2PBYA

Probable glutaminase from geobacillus kaustophilus hta426
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
307
structure length
291
Chain Sequence
LVYNQEELVRFVEEAKQYARYGKVADYIPALGKANPNELSIAIYTPDDEVVSAGDVTVKVTLQSISKIIALALVLIDRGEDEVFHKVGMEPKPLNPMINAGALVVTSMIQGGSVSERLERLLAFVRRLAGNERISYSDEVARSEFETAFLNRSLCYFLKQHRIIDEDVEELMELYTKQCAIEMTCIDLARIGLVLALDGRDPHSSEPLMPLDVARICKTFMVTCGMYNSSGEFAIKVGIPAKSGVSGGILAAVPGRCGIGVFGPALDDKGNSLTGVKLLERLSKTYSLSIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminase
publication title Glutaminase from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Hydrolase
total genus 105
structure length 291
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1500.10 Mainly Alpha Orthogonal Bundle Probable Glutaminase Ybgj; Chain: A, domain 2 Probable Glutaminase Ybgj; Chain: A, domain 2 2pbyA02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2pbyA01
3GTCA 3ZDJA 1HD8A 2FFYA 3VOZA 5BOHA 4ZTKA 3G2YA 3WS5A 4GDBA 4IVIA 4E3MA 1WYBA 1W8QA 4JPMA 4WEJA 2PU4A 2JC7A 2Y4AA 1NJ4A 4FH2A 2C5WB 1LLBA 4X69A 5AQAA 4DKIA 2V2FF 4GD8A 3ZHHA 5EUAA 4S2NA 1FSWA 2ZQCA 5TFQA 2RCXA 3N7WA 4WM9A 1K6SA 1IELA 1M6KA 5M19A 3WS2A 2VGKA 3VP1A 4FSFA 1KE0A 1ES4A 3VP0A 3HLEA 3NY4A 1BZAA 1LHYA 2EXAA 2JE5A 1L2SA 3DWZA 3IXHA 4K91A 4IBXA 3CJMA 3HREA 4L0LA 4OH0A 1RGZA 2Y2LA 3FV7A 3ZG8B 4KZ4A 2ZQDA 3W4OA 4GD6A 3G34A 4KZAA 1TVFA 3AGEA 4LV0A 3N8SA 4OLDA 1YLPA 5FQ9A 1Q2QA 1W8YA 1W5DA 4XUXA 1KVLA 1L0EA 4KZ8A 4RX3A 3BM6A 5A92A 5FAPA 3VSLA 3ZG7B 5EPHA 4N1XA 5HFOA 1JVJA 4OVDA 4OONA 4WEKA 3W4QA 4QHCA 2EXBA 1U60A 4WMCA 4IBRA 4OLGA 5CXWA 4P85A 1MY8A 2XF3A 3OPHA 1PW8A 4Y0UA 2Y2JA 3B3XA 2XDMA 2Y2IA 3OCLA 5FQIA 3AGFA 3Q7VB 3O87A 3FKVA 3MXRA 3SH9A 4Y0OA 3HL9A 3IF5A 4OP8A 4PM6A 3VOYA 3GQZA 