2PBYA

Probable glutaminase from geobacillus kaustophilus hta426
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
307
structure length
291
Chain Sequence
b'LVYNQEELVRFVEEAKQYARYGKVADYIPALGKANPNELSIAIYTPDDEVVSAGDVTVKVTLQSISKIIALALVLIDRGEDEVFHKVGMEPKPLNPMINAGALVVTSMIQGGSVSERLERLLAFVRRLAGNERISYSDEVARSEFETAFLNRSLCYFLKQHRIIDEDVEELMELYTKQCAIEMTCIDLARIGLVLALDGRDPHSSEPLMPLDVARICKTFMVTCGMYNSSGEFAIKVGIPAKSGVSGGILAAVPGRCGIGVFGPALDDKGNSLTGVKLLERLSKTYSLSIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glutaminase from Geobacillus kaustophilus HTA426
rcsb
molecule keywords Glutaminase
source organism Geobacillus kaustophilus
molecule tags Hydrolase
total genus 105
structure length 291
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1500.10 Mainly Alpha Orthogonal Bundle Probable Glutaminase Ybgj; Chain: A, domain 2 Probable Glutaminase Ybgj; Chain: A, domain 2 2pbyA02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2pbyA01
3ITAA 4OOMA 1YM1A 4X56A 4RA7A 4DDYA 2JC7A 3Q7ZA 1N9BA 5A93A 5FQMA 1TVFA 1YMSA 4KQRA 4L0LA 1MKIA 4WZ4A 2ZM2A 3O87A 4BL3A 3VFFA 5GLAA 2WGIA 3M6HA 2Y2IA 1LI0A 5EVIA 3MZEA 4QY5A 3BM6A 4PM6A 5EVID 3VP4A 3IHAA 2WAEA 2XGNA 4JBFA 1CEGA 5E43A 1K6SA 2Y2PA 5HAIA 3WRZA 1MWTA 4OP5A 3UPOA 3N8RA 3ZG0A 1TEMA 1MY8A 2G2WA 3N4IA 4HEFA 1GA9A 4P6BA 5GLCA 1YLZA 4KZBA 4R4RA 5FDHA 2EX8A 2XQZA 5KZHA 1IYSA 1NZUA 1KGGA 1K25A 4O7DA 1SDNA 1BULA 3GMWA 4K0WA 3A3EA 3Q07A 5E2GA 3V5MA 3HL9A 5HAQA 1XX2A 1W79A 2CC1A 2Y2NA 4DE0A 4EWFA 5TFQA 4K91A 3HBRA 2WKIA 4LCMA 4M3KA 5A90A 1FCMA 2ZQ9A 1Q2QA 2Y2LA 2OLUA 3FYZA 3MBZA 1NYYA 1VQQA 5EPHA 3UY6A 2XDMA 1IYOA 3SS4A 1ONHA 2EX9A 3UDFA 4E3JA 3OCLA 3PBQA 3MZFA 4DXCA 5EOEA 1OMEA 4E6XA 1ES3A 3WS0A 1I2SA 2Y2MA 4KG6A 1CI9A 3LCEA 1K57A 1O07A 4N9KA 4DE1A 1DJAA 4JPMA 2P74A 1W8YA 1YLJA 4FH4A 2HP5A 2Y2KA 1GHMA 3G35A 1TDGA 1BLHA 1KVMA 1HVBA 1XA1A 1ZC2A 2WKEA 3P09A 4QB8A 4DF6A 3PBSA 3IWIA 1NYMA 2H5SA 4BJPA 1DJBA 4NK3A 4UAAA 4EQIA 2R9WA 3UE1A 4P87A 3GRJA 2B5RA 3CZDA 5CERA 4HBTA 4EBPA 2ZQ8A 3TG9A 4ZDXA 3MXRA 4DRTA 1SHVA 2ZM0A 3S4XA 1MPLA 1YMXA 2ZQAA 2DRWA 1BLPA 2X71A 2C6WB 3HUNA 1H8YA 3G4PA 3LY4A 4Q8IA 3IXHA 1YLPA 3OCNA 1E3UA 3N7WA 3DW0A 1BSGA 4MLLA 4XUXA 1SDEA 3BFDA 4GD6A 2RL3A 1E3UD 1K6RA 3I7JA 3IWQA 3ITBA 4R3JA 1CK3A 1DY6A 1ALQA 2HDQA 1BTLA 1NJ4A 4R4SA 4XXRA 3VP0A 1WE4A 4DE3A 1IYQA 3EQUA 4OQGA 3W4QA 2I72A 1Z6FA 4C3QA 3OPRA 1I5QA 4KZ8A 4UA6A 3DTMA 1QMEA 4OLDA 3SS3A 1XKZA 3IF6B 1RCJA 4S2NC 2EX6A 5DTTA 5FAQA 3ZVWA 3IF5A 2WK0A 5J8XA 1IKGA 3HUMA 4LV0A 4KZ5A 1GA0A 4DKIA 5GHXA 2EX2A 2JBFA 2FFFB 3AGDA 4F94A 1MBLA 2WGWB 4WMCD 2EXAA 1BLSA 1L0EA 3E2LA 3S1YA 5CECA 1FSWA 1FQGA 4OPZA 4X69A 4S2LA 3MXSA 3SH9A 5A92A 3HUOA 3BFGA 3A3FA 2Y91A 3QNBA 2OV5A 2Y2QA 3LO7A 3ZDJA 4OQHA 4GN2A 3ZG5A 1PI5A 4WYYA 1XXMA 5FI2A 4FSFA 2Y4AA 4N9LA 5JYOA 1KDWA 3IF6C 5A91A 1KVLA 3QNCA 5CTMA 4P85A 4QHCA 4Y0UA 3VFHA 1IELA 1AXBA 3UNWA 3MKEA 1KE4A 2XK1A 3OPHA 4LV1A 4CPKA 5HAPA 3IH9A 1ES4A 5TGFA 1NY0A 4B88A 1GHPA 5AQ7A 4E6WA 4N1XA 4GKUA 3HLDA 3PBNA 2WUQA 1HZOA 2XFSA 4WELA 4U3TA 4KQOA 3A3JA 5EVLA 5L2FA 4JXWA 1YQSA 3ISGA 3MFDA 1HD8A 3BFCA 1XA7A 3TOIA 1XP4A 5BOHA 1ERMA 3M2JA 5GLBA 5M18A 3D4FA 2P9VA 4BQMA 2ZJ9A 1FR6A 4Z9QA 3UDXA 3PTEA 4OQIA 3NDGA 3JYIA 4MBKA 2C5WB 5FAPA 2ZC6B 5DF9A 1NZOA 1EI5A 1RP5A 4LV3A 3EQVA 2Z2LB 4OVDA 4MNRA 1Q2PA 1S0WA 5HX9A 1YLYA 3DWZA 3NDEA 4S2IA 2G2UA 2R9XA 5HFOA 2XH9A 3Q7VA 4R0QA 3ZFZA 4ZTKA 4ID4A 5KSHA 1MXOA 3WS4A 3UDIA 3PBTA 1FCOA 4A5RA 3GQZA 4X68A 2HP9A 3G2ZA 3TSGA 1EROA 5FQQA 2H10A 2X01A 3OPLA 1NXYA 1IKIA 2Y2HA 3PAGA 2Y2GA 3UN7A 3SH8A 5CEDA 2WGVA 3RXWA 1JWZA 4WBGA 4GDBA 4OQ0A 2H0TA 4E3LA 2Y2OA 1PWCA 2IWDA 3FZCA 3OPPA 4GD8A 5F83A 4E3IA 4HESA 5DTKA 1CI8A 4X6TA 1E25A 2E8IA 4DXBA 3SS5A 4OP8A 5CEBA 3IT9A 1MWSA 5CHJA 4ZAMA 5GLDA 1PYYA 2PU4A 3RXXA 1Y54A 4QD4A 1LI9A 3VP3A 4OPYA 1U60A 1K4FA 4KQQA 2A3UA 2XEPA 4GB7A 5HW3A 4KZAA 1K54C 1G6AA 1L0DA 4PPRA 4Y0OA 3IHBA 1PW1A 4OLGA 4WEKA 4ZBEA 3UE3A 2QZ6A 4CJNA 3NIAA 1JTDA 4QU3A 3GVBA 4KZ7A 3SOIA 4X55A 5DVAA 4IVIA 3NI9A 2ZC4B 4BENA 2J9OA 4MEZA 5FAOA 3ZVTA 2ZC5B 5CHMA 4FD8A 1TDLA 1SKFA 1L2SA 2WZXA 3A3DA 1G68A 1K56D 5GHZA 4JF5A 3GR2A 1PWGA 4JF6A 3UE0A 1RGYA 1YT4A 3AGEA 4JKTA 4C75A 4DE2A 5EVIB 3WWXA 2HP6A 1PIOA 1PWDA 3HLWA 5DTSA 1K55C 4GOGA 4LENA 1ES5A 1VM1A 3BYDA 5KMWA 5EUAA 5M1AA 1XGIA 1L0GA 4BLMA 1BLCA 4IBRA 3HLGA 1YLTA 2P9VB 4KENB 3C4OA 4S2MA 3HLBA 5E2EA 3NCKA 1K38A 4KG2A 5FQJA 4IBXA 2XLNA 4WMCA 2ZD8A 3WS2A 3OC2A 2H0YA 2J7VA 5FQIA 3CMZA 4EV4A 2WADA 5FI6A 1ES2A 5HL1A 3CG5A 1H8ZA 3C7VA 3HLFA 5EVIC 4S2KA 4KZ4A 3MZDA 3VSLA 1K4EA 1PZPA 1QMFA 2PU2A 3A3IA 4GZBA 4IVKA 4RVAA 5GHYA 1IYPA 4YFMA 5FSRA 1LLBA 1HTZA 1DJCA 3Q7VB 3BFFA 1FOFA 2HDSA 5JYPA 3RJUA 2ZLYA 1ZG4A 3ZNTA 1H5XA 1LL9A 2J9PA 3VP2A 4EUZA 2HDRA 2XD1A 2ZM8A 1N4OA 1WYCA 4RX3A 4PM9A 3PBOA 4MBFA 5CXWA 3ZCZA 3P98A 3M2KA 5EECA 1ZKJA 1W8QA 4JLFA 3FWLA 3G30A 4GDNA 2ZC3B 5AQBA 5DF8A 5F82A 3IXGA 4UHUA 5GL9A 1GHIA 4E3NA 2UWXA 4S2NA 3LEZA 2ZQCA 4JXSA 2Q9MA 1XGJA 2RCXA 3NBLA 4OOLA 4U0TA 1RGZA 5FQKA 4B4ZA 3ZHHA 1NRFA 3BECA 4QJGA 4HBUA 2V1ZA 3GSGA 2HPBA 3WRTA 1JTGA 3HREA 4PM5A 3N8LA 4KZ9A 4S2PA 4WZ5C 4YINA 1PZOA 4KG5A 1C3BA 2HDUA 1FR1A 2XF3A 5E2FA 3N6IA 2EFXA 3BEBA 1O7EA 1MWRA 4S2JA 5KSCA 4JXGA 1K57C 3G34A 3UO9A 2BG1A 2Z2MB 3O3VA 4WEJA 2ZC7A 3IF6A 3G32A 5AQAA 3ZGAB 3HVFA 4UA7A 3G2YA 4OKPA 2J8YA 3ZG7B 2Y59A 3IXDA 3FKVA 1PW8A 2JCHA 2WGWA 2GDNA 3IQAA 3OZHA 4K0XA 2QMIA 5AQ9A 4Y0TA 3B3XA 5F1FA 4LV2A 4R23A 1M6KA 1KGEA 4E3KA 2V20A 3VSKA 1S6RA 2V2FF 1J9MA 2OLVA 3W8KA 2ZQDA 3ZNYA 5DF7A 1WYBA 3HLEA 1E4DA 4RYEA 4IEDA 3IXBA 4GNUA 1ERQA 3DWKA 1IEMA 2XFTA 5HARA 1MWUA 5F1GA 3N8SA 3O86A 4BD1A 3LY3A 3HLCA 4EBLA 1JWPA 4PM7A 1JWVA 3V50A 4WZ5A 3ZG8B 2XR0A 4OOYA 3E2KA 3GTCA 1ONGA 3G31A 3ZG9B 4MBHA 1KE0A 1LL5A 2WYXA 2ZQ7A 4FCFA 3VOYA 5FASA 2WZZA 3BLMA 2IWBA 3VMAA 4XUZA 2Q9NA 3VOZA 4OPQA 5FA7A 5M19A 4E3MA 3IWOA 3Q1FA 4DDSA 1K56A 3NC8A 1GCEA 4EBNA 3MKFA 4PMAA 5D3OA 4N1HA 3C5AA 3AGFA 4E3OA 4X53A 5CGWA 5U47A 5EOOA 2QPNA 3NY4A 5CGSA 5I94A 2EXBA 5FATA 3UPPA 4B4XA 1JVJA 1SCWA 4ZJ2A 1PI4A 3O88A 4OH0A 5TR7A 4P0MA 2OSUA 5CRFA 1W5DA 2EFUA 1CEFA 2DNSA 4NETA 5E2HA 4S2OA 3W4OA 1XPBA 3WS5A 5CTNA 1BUEA 5G18A 4RX2A 5CHUA 3QHYA 3VP1A 1BT5A 4N92A 1ESUA 2WAFA 3FV7A 3BRMA 1ESIA 3BFEA 2Y2JA 2JE5A 1K54A 3FKWA 4FH2A 1BZAA 4LCLA 1KE3A 4R3BA 3Q82A 3V39A 3W4PA 2DCFA 5CGXA 2ZMAA 4BL2A 1KGFA 4OONA 1FCNA 4JXVA 3CJMA 5FI7A 2X02A 3GV9A 3V3RA 5EE8A 4WM9A 2WKHA 4KZ3A 4UA9A 3SH7A 4KZ6A 2XD5A 1I2WA 4JF4A 4U0XA 4C6YA 1L0FA 2BLSA 1EWZA 3Q81A 3C7UA 4ZJ1A 1ZG6A 4ZJ3A 3PAEA 4D2OA 4PM8A 2VGKA 2Y55A 3IH8A 3PBRA 4R1GA 3C4PA 4Y7PA 1FSYA 2A49A 1KDSA 3V3SA 3BLSA 2VGJA 1K55A 3WS1A 1M40A 4H8RA 2IWCA 5IHVA 4QY6A 3UPNA 4BD0A 2FFYA 1W7FA 1LHYA 5FQ9A 3M6BA 2PBYA 1YLWA 4OPRA 3S22A
chains in the Genus database with same CATH superfamily
