ5 A;  2NP5 A;  2QCO A;  2HXO A;  3HIM A;  3NXC A;  3BR3 A;  5IPA A;  3VW2 A;  3G7R A;  4GFK A;  3LWJ A;  3CWR A;  3QPL A;  4B3A A;  2IU5 A;  5D19 A;  3COL A;  5CXG A;  2VKV A;  3HGY A;  3ANP A;  5CW8 A;  3Q0V A;  3TP3 A;  3DEW A;  3V6G A;  3NNR A;  5IOY A;  4AC0 A;  3NRG A;  4G12 A;  3LJL A;  2G0E A;  1ORK A;  3BQZ A;  3DCF A;  3G56 A;  4JL3 A;  3IH3 A;  3TP0 A;  2NS8 A;  1JTY A;  3B6C A;  3B81 A;  4MXM A;  2QIB A;  4X1E A;  4ICH A;  4AC6 A;  5F0H A;  3ON2 A;  3RD3 A;  3VVX A;  4W1U A;  3O8H A;  3MVP A;  3QKX A;  5FHP A;  3Q0U A;  3SFI A;  3MNL A;  2GEN A;  4GCL A;  2DTZ A;  2PZ9 A;  3CDL A;  1U9N A;  5J1Y A;  4ABZ A;  4KWA A;  3CRJ A;  1JUP A;  2FX0 A;  3B6A A;  5FKN A;  4PXI A;  3Q0W A;  4M3B A;  2NS7 A;  2VPR A;  5FKO A;  2XRL A;  3F0C A;  2RAS A;  3FK6 A;  2DG7 A;  3EUP A;  3KZ9 A;  3BT9 A;  4MO7 A;  2XPV A;  2HXI A;  3S5R A;  5K7F A;  5EFY A;  2ZCN A;  5K58 A;  4V2G A;  3BR5 A;  4CGR A;  3PAS A;  4B1R A;  3P9T A;  3BCG A;  3LHQ A;  5K7Z A;  1U9O A;  3BR6 A;  2FJ1 A;  2IEK A;  5H9T A;  5K7H A;  3V78 A;  5FKL A;  4XK4 A;  3SDG A;  1Z0X A;  3Q3S A;  3ZQH A;  3BTC A;  5HSZ A;  3JSJ A;  2UXH A; 
#chains in the Genus database with same CATH topology
 2R7V A;  2FD5 A;  3PPB A;  1QPI A;  2XGD A;  3ZQL A;  3HGG A;  3ZQG A;  4GFL A;  1JT6 A;  3C07 A;  5J1U A;  4M3E A;  5D18 A;  4M3D A;  2ZY9 A;  1JUM A;  5EZH A;  2QOP A;  5J1R A;  5EZG A;  3HE0 A;  5FMP A;  4OD4 A;  2G3B A;  4D5F A;  4AUX A;  4U9L A;  2R7X A;  2ID6 A;  2GUH A;  3VOK A;  2F07 A;  4D5C A;  1A6I A;  2Y31 A;  2UXU A;  5F1J A;  5F27 A;  5HAW A;  4V2F A;  3DU6 A;  5F0C A;  3E7Q A;  2Y2Z A;  4GCK A;  5FKK A;  4W97 A;  3VW0 A;  3KKC A;  3T6N A;  2NX4 A;  1UI5 A;  3FIW A;  3HTH A;  1ZK8 A;  2B3W A;  4DVY P;  1JTX A;  2IBD A;  2O7T A;  2TRT A;  5AQC A;  3BR0 A;  2XGE A;  2XPW A;  4UDS A;  3O60 A;  2QKO A;  4OD5 A;  3KKD A;  2Q24 A;  3GEU A;  2R7W A;  3BHQ A;  2ID3 A;  5J3L A;  1QVU A;  2FQ4 A;  3BR2 A;  1T56 A;  2IAI A;  3VOX A;  3NPI A;  3LSJ A;  2OI8 A;  2VKE A;  3KYL A;  1T33 A;  