1IYOA 3UPNA 3IXDA 2WZZA 3UPOA 3IWIA 2WGWB 2Y91A 3BLSA 3G35A 3S1YA 2J7VA 3NDGA 2P9VB 2XK1A 1IYQA 4R3JA 3V3SA 3C7VA 4R4RA 5FQJA 2HP9A 3Q82A 1YLZA 1MWRA 2H0YA 4RYEA 4PPRA 3CZDA 1SHVA 2QMIA 3VSKA 4ZDXA 3SS4A 1TDLA 2J8YA 4OQHA 3G31A 4N92A 5FQQA 1RCJA 4M3KA 4BLMA 5EOEA 4DE0A 4P87A 3HLWA 5FI6A 2CC1A 5EVLA 4KZ5A 4S2LA 5D3OA 2HDQA 2Q9NA 4U3TA 4XXRA 4X6TA 1KGEA 1BLSA 1BTLA 2WADA 3NC8A 1GHIA 3S22A 3ISGA 1L0GA 2XEPA 1PI4A 1QMFA 2Y2HA 3PBRA 1Q2PA 4K0XA 2PU2A 3PBOA 1NZOA 1NY0A 1XP4A 4OQ0A 3PBNA 4EUZA 3LY3A 3DTMA 3G32A 3IQAA 2EFUA 4S2KA 1H5XA 3AGDA 4PMAA 1FR6A 4QD4A 4WBGA 4RA7A 2Z2LB 2EX8A 2R9WA 3A3DA 3MFDA 5TGFA 4DE1A 2BG1A 1DY6A 2ZM8A 3M6BA 1FCNA 2H10A 3Q7ZA 4MBKA 3C4OA 5CECA 4RX2A 5L2FA 3CMZA 2XFSA 4S2MA 4C6YA 3BFCA 4PM9A 1FSYA 1S6RA 3IXBA 1ES2A 5HAPA 1BT5A 2ZC4B 3BFFA 1MWSA 4N9KA 4CJNA 2G2WA 4GDNA 3FKWA 2XD1A 5A91A 3RXWA 4GZBA 2ZQ9A 1G68A 5DF8A 2JCHA 2Y2PA 4WELA 4KQRA 3VP4A 4DRTA 4OPYA 4EV4A 5FQKA 3Q07A 1ESUA 2QZ6A 4B88A 4S2IA 1OMEA 2X71A 4XUZA 4O7DA 1K4EA 5F1FA 3V5MA 3RJUA 5GLDA 3UDFA 1YT4A 2EX2A 1IYPA 1YM1A 2G2UA 3WWXA 3C4PA 4KQOA 3BYDA 1YLYA 1PIOA 2PBYA 1BULA 3M2KA 4P6BA 1H8ZA 4HESA 4OOLA 4QY5A 2OSUA 3SOIA 1ES5A 1CI9A 5FDHA 1FOFA 4BQMA 4QJGA 1CEGA 2HPBA 3DW0A 3A3IA 5E2GA 5CHUA 3LEZA 5DVAA 1PYYA 4CPKA 1I2SA 3HUNA 3SS5A 5M18A 1MWTA 5CTNA 2WKEA 2XD5A 3Q7VA 4FD8A 4MEZA 4E3NA 1CK3A 4GKUA 4ZJ3A 2XQZA 3MZEA 3OCNA 2V1ZA 4ID4A 1N9BA 2WGWA 5FAOA 5F83A 3BRMA 1L0DA 2P9VA 2X01A 5KSHA 3A3JA 1S0WA 2WAFA 4WYYA 1TEMA 2FFFB 5GL9A 2Y2NA 4QB8A 3ZVWA 2VGJA 4LV2A 1KE4A 2C6WB 1BLCA 5DTSA 4B4XA 3IH8A 3CG5A 1TDGA 4X68A 2WAEA 3UPPA 4EBNA 5GLBA 2BLSA 3HBRA 2H5SA 1MPLA 3HUOA 4F94A 3EQUA 5CERA 2R9XA 2XGNA 5IHVA 4H8RA 5JYPA 2E8IA 1MBLA 4KZ9A 3N4IA 1LL9A 3HLGA 1O07A 3NBLA 2OLVA 4JKTA 1PW1A 3OC2A 2ZC7A 