1YM1A 4X56A 4RA7A 1MKIA 3O87A 4BL3A 4EERA 2WGIA 3M6HA 2M7VA 5TJJA 4UEYA 4NKPA 3VP4A 3IHAA 2WAEA 4WF0A 1CEGA 2E8JA 1T1AA 4RQ9A 2LB5A 4G3KA 4Y5FA 1VEUA 4HEFA 4P6BA 5GLCA 1YLZA 1NLZA 4LRZE 5L8MA 3SW1A 1BULA 3KSIA 3GMWA 5E2GA 3HL9A 4L9FA 1W79A 2WKPA 4M3KA 2GJ3A 3VOLA 3MQQA 3LYXA 3FYZA 1VQQA 4UQIS 1IYOA 1ZHHB 5IT5A 4DXCA 4P6ZS 2VLGA 1CI9A 3LCEA 1K57A 1O07A 1WA9A 4N9KA 4DE1A 2P74A 1GHMA 1KVMA 4GJ4A 1ZC2A 1MKMA 2PR6A 4NK3A 3IX4A 2ZQ8A 2FH5A 3MXRA 1MPLA 3MQOA 2X71A 3G4PA 3LY4A 1SZVA 1LSWA 3IXHA 3P01A 3T4OA 3N7WA 4MLLA 1SDEA 3CPTA 2JKTI 1K6RA 3QP4A 1YPRA 4KUKA 4HQAA 1A0KA 4OQGA 2XA7S 4HHDA 4NG2A 4C3QA 4KZ8A 1PFLA 4R3AA 4Y15A 1XKZA 5HPIA 1VEUB 3QP6A 5DTTA 2WK0A 3HUMA 4KZ5A 1GA0A 4NEED 4DKIA 2W3DA 2JBFA 3AGDA 5HSQA 5L07A 3NHQA 1L0EA 5CECA 1OJGA 1YKDA 1FQGA 4NXGA 2Y91A 2EWVA 3ZG5A 1PI5A 4X1LA 2Y4AA 5JYOA 5A91A 1KVLA 5CTMA 1XFNA 4P85A 5HDDA 4LV1A 3F1NA 3OPHA 5FL3A 1ES4A 3NJAA 1GHPA 1OPXA 5AQ7A 1HZOA 2XFSA 3A3JA 3ISGA 4HI4A 4HIAA 1GSVA 1XA7A 3M2JA 3D4FA 2ZJ9A 4Z9QA 3CUEC 3TW8A 3JYIA 4MBKA 3K3CA 5DF9A 3JVVA 1EI5A 2Z2LB 1V9ZA 4MNRA 1Q2PA 1S0WA 5HX9A 3NDEA 5IS1A 4ARZA 2R9XA 5DJTA 1S67L 3LICA 3QP1A 4ZTKA 4AFIA 4O8GA 3PBTA 1TD5A 3TSGA 1EROA 1T1BA 3T1QB 1NXYA 2Y2GA 4E04A 1JWZA 2HJ9C 2H0TA 1PWCA 3FZCA 3RFBA 4GD8A 5F83A 5DTKA 4DXBA 4G3VA 4X6TA 3CLOA 1MWSA 3FPWA 5GLDA 3LGOA 2M1CA 4QD4A 1LI9A 4ME4A 2QJ7A 4KZAA 1K54C 1PRQA 4ZBEA 3UE3A 2QZ6A 4CJNA 4KZ7A 4X55A 1CF0A 2ZC4B 5CHMA 3F1PA 2WZXA 5GHZA 3UE0A 1YT4A 2NUTC 3WWXA 3K3DA 1PIOA 5DTSA 1S66L 3L7HA 1VM1A 3DTIA 2KDKA 1BLCA 1YLTA 4S2MA 2V8CA 3NCKA 3WS2A 2H0YA 5FQIA 5HPFA 2WADA 2OAQ1 1ES2A 5FI6A 3H82A 1H8ZA 3C7VA 2Q0OA 4KZ4A 4ARZB 2PU2A 2PAVP 1IYPA 4BBUA 4YFMA 3T12B 2HDSA 3OOVA 4GW9A 3EEHA 4ETZA 3TJZC 3VP2A 3DTKA 4EUZA 2XD1A 1Y28A 4RX3A 4MBFA 1P0ZA 3BJNA 1P9RA 3FWLA 3G30A 3IBJA 5AQBA 4UHUA 2UWXA 1T1CA 2DMWA 2ZQCA 4I3JA 3N8LA 4YINA 2XF3A 1FR1A 2HV1A 4Q0JA 4JXGA 4PKYG 3F1PB 2HJEA 1OTEA 5AQAA 1IFQA 3ZG7B 2M7UA 2JCHA 2WGWA 2GDNA 1M6KA 1J9MA 3W8KA 2PDRA 3IXBA 3DWKA 3N8SA 3LY3A 3C30A 3HLCA 4EBLA 1JWVA 3T4TA 2XR0A 3H82B 1ONGA 4WN5A 3ZG9B 3NOTC 2QJ5A 3E4OA 2Q9NA 3ICYA 3VOZA 4OPQA 2QHKA 4DDSA 4EBNA 4LGWA 4E3OA 3C5AA 4X53A 4JGPA 5CGWA 1ODVA 5EOOA 4I39A 3NULA 4HH3A 1W5DA 2EFUA 2DNSA 5E2HA 4S2OA 3QP8A 1XPBA 1BUEA 2MJ6A 3K2NA 5G18A 5CHUA 1BT5A 1P9WA 1ESUA 1ESIA 3BFEA 2Y2JA 3A0VA 1KE3A 3V39A 4PKYA 1FCNA 4JXVA 5FI7A 3GV9A 3V3RA 3SH7A 4YOFA 3T4SA 3ZQ5A 3GECA 3TRCA 5LBRA 4ZJ3A 2O9AA 1FSYA 2A49A 2B95A 2K7SA 2VV7A 2ZOHA 1M40A 4H8RA 4UQIM 4BD0A 2J3WA 2PBYA 5IU1A 4DMZA 1GSWA 4DDYA 5A93A 5FQMA 4L0LA 3MSHA 4WZ4A 5EVIA 3MS6A 3BM6A 3UB8A 1H3QA 4HJ4A 2A24B 3WRZA 4OP5A 1TEMA 3N4IA 3S7NA 1GA9A 3RH8B 4KZBA 5FDHA 4HJ6A 2EX8A 2O9CA 3H7WA 2Z6DA 1OTAA 1SDNA 3CI6A 3V5MA 2VZWA 5HAQA 3UMEA 1XX2A 2CC1A 4K91A 2WKIA 2ZQ9A 2W0NA 3T4QA 3T50A 3UY6A 1ONHA 2EX9A 4B93A 3PBQA 4LPZA 5EOEA 1OMEA 3WS0A 3HJKA 3E98A 2PRFA 1Z09A 3CHWP 4FH4A 2VJWA 2Y2KA 2W3HA 1TDGA 1XA1A 4QB8A 3PBSA 2HGVA 4G3WA 4BJPA 4UAAA 1F5MA 2R9WA 4P87A 2K31A 2ZQAA 2DRWA 5HWWA 1BLPA 1H8YA 3BQ8A 2OWJA 2V0WA 1E3UA 3HJIA 5HDCA 3R7WA 1XJ6A 4GD6A 1ACFA 1ALQA 1MZUA 1NJ4A 3VP0A 4R4SA 5DFXA 4DN0A 3V67A 4PHTA 5HD5A 3OPRA 4UA6A 2ZOIA 3DTMA 2JN7A 3IF6B 1RCJA 5FAQA 5J8XA 1IKGA 1LL8A 2EA9A 5GHXA 4WLAA 4F94A 1MBLA 4WMCD 2EXAA 1BLSA 1OT6A 3LIDA 1P97A 4OPZA 3BFGA 3QNBA 3IBRA 3LO7A 4BWIA 4GN2A 5FI2A 4WYYA 1KDWA 2R78A 4F3LA 5J7EA 4HJ3A 4QHCA 4Y0UA 1IELA 3VV4A 1KE4A 5HAPA 3IH9A 1NY0A 3ULFA 4ZRRA 3C2WA 1STZA 2PBDP 5FDSA 4WELA 5EVLA 4LRXC 4JXWA 3BFCA 5GLBA 3PTEA 4LRYC 4OQIA 2C5WB 4LV3A 2V1AA 4OVDA 4S2IA 2G2UA 5EFWA 5HFOA 1OTDA 3Q7VA 4R0QA 4Y3IA 5G4YA 3WS4A 3UDIA 1FCOA 4A5RA 3R7WB 2PHYA 4GS9A 2Y2HA 5CEDA 4WBGA 4GDBA 1N9NA 4E3LA 4E3IA 2E8IA 2IA2A 4ZAMA 5CHJA 1T19A 2PU4A 3VP3A 4OPYA 5HW3A 1DP6A 2ZMVA 1G6AA 5G4ZA 4PPRA 3IHBA 2VKSA 2P08A 3SOIA 3GVBA 3E4PA 4MN5A 4IUHA 1UGUA 4IVIA 1L3LA 1S1YA 2FZ0A 4BENA 3ZVTA 4MEZA 5FAOA 2J3TC 1SKFA 1L2SA 1TS8A 3L9KA 1PWGA 2HF6A 3AGEA 1XJ4A 1TS0A 2HP6A 1K0KA 3OBFA 3HLWA 1K55C 2VEAA 4LENA 1ES5A 1H8MA 5KMWA 5EUAA 5M1AA 4IBRA 3HLGA 5HWTA 4KENB 3HLBA 4KG2A 5FQJA 2XLNA 4WMCA 3OC2A 4EV4A 3KYEA 2O9BA 3UE6A 3MZDA 1QMFA 4IVKA 4GZBA 3O5YA 2VV6A 5FSRA 1LLBA 1DJCA 3Q7VB 1ZG4A 3PBOA 3E0YA 5CXWA 1TF1A 1D7EA 3P98A 3ZCZA 2ZL1A 1KOUA 1OTBA 3M2KA 5HL6A 2H28A 3LIFA 2ZC3B 2PYPA 1GHIA 4E3NA 4XT2A 1XGJA 4OOLA 4U0TA 5FQKA 4B4ZA 3LR0A 3GSGA 2HPBA 5K5BA 2XROA 1C3BA 2HDUA 4NXBA 3KSGA 1HLUP 2EFXA 3BEBA 2KLIA 5HZHA 1MWRA 3UO9A 3O3VA 4WEJA 5TBMA 3HVFA 3CPTB 2Y8HA 2J8YA 2QMIA 4Y0TA 2KX6A 4Q0IA 1AWIA 2V20A 4R38A 3KO6A 2OOLA 3ZNYA 5DF7A 2Z6CA 4IEDA 3CUEA 4GNUA 4H6JA 1MWUA 3MR0A 4FOFA 4PM7A 3V50A 2W3FA 3VE4A 5FASA 1LL5A 2ZQ7A 2IWBA 3VMAA 4CLCC 3JPUA 2L4RA 1NWZA 5M19A 4E3MA 3IWOA 1GCEA 1N9OA 1TS6A 3B47A 3AGFA 5FATA 3UPPA 1SCWA 3F1NB 3O88A 5TR7A 2OSUA 3UB5P 2BTFP 3LIEA 3LFVA 4NXEA 5EM0A 3QHYA 2WAFA 3BRMA 3JVUA 1K54A 4FH2A 1BZAA 2P7JA 3G6OA 3Q82A 3BY8A 3OLOA 1J3WA 3CJMA 3A0RA 2JHEA 4I38A 3KYZA 4UA9A 2PD8A 1I2WA 3S7QA 4C6YA 2BLSA 3C7UA 4D2OA 4PM8A 3IH8A 3V3SA 1FIKA 3BLSA 1F9IA 2VGJA 3WS1A 3UPNA 4QY6A 2FFYA 1MC0A 4FUWA 4OOMA 3Q7ZA 1TVFA 1YMSA 2ZM2A 4LLOB 3D9YA 2Y2IA 1LI0A 3MJQA 4QY5A 5EVID 2XGNA 5EVEA 5E43A 1K6SA 2Y2PA 3PHYA 3N8RA 3IX8A 3ZG0A 1MY8A 2G2WA 4R4RA 2XQZA 5L10A 5C5KA 5KZHA 1NZUA 1K25A 4O7DA 2V1BA 1YSPA 4K08A 5TFQA 4II7A 3R4KA 4LCMA 5A90A 2Y2LA 5EPHA 2XDMA 3SS4A 3UDFA 2ZMFA 3OCLA 3B42A 3MZFA 2B02A 4E6XA 1I2SA 4KG6A 4B9OA 4IUKA 2D02A 4JPMA 1YLJA 2HP5A 3G35A 4Y17A 1HVBA 2WKEA 3P09A 1OTIA 3IWIA 1NYMA 2H5SA 1EW0A 3UE1A 3GRJA 5CERA 4EBPA 5F6AA 4DRTA 1SHVA 1YMXA 2C6WB 3HUNA 4Q8IA 1YLPA 3OCNA 2EWWA 1BSGA 3BFDA 2RL3A 1E3UD 4R3JA 1CK3A 1S4RA 2HDQA 3VE3A 3EQUA 1Z6FA 3EEAA 4IHQA 5HWVA 1DP9A 1I5QA 3SS3A 3SZTA 4S2NC 2EX6A 3IF5A 4LV0A 3LUQA 2JKGA 2EX2A 5FEFA 3P7NA 1PNEA 2WGWB 3CITA 2O0YA 3LR5A 4X69A 4S2LA 5A92A 2OV5A 4OQHA 2YKFA 3IF6C 4HOIA 4BMWA 3T1XA 3C38A 3UNWA 2XK1A 4CPKA 5TGFA 3C8CA 4YNRA 4N1XA 3HLDA 3PBNA 2WUQA 4U3TA 4KQOA 5L2FA 1HD8A 3TOIA 1XP4A 2VA0A 3D72A 4BQMA 2PR5A 5FAPA 2WKQA 1V9YA 1NZOA 2W1TA 1T18A 3DWZA 1X0OA 2W3EA 3IX3A 1VHMA 2XH9A 3ZFZA 4ID4A 1VB6A 2HP9A 3G2ZA 2K2NA 4IJGA 3H9WA 3PAGA 4OQ0A 1CI8A 3SS5A 5CEBA 1PYYA 3RXXA 1Y54A 4EEUA 4KQQA 1K4FA 2A3UA 4R70A 4JGRA 1L0DA 4Y0OA 1PW1A 4WEKA 1W63M 3T1SA 1LT0A 4QU3A 1JTDA 3EGDC 2J9OA 4FD8A 1TDLA 3A3DA 4HY8A 1G68A 4JF5A 3GR2A 3DAVA 1RGYA 3S7PA 1GSXA 3MMHA 5F5YA 4JKTA 4C75A 4DE2A 5EVIB 4L9GA 1XJ2A 4DJ2A 5DFYA 3BYDA 1XGIA 2QKPA 2OWHA 4EXOA 3C4OA 1K38A 4GHIA 3H7WB 2J7VA 3CMZA 3LR3A 2W1RA 4JGOA 4X1MA 4S2KA 3VSLA 1K4EA 5F69A 4RVAA 2V9AA 1HTZA 5JYPA 1UWNX 3ZNTA 1LL9A 1N4OA 1WYCA 2JKTM 3FG8A 4ETXA 3U2AA 5EECA 1ZKJA 4JLFA 1CJFA 5F82A 3IXGA 2GNXA 5GL9A 4L9EA 3LEZA 3MQ0A 2RCXA 3NBLA 1RGZA 3T1RA 3ZHHA 1NRFA 3BECA 4DJ3A 3WRTA 1JTGA 4I5SA 4S2PA 4WZ5C 1PZOA 4KG5A 5E2FA 3N6IA 5AJGA 5KSCA 4S2JA 4GCZA 1K57C 2BG1A 2Z2MB 5J4EA 2ZC7A 1JNUA 3BQAA 3ZGAB 4UA7A 4Y13A 2Y59A 1BYWA 1PW8A 2VV8A 3BW6A 3OZHA 5AQ9A 3B3XA 4MMNA 4R23A 4D60A 2V0UA 3TE8A 5I5LA 1G6OA 3VSKA 