3AQT A;  4U9N A;  2WV1 A;  2REK A;  2ZOZ A;  2ZB9 A;  4YZE A;  5FKM A;  2GFN A;  3F1B A;  2Y30 A;  2G7G A;  2QWT A;  2NP3 A;  3QBM A;  2OER A;  3EGQ A;  3LSR A;  3GZI A;  5IP6 A;  3WHC A;  2XDN A;  1RPW A;  2WGB A;  4L62 A;  2ZCX A;  5D1R A;  2HYT A;  5GPC A;  2X6O A;  3BJB A;  1SGM A;  2JJ7 A;  3NI7 A;  2R7O A;  2PFV A;  4NEL A;  4AF5 A;  2DG8 A;  2QTQ A;  3HTI A;  4I76 A;  1ZKG A;  3HTA A;  1RKW A;  3G1L A;  3QPS A;  1JUS A;  2UXP A;  3FRQ A;  5F04 A;  5CXI A;  2PBX A;  3BR1 A;  5C4Y A;  3ON4 A;  1UI6 A;  1BJZ A;  3BRU A;  3VIB A;  3RH2 A;  1JT0 A;  2UXI A;  2TCT A;  2JK3 A;  4D7N A;  3IUV A;  2G7S A;  3ZQI A;  5GPA A;  2B1E A;  2ZCM A;  3G1M A;  5F0F A;  3ZQF A;  4JKZ A;  2XGC A;  4JYK A;  2XPU A;  4JNN A;  5FGL A;  3BTJ A;  3LOC A;  3FHN A;  2HYJ A;  2ZOY A;  4GCT A;  2I10 A;  5EYR A;  3FK7 A;  4MK6 A;  3O8G A;  2OPT A;  2EH3 A;  3BNI A;  3WHB A;  2V57 A;  3BQY A;  2OF7 A;  1RKT A;  2XB5 A;  2G7L A;  3VW1 A;  5HBU A;  3VUQ A;  2YVE A;  4M3G A;  3AQS A;  3CCY A;  3IH2 A;  4I6Z A;  5IOZ A;  3BTI A;  5F08 A;  3VVZ A;  2WUI A;  2FBQ A;  4D7M A;  3ANG A;  4M3F A;  1VI0 A;  2RHA A;  3BTL A;  1QVT A;  2O7O A;  3QQA A;  2X9D A;  2R7Q A;  4HKU A;  3VP5 A;  2RAE A;  3DPJ A;  4WIB A;  5DAJ A;  2W53 A;  2UXO A;  2HKU A;  3PM1 A;  3VVY A;  3VPR A;  4IRV A;  5GP9 A;  4NN1 A;  3NS4 A;  2GBY A;  2D6Y A;  3G1O A;  3CJD A;  4DW6 A;  3HTJ A;  3KNW A;  4ACI A;  4ME9 A;  3IH4 A;  1Z77 A;  3LSP A;  3C2B A;  2YVH A;  2HQ5 A;  2NP5 A;  2QCO A;  2HXO A;  3HIM A;  3NXC A;  3BR3 A;  5IPA A;  3VW2 A;  3G7R A;  4GFK A;  3LWJ A;  3CWR A;  3QPL A;  4B3A A;  2IU5 A;  5D19 A;  3COL A;  5CXG A;  2VKV A;  3HGY A;  3ANP A;  5CW8 A;  3Q0V A;  3TP3 A;  3DEW A;  3V6G A;  3NNR A;  5IOY A;  4AC0 A;  3NRG A;  4G12 A;  3LJL A;  2R7R A;  2G0E A;  1ORK A;  3BQZ A;  3DCF A;  3G56 A;  4JL3 A;  3IH3 A;  3TP0 A;  2NS8 A;  1JTY A;  3B6C A;  3B81 A;  4MXM A;  2QIB A;  4X1E A;  2R7T A;  3K8P C;  4ICH A;  4AC6 A;  5F0H A;  3ON2 A;  3RD3 A;  3VVX A;  3SWH A;  4W1U A;  3O8H A;  3MVP