2A49A 1M40A 3N8LA 4OPZA 4U0XA 5DTKA 2B5RA 5I94A 4FCFA 3UO9A 4S2PA 4HBUA 3ITAA 4EWFA 4MBHA 1K56D 2ZM2A 2WKHA 4DE3A 4A5RA 3BFEA 4DXCA 1E3UD 4ZJ1A 2ZQ8A 4KG6A 3OZHA 5EOOA 2DCFA 5HARA 1XPBA 2EX9A 3LY4A 3NI9A 1ZG4A 3IT9A 3SH8A 3HLBA 4K0WA 1K4FA 1PWDA 1XGIA 4YINA 3V50A 4DF6A 4BENA 3IH9A 3WS1A 5EVID 1EROA 3DWKA 1RGYA 3LO7A 2WGIA 2WZXA 3EQVA 4R23A 4Y7PA 5GHYA 2HDSA 5CEDA 1EWZA 2XH9A 3HLCA 5FI7A 2EX6A 1MKIA 3OPRA 4UHUA 1O7EA 1K56A 2QPNA 1ES3A 2ZLYA 3VMAA 3ZNYA 2Z2MB 1FQGA 3MZDA 1HTZA 2V20A 3P98A 4YFMA 5EECA 5M1AA 3OPPA 1E3UA 2RL3A 3BEBA 1G6AA 1I5QA 4R4SA 5CRFA 3ZCZA 3V3RA 4MNRA 3WRZA 5EE8A 4OQGA 4KZBA 4S2JA 3PBQA 1K25A 2Y59A 4GB7A 4DE2A 3E2KA 5DF9A 3RXXA 3UE3A 4ZBEA 1JWVA 5EVIA 3QNBA 4OOYA 1ZKJA 4DDSA 1CI8A 4E3JA 4P0MA 3I7JA 1NZUA 1PI5A 2ZD8A 1JTDA 5CGSA 1IKIA 3A3EA 3BFGA 4HBTA 2JBFA 4JXVA 4E3KA 5G18A 3ZG5A 2WKIA 2X02A 4UA9A 4E3LA 3UN7A 3UDIA 1DJAA 5KSCA 1KGFA 4GOGA 3LCEA 3S4XA 2J9PA 3ITBA 5DTTA 5AQBA 2OLUA 3WS0A 4X55A 3UE1A 5HAQA 1K54A 1XXMA 1KGGA 3VP3A 5EVIC 3UNWA 1DJBA 4KG2A 3C5AA 2XFTA 4JXGA 4KQQA 4JXWA 1KDSA 3JYIA 4N9LA 3QNCA 1ESIA 3WRTA 4WZ5C 3IF6C 1ALQA 2Y2KA 1YMXA 5U47A 5EVIB 2WUQA 3PBSA 1GCEA 1E25A 1EI5A 4C3QA 5E43A 2ZMAA 3UE0A 2DRWA 2OV5A 1PWGA 3FZCA 2ZJ9A 3HVFA 4MBFA 4JBFA 3TSGA 3IF6B 3W8KA 1AXBA 1K54C 3GR2A 1ONHA 5TR7A 1QMEA 3G30A 3HLFA 4UA7A 4FH4A 5E2FA 3TOIA 2ZC6B 5F1GA 3P09A 3M2JA 4C75A 1K55C 3SS3A 4OP5A 1KDWA 2Y2OA 4OQIA 1E4DA 2UWXA 3MXSA 5FI2A 1LI9A 3NCKA 5HAIA 2IWCA 4KG5A 2HDUA 1ZC2A 3QHYA 4LENA 1HZOA 1YQSA 2Y2GA 3O86A 4IEDA 5A90A 5JYOA 5E2HA 1BLPA 4BD1A 3MKEA 1K57A 3UY6A 1Y54A 4Q8IA 4EBPA 1ERMA 2ZC3B 2WK0A 3BLMA 1JWPA 3GMWA 4KZ6A 1C3BA 4Y0TA 2H0TA 2ZQAA 1LL5A 1PZOA 1NXYA 4WMCD 4WZ4A 3N8RA 3FWLA 1PZPA 5CEBA 4R3BA 4NETA 3WS4A 4LCMA 1ZG6A 1BSGA 1I2WA 