1YAXA 5DKLA 2ZQDA 1WYBA 3HCYA 4RYEA 1ERQA 1IEMA 2XFTA 5F1GA 4GHIB 3O86A 4BD1A 3UB9A 1JWPA 3BY9A 4WZ5A 3ZG8B 3G31A 4MBHA 4R6LA 4FCFA 3VOYA 2WZZA 3BLMA 4XUZA 4GLQA 2HZ5A 1FILA 3NC8A 3MKFA 2BASA 4F3LB 3NY4A 5CGSA 5I94A 2EXBA 3LI9A 1G5UA 1JVJA 4ZJ2A 1PI4A 3PXPA 3KYQA 4OH0A 4P0MA 5CRFA 4NETA 3W4OA 4N92A 2GZAA 2JE5A 4X25A 4HH2A 3D3OA 4R3BA 5CGXA 4BL2A 2X02A 5EE8A 4BBTA 4WM9A 4CLCD 2WKHA 3F1OA 4KZ6A 2W3GA 2XD5A 3NECA 3T4LA 4ZJ1A 4GS9B 3PAEA 3PBRA 2Y55A 4R1GA 2INWA 3C4PA 2L1MA 1K55A 2WKRA 5IHVA 1LSVA 1W7FA 3M6BA 4FTXA 4OPRA 3KSFA 3ITAA 4NXFA 2JC7A 1N9BA 4KQRA 3VFFA 5GLAA 1VETA 3MZEA 1N9LA 4MCWA 4PM6A 3KSHA 5HD3A 4JBFA 2PYRA 5HDSA 3DBAA 5HAIA 1MWTA 3UPOA 4EW7A 1LSXA 1D06A 1IYSA 1KGGA 1DP8A 2GX5A 4K0WA 3MXQA 3A3EA 3Q07A 5F68A 1TS7A 2Y2NA 5DJUA 4DE0A 4EWFA 3HBRA 1YSQA 2I9VA 4EEPA 1FCMA 1Q2QA 1CQAA 2OLUA 3MBZA 1NYYA 1S1ZA 4E3JA 3LIBA 4Z1WA 1ES3A 3PYPA 2Y2MA 3BWLA 3F1OB 3CAXA 3LI8A 1DJAA 1W8YA 2V8FA 1BLHA 2KOIA 4DF6A 1F98A 1DJBA 2ZL1B 4EQIA 4QPRA 2Y79A 2NUPC 2B5RA 3CZDA 4HBTA 4ZDXA 3TG9A 2ZM0A 5AVEA 2VGLM 3S4XA 1Y4OA 4XT2B 2VK3A 4CQHA 3T4KA 3FC7A 1D1JA 3DW0A 4XUXA 2OAP1 3I7JA 3IWQA 3EOIA 3ITBA 1DY6A 5EV0A 1VETB 1BTLA 2QYBA 4XXRA 1WE4A 1XJ3A 4DE3A 1IYQA 3W4QA 3KX0X 2I72A 4CLCA 3S7OA 1QMEA 5TBMB 4OLDA 3U4LP 3ZVWA 2FFFB 3E2LA 3S1YA 4O01A 1FSWA 3SH9A 3MXSA 3HUOA 3A3FA 2Y2QA 4KQDA 3ZDJA 1XXMA 4H6JB 4FSFA 4N9LA 3LIAA 3QNCA 3QP2A 3VFHA 1AXBA 3MKEA 3E4QA 4B88A 3B33A 4E6WA 4GKUA 5J3WA 1YQSA 3MFDA 4PAUA 5M18A 5BOHA 1ERMA 2P9VA 3GDIA 1FR6A 3UB7A 3UDXA 3NDGA 2ZC6B 1RP5A 5A8BA 4WL9A 3EQVA 3A0SA 1UWPX 1YLYA 3QP5A 2P04A 5KSHA 1MXOA 3NOUC 3GQZA 4X68A 5FQQA 2H10A 2X01A 3OPLA 2JKRM 1IKIA 1XFQA 3UN7A 3SH8A 2WGVA 3RXWA 4CLCB 2Y2OA 2IWDA 3OPPA 4HP9A 4HESA 1E25A 3UB6A 4OP8A 3IT9A 2L0WA 4WUJA 1OJ5A 1U60A 2XEPA 4GB7A 5MC7A 2G7UA 4OLGA 3NIAA 5L09A 4MN7A 5DVAA 3PR6A 3NI9A 2ZC5B 2A24A 2A2LA 4MN6A 1K56D 4MDZA 4JF6A 2O99A 1PWDA 4GOGA 4HNBA 4JGQA 4Y2FA 5KIZA 1L0GA 4BLMA 2ZBBA 2P9VB 5E2EA 2PD7A 4IBXA 2ZD8A 5HL1A 3CG5A 3UMDA 3HLFA 5EVIC 1DRMA 1PZPA 3A3IA 5GHYA 3NOPC 4I3IA 1SKOA 3RTYA 3BFFA 1FOFA 3RJUA 2ZLYA 1H5XA 2J9PA 2HDRA 3EWKA 2ZM8A 4PM9A 1OT9A 2VGLS 5AVFA 1W8QA 4YWZA 3IS2A 4EQ1A 4GDNA 4Q0HA 5DF8A 4P6ZM 4S2NA 4JXSA 4BBVA 1S4SA 2Q9MA 4ESPA 4QJGA 2VX8A 4HBUA 2V1ZA 2JKRI 1ZTUA 3HREA 4PM5A 4KZ9A 1W63Q 1O7EA 4CLCE 4KUOA 2YKHA 3G34A 3IF6A 3G32A 2CMNA 3G2YA 4OKPA 3IXDA 3FKVA 2W27A 2XRNA 3IQAA 4K0XA 5CX7A 5F1FA 5DKKA 4LV2A 1KGEA 4E3KA 1H0MA 1S6RA 2V2FF 3ZYTA 2OLVA 2B18A 2XA7M 1NLYA 3HLEA 1E4DA 1F2KA 2UV0E 5HARA 4OOYA 3E2KA 3GTCA 2ACGA 1KE0A 2WYXA 3EGXC 2XSSA 1SKOB 5FA7A 4M4XA 5EM1A 3Q1FA 1K56A 4PMAA 5D3OA 4N1HA 2JKFA 5U47A 4LFUA 2QPNA 3FPVA 4B4XA 3DTEA 5FEGA 3IS2B 2J80A 2LB9A 1CEFA 1G28A 3WS5A 5CTNA 3T4JA 4RX2A 3VP1A 3CWFA 3FV7A 2QWSA 3FKWA 3LEQA 4LCLA 3W4PA 2DCFA 2ZMAA 2W1TB 1KGFA 2AVXA 4OONA 4I3AA 1NRJA 4KZ3A 4EU0A 2J3TD 4EESA 4JF4A 4U0XA 1L0FA 4EETB 1EWZA 3Q81A 4QWOA 1ZG6A 2VGKA 2PT7A 4Y7PA 1IOUA 3MFXA 1KDSA 2D01A 3MF0A 4O0PA 4EUVA 2IWCA 1LHYA 3LR4A 4HP4A 5FQ9A 1YLWA 3W2ZA 3S22A
chains in the Genus database with same CATH topology
3ITAA 4OOMA 1YM1A 4X56A 4RA7A 4DDYA 2JC7A 3Q7ZA 1N9BA 5A93A 5FQMA 1TVFA 1YMSA 4KQRA 4L0LA 1MKIA 4WZ4A 2ZM2A 3O87A 4BL3A 3VFFA 5GLAA 2WGIA 3M6HA 2Y2IA 1LI0A 5EVIA 3MZEA 4QY5A 3BM6A 4PM6A 5EVID 3VP4A 3IHAA 2WAEA 2XGNA 4JBFA 1CEGA 5E43A 1K6SA 2Y2PA 5HAIA 3WRZA 1MWTA 4OP5A 3UPOA 3N8RA 3ZG0A 1TEMA 1MY8A 2G2WA 3N4IA 4HEFA 1GA9A 4P6BA 5GLCA 1YLZA 4KZBA 4R4RA 5FDHA 2EX8A 2XQZA 5KZHA 1IYSA 1NZUA 1KGGA 1K25A 4O7DA 1SDNA 1BULA 3GMWA 4K0WA 3A3EA 3Q07A 5E2GA 3V5MA 3HL9A 5HAQA 1XX2A 1W79A 2CC1A 2Y2NA 4DE0A 4EWFA 5TFQA 4K91A 3HBRA 2WKIA 4LCMA 4M3KA 5A90A 1FCMA 2ZQ9A 1Q2QA 2Y2LA 2OLUA 3FYZA 3MBZA 1NYYA 1VQQA 5EPHA 3UY6A 2XDMA 1IYOA 3SS4A 1ONHA 2EX9A 3UDFA 4E3JA 3OCLA 3PBQA 3MZFA 4DXCA 5EOEA 1OMEA 4E6XA 1ES3A 3WS0A 1I2SA 2Y2MA 4KG6A 1CI9A 3LCEA 1K57A 1O07A 4N9KA 4DE1A 1DJAA 4JPMA 2P74A 1W8YA 1YLJA 4FH4A 2HP5A 2Y2KA 1GHMA 3G35A 1TDGA 1BLHA 1KVMA 1HVBA 1XA1A 1ZC2A 2WKEA 3P09A 4QB8A 4DF6A 3PBSA 3IWIA 1NYMA 2H5SA 4BJPA 1DJBA 4NK3A 4UAAA 4EQIA 2R9WA 3UE1A 4P87A 3GRJA 2B5RA 3CZDA 5CERA 4HBTA 4EBPA 2ZQ8A 3TG9A 4ZDXA 3MXRA 4DRTA 1SHVA 2ZM0A 3S4XA 1MPLA 1YMXA 2ZQAA 2DRWA 1BLPA 2X71A 2C6WB 3HUNA 1H8YA 3G4PA 3LY4A 4Q8IA 3IXHA 1YLPA 3OCNA 1E3UA 3N7WA 3DW0A 1BSGA 4MLLA 4XUXA 1SDEA 3BFDA 4GD6A 2RL3A 1E3UD 1K6RA 3I7JA 3IWQA 3ITBA 4R3JA 1CK3A 1DY6A 1ALQA 2HDQA 1BTLA 1NJ4A 4R4SA 4XXRA 3VP0A 1WE4A 4DE3A 1IYQA 3EQUA 4OQGA 3W4QA 2I72A 1Z6FA 4C3QA 3OPRA 1I5QA 4KZ8A 4UA6A 3DTMA 1QMEA 4OLDA 3SS3A 1XKZA 3IF6B 1RCJA 4S2NC 2EX6A 5DTTA 5FAQA 3ZVWA 3IF5A 2WK0A 5J8XA 1IKGA 3HUMA 4LV0A 4KZ5A 1GA0A 4DKIA 5GHXA 2EX2A 2JBFA 2FFFB 3AGDA 4F94A 1MBLA 2WGWB 4WMCD 2EXAA 1BLSA 1L0EA 3E2LA 3S1YA 5CECA 1FSWA 1FQGA 4OPZA 4X69A 4S2LA 3MXSA 3SH9A 5A92A 3HUOA 3BFGA 3A3FA 2Y91A 3QNBA 2OV5A 2Y2QA 3LO7A 3ZDJA 4OQHA 4GN2A 3ZG5A 1PI5A 4WYYA 1XXMA 5FI2A 4FSFA 2Y4AA 4N9LA 5JYOA 1KDWA 3IF6C 5A91A 1KVLA 3QNCA 5CTMA 4P85A 4QHCA 4Y0UA 3VFHA 1IELA 1AXBA 3UNWA 3MKEA 1KE4A 2XK1A 3OPHA 4LV1A 4CPKA 5HAPA 3IH9A 1ES4A 5TGFA 1NY0A 4B88A 1GHPA 5AQ7A 4E6WA 4N1XA 4GKUA 3HLDA 3PBNA 2WUQA 1HZOA 2XFSA 4WELA 4U3TA 4KQOA 3A3JA 5EVLA 5L2FA 4JXWA 1YQSA 3ISGA 3MFDA 1HD8A 3BFCA 1XA7A 3TOIA 1XP4A 5BOHA 1ERMA 3M2JA 5GLBA 5M18A 3D4FA 2P9VA 4BQMA 2ZJ9A 1FR6A 4Z9QA 3UDXA 3PTEA 4OQIA 3NDGA 3JYIA 4MBKA 2C5WB 5FAPA 2ZC6B 5DF9A 1NZOA 1EI5A 1RP5A 4LV3A 3EQVA 2Z2LB 4OVDA 4MNRA 1Q2PA 1S0WA 5HX9A 1YLYA 3DWZA 3NDEA 4S2IA 2G2UA 2R9XA 5HFOA 2XH9A 3Q7VA 4R0QA 3ZFZA 4ZTKA 4ID4A 5KSHA 1MXOA 3WS4A 3UDIA 3PBTA 1FCOA 4A5RA 3GQZA 4X68A 2HP9A 3G2ZA 3TSGA 1EROA 5FQQA 2H10A 2X01A 3OPLA 1NXYA 1IKIA 2Y2HA 3PAGA 2Y2GA 3UN7A 3SH8A 5CEDA 2WGVA 3RXWA 1JWZA 4WBGA 4GDBA 4OQ0A 2H0TA 4E3LA 2Y2OA 1PWCA 2IWDA 3FZCA 3OPPA 4GD8A 5F83A 4E3IA 4HESA 5DTKA 1CI8A 4X6TA 1E25A 2E8IA 4DXBA 3SS5A 4OP8A 5CEBA 3IT9A 1MWSA 5CHJA 4ZAMA 5GLDA 1PYYA 2PU4A 3RXXA 1Y54A 4QD4A 1LI9A 3VP3A 4OPYA 1U60A 1K4FA 4KQQA 2A3UA 2XEPA 4GB7A 5HW3A 4KZAA 1K54C 1G6AA 1L0DA 4PPRA 4Y0OA 3IHBA 1PW1A 4OLGA 4WEKA 4ZBEA 3UE3A 2QZ6A 4CJNA 3NIAA 1JTDA 4QU3A 3GVBA 4KZ7A 3SOIA 4X55A 5DVAA 4IVIA 3NI9A 2ZC4B 4BENA 2J9OA 4MEZA 5FAOA 3ZVTA 2ZC5B 5CHMA 4FD8A 1TDLA 1SKFA 1L2SA 2WZXA 3A3DA 1G68A 1K56D 5GHZA 4JF5A 3GR2A 1PWGA 4JF6A 3UE0A 1RGYA 1YT4A 3AGEA 4JKTA 4C75A 4DE2A 5EVIB 3WWXA 2HP6A 1PIOA 1PWDA 3HLWA 5DTSA 1K55C 4GOGA 4LENA 1ES5A 1VM1A 3BYDA 5KMWA 5EUAA 5M1AA 1XGIA 1L0GA 4BLMA 1BLCA 4IBRA 3HLGA 1YLTA 2P9VB 4KENB 3C4OA 4S2MA 3HLBA 5E2EA 3NCKA 1K38A 4KG2A 5FQJA 4IBXA 2XLNA 4WMCA 2ZD8A 3WS2A 3OC2A 2H0YA 2J7VA 5FQIA 3CMZA 4EV4A 2WADA 5FI6A 1ES2A 5HL1A 3CG5A 1H8ZA 3C7VA 3HLFA 5EVIC 4S2KA 4KZ4A 3MZDA 3VSLA 1K4EA 1PZPA 1QMFA 2PU2A 3A3IA 4GZBA 4IVKA 4RVAA 5GHYA 1IYPA 4YFMA 5FSRA 1LLBA 1HTZA 1DJCA 3Q7VB 3BFFA 1FOFA 2HDSA 5JYPA 3RJUA 2ZLYA 1ZG4A 3ZNTA 1H5XA 1LL9A 2J9PA 3VP2A 4EUZA 2HDRA 2XD1A 2ZM8A 1N4OA 1WYCA 