A;  3QKX A;  5FHP A;  3Q0U A;  3SFI A;  3MNL A;  2GEN A;  4GCL A;  2DTZ A;  2PZ9 A;  3CDL A;  1U9N A;  5J1Y A;  4ABZ A;  4KWA A;  3CRJ A;  1JUP A;  5CQG A;  2FX0 A;  2YVX A;  3B6A A;  5FKN A;  4PXI A;  3Q0W A;  4M3B A;  2NS7 A;  2FJI 1;  2VPR A;  2R7U A;  5FKO A;  2A2F X;  2XRL A;  3F0C A;  2RAS A;  3FK6 A;  2DG7 A;  3EUP A;  3KZ9 A;  3BT9 A;  4MO7 A;  2XPV A;  2HXI A;  3S5R A;  5K7F A;  5EFY A;  3VTI A;  2ZCN A;  5K58 A;  4V2G A;  3BR5 A;  4CGR A;  3PAS A;  4B1R A;  3P9T A;  3DU5 A;  3BCG A;  3LHQ A;  1U9O A;  5K7Z A;  3BR6 A;  2FJ1 A;  2IEK A;  5H9T A;  5K7H A;  4C2M A;  3V78 A;  5FKL A;  4XK4 A;  3SDG A;  1Z0X A;  3Q3S A;  2R7S A;  3ZQH A;  3BTC A;  5HSZ A;  3JSJ A;  2UXH A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  3PPB A;  1QPI A;  2XGD A;  3ZQL A;  3HGG A;  3ZQG A;  4GFL A;  1JT6 A;  3C07 A;  5J1U A;  4M3E A;  5D18 A;  4M3D A;  1JUM A;  5EZH A;  2QOP A;  5J1R A;  5EZG A;  3HE0 A;  5FMP A;  2G3B A;  4D5F A;  4AUX A;  2ID6 A;  2GUH A;  3VOK A;  2F07 A;  4D5C A;  1A6I A;  2Y31 A;  2UXU A;  5F1J A;  5F27 A;  5HAW A;  4V2F A;  5F0C A;  3E7Q A;  2Y2Z A;  4GCK A;  5FKK A;  4W97 A;  3VW0 A;  3KKC A;  3T6N A;  2NX4 A;  1UI5 A;  3FIW A;  3HTH A;  1ZK8 A;  1JTX A;  2IBD A;  2O7T A;  2TRT A;  5AQC A;  3BR0 A;  2XGE A;  2XPW A;  4UDS A;  3O60 A;  2QKO A;  3KKD A;  2Q24 A;  3GEU A;  3BHQ A;  2ID3 A;  5J3L A;  1QVU A;  2FQ4 A;  3BR2 A;  1T56 A;  2IAI A;  3VOX A;  3NPI A;  3LSJ A;  2OI8 A;  2VKE A;  1T33 A;  3AQT A;  2WV1 A;  2REK A;  2ZOZ A;  2ZB9 A;  4YZE A;  5FKM A;  2GFN A;  3F1B A;  2Y30 A;  2G7G A;  2QWT A;  2NP3 A;  3QBM A;  2OER A;  3EGQ A;  3LSR A;  3GZI A;  5IP6 A;  3WHC A;  2XDN A;  1RPW A;  2WGB A;  4L62 A;  2ZCX A;  5D1R A;  2HYT A;  5GPC A;  2X6O A;  3BJB A;  1SGM A;  2JJ7 A;  3NI7 A;  4NEL A;  4AF5 A;  2DG8 A;  2QTQ A;  3HTI A;  4I76 A;  1ZKG A;  3HTA A;  1RKW A;  3G1L A;  3QPS A;  1JUS A;  2UXP A;  3FRQ A;  5F04 A;  5CXI A;  2PBX A;  3BR1 A;  5C4Y A;  3ON4 A;  1UI6 A;  1BJZ A;  3BRU A;  3VIB A;  3RH2 A;  1JT0 A;  2UXI