4ZAMA 3MBZA 1NYMA 4JXSA 3ZGAB 5GLCA 1FCOA 4PM5A 4BL2A 2Y2MA 2GDNA 2WYXA 1NYYA 1MWUA 1XKZA 4S2NC 1IEMA 4Z9QA 4JF5A 1CEFA 1K57C 2Y2QA 4DDYA 1XGJA 5FSRA 3D4FA 1FCMA 1VM1A 3ZG0A 3PTEA 5DF7A 1XX2A 3N6IA 1YLTA 3MKFA 3V39A 2DNSA 4E6XA 1YLJA 1MXOA 3O3VA 4LV1A 4EQIA 4R0QA 1HVBA 1XA1A 3A3FA 3ZG9B 5CHMA 1KVMA 3IXGA 5CGXA 3TG9A 4KENB 5FASA 5FAQA 3PAGA 3IHBA 3PAEA 2I72A 4KZ7A 1JWZA 4NK3A 1YMSA 4B4ZA 5KMWA 4PM7A 3IWQA 2HP5A 1IKGA 4UAAA 5CTMA 5A93A 1K38A 3HUMA 3HLDA 4OOMA 5CHJA 1BUEA 1Z6FA 3IWOA 1ONGA 2XR0A 4RVAA 3UDXA 1J9MA 4IVKA 4BD0A 3BFDA 1RP5A 1GA0A 4PM8A 1LI0A 5AQ9A 1NRFA 3GSGA 3W4PA 1BLHA 3FYZA 5CGWA 1SKFA 5F82A 3MZFA 4KZ3A 4EBLA 1IYSA 1SDNA 1W7FA 3G2ZA 5FATA 5GHXA 1K6RA 3NIAA 2Y55A 1VQQA 2Q9MA 2IWDA 3ZVTA 4D2OA 3Q1FA 4OKPA 1YLWA 4E3OA 4LCLA 5FA7A 4JLFA 4WZ5A 3IF6A 3IHAA 3O88A 4E3IA 3C7UA 4HEFA 5FQMA 5J8XA 2XLNA 3PBTA 4X53A 4JF4A 1XA7A 2HP6A 2EFXA 4BJPA 3VFFA 5E2EA 1WE4A 5HW3A 1SDEA 2ZQ7A 1SCWA 4U0TA 3E2LA 4DXBA 4ZJ2A 3M6HA 4BL3A 4LV3A 4GN2A 5GHZA 4GNUA 3OPLA 1KE3A 1ERQA 2WGVA 4N1HA 4X56A 3G4PA 4QU3A 3Q81A 1L0FA 2J9OA 1GHPA 1DJCA 1K55A 5AQ7A 2A3UA 1H8YA 4R1GA 1FR1A 3ZFZA 3GV9A 3BECA 4QY6A 3NDEA 1PWCA 1WYCA 2HDRA 5HX9A 3VFHA 5KZHA 2IWBA 3SH7A 3GVBA 4JF6A 4S2OA 3VP2A 4OPRA 4UA6A 4MLLA 1JTGA 1N4OA 2P74A 5HL1A 5GLAA 3GRJA 2ZC5B 3ZNTA 4OPQA 2ZM0A 1GHMA 1W79A 4E6WA 1GA9A
chains in the Genus database with same CATH superfamily
1OTEA 2W3HA 5BOHA 4ZTKA 4GDBA 3T12B 4E3MA 1W8QA 4EUVA 2JC7A 2Y4AA 1LLBA 4DKIA 3E0YA 1T1CA 4MCWA 1K6SA 5L10A 3WS2A 2ZL1B 2W3EA 1L2SA 4K91A 3CJMA 2Y2LA 1STZA 3ZG8B 3W4OA 1OT6A 3AGEA 5FQ9A 1Q2QA 1W8YA 2MJ6A 1W5DA 5DKKA 3S7NA 4RX3A 5FL3A 3BM6A 5A92A 1G6OA 3O5YA 1JVJA 3D72A 3W4QA 5F69A 1MKMA 3OPHA 3EGDC 4HJ3A 4Y0UA 2Y2JA 3B3XA 3OCLA 2Y79A 2Y8HA 3Q7VB 3O87A 3MXRA 