4RX3A 4PM9A 3PBOA 4MBFA 5CXWA 3ZCZA 3P98A 3M2KA 5EECA 1ZKJA 1W8QA 4JLFA 3FWLA 3G30A 4GDNA 2ZC3B 5AQBA 5DF8A 5F82A 3IXGA 4UHUA 5GL9A 1GHIA 4E3NA 2UWXA 4S2NA 3LEZA 2ZQCA 4JXSA 2Q9MA 1XGJA 2RCXA 3NBLA 4OOLA 4U0TA 1RGZA 5FQKA 4B4ZA 3ZHHA 1NRFA 3BECA 4QJGA 4HBUA 2V1ZA 3GSGA 2HPBA 3WRTA 1JTGA 3HREA 4PM5A 3N8LA 4KZ9A 4S2PA 4WZ5C 4YINA 1PZOA 4KG5A 1C3BA 2HDUA 1FR1A 2XF3A 5E2FA 3N6IA 2EFXA 3BEBA 1O7EA 1MWRA 4S2JA 5KSCA 4JXGA 1K57C 3G34A 3UO9A 2BG1A 2Z2MB 3O3VA 4WEJA 2ZC7A 3IF6A 3G32A 5AQAA 3ZGAB 3HVFA 4UA7A 3G2YA 4OKPA 2J8YA 3ZG7B 2Y59A 3IXDA 3FKVA 1PW8A 2JCHA 2WGWA 2GDNA 3IQAA 3OZHA 4K0XA 2QMIA 5AQ9A 4Y0TA 3B3XA 5F1FA 4LV2A 4R23A 1M6KA 1KGEA 4E3KA 2V20A 3VSKA 1S6RA 2V2FF 1J9MA 2OLVA 3W8KA 2ZQDA 3ZNYA 5DF7A 1WYBA 3HLEA 1E4DA 4RYEA 4IEDA 3IXBA 4GNUA 1ERQA 3DWKA 1IEMA 2XFTA 5HARA 1MWUA 5F1GA 3N8SA 3O86A 4BD1A 3LY3A 3HLCA 4EBLA 1JWPA 4PM7A 1JWVA 3V50A 4WZ5A 3ZG8B 2XR0A 4OOYA 3E2KA 3GTCA 1ONGA 3G31A 3ZG9B 4MBHA 1KE0A 1LL5A 2WYXA 2ZQ7A 4FCFA 3VOYA 5FASA 2WZZA 3BLMA 2IWBA 3VMAA 4XUZA 2Q9NA 3VOZA 4OPQA 5FA7A 5M19A 4E3MA 3IWOA 3Q1FA 4DDSA 1K56A 3NC8A 1GCEA 4EBNA 3MKFA 4PMAA 5D3OA 4N1HA 3C5AA 3AGFA 4E3OA 4X53A 5CGWA 5U47A 5EOOA 2QPNA 3NY4A 5CGSA 5I94A 2EXBA 5FATA 3UPPA 4B4XA 1JVJA 1SCWA 4ZJ2A 1PI4A 3O88A 4OH0A 5TR7A 4P0MA 2OSUA 5CRFA 1W5DA 2EFUA 1CEFA 2DNSA 4NETA 5E2HA 4S2OA 3W4OA 1XPBA 3WS5A 5CTNA 1BUEA 5G18A 4RX2A 5CHUA 3QHYA 3VP1A 1BT5A 4N92A 1ESUA 2WAFA 3FV7A 3BRMA 1ESIA 3BFEA 2Y2JA 2JE5A 1K54A 3FKWA 4FH2A 1BZAA 4LCLA 1KE3A 4R3BA 3Q82A 3V39A 3W4PA 2DCFA 5CGXA 2ZMAA 4BL2A 1KGFA 4OONA 1FCNA 4JXVA 3CJMA 5FI7A 2X02A 3GV9A 3V3RA 5EE8A 4WM9A 2WKHA 4KZ3A 4UA9A 3SH7A 4KZ6A 2XD5A 1I2WA 4JF4A 4U0XA 4C6YA 1L0FA 2BLSA 1EWZA 3Q81A 3C7UA 4ZJ1A 1ZG6A 4ZJ3A 3PAEA 4D2OA 4PM8A 2VGKA 2Y55A 3IH8A 3PBRA 4R1GA 3C4PA 4Y7PA 1FSYA 2A49A 1KDSA 3V3SA 3BLSA 2VGJA 1K55A 3WS1A 1M40A 4H8RA 2IWCA 5IHVA 4QY6A 3UPNA 4BD0A 2FFYA 1W7FA 1LHYA 5FQ9A 3M6BA 2PBYA 1YLWA 4OPRA 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITA A;  4OOM A;  1YM1 A;  4X56 A;  4RA7 A;  4DDY A;  2JC7 A;  3Q7Z A;  1N9B A;  5A93 A;  5FQM A;  1TVF A;  1YMS A;  4KQR A;  4L0L A;  1MKI A;  4WZ4 A;  2ZM2 A;  3O87 A;  4BL3 A;  3VFF A;  5GLA A;  2WGI A;  3M6H A;  2Y2I A;  1LI0 A;  5EVI A;  3MZE A;  4QY5 A;  3BM6 A;  4PM6 A;  5EVI D;  3VP4 A;  3IHA A;  2WAE A;  2XGN A;  4JBF A;  1CEG A;  5E43 A;  1K6S A;  2Y2P A;  5HAI A;  3WRZ A;  1MWT A;  4OP5 A;  3UPO A;  3N8R A;  3ZG0 A;  1TEM A;  1MY8 A;  2G2W A;  3N4I A;  4HEF A;  1GA9 A;  4P6B A;  5GLC A;  1YLZ A;  4KZB A;  4R4R A;  5FDH A;  2EX8 A;  2XQZ A;  5KZH A;  1IYS A;  1NZU A;  1KGG A;  1K25 A;  4O7D A;  1SDN A;  1BUL A;  3GMW A;  4K0W A;  3A3E A;  3Q07 A;  5E2G A;  3V5M A;  3HL9 A;  5HAQ A;  1XX2 A;  1W79 A;  2CC1 A;  2Y2N A;  4DE0 A;  4EWF A;  5TFQ A;  4K91 A;  3HBR A;  2WKI A;  4LCM A;  4M3K A;  5A90 A;  1FCM A;  2ZQ9 A;  1Q2Q A;  2Y2L A;  2OLU A;  3FYZ A;  3MBZ A;  1NYY A;  1VQQ A;  5EPH A;  3UY6 A;  2XDM A;  1IYO A;  3SS4 A;  1ONH A;  2EX9 A;  3UDF A;  4E3J A;  3OCL A;  3PBQ A;  3MZF A;  4DXC A;  5EOE A;  1OME A;  4E6X A;  1ES3 A;  3WS0 A;  1I2S A;  2Y2M A;  4KG6 A;  1CI9 A;  3LCE A;  1K57 A;  1O07 A;  4N9K A;  4DE1 A;  1DJA A;  4JPM A;  2P74 A;  1W8Y A;  1YLJ A;  4FH4 A;  2HP5 A;  2Y2K A;  1GHM A;  3G35 A;  1TDG A;  1BLH A;  1KVM A;  1HVB A;  1XA1 A;  1ZC2 A;  2WKE A;  3P09 A;  4QB8 A;  4DF6 A;  3PBS A;  3IWI A;  1NYM A;  2H5S A;  4BJP A;  1DJB A;  4NK3 A;  4UAA A;  4EQI A;  2R9W A;  3UE1 A;  4P87 A;  3GRJ A;  2B5R A;  3CZD A;  5CER A;  4HBT A;  4EBP A;  2ZQ8 A;  3TG9 A;  4ZDX A;  3MXR A;  4DRT A;  1SHV A;  2ZM0 A;  3S4X A;  1MPL A;  1YMX A;  2ZQA A;  2DRW A;  1BLP A;  2X71 A;  2C6W B;  3HUN A;  1H8Y A;  3G4P A;  3LY4 A;  4Q8I A;  3IXH A;  1YLP A;  3OCN A;  1E3U A;  3N7W A;  3DW0 A;  1BSG A;  4MLL A;  4XUX A;  1SDE A;  3BFD A;  4GD6 A;  2RL3 A;  1E3U D;  1K6R A;  3I7J A;  3IWQ A;  3ITB A;  4R3J A;  1CK3 A;  1DY6 A;  1ALQ A;  2HDQ A;  1BTL A;  1NJ4 A;  4R4S A;  4XXR A;  3VP0 A;  1WE4 A;  4DE3 A;  1IYQ A;  3EQU A;  4OQG A;  3W4Q A;  2I72 A;  1Z6F A;  4C3Q A;  3OPR A;  1I5Q A;  4KZ8 A;  4UA6 A;  3DTM A;  1QME A;  4OLD A;  3SS3 A;  1XKZ A;  3IF6 B;  1RCJ A;  4S2N C;  2EX6 A;  5DTT A;  5FAQ A;  3ZVW A;  3IF5 A;  2WK0 A;  5J8X A;  1IKG A;  3HUM A;  4LV0 A;  4KZ5 A;  1GA0 A;  4DKI A;  5GHX A;  2EX2 A;  2JBF A;  2FFF B;  3AGD A;  4F94 A;  1MBL A;  2WGW B;  4WMC D;  2EXA A;  1BLS A;  1L0E A;  3E2L A;  3S1Y A;  5CEC A;  1FSW A;  1FQG A;  4OPZ A;  4X69 A;  4S2L A;  3MXS A;  3SH9 A;  5A92 A;  3HUO A;  3BFG A;  3A3F A;  2Y91 A;  3QNB A;  2OV5 A;  2Y2Q A;  3LO7 A;  3ZDJ A;  4OQH A;  4GN2 A;  3ZG5 A;  1PI5 A;  4WYY A;  1XXM A;  5FI2 A;  4FSF A;  2Y4A A;  4N9L A;  5JYO A;  1KDW A;  3IF6 C;  5A91 A;  1KVL A;  3QNC A;  5CTM A;  4P85 A;  4QHC A;  4Y0U A;  3VFH A;  1IEL A;  1AXB A;  3UNW A;  3MKE A;  1KE4 A;  2XK1 A;  3OPH A;  4LV1 A;  4CPK A;  5HAP A;  3IH9 A;  1ES4 A;  5TGF A;  1NY0 A;  4B88 A;  1GHP A;  5AQ7 A;  4E6W A;  4N1X A;  4GKU A;  3HLD A;  3PBN A;  2WUQ A;  1HZO A;  2XFS A;  4WEL A;  4U3T A;  4KQO A;  3A3J A;  5EVL A;  5L2F A;  4JXW A;  1YQS A;  3ISG A;  3MFD A;  1HD8 A;  3BFC A;  1XA7 A;  3TOI A;  1XP4 A;  5BOH A;  1ERM A;  3M2J A;  5GLB A;  5M18 A;  3D4F A;  2P9V A;  4BQM A;  2ZJ9 A;  1FR6 A;  4Z9Q A;  3UDX A;  3PTE A;  4OQI A;  3NDG A;  3JYI A;  4MBK A;  2C5W B;  5FAP A;  2ZC6 B;  5DF9 A;  1NZO A;  1EI5 A;  1RP5 A;  4LV3 A;  3EQV A;  2Z2L B;  4OVD A;  4MNR A;  1Q2P A;  1S0W A;  5HX9 A;  1YLY A;  3DWZ A;  3NDE A;  4S2I A;  2G2U A;  2R9X A;  5HFO A;  2XH9 A;  3Q7V A;  4R0Q A;  3ZFZ A;  4ZTK A;  4ID4 A;  5KSH A;  1MXO A;  3WS4 A;  3UDI A;  3PBT A;  1FCO A;  4A5R A;  3GQZ A;  4X68 A;  2HP9 A;  3G2Z A;  3TSG A;  1ERO A;  5FQQ A;  2H10 A;  2X01 A;  3OPL A;  1NXY A;  1IKI A;  2Y2H A;  3PAG A;  2Y2G A;  3UN7 A;  3SH8 A;  5CED A;  2WGV A;  3RXW A;  1JWZ A;  4WBG A;  4GDB A;  4OQ0 A;  2H0T A;  4E3L A;  2Y2O A;  1PWC A;  2IWD A;  3FZC A;  3OPP A;  4GD8 A;  5F83 A;  4E3I A;  4HES A;  5DTK A;  1CI8 A;  4X6T A;  1E25 A;  2E8I A;  4DXB A;  3SS5 A;  4OP8 A;  5CEB A;  3IT9 A;  1MWS A;  5CHJ A;  4ZAM A;  5GLD A;  1PYY A;  2PU4 A;  3RXX A;  1Y54 A;  4QD4 A;  1LI9 A;  3VP3 A;  4OPY A;  1U60 A;  1K4F A;  4KQQ A;  2A3U A;  2XEP A;  4GB7 A;  5HW3 A;  4KZA A;  1K54 C;  1G6A A;  1L0D A;  4PPR A;  4Y0O A;  3IHB A;  1PW1 A;  4OLG A;  4WEK A;  4ZBE A;  3UE3 A;  2QZ6 A;  4CJN A;  3NIA A;  1JTD A;  4QU3 A;  3GVB A;  4KZ7 A;  3SOI A;  4X55 A;  5DVA A;  4IVI A;  3NI9 A;  2ZC4 B;  4BEN A;  2J9O A;  4MEZ A;  5FAO A;  3ZVT A;  2ZC5 B;  5CHM A;  4FD8 A;  1TDL A;  1SKF A;  1L2S A;  2WZX A;  3A3D A;  1G68 A;  1K56 D;  5GHZ A;  4JF5 A;  3GR2 A;  1PWG A;  4JF6 A;  3UE0 A;  1RGY A;  1YT4 A;  3AGE A;  4JKT A;  4C75 A;  4DE2 A;  5EVI B;  3WWX A;  2HP6 A;  1PIO A;  1PWD A;  3HLW A;  5DTS