A;  2TCT A;  2JK3 A;  4D7N A;  3IUV A;  2G7S A;  3ZQI A;  5GPA A;  2ZCM A;  3G1M A;  5F0F A;  3ZQF A;  4JKZ A;  2XGC A;  4JYK A;  2XPU A;  4JNN A;  5FGL A;  3BTJ A;  3LOC A;  2HYJ A;  2ZOY A;  4GCT A;  2I10 A;  5EYR A;  3FK7 A;  4MK6 A;  3O8G A;  2OPT A;  2EH3 A;  3BNI A;  3WHB A;  2V57 A;  3BQY A;  2OF7 A;  1RKT A;  2XB5 A;  2G7L A;  3VW1 A;  5HBU A;  3VUQ A;  2YVE A;  4M3G A;  3AQS A;  3CCY A;  3IH2 A;  4I6Z A;  5IOZ A;  3BTI A;  5F08 A;  3VVZ A;  2WUI A;  2FBQ A;  4D7M A;  3ANG A;  4M3F A;  1VI0 A;  2RHA A;  3BTL A;  1QVT A;  2O7O A;  3QQA A;  2X9D A;  4HKU A;  3VP5 A;  2RAE A;  3DPJ A;  5DAJ A;  2W53 A;  2UXO A;  2HKU A;  3PM1 A;  3VVY A;  3VPR A;  5GP9 A;  4NN1 A;  2GBY A;  2D6Y A;  3G1O A;  3CJD A;  4DW6 A;  3HTJ A;  3KNW A;  4ACI A;  4ME9 A;  3IH4 A;  1Z77 A;  3LSP A;  3C2B A;  2YVH A;  2HQ5 A;  2NP5 A;  2QCO A;  2HXO A;  3HIM A;  3NXC A;  3BR3 A;  5IPA A;  3VW2 A;  3G7R A;  4GFK A;  3LWJ A;  3CWR A;  3QPL A;  4B3A A;  2IU5 A;  5D19 A;  3COL A;  5CXG A;  2VKV A;  3HGY A;  3ANP A;  5CW8 A;  3Q0V A;  3TP3 A;  3DEW A;  3V6G A;  3NNR A;  5IOY A;  4AC0 A;  3NRG A;  4G12 A;  3LJL A;  2G0E A;  1ORK A;  3BQZ A;  3DCF A;  3G56 A;  4JL3 A;  3IH3 A;  3TP0 A;  2NS8 A;  1JTY A;  3B6C A;  3B81 A;  4MXM A;  2QIB A;  4X1E A;  4ICH A;  4AC6 A;  5F0H A;  3ON2 A;  3RD3 A;  3VVX A;  4W1U A;  3O8H A;  3MVP A;  3QKX A;  5FHP A;  3Q0U A;  3SFI A;  3MNL A;  2GEN A;  4GCL A;  2DTZ A;  2PZ9 A;  3CDL A;  1U9N A;  5J1Y A;  4ABZ A;  4KWA A;  3CRJ A;  1JUP A;  2FX0 A;  3B6A A;  5FKN A;  4PXI A;  3Q0W A;  4M3B A;  2NS7 A;  2VPR A;  5FKO A;  2XRL A;  3F0C A;  2RAS A;  3FK6 A;  2DG7 A;  3EUP A;  3KZ9 A;  3BT9 A;  4MO7 A;  2XPV A;  2HXI A;  3S5R A;  5K7F A;  5EFY A;  2ZCN A;  5K58 A;  4V2G A;  3BR5 A;  4CGR A;  3PAS A;  4B1R A;  3P9T A;  3BCG A;  3LHQ A;  5K7Z A;  1U9O A;  3BR6 A;  2FJ1 A;  2IEK A;  5H9T A;  5K7H A;  3V78 A;  5FKL A;  4XK4 A;  3SDG A;  1Z0X A;  3Q3S A;  3ZQH A;  3BTC A;  5HSZ A;  3JSJ A;  2UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...