3T1XA 4GS9A 4Y0OA 3UPNA 3LI9A 2WGWB 3G35A 3DTIA 3C7VA 3PR6A 1YLZA 1MWRA 2H0YA 4RYEA 2DMWA 4DMZA 4EW7A 1SHVA 3VSKA 5KIZA 3MF0A 5FQQA 3L7HA 5FI6A 2HDQA 4JGQA 2XRNA 1H8MA 1ACFA 3GECA 4L9FA 1UGUA 2VX8A 3QP1A 4LPZA 4I5SA 4EUZA 3DTMA 1H5XA 4WBGA 2Z2LB 2EX8A 1NRJA 2NUPC 5FEFA 3MFDA 5TGFA 2J3TC 2ZM8A 5F5YA 4NXEA 3LIEA 4RX2A 4ETZA 2VZWA 3DTEA 4S2MA 2FZ0A 4HOIA 4PKYA 2ACGA 1S6RA 2G2WA 2W27A 2V9AA 5HWWA 1ZTUA 5A91A 2ZQ9A 5TJJA 2Y2PA 4WELA 4KQRA 4EV4A 1TS0A 4S2IA 3T4LA 4O7DA 5EM0A 3V5MA 5GLDA 3UDFA 1G5UA 3WWXA 2R78A 1PIOA 1H8ZA 4HESA 4QY5A 3SOIA 1CI9A 4BQMA 3ICYA 4CPKA 3HUNA 2HGVA 3UMEA 2XQZA 2BASA 1N9BA 5FAOA 5F83A 1L0DA 2P9VA 1VEUB 4IUKA 4WYYA 3LUQA 3ZVWA 4GHIB 3LGOA 1KE4A 3UB9A 5DTSA 3CG5A 2XA7M 4CQHA 2H5SA 4LLOB 3HUOA 3EQUA 5CERA 2R9XA 2XGNA 1OJ5A 4KZ9A 1LL9A 3HLGA 3CWFA 3LYXA 3T4KA 1PW1A 1M40A 4OPZA 1S1YA 2VEAA 4QPRA 1FILA 3T4OA 4IUHA 3ITAA 2Z6DA 3VOLA 1XJ3A 3LR0A 1XJ4A 5HARA 3LY4A 3IT9A 3SH8A 4K0WA 4YINA 3V50A 2XROA 1PRQA 5EVID 1EROA 3LO7A 4ARZA 2W1RA 2HDSA 5G4YA 1K56A 1ES3A 4YFMA 4WUJA 3MJQA 2VK3A 4GJ4A 1I5QA 4R4SA 5CRFA 3ZCZA 3V3RA 3WRZA 4OQGA 4O8GA 5A8BA 1K25A 2V1AA 5DF9A 3FPWA 4P0MA 3I7JA 2VGLS 1IKIA 4HBTA 2JBFA 2X02A 3NOPC 4UA9A 4Y3IA 2H28A 3UDIA 1DJAA 2J9PA 5J7EA 3UNWA 3H9WA 4KG2A 4EXOA 2B18A 4N9LA 1ESIA 3P7NA 3WRTA 3IF6C 2VV7A 1ALQA 4I39A 2PAVP 1YMXA 3PBSA 4L9EA 3UE0A 1PWGA 4MBFA 3GR2A 5HDDA 4HI4A 3HJIA 2KLIA 3M2JA 4C75A 4YNRA 1E4DA 2UWXA 5FI2A 1LI9A 2IWCA 4UQIS 4I3IA 2ZOIA 1P9WA 5E2HA 1BLPA 5HDCA 3UY6A 1Y54A 2OWHA 3BLMA 4KZ6A 1PZOA 4WMCD 3FWLA 5CEBA 3WS4A 3MBZA 1NYMA 4JXSA 5I5LA 5FEGA 2GDNA 1MWUA 3UB6A 1CEFA 4BBUA 1FCMA 3PTEA 3N6IA 1YLTA 4E6XA 2DNSA 4LV1A 4EQIA 4R0QA 4UEYA 5CHMA 5FASA 4KZ7A 3F1PA 5KMWA 2HP5A 1IKGA 5A93A 5CTMA 3HUMA 2P04A 4EERA 1ONGA 4RVAA 3BFDA 