A;  1K55 C;  4GOG A;  4LEN A;  1ES5 A;  1VM1 A;  3BYD A;  5KMW A;  5EUA A;  5M1A A;  1XGI A;  1L0G A;  4BLM A;  1BLC A;  4IBR A;  3HLG A;  1YLT A;  2P9V B;  4KEN B;  3C4O A;  4S2M A;  3HLB A;  5E2E A;  3NCK A;  1K38 A;  4KG2 A;  5FQJ A;  4IBX A;  2XLN A;  4WMC A;  2ZD8 A;  3WS2 A;  3OC2 A;  2H0Y A;  2J7V A;  5FQI A;  3CMZ A;  4EV4 A;  2WAD A;  5FI6 A;  1ES2 A;  5HL1 A;  3CG5 A;  1H8Z A;  3C7V A;  3HLF A;  5EVI C;  4S2K A;  4KZ4 A;  3MZD A;  3VSL A;  1K4E A;  1PZP A;  1QMF A;  2PU2 A;  3A3I A;  4GZB A;  4IVK A;  4RVA A;  5GHY A;  1IYP A;  4YFM A;  5FSR A;  1LLB A;  1HTZ A;  1DJC A;  3Q7V B;  3BFF A;  1FOF A;  2HDS A;  5JYP A;  3RJU A;  2ZLY A;  1ZG4 A;  3ZNT A;  1H5X A;  1LL9 A;  2J9P A;  3VP2 A;  4EUZ A;  2HDR A;  2XD1 A;  2ZM8 A;  1N4O A;  1WYC A;  4RX3 A;  4PM9 A;  3PBO A;  4MBF A;  5CXW A;  3ZCZ A;  3P98 A;  3M2K A;  5EEC A;  1ZKJ A;  1W8Q A;  4JLF A;  3FWL A;  3G30 A;  4GDN A;  2ZC3 B;  5AQB A;  5DF8 A;  5F82 A;  3IXG A;  4UHU A;  5GL9 A;  1GHI A;  4E3N A;  2UWX A;  4S2N A;  3LEZ A;  2ZQC A;  4JXS A;  2Q9M A;  1XGJ A;  2RCX A;  3NBL A;  4OOL A;  4U0T A;  1RGZ A;  5FQK A;  4B4Z A;  3ZHH A;  1NRF A;  3BEC A;  4QJG A;  4HBU A;  2V1Z A;  3GSG A;  2HPB A;  3WRT A;  1JTG A;  3HRE A;  4PM5 A;  3N8L A;  4KZ9 A;  4S2P A;  4WZ5 C;  4YIN A;  1PZO A;  4KG5 A;  1C3B A;  2HDU A;  1FR1 A;  2XF3 A;  5E2F A;  3N6I A;  2EFX A;  3BEB A;  1O7E A;  1MWR A;  4S2J A;  5KSC A;  4JXG A;  1K57 C;  3G34 A;  3UO9 A;  2BG1 A;  2Z2M B;  3O3V A;  4WEJ A;  2ZC7 A;  3IF6 A;  3G32 A;  5AQA A;  3ZGA B;  3HVF A;  4UA7 A;  3G2Y A;  4OKP A;  2J8Y A;  3ZG7 B;  2Y59 A;  3IXD A;  3FKV A;  1PW8 A;  2JCH A;  2WGW A;  2GDN A;  3IQA A;  3OZH A;  4K0X A;  2QMI A;  5AQ9 A;  4Y0T A;  3B3X A;  5F1F A;  4LV2 A;  4R23 A;  1M6K A;  1KGE A;  4E3K A;  2V20 A;  3VSK A;  1S6R A;  2V2F F;  1J9M A;  2OLV A;  3W8K A;  2ZQD A;  3ZNY A;  5DF7 A;  1WYB A;  3HLE A;  1E4D A;  4RYE A;  4IED A;  3IXB A;  4GNU A;  1ERQ A;  3DWK A;  1IEM A;  2XFT A;  5HAR A;  1MWU A;  5F1G A;  3N8S A;  3O86 A;  4BD1 A;  3LY3 A;  3HLC A;  4EBL A;  1JWP A;  4PM7 A;  1JWV A;  3V50 A;  4WZ5 A;  3ZG8 B;  2XR0 A;  4OOY A;  3E2K A;  3GTC A;  1ONG A;  3G31 A;  3ZG9 B;  4MBH A;  1KE0 A;  1LL5 A;  2WYX A;  2ZQ7 A;  4FCF A;  3VOY A;  5FAS A;  2WZZ A;  3BLM A;  2IWB A;  3VMA A;  4XUZ A;  2Q9N A;  3VOZ A;  4OPQ A;  5FA7 A;  5M19 A;  4E3M A;  3IWO A;  3Q1F A;  4DDS A;  1K56 A;  3NC8 A;  1GCE A;  4EBN A;  3MKF A;  4PMA A;  5D3O A;  4N1H A;  3C5A A;  3AGF A;  4E3O A;  4X53 A;  5CGW A;  5U47 A;  5EOO A;  2QPN A;  3NY4 A;  5CGS A;  5I94 A;  2EXB A;  5FAT A;  3UPP A;  4B4X A;  1JVJ A;  1SCW A;  4ZJ2 A;  1PI4 A;  3O88 A;  4OH0 A;  5TR7 A;  4P0M A;  2OSU A;  5CRF A;  1W5D A;  2EFU A;  1CEF A;  2DNS A;  4NET A;  5E2H A;  4S2O A;  3W4O A;  1XPB A;  3WS5 A;  5CTN A;  1BUE A;  5G18 A;  4RX2 A;  5CHU A;  3QHY A;  3VP1 A;  1BT5 A;  4N92 A;  1ESU A;  2WAF A;  3FV7 A;  3BRM A;  1ESI A;  3BFE A;  2Y2J A;  2JE5 A;  1K54 A;  3FKW A;  4FH2 A;  1BZA A;  4LCL A;  1KE3 A;  4R3B A;  3Q82 A;  3V39 A;  3W4P A;  2DCF A;  5CGX A;  2ZMA A;  4BL2 A;  1KGF A;  4OON A;  1FCN A;  4JXV A;  3CJM A;  5FI7 A;  2X02 A;  3GV9 A;  3V3R A;  5EE8 A;  4WM9 A;  2WKH A;  4KZ3 A;  4UA9 A;  3SH7 A;  4KZ6 A;  2XD5 A;  1I2W A;  4JF4 A;  4U0X A;  4C6Y A;  1L0F A;  2BLS A;  1EWZ A;  3Q81 A;  3C7U A;  4ZJ1 A;  1ZG6 A;  4ZJ3 A;  3PAE A;  4D2O A;  4PM8 A;  2VGK A;  2Y55 A;  3IH8 A;  3PBR A;  4R1G A;  3C4P A;  4Y7P A;  1FSY A;  2A49 A;  1KDS A;  3V3S A;  3BLS A;  2VGJ A;  1K55 A;  3WS1 A;  1M40 A;  4H8R A;  2IWC A;  5IHV A;  4QY6 A;  3UPN A;  4BD0 A;  2FFY A;  1W7F A;  1LHY A;  5FQ9 A;  3M6B A;  2PBY A;  1YLW A;  4OPR A;  3S22 A; 
#chains in the Genus database with same CATH topology
 1YM1 A;  4X56 A;  4RA7 A;  1MKI A;  3O87 A;  4BL3 A;  4EER A;  2WGI A;  3M6H A;  2M7V A;  5TJJ A;  4UEY A;  4NKP A;  3VP4 A;  3IHA A;  2WAE A;  4WF0 A;  1CEG A;  2E8J A;  1T1A A;  4RQ9 A;  2LB5 A;  4G3K A;  4Y5F A;  1VEU A;  4HEF A;  4P6B A;  5GLC A;  1YLZ A;  1NLZ A;  4LRZ E;  5L8M A;  3SW1 A;  1BUL A;  3KSI A;  3GMW A;  5E2G A;  3HL9 A;  4L9F A;  1W79 A;  2WKP A;  4M3K A;  2GJ3 A;  3VOL A;  3MQQ A;  3LYX A;  3FYZ A;  1VQQ A;  4UQI S;  1IYO A;  1ZHH B;  5IT5 A;  4DXC A;  4P6Z S;  2VLG A;  1CI9 A;  3LCE A;  1K57 A;  1O07 A;  1WA9 A;  4N9K A;  4DE1 A;  2P74 A;  1GHM A;  1KVM A;  4GJ4 A;  1ZC2 A;  1MKM A;  2PR6 A;  4NK3 A;  3IX4 A;  2ZQ8 A;  2FH5 A;  3MXR A;  1MPL A;  3MQO A;  2X71 A;  3G4P A;  3LY4 A;  1SZV A;  1LSW A;  3IXH A;  3P01 A;  3T4O A;  3N7W A;  4MLL A;  1SDE A;  3CPT A;  2JKT I;  1K6R A;  3QP4 A;  1YPR A;  4KUK A;  4HQA A;  1A0K A;  4OQG A;  2XA7 S;  4HHD A;  4NG2 A;  4C3Q A;  4KZ8 A;  1PFL A;  4R3A A;  4Y15 A;  1XKZ A;  5HPI A;  1VEU B;  3QP6 A;  5DTT A;  2WK0 A;  3HUM A;  4KZ5 A;  1GA0 A;  4NEE D;  4DKI A;  2W3D A;  2JBF A;  3AGD A;  5HSQ A;  5L07 A;  3NHQ A;  1L0E A;  5CEC A;  1OJG A;  1YKD A;  1FQG A;  4NXG A;  2Y91 A;  2EWV A;  3ZG5 A;  1PI5 A;  4X1L A;  2Y4A A;  5JYO A;  5A91 A;  1KVL A;  5CTM A;  1XFN A;  4P85 A;  5HDD A;  4LV1 A;  3F1N A;  3OPH A;  5FL3 A;  1ES4 A;  3NJA A;  1GHP A;  1OPX A;  5AQ7 A;  1HZO A;  2XFS A;  3A3J A;  3ISG A;  4HI4 A;  4HIA A;  1GSV A;  1XA7 A;  3M2J A;  3D4F A;  2ZJ9 A;  4Z9Q A;  3CUE C;  3TW8 A;  3JYI A;  4MBK A;  3K3C A;  5DF9 A;  3JVV A;  1EI5 A;  2Z2L B;  1V9Z A;  4MNR A;  1Q2P A;  1S0W A;  5HX9 A;  3NDE A;  5IS1 A;  4ARZ A;  2R9X A;  5DJT A;  1S67 L;  3LIC A;  3QP1 A;  4ZTK A;  4AFI A;  4O8G A;  3PBT A;  1TD5 A;  3TSG A;  1ERO A;  1T1B A;  3T1Q B;  1NXY A;  2Y2G A;  4E04 A;  1JWZ A;  2HJ9 C;  2H0T A;  1PWC A;  3FZC A;  3RFB A;  4GD8 A;  5F83 A;  5DTK A;  4DXB A;  4G3V A;  4X6T A;  3CLO A;  1MWS A;  3FPW A;  5GLD A;  3LGO A;  2M1C A;  4QD4 A;  1LI9 A;  4ME4 A;  2QJ7 A;  4KZA A;  1K54 C;  1PRQ A;  4ZBE A;  3UE3 A;  2QZ6 A;  4CJN A;  4KZ7 A;  4X55 A;  1CF0 A;  2ZC4 B;  5CHM A;  3F1P A;  2WZX A;  5GHZ A;  3UE0 A;  1YT4 A;  2NUT C;  3WWX A;  3K3D A;  1PIO A;  5DTS A;  1S66 L;  3L7H A;  1VM1 A;  3DTI A;  2KDK A;  1BLC A;  1YLT A;  4S2M A;  2V8C A;  3NCK A;  3WS2 A;  2H0Y A;  5FQI A;  5HPF A;  2WAD A;  2OAQ 1;  1ES2 A;  5FI6 A;  3H82 A;  1H8Z A;  3C7V A;  2Q0O A;  4KZ4 A;  4ARZ B;  2PU2 A;  2PAV P;  1IYP A;  4BBU A;  4YFM A;  3T12 B;  2HDS A;  3OOV A;  4GW9 A;  3EEH A;  4ETZ A;  3TJZ C;  3VP2 A;  3DTK A;  4EUZ A;  2XD1 A;  1Y28 A;  4RX3 A;  4MBF A;  1P0Z A;  3BJN A;  1P9R A;  3FWL A;  3G30 A;  3IBJ A;  5AQB A;  4UHU A;  2UWX A;  1T1C A;  2DMW A;  2ZQC A;  4I3J A;  3N8L A;  4YIN A;  2XF3 A;  1FR1 A;  2HV1 A;  4Q0J A;  4JXG A;  4PKY G;  3F1P B;  2HJE A;  1OTE A;  5AQA A;  1IFQ A;  3ZG7 B;  2M7U A;  2JCH A;  2WGW A;  2GDN A;  1M6K A;  1J9M A;  3W8K A;  2PDR A;  3IXB A;  3DWK A;  3N8S A;  3LY3 A;  3C30 A;  3HLC A;  4EBL A;  1JWV A;  3T4T A;  