1RP5A 4PM8A 5F82A 3S7PA 2GX5A 2Y55A 4DN0A 3JVVA 4E3OA 5HD5A 3FPVA 5FQMA 1D7EA 4HEFA 3PBTA 1N9OA 1LSWA 4GS9B 2B95A 4BJPA 4G3KA 5E2EA 5HZHA 1UWPX 1WE4A 5HW3A 4GW9A 1SCWA 4U0TA 3LIBA 4BL3A 4GN2A 4LFUA 2PR5A 3OPLA 5GHZA 4QU3A 3Q81A 5AQ7A 1K55A 1WA9A 2A3UA 4KQDA 3ZFZA 3GV9A 3BECA 3SH7A 2KX6A 2VKSA 3GVBA 4S2OA 3MR0A 4OPRA 3LI8A 2P74A 1Y4OA 1SKOB 4CLCC 2L4RA 5U47A 1W79A 3QP6A 3D3OA 3P01A 2C5WB 2ZBBA 4GD8A 3BJNA 2ZQCA 2RCXA 5M19A 2E8JA 2VGKA 3VP1A 1KE0A 1ES4A 3HLEA 1BZAA 1PNEA 3K3DA 3IXHA 1RGZA 3BY9A 2ZQDA 4HP9A 4L9GA 1VETA 2P08A 1KVLA 1L0EA 4N1XA 4OVDA 4WEKA 4QHCA 2EXBA 4WMCA 4IBRA 4OLGA 2W0NA 1LSXA 1V9ZA 2PR6A 4PAUA 2XF3A 2Y2IA 4MN6A 5EV0A 3AGFA 4HH2A 5DJUA 3FC7A 3SH9A 3HL9A 3KYEA 4OP8A 3V67A 2J3TD 1IYOA 3GQZA 3PYPA 3IXDA 3TRCA 2Y91A 4YOFA 2P9VB 2XK1A 2JHEA 5FQJA 5AVEA 4OQHA 5AVFA 4M3KA 4DE0A 4P87A 4KZ5A 1A0KA 2Q9NA 4X6TA 1BLSA 1L0GA 2XEPA 3LICA 2OAP1 3MQ0A 1QMFA 3PBRA 4K0XA 4RQ9A 2PU2A 3OBFA 5HWVA 1AWIA 3LY3A 1IFQA 2BG1A 4WL9A 2H10A 3H7WA 3C4OA 3JVUA 5HDSA 5L07A 4HHDA 2XFSA 1TS8A 2XA7S 5DJTA 4ARZB 4NXGA 1ES2A 4N9KA 3FKWA 4H6JA 3UB8A 3RXWA 2A24A 3Q07A 1ESUA 2QZ6A 2X71A 4XUZA 2LB9A 3CLOA 2EX2A 2M7UA 2G2UA 3C8CA 1ZHHB 3BYDA 2PBYA 4P6BA 1XFNA 2QJ7A 5FDHA 1FOFA 3A3IA 5E2GA 5CHUA 3LEZA 1PYYA 1I2SA 3MXQA 5CTNA 2WKEA 4FD8A 2INWA 4MEZA 3MZEA 3OCNA 2V1ZA 2Z6CA 3CPTA 4WN5A 1EW0A 4P6ZM 2EWWA 1S0WA 1TF1A 2VGJA 4R38A 4G3WA 1BLCA 2YKHA 1N9NA 3IH8A 1TDGA 2WAEA 3UPPA 3TE8A 1MPLA 4F94A 5JYPA 2E8IA 4Q0JA 5HSQA 3NBLA 4GCZA 4EEPA 1S4RA 2ZC7A 2A49A 5I94A 4HBUA 2PHYA 4MBHA 1K56D 2ZM2A 4DE3A 4DXCA 4ZJ1A 2ZQ8A 1VB6A 3S7QA 5FDSA 3IH9A 3T50A 1XJ6A 3DWKA 3U4LP 1RGYA 2WGIA 4R23A 1H0MA 5GHYA 2XH9A 3HLCA 5FI7A 1S67L 3OPRA 2PDRA 1FQGA 2QKPA 5EECA 2V20A 3P98A 1G6AA 4IJGA 3F1NB 2PRFA 1TS6A 1NLYA 3PBQA 