2XR0 A;  3H82 B;  1ONG A;  4WN5 A;  3ZG9 B;  3NOT C;  2QJ5 A;  3E4O A;  2Q9N A;  3ICY A;  3VOZ A;  4OPQ A;  2QHK A;  4DDS A;  4EBN A;  4LGW A;  4E3O A;  3C5A A;  4X53 A;  4JGP A;  5CGW A;  1ODV A;  5EOO A;  4I39 A;  3NUL A;  4HH3 A;  1W5D A;  2EFU A;  2DNS A;  5E2H A;  4S2O A;  3QP8 A;  1XPB A;  1BUE A;  2MJ6 A;  3K2N A;  5G18 A;  5CHU A;  1BT5 A;  1P9W A;  1ESU A;  1ESI A;  3BFE A;  2Y2J A;  3A0V A;  1KE3 A;  3V39 A;  4PKY A;  1FCN A;  4JXV A;  5FI7 A;  3GV9 A;  3V3R A;  3SH7 A;  4YOF A;  3T4S A;  3ZQ5 A;  3GEC A;  3TRC A;  5LBR A;  4ZJ3 A;  2O9A A;  1FSY A;  2A49 A;  2B95 A;  2K7S A;  2VV7 A;  2ZOH A;  1M40 A;  4H8R A;  4UQI M;  4BD0 A;  2J3W A;  2PBY A;  5IU1 A;  4DMZ A;  1GSW A;  4DDY A;  5A93 A;  5FQM A;  4L0L A;  3MSH A;  4WZ4 A;  5EVI A;  3MS6 A;  3BM6 A;  3UB8 A;  1H3Q A;  4HJ4 A;  2A24 B;  3WRZ A;  4OP5 A;  1TEM A;  3N4I A;  3S7N A;  1GA9 A;  3RH8 B;  4KZB A;  5FDH A;  4HJ6 A;  2EX8 A;  2O9C A;  3H7W A;  2Z6D A;  1OTA A;  1SDN A;  3CI6 A;  3V5M A;  2VZW A;  5HAQ A;  3UME A;  1XX2 A;  2CC1 A;  4K91 A;  2WKI A;  2ZQ9 A;  2W0N A;  3T4Q A;  3T50 A;  3UY6 A;  1ONH A;  2EX9 A;  4B93 A;  3PBQ A;  4LPZ A;  5EOE A;  1OME A;  3WS0 A;  3HJK A;  3E98 A;  2PRF A;  1Z09 A;  3CHW P;  4FH4 A;  2VJW A;  2Y2K A;  2W3H A;  1TDG A;  1XA1 A;  4QB8 A;  3PBS A;  2HGV A;  4G3W A;  4BJP A;  4UAA A;  1F5M A;  2R9W A;  4P87 A;  2K31 A;  2ZQA A;  2DRW A;  5HWW A;  1BLP A;  1H8Y A;  3BQ8 A;  2OWJ A;  2V0W A;  1E3U A;  3HJI A;  5HDC A;  3R7W A;  1XJ6 A;  4GD6 A;  1ACF A;  1ALQ A;  1MZU A;  1NJ4 A;  3VP0 A;  4R4S A;  5DFX A;  4DN0 A;  3V67 A;  4PHT A;  5HD5 A;  3OPR A;  4UA6 A;  2ZOI A;  3DTM A;  2JN7 A;  3IF6 B;  1RCJ A;  5FAQ A;  5J8X A;  1IKG A;  1LL8 A;  2EA9 A;  5GHX A;  4WLA A;  4F94 A;  1MBL A;  4WMC D;  2EXA A;  1BLS A;  1OT6 A;  3LID A;  1P97 A;  4OPZ A;  3BFG A;  3QNB A;  3IBR A;  3LO7 A;  4BWI A;  4GN2 A;  5FI2 A;  4WYY A;  1KDW A;  2R78 A;  4F3L A;  5J7E A;  4HJ3 A;  4QHC A;  4Y0U A;  1IEL A;  3VV4 A;  1KE4 A;  5HAP A;  3IH9 A;  1NY0 A;  3ULF A;  4ZRR A;  3C2W A;  1STZ A;  2PBD P;  5FDS A;  4WEL A;  5EVL A;  4LRX C;  4JXW A;  3BFC A;  5GLB A;  3PTE A;  4LRY C;  4OQI A;  2C5W B;  4LV3 A;  2V1A A;  4OVD A;  4S2I A;  2G2U A;  5EFW A;  5HFO A;  1OTD A;  3Q7V A;  4R0Q A;  4Y3I A;  5G4Y A;  3WS4 A;  3UDI A;  1FCO A;  4A5R A;  3R7W B;  2PHY A;  4GS9 A;  2Y2H A;  5CED A;  4WBG A;  4GDB A;  1N9N A;  4E3L A;  4E3I A;  2E8I A;  2IA2 A;  4ZAM A;  5CHJ A;  1T19 A;  2PU4 A;  3VP3 A;  4OPY A;  5HW3 A;  1DP6 A;  2ZMV A;  1G6A A;  5G4Z A;  4PPR A;  3IHB A;  2VKS A;  2P08 A;  3SOI A;  3GVB A;  3E4P A;  4MN5 A;  4IUH A;  1UGU A;  4IVI A;  1L3L A;  1S1Y A;  2FZ0 A;  4BEN A;  3ZVT A;  4MEZ A;  5FAO A;  2J3T C;  1SKF A;  1L2S A;  1TS8 A;  3L9K A;  1PWG A;  2HF6 A;  3AGE A;  1XJ4 A;  1TS0 A;  2HP6 A;  1K0K A;  3OBF A;  3HLW A;  1K55 C;  2VEA A;  4LEN A;  1ES5 A;  1H8M A;  5KMW A;  5EUA A;  5M1A A;  4IBR A;  3HLG A;  5HWT A;  4KEN B;  3HLB A;  4KG2 A;  5FQJ A;  2XLN A;  4WMC A;  3OC2 A;  4EV4 A;  3KYE A;  2O9B A;  3UE6 A;  3MZD A;  1QMF A;  4IVK A;  4GZB A;  3O5Y A;  2VV6 A;  5FSR A;  1LLB A;  1DJC A;  3Q7V B;  1ZG4 A;  3PBO A;  3E0Y A;  5CXW A;  1TF1 A;  1D7E A;  3P98 A;  3ZCZ A;  2ZL1 A;  1KOU A;  1OTB A;  3M2K A;  5HL6 A;  2H28 A;  3LIF A;  2ZC3 B;  2PYP A;  1GHI A;  4E3N A;  4XT2 A;  1XGJ A;  4OOL A;  4U0T A;  5FQK A;  4B4Z A;  3LR0 A;  3GSG A;  2HPB A;  5K5B A;  2XRO A;  1C3B A;  2HDU A;  4NXB A;  3KSG A;  1HLU P;  2EFX A;  3BEB A;  2KLI A;  5HZH A;  1MWR A;  3UO9 A;  3O3V A;  4WEJ A;  5TBM A;  3HVF A;  3CPT B;  2Y8H A;  2J8Y A;  2QMI A;  4Y0T A;  2KX6 A;  4Q0I A;  1AWI A;  2V20 A;  4R38 A;  3KO6 A;  2OOL A;  3ZNY A;  5DF7 A;  2Z6C A;  4IED A;  3CUE A;  4GNU A;  4H6J A;  1MWU A;  3MR0 A;  4FOF A;  4PM7 A;  3V50 A;  2W3F A;  3VE4 A;  5FAS A;  1LL5 A;  2ZQ7 A;  2IWB A;  3VMA A;  4CLC C;  3JPU A;  2L4R A;  1NWZ A;  5M19 A;  4E3M A;  3IWO A;  1GCE A;  1N9O A;  1TS6 A;  3B47 A;  3AGF A;  5FAT A;  3UPP A;  1SCW A;  3F1N B;  3O88 A;  5TR7 A;  2OSU A;  3UB5 P;  2BTF P;  3LIE A;  3LFV A;  4NXE A;  5EM0 A;  3QHY A;  2WAF A;  3BRM A;  3JVU A;  1K54 A;  4FH2 A;  1BZA A;  2P7J A;  3G6O A;  3Q82 A;  3BY8 A;  3OLO A;  1J3W A;  3CJM A;  3A0R A;  2JHE A;  4I38 A;  3KYZ A;  4UA9 A;  2PD8 A;  1I2W A;  3S7Q A;  4C6Y A;  2BLS A;  3C7U A;  4D2O A;  4PM8 A;  3IH8 A;  3V3S A;  1FIK A;  3BLS A;  1F9I A;  2VGJ A;  3WS1 A;  3UPN A;  4QY6 A;  2FFY A;  1MC0 A;  4FUW A;  4OOM A;  3Q7Z A;  1TVF A;  1YMS A;  2ZM2 A;  4LLO B;  3D9Y A;  2Y2I A;  1LI0 A;  3MJQ A;  4QY5 A;  5EVI D;  2XGN A;  5EVE A;  5E43 A;  1K6S A;  2Y2P A;  3PHY A;  3N8R A;  3IX8 A;  3ZG0 A;  1MY8 A;  2G2W A;  4R4R A;  2XQZ A;  5L10 A;  5C5K A;  5KZH A;  1NZU A;  1K25 A;  4O7D A;  2V1B A;  1YSP A;  4K08 A;  5TFQ A;  4II7 A;  3R4K A;  4LCM A;  5A90 A;  2Y2L A;  5EPH A;  2XDM A;  3SS4 A;  3UDF A;  2ZMF A;  3OCL A;  3B42 A;  3MZF A;  2B02 A;  4E6X A;  1I2S A;  4KG6 A;  4B9O A;  4IUK A;  2D02 A;  4JPM A;  1YLJ A;  2HP5 A;  3G35 A;  4Y17 A;  1HVB A;  2WKE A;  3P09 A;  1OTI A;  3IWI A;  1NYM A;  2H5S A;  1EW0 A;  3UE1 A;  3GRJ A;  5CER A;  4EBP A;  5F6A A;  4DRT A;  1SHV A;  1YMX A;  2C6W B;  3HUN A;  4Q8I A;  1YLP A;  3OCN A;  2EWW A;  1BSG A;  3BFD A;  2RL3 A;  1E3U D;  4R3J A;  1CK3 A;  1S4R A;  2HDQ A;  3VE3 A;  3EQU A;  1Z6F A;  3EEA A;  4IHQ A;  5HWV A;  1DP9 A;  1I5Q A;  3SS3 A;  3SZT A;  4S2N C;  2EX6 A;  3IF5 A;  4LV0 A;  3LUQ A;  2JKG A;  2EX2 A;  5FEF A;  3P7N A;  1PNE A;  2WGW B;  3CIT A;  2O0Y A;  3LR5 A;  4X69 A;  4S2L A;  5A92 A;  2OV5 A;  4OQH A;  2YKF A;  3IF6 C;  4HOI A;  4BMW A;  3T1X A;  3C38 A;  3UNW A;  2XK1 A;  4CPK A;  5TGF A;  3C8C A;  4YNR A;  4N1X A;  3HLD A;  3PBN A;  2WUQ A;  4U3T A;  4KQO A;  5L2F A;  1HD8 A;  3TOI A;  1XP4 A;  2VA0 A;  3D72 A;  4BQM A;  2PR5 A;  5FAP A;  2WKQ A;  1V9Y A;  1NZO A;  2W1T A;  1T18 A;  3DWZ A;  1X0O A;  2W3E A;  3IX3 A;  1VHM A;  2XH9 A;  3ZFZ A;  4ID4 A;  1VB6 A;  2HP9 A;  3G2Z A;  2K2N A;  4IJG A;  3H9W A;  3PAG A;  4OQ0 A;  1CI8 A;  3SS5 A;  5CEB A;  1PYY A;  3RXX A;  1Y54 A;  4EEU A;  4KQQ A;  1K4F A;  2A3U A;  4R70 A;  4JGR A;  1L0D A;  4Y0O A;  1PW1 A;  4WEK A;  1W63 M;  3T1S A;  1LT0 A;  4QU3 A;  1JTD A;  3EGD C;  2J9O A;  4FD8 A;  1TDL A;  3A3D A;  4HY8 A;  1G68 A;  4JF5 A;  3GR2 A;  3DAV A;  1RGY A;  3S7P A;  1GSX A;  3MMH A;  5F5Y A;  4JKT A;  4C75 A;  4DE2 A;  5EVI B;  4L9G A;  1XJ2 A;  4DJ2 A;  5DFY A;  3BYD A;  1XGI A;  2QKP A;  2OWH A;  4EXO A;  3C4O A;  1K38 A;  4GHI A;  3H7W B;  2J7V A;  3CMZ A;  3LR3 A;  2W1R A;  4JGO A;  4X1M A;  4S2K A;  3VSL A;  1K4E A;  5F69 A;  4RVA A;  2V9A A;  1HTZ A;  5JYP A;  1UWN X;  3ZNT A;  1LL9 A;  1N4O A;  1WYC A;  2JKT M;  3FG8 A;  4ETX A;  3U2A A;  5EEC A;  1ZKJ A;  4JLF A;  1CJF A;  5F82 A;  3IXG A;  2GNX