1CQAA 4DE2A 1MZUA 3RXXA 3UE3A 4HY8A 4ZBEA 3R4KA 3QNBA 2JKTM 4E3JA 1NZUA 1PI5A 1LT0A 4ME4A 2WKQA 1HLUP 3F1PB 2WKIA 3VV4A 3S4XA 3ITBA 1OJGA 5AQBA 4X55A 3UE1A 5HAQA 3KO6A 1KGGA 3IS2A 3C5AA 2XFTA 4F3LA 4KQQA 4X25A 2WKRA 3JYIA 3QNCA 5F68A 5EVIB 2JKRI 4C3QA 5TBMB 3HVFA 4PKYG 4JBFA 2IA2A 4BBVA 1ONHA 5TR7A 2K2NA 3G30A 5E2FA 2Y2OA 3MXSA 3C30A 3NCKA 2Y2GA 1YQSA 3CUEC 1K57A 3ULFA 3F1OA 3E4QA 1JWPA 1C3BA 2H0TA 3G6OA 1LL5A 4DJ3A 4R3BA 1I2WA 4PM5A 4LRZE 4BL2A 2WYXA 1XKZA 4S2NC 1PFLA 1K57C 1VM1A 1XX2A 3MKFA 1GSVA 1YLJA 1MXOA 2HV1A 4Z1WA 1XA1A 3A3FA 3DTKA 3A0VA 3ZG9B 4KENB 1P9RA 5FAQA 3PAEA 2I72A 4HIAA 1YMSA 3A0RA 4PM7A 4Y5FA 4UAAA 1K38A 3HLDA 4OOMA 1Z6FA 3IWOA 3UB5P 5AQ9A 3GSGA 1SKFA 3OLOA 2JKTI 1W7FA 5FATA 3HCYA 1K6RA 3NIAA 2ZMVA 1D1JA 2W1TA 3ZVTA 4D2OA 4KUKA 4CLCD 1YLWA 1CF0A 3CITA 3B33A 4CLCE 3IF6A 3IHAA 4B9OA 2EFXA 3E2LA 3PXPA 4NKPA 4DXBA 3KSHA 4GNUA 2WGVA 3ZYTA 4N1HA 2J9OA 1G28A 1H8YA 2VJWA 1WYCA 3VFHA 2HDRA 5C5KA 3VP2A 4MLLA 1N4OA 5HL1A 3GRJA 2ZC5B 3MMHA 2ZM0A 3CAXA 4H8RA 2XSSA 3GTCA 3ZDJA 1HD8A 2FFYA 3VOZA 3SW1A 3G2YA 3WS5A 3BY8A 4JPMA 4WEJA 1NJ4A 4X69A 2Q0OA 5AQAA 3H7WB 3UE6A 2V2FF 5EUAA 2O99A 4XT2B 4WM9A 1IELA 3IX8A 4NXBA 2HZ5A 3NY4A 3KX0X 2EXAA 2JE5A 1T19A 4D60A 3DWZA 4H6JB 4IBXA 4OH0A 3MFXA 3FV7A 4KZAA 3KYZA 1YLPA 4M4XA 2OOLA 2UV0E 4YWZA 3ZG7B 4EETB 5HFOA 3KSGA 3IX3A 5EM1A 4OONA 1OTIA 1DRMA 1U60A 5CXWA 4P85A 3CI6A 1XJ2A 4BMWA 3IF5A 4PM6A 3MS6A 3UPOA 3IWIA 3CPTB 3BLSA 3S1YA 2J7VA 3EOIA 3V3SA 1IYQA 1NLZA 2VV8A 3T1RA 3PHYA 3CZDA 4PPRA 2QMIA 4ZDXA 4ESPA 4BLMA 3EEAA 2CC1A 2G7UA 1KGEA 2WADA 3NC8A 4MDZA 4AFIA 1GHIA 1OTDA 1PI4A 1DP8A 2Y2HA 3UMDA 3PBOA 3FG8A 1FIKA 4NEED 3PBNA 3G32A 4HH3A 3U2AA 3RFBA 4EQ1A 4PMAA 4RA7A 2R9WA 4CLCA 2PD7A 3M6BA 4MBKA 1ODVA 5L2FA 3CMZA 3LFVA 1W63Q 