A;  5GL9 A;  4L9E A;  3LEZ A;  3MQ0 A;  2RCX A;  3NBL A;  1RGZ A;  3T1R A;  3ZHH A;  1NRF A;  3BEC A;  4DJ3 A;  3WRT A;  1JTG A;  4I5S A;  4S2P A;  4WZ5 C;  1PZO A;  4KG5 A;  5E2F A;  3N6I A;  5AJG A;  5KSC A;  4S2J A;  4GCZ A;  1K57 C;  2BG1 A;  2Z2M B;  5J4E A;  2ZC7 A;  1JNU A;  3BQA A;  3ZGA B;  4UA7 A;  4Y13 A;  2Y59 A;  1BYW A;  1PW8 A;  2VV8 A;  3BW6 A;  3OZH A;  5AQ9 A;  3B3X A;  4MMN A;  4R23 A;  4D60 A;  2V0U A;  3TE8 A;  5I5L A;  1G6O A;  3VSK A;  1YAX A;  5DKL A;  2ZQD A;  1WYB A;  3HCY A;  4RYE A;  1ERQ A;  1IEM A;  2XFT A;  5F1G A;  4GHI B;  3O86 A;  4BD1 A;  3UB9 A;  1JWP A;  3BY9 A;  4WZ5 A;  3ZG8 B;  3G31 A;  4MBH A;  4R6L A;  4FCF A;  3VOY A;  2WZZ A;  3BLM A;  4XUZ A;  4GLQ A;  2HZ5 A;  1FIL A;  3NC8 A;  3MKF A;  2BAS A;  4F3L B;  3NY4 A;  5CGS A;  5I94 A;  2EXB A;  3LI9 A;  1G5U A;  1JVJ A;  4ZJ2 A;  1PI4 A;  3PXP A;  3KYQ A;  4OH0 A;  4P0M A;  5CRF A;  4NET A;  3W4O A;  4N92 A;  2GZA A;  2JE5 A;  4X25 A;  4HH2 A;  3D3O A;  4R3B A;  5CGX A;  4BL2 A;  2X02 A;  5EE8 A;  4BBT A;  4WM9 A;  4CLC D;  2WKH A;  3F1O A;  4KZ6 A;  2W3G A;  2XD5 A;  3NEC A;  3T4L A;  4ZJ1 A;  4GS9 B;  3PAE A;  3PBR A;  2Y55 A;  4R1G A;  2INW A;  3C4P A;  2L1M A;  1K55 A;  2WKR A;  5IHV A;  1LSV A;  1W7F A;  3M6B A;  4FTX A;  4OPR A;  3KSF A;  3ITA A;  4NXF A;  2JC7 A;  1N9B A;  4KQR A;  3VFF A;  5GLA A;  1VET A;  3MZE A;  1N9L A;  4MCW A;  4PM6 A;  3KSH A;  5HD3 A;  4JBF A;  2PYR A;  5HDS A;  3DBA A;  5HAI A;  1MWT A;  3UPO A;  4EW7 A;  1LSX A;  1D06 A;  1IYS A;  1KGG A;  1DP8 A;  2GX5 A;  4K0W A;  3MXQ A;  3A3E A;  3Q07 A;  5F68 A;  1TS7 A;  2Y2N A;  5DJU A;  4DE0 A;  4EWF A;  3HBR A;  1YSQ A;  2I9V A;  4EEP A;  1FCM A;  1Q2Q A;  1CQA A;  2OLU A;  3MBZ A;  1NYY A;  1S1Z A;  4E3J A;  3LIB A;  4Z1W A;  1ES3 A;  3PYP A;  2Y2M A;  3BWL A;  3F1O B;  3CAX A;  3LI8 A;  1DJA A;  1W8Y A;  2V8F A;  1BLH A;  2KOI A;  4DF6 A;  1F98 A;  1DJB A;  2ZL1 B;  4EQI A;  4QPR A;  2Y79 A;  2NUP C;  2B5R A;  3CZD A;  4HBT A;  4ZDX A;  3TG9 A;  2ZM0 A;  5AVE A;  2VGL M;  3S4X A;  1Y4O A;  4XT2 B;  2VK3 A;  4CQH A;  3T4K A;  3FC7 A;  1D1J A;  3DW0 A;  4XUX A;  2OAP 1;  3I7J A;  3IWQ A;  3EOI A;  3ITB A;  1DY6 A;  5EV0 A;  1VET B;  1BTL A;  2QYB A;  4XXR A;  1WE4 A;  1XJ3 A;  4DE3 A;  1IYQ A;  3W4Q A;  3KX0 X;  2I72 A;  4CLC A;  3S7O A;  1QME A;  5TBM B;  4OLD A;  3U4L P;  3ZVW A;  2FFF B;  3E2L A;  3S1Y A;  4O01 A;  1FSW A;  3SH9 A;  3MXS A;  3HUO A;  3A3F A;  2Y2Q A;  4KQD A;  3ZDJ A;  1XXM A;  4H6J B;  4FSF A;  4N9L A;  3LIA A;  3QNC A;  3QP2 A;  3VFH A;  1AXB A;  3MKE A;  3E4Q A;  4B88 A;  3B33 A;  4E6W A;  4GKU A;  5J3W A;  1YQS A;  3MFD A;  4PAU A;  5M18 A;  5BOH A;  1ERM A;  2P9V A;  3GDI A;  1FR6 A;  3UB7 A;  3UDX A;  3NDG A;  2ZC6 B;  1RP5 A;  5A8B A;  4WL9 A;  3EQV A;  3A0S A;  1UWP X;  1YLY A;  3QP5 A;  2P04 A;  5KSH A;  1MXO A;  3NOU C;  3GQZ A;  4X68 A;  5FQQ A;  2H10 A;  2X01 A;  3OPL A;  2JKR M;  1IKI A;  1XFQ A;  3UN7 A;  3SH8 A;  2WGV A;  3RXW A;  4CLC B;  2Y2O A;  2IWD A;  3OPP A;  4HP9 A;  4HES A;  1E25 A;  3UB6 A;  4OP8 A;  3IT9 A;  2L0W A;  4WUJ A;  1OJ5 A;  1U60 A;  2XEP A;  4GB7 A;  5MC7 A;  2G7U A;  4OLG A;  3NIA A;  5L09 A;  4MN7 A;  5DVA A;  3PR6 A;  3NI9 A;  2ZC5 B;  2A24 A;  2A2L A;  4MN6 A;  1K56 D;  4MDZ A;  4JF6 A;  2O99 A;  1PWD A;  4GOG A;  4HNB A;  4JGQ A;  4Y2F A;  5KIZ A;  1L0G A;  4BLM A;  2ZBB A;  2P9V B;  5E2E A;  2PD7 A;  4IBX A;  2ZD8 A;  5HL1 A;  3CG5 A;  3UMD A;  3HLF A;  5EVI C;  1DRM A;  1PZP A;  3A3I A;  5GHY A;  3NOP C;  4I3I A;  1SKO A;  3RTY A;  3BFF A;  1FOF A;  3RJU A;  2ZLY A;  1H5X A;  2J9P A;  2HDR A;  3EWK A;  2ZM8 A;  4PM9 A;  1OT9 A;  2VGL S;  5AVF A;  1W8Q A;  4YWZ A;  3IS2 A;  4EQ1 A;  4GDN A;  4Q0H A;  5DF8 A;  4P6Z M;  4S2N A;  4JXS A;  4BBV A;  1S4S A;  2Q9M A;  4ESP A;  4QJG A;  2VX8 A;  4HBU A;  2V1Z A;  2JKR I;  1ZTU A;  3HRE A;  4PM5 A;  4KZ9 A;  1W63 Q;  1O7E A;  4CLC E;  4KUO A;  2YKH A;  3G34 A;  3IF6 A;  3G32 A;  2CMN A;  3G2Y A;  4OKP A;  3IXD A;  3FKV A;  2W27 A;  2XRN A;  3IQA A;  4K0X A;  5CX7 A;  5F1F A;  5DKK A;  4LV2 A;  1KGE A;  4E3K A;  1H0M A;  1S6R A;  2V2F F;  3ZYT A;  2OLV A;  2B18 A;  2XA7 M;  1NLY A;  3HLE A;  1E4D A;  1F2K A;  2UV0 E;  5HAR A;  4OOY A;  3E2K A;  3GTC A;  2ACG A;  1KE0 A;  2WYX A;  3EGX C;  2XSS A;  1SKO B;  5FA7 A;  4M4X A;  5EM1 A;  3Q1F A;  1K56 A;  4PMA A;  5D3O A;  4N1H A;  2JKF A;  5U47 A;  4LFU A;  2QPN A;  3FPV A;  4B4X A;  3DTE A;  5FEG A;  3IS2 B;  2J80 A;  2LB9 A;  1CEF A;  1G28 A;  3WS5 A;  5CTN A;  3T4J A;  4RX2 A;  3VP1 A;  3CWF A;  3FV7 A;  2QWS A;  3FKW A;  3LEQ A;  4LCL A;  3W4P A;  2DCF A;  2ZMA A;  2W1T B;  1KGF A;  2AVX A;  4OON A;  4I3A A;  1NRJ A;  4KZ3 A;  4EU0 A;  2J3T D;  4EES A;  4JF4 A;  4U0X A;  1L0F A;  4EET B;  1EWZ A;  3Q81 A;  4QWO A;  1ZG6 A;  2VGK A;  2PT7 A;  4Y7P A;  1IOU A;  3MFX A;  1KDS A;  2D01 A;  3MF0 A;  4O0P A;  4EUV A;  2IWC A;  1LHY A;  3LR4 A;  4HP4 A;  5FQ9 A;  1YLW A;  3W2Z A;  3S22 A; 
#chains in the Genus database with same CATH homology
 3ITA A;  4OOM A;  1YM1 A;  4X56 A;  4RA7 A;  4DDY A;  2JC7 A;  3Q7Z A;  1N9B A;  5A93 A;  5FQM A;  1TVF A;  1YMS A;  4KQR A;  4L0L A;  1MKI A;  4WZ4 A;  2ZM2 A;  3O87 A;  4BL3 A;  3VFF A;  5GLA A;  2WGI A;  3M6H A;  2Y2I A;  1LI0 A;  5EVI A;  3MZE A;  4QY5 A;  3BM6 A;  4PM6 A;  5EVI D;  3VP4 A;  3IHA A;  2WAE A;  2XGN A;  4JBF A;  1CEG A;  5E43 A;  1K6S A;  2Y2P A;  5HAI A;  3WRZ A;  1MWT A;  4OP5 A;  3UPO A;  3N8R A;  3ZG0 A;  1TEM A;  1MY8 A;  2G2W A;  3N4I A;  4HEF A;  1GA9 A;  4P6B A;  5GLC A;  1YLZ A;  4KZB A;  4R4R A;  5FDH A;  2EX8 A;  2XQZ A;  5KZH A;  1IYS A;  1NZU A;  1KGG A;  1K25 A;  4O7D A;  1SDN A;  1BUL A;  3GMW A;  4K0W A;  3A3E A;  3Q07 A;  5E2G A;  3V5M A;  3HL9 A;  5HAQ A;  1XX2 A;  1W79 A;  2CC1 A;  2Y2N A;  4DE0 A;  4EWF A;  5TFQ A;  4K91 A;  3HBR A;  2WKI A;  4LCM A;  4M3K A;  5A90 A;  1FCM A;  2ZQ9 A;  1Q2Q A;  2Y2L A;  2OLU A;  3FYZ A;  3MBZ A;  1NYY A;  1VQQ A;  5EPH A;  3UY6 A;  2XDM A;  1IYO A;  3SS4 A;  1ONH A;  2EX9 A;  3UDF A;  4E3J A;  3OCL A;  3PBQ A;  3MZF A;  4DXC A;  5EOE A;  1OME A;  4E6X A;  1ES3 A;  3WS0 A;  1I2S A;  2Y2M A;  4KG6 A;  1CI9 A;  3LCE A;  1K57 A;  1O07 A;  4N9K A;  4DE1 A;  1DJA A;  4JPM A;  2P74 A;  1W8Y A;  1YLJ A;  4FH4 A;  2HP5 A;  2Y2K A;  1GHM A;  3G35 A;  1TDG A;  1BLH A;  1KVM A;  1HVB A;  1XA1 A;  1ZC2 A;  2WKE A;  3P09 A;  4QB8 A;  4DF6 A;  3PBS A;  3IWI A;  1NYM A;  2H5S A;  4BJP A;  1DJB A;  4NK3 A;  4UAA A;  4EQI A;  2R9W A;  3UE1 A;  4P87 A;  3GRJ A;  2B5R A;  3CZD A;  5CER A;  4HBT A;  4EBP A;  2ZQ8 A;  3TG9 A;  4ZDX A;  3MXR A;  4DRT A;  1SHV A;  2ZM0 A;  3S4X A;  1MPL A;  1YMX A;  2ZQA A;  2DRW A;  1BLP A;  2X71 A;  2C6W B;  3HUN A;  1H8Y A;  3G4P A;  3LY4 A;  4Q8I A;  3IXH A;  1YLP A;  3OCN A;  1E3U A;  3N7W A;  3DW0 A;  1BSG A;  4MLL A;  4XUX A;  1SDE A;  3BFD A;  4GD6 A;  2RL3 A;  1E3U D;  1K6R A;  3I7J A;  3IWQ A;  3ITB A;  4R3J A;  1CK3 A;  1DY6 A;  1ALQ A;  2HDQ A;  1BTL A;  1NJ4 A;  4R4S A;  4XXR A;  3VP0 A;  1WE4 A;  4DE3 A;  1IYQ A;  3EQU A;  4OQG A;  3W4Q A;  2I72 A;  1Z6F A;  4C3Q A;  3OPR A;  1I5Q A;  4KZ8 A;  4UA6 A;  3DTM A;  1QME A;  4OLD A;  3SS3 A;  1XKZ A;  3IF6 B;  1RCJ A;  4S2N C;  2EX6 A;  5DTT A;  5FAQ A;  3ZVW A;  3IF5 A;  2WK0 A;  5J8X A;  1IKG A;  3HUM A;  4LV0 A;  4KZ5 A;  1GA0 A;  4DKI A;  5GHX A;  2EX2 A;  2JBF A;  2FFF B;  3AGD A;  4F94 A;  1MBL A;  2WGW B;  4WMC D;  2EXA A;  1BLS A;  1L0E A;  3E2L A;  3S1Y A;  5CEC A;  1FSW A;  1FQG A;  4OPZ A;  4X69 A;  4S2L A;  3MXS A;  3SH9 A;  5A92 A;  3HUO A;  3BFG A;  3A3F A;  2Y91 A;  3QNB A;  2OV5 A;  2Y2Q A;  3LO7 A;  3ZDJ A;  4OQH A;  4GN2 A;  3ZG5 A;  1PI5 A;  4WYY A;  1XXM A;  5FI2 A;  4FSF A;  2Y4A A;  4N9L A;  5JYO A;  1KDW A;  3IF6 C;  5A91 A;  1KVL A;  3QNC A;  5CTM A;  4P85 A;  4QHC A;  4Y0U A;  3VFH A;  1IEL A;  1AXB A;  3UNW A;  3MKE A;  1KE4 A;  2XK1 A;  3OPH A;  4LV1 A;  4CPK A;  5HAP A;  3IH9 A;  1ES4 A;  5TGF A;  1NY0 A;  4B88 A;  1GHP A;  5AQ7 A;  4E6W A;  4N1X A;  4GKU A;  3HLD A;  3PBN A;  2WUQ A;  1HZO A;  2XFS A;  4WEL A;  4U3T A;  4KQO A;  3A3J A;  5EVL A;  5L2F A;  4JXW A;  1YQS A;  3ISG A;  3MFD A;  1HD8 A;  3BFC A;  1XA7 A;  3TOI A;  1XP4 A;  5BOH A;  1ERM A;  3M2J A;  5GLB A;  5M18 A;  3D4F A;  2P9V A;  4BQM A;  2ZJ9 A;  1FR6 A;  4Z9Q A;  3UDX A;  3PTE A;  4OQI A;  3NDG A;  3JYI A;  4MBK A;  2C5W B;  5FAP A;  2ZC6 B;  5DF9 A;  1NZO A;  1EI5 A;  1RP5 A;  4LV3 A;  3EQV A;  2Z2L B;  4OVD A;  4MNR A;  1Q2P A;  1S0W A;  5HX9 A;  1YLY A;  3DWZ A;  3NDE A;  4S2I A;  2G2U A;  2R9X A;  5HFO A;  2XH9 A;  3Q7V A;  4R0Q A;  3ZFZ A;  4ZTK A;  4ID4 A;  5KSH A;  1MXO A;  3WS4 A;  3UDI A;  3PBT A;  1FCO A;  4A5R A;  3GQZ A;  4X68 A;  2HP9 A;  3G2Z A;  3TSG A;  1ERO A;  5FQQ A;  2H10 A;  2X01 A;  3OPL A;  1NXY A;  1IKI A;  2Y2H A;  3PAG A;  2Y2G A;  3UN7 A;  3SH8 A;  5CED A;  2WGV A;  3RXW A;  1JWZ A;  4WBG A;  4GDB A;  4OQ0 A;  2H0T A;  4E3L A;  2Y2O A;  1PWC A;  2IWD A;  3FZC A;  3OPP A;  4GD8 A;  5F83 A;  4E3I A;  4HES A;  5DTK A;  1CI8 A;  4X6T A;  1E25 A;  2E8I A;  4DXB A;  3SS5 A;  4OP8 A;  5CEB A;  3IT9 A;  1MWS A;  5CHJ A;  4ZAM A;  5GLD A;  1PYY A;  2PU4 A;  3RXX A;  1Y54 A;  4QD4 A;  1LI9 A;  3VP3 A;  4OPY A;  1U60 A;  1K4F A;  4KQQ A;  2A3U A;  2XEP A;  4GB7 A;  5HW3 A;  4KZA A;  1K54 C;  1G6A A;  1L0D A;  4PPR A;  4Y0O A;  3IHB A;  1PW1 A;  4OLG A;  4WEK A;  4ZBE A;  3UE3 A;  2QZ6 A;  4CJN A;  3NIA A;  1JTD A;  4QU3 A;  3GVB A;  4KZ7 A;  3SOI A;  4X55 A;  5DVA A;  4IVI A;  3NI9 A;  2ZC4 B;  4BEN A;  2J9O A;  4MEZ A;  5FAO A;  3ZVT A;  2ZC5 B;  5CHM A;  4FD8 A;  1TDL A;  1SKF A;  1L2S A;  2WZX A;  3A3D A;  1G68 A;  1K56 D;  5GHZ A;  4JF5 A;  3GR2 A;  1PWG A;  4JF6 A;  3UE0 A;  1RGY A;  1YT4 A;  3AGE A;  4JKT A;  4C75 A;  4DE2 A;  5EVI B;  3WWX A;  2HP6 A;  1PIO A;  1PWD A;  3HLW A;  5DTS A;  1K55 C;  4GOG A;  4LEN A;  1ES5 A;  1VM1 A;  3BYD A;  5KMW A;  5EUA A;  5M1A A;  1XGI A;  1L0G A;  4BLM A;  1BLC A;  4IBR A;  3HLG A;  1YLT A;  2P9V B;  4KEN B;  3C4O A;  4S2M A;  3HLB A;  5E2E A;  3NCK A;  1K38 A;  4KG2 A;  5FQJ A;  4IBX A;  2XLN A;  4WMC A;  2ZD8 A;  3WS2 A;  3OC2 A;  2H0Y A;  2J7V A;  5FQI A;  3CMZ A;  4EV4 A;  2WAD A;  5FI6 A;  1ES2 A;  5HL1 A;  3CG5 A;  1H8Z A;  3C7V A;  3HLF A;  5EVI C;  4S2K A;  4KZ4 A;  3MZD A;  3VSL A;  1K4E A;  1PZP A;  1QMF A;  2PU2 A;  3A3I A;  4GZB A;  4IVK A;  4RVA A;  5GHY A;  1IYP A;  4YFM A;  5FSR A;  1LLB A;  1HTZ A;  1DJC A;  3Q7V B;  3BFF A;  1FOF A;  2HDS A;  5JYP A;  3RJU A;  2ZLY A;  1ZG4 A;  3ZNT A;  1H5X A;  1LL9 A;  2J9P A;  3VP2 A;  4EUZ A;  2HDR A;  2XD1 A;  2ZM8 A;  1N4O A;  1WYC A;  4RX3 A;  4PM9 A;  3PBO A;  4MBF A;  5CXW A;  3ZCZ A;  3P98 A;  3M2K A;  5EEC A;  1ZKJ A;  1W8Q A;  4JLF A;  3FWL A;  3G30 A;  4GDN A;  2ZC3 B;  5AQB A;  5DF8 A;  5F82 A;  3IXG A;  4UHU A;  5GL9 A;  1GHI A;  4E3N A;  2UWX A;  4S2N A;  3LEZ A;  2ZQC A;  4JXS A;  2Q9M A;  1XGJ A;  2RCX A;  3NBL A;  4OOL A;  4U0T A;  1RGZ A;  5FQK A;  4B4Z A;  3ZHH A;  1NRF A;  3BEC A;  4QJG A;  4HBU A;  2V1Z A;  3GSG A;  2HPB A;  3WRT A;  1JTG A;  3HRE A;  4PM5 A;  3N8L A;  4KZ9 A;  4S2P A;  4WZ5 C;  4YIN A;  1PZO A;  4KG5 A;  1C3B A;  2HDU A;  1FR1 A;  2XF3 A;  5E2F A;  3N6I A;  2EFX A;  3BEB A;  1O7E A;  1MWR A;  4S2J A;  5KSC A;  4JXG A;  1K57 C;  3G34 A;  3UO9 A;  2BG1 A;  2Z2M B;  3O3V A;  4WEJ A;  2ZC7 A;  3IF6 A;  3G32 A;  5AQA A;  3ZGA B;  3HVF A;  4UA7 A;  3G2Y A;  4OKP A;  2J8Y A;  3ZG7 B;  2Y59 A;  3IXD A;  3FKV A;  1PW8 A;  2JCH A;  2WGW A;  2GDN A;  3IQA A;  3OZH A;  4K0X A;  2QMI A;  5AQ9 A;  4Y0T A;  3B3X A;  5F1F A;  4LV2 A;  4R23 A;  1M6K A;  1KGE A;  4E3K A;  2V20 A;  3VSK A;  1S6R A;  2V2F F;  1J9M A;  2OLV A;  3W8K A;  2ZQD A;  3ZNY A;  5DF7 A;  1WYB A;  3HLE A;  1E4D A;  4RYE A;  4IED A;  3IXB A;  4GNU A;  1ERQ A;  3DWK A;  1IEM A;  2XFT A;  5HAR A;  1MWU A;  5F1G A;  3N8S A;  3O86 A;  4BD1 A;  3LY3 A;  3HLC A;  4EBL A;  1JWP A;  4PM7 A;  1JWV A;  3V50 A;  4WZ5 A;  3ZG8 B;  2XR0 A;  4OOY A;  3E2K A;  3GTC A;  1ONG A;  3G31 A;  3ZG9 B;  4MBH A;  1KE0 A;  1LL5 A;  2WYX A;  2ZQ7 A;  4FCF A;  3VOY A;  5FAS A;  2WZZ A;  3BLM A;  2IWB A;  3VMA A;  4XUZ A;  2Q9N A;  3VOZ A;  4OPQ A;  5FA7 A;  5M19 A;  4E3M A;  3IWO A;  3Q1F A;  4DDS A;  1K56 A;  3NC8 A;  1GCE A;  4EBN A;  3MKF A;  4PMA A;  5D3O A;  4N1H A;  3C5A A;  3AGF A;  4E3O A;  4X53 A;  5CGW A;  5U47 A;  5EOO A;  2QPN A;  3NY4 A;  5CGS A;  5I94 A;  2EXB A;  5FAT A;  3UPP A;  4B4X A;  1JVJ A;  1SCW A;  4ZJ2 A;  1PI4 A;  3O88 A;  4OH0 A;  5TR7 A;  4P0M A;  2OSU A;  5CRF A;  1W5D A;  2EFU A;  1CEF A;  2DNS A;  4NET A;  5E2H A;  4S2O A;  3W4O A;  1XPB A;  3WS5 A;  5CTN A;  1BUE A;  5G18 A;  4RX2 A;  5CHU A;  3QHY A;  3VP1 A;  1BT5 A;  4N92 A;  1ESU A;  2WAF A;  3FV7 A;  3BRM A;  1ESI A;  3BFE A;  2Y2J A;  2JE5 A;  1K54 A;  3FKW A;  4FH2 A;  1BZA A;  4LCL A;  1KE3 A;  4R3B A;  3Q82 A;  3V39 A;  3W4P A;  2DCF A;  5CGX A;  2ZMA A;  4BL2 A;  1KGF A;  4OON A;  1FCN A;  4JXV A;  3CJM A;  5FI7 A;  2X02 A;  3GV9 A;  3V3R A;  5EE8 A;  4WM9 A;  2WKH A;  4KZ3 A;  4UA9 A;  3SH7 A;  4KZ6 A;  2XD5 A;  1I2W A;  4JF4 A;  4U0X A;  4C6Y A;  1L0F A;  2BLS A;  1EWZ A;  3Q81 A;  3C7U A;  4ZJ1 A;  1ZG6 A;  4ZJ3 A;  3PAE A;  4D2O A;  4PM8 A;  2VGK A;  2Y55 A;  3IH8 A;  3PBR A;  4R1G A;  3C4P A;  4Y7P A;  1FSY A;  2A49 A;  1KDS A;  3V3S A;  3BLS A;  2VGJ A;  1K55 A;  3WS1 A;  1M40 A;  4H8R A;  2IWC A;  5IHV A;  4QY6 A;  3UPN A;  4BD0 A;  2FFY A;  1W7F A;  1LHY A;  5FQ9 A;  3M6B A;  2PBY A;  1YLW A;  4OPR A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...