4C6YA 1CJFA 1BT5A 2ZC4B 3NOTC 1NWZA 1MWSA 2HJ9C 4CJNA 4GDNA 3BW6A 2XD1A 4HJ6A 2B02A 4GZBA 1G68A 2JCHA 3EWKA 1OT9A 5FQKA 4B88A 1MC0A 1OMEA 5F1FA 1W63M 1YT4A 2JKFA 3C4PA 1BULA 1P97A 4Q0HA 3JPUA 3DAVA 1ES5A 1CEGA 2HPBA 3T4QA 3UB7A 4EU0A 3BWLA 3SS5A 4DJ2A 1KOUA 1MWTA 5M18A 2M7VA 2PBDP 2XD5A 1S4SA 1CK3A 4ZJ3A 5K5BA 4F3LB 2WAFA 1TEMA 4QB8A 5DFXA 4X68A 4EBNA 5GLBA 2BLSA 3HBRA 3R7WA 4Y15A 1MBLA 3T1SA 2OLVA 2WKPA 3N8LA 4U0XA 4FUWA 4FCFA 3UO9A 1TS7A 4X1LA 2EA9A 2WKHA 4A5RA 4Y13A 2AVXA 4JGOA 4KG6A 3OZHA 2V8CA 2EX9A 3NI9A 1ZG4A 3F1OB 4R70A 1K4FA 1PWDA 3IX4A 3EGXC 4BENA 2A2LA 2WZXA 4K08A 4Y7PA 3B42A 3BQ8A 1EWZA 5DFYA 1MKIA 2ZLYA 1HTZA 4UQIM 5M1AA 3OPPA 1E3UA 2EWVA 3E98A 4MNRA 5EE8A 4KZBA 4S2JA 4GB7A 1JWVA 4KUOA 4OOYA 4DDSA 3A0SA 2ZD8A 1JTDA 5G18A 3ZG5A 3TW8A 5KSCA 1KGFA 4GOGA 3LCEA 3WS0A 5DTTA 2OLUA 1K54A 3VE4A 3VP3A 1LSVA 3NOUC 3E4OA 1V9YA 2FH5A 3C38A 4WZ5C 2Y2KA 4BWIA 2W1TB 2WUQA 3HJKA 1GCEA 5HPIA 1EI5A 4HJ4A 4R3AA 2PT7A 2DRWA 3IBJA 2OV5A 3W8KA 3IF6B 1K54C 2JKRM 3HLFA 4FH4A 4UA7A 3TOIA 2ZC6B 2GZAA 2D01A 4GLQA 1YSPA 3SS3A 4OP5A 1KDWA 1OTAA 4KG5A 4X1MA 3QHYA 4LENA 2W3DA 4NG2A 4IEDA 4BD1A 3MKEA 3RH8B 4MN5A 4EBPA 2ZC3B 2WK0A 4Y0TA 1OTBA 2ZQAA 4WZ4A 1NXYA 4NETA 4LCMA 5GLCA 1DP6A 3MQQA 4JF5A 4DDYA 5FSRA 3D4FA 3ZG0A 3MQOA 5DF7A 1S1ZA 1F9IA 1HVBA 5AJGA 4JGPA 5CGXA 4G3VA 4I3JA 3PAGA 4BBTA 4Y2FA 5CHJA 1BUEA 4IVKA 1GA0A 2QHKA 3NULA 3S7OA 3W4PA 1BLHA 5CGWA 3LR4A 1IYSA 1SDNA 2VV6A 2PYRA 2W3FA 1T1BA 2O9BA 4OKPA 4B93A 1H3QA 4JLFA 3O88A 5J8XA 3C7UA 2GNXA 3H82A 4JF4A 1XA7A 2HP6A 1SKOA 3VFFA 2ZQ7A 4ZJ2A 3M6HA 4PHTA 1ERQA 1K0KA 2O0YA 4X56A 3G4PA 2V0WA 1L0FA 2O9AA 1GHPA 1DJCA 3DBAA 4R1GA 1FR1A 1Z09A 4QY6A 3NDEA 1PWCA 5HX9A 2K31A 3CUEA 4HNBA 2JKGA 4WF0A 1JTGA 3ZNTA 4OPQA 1GHMA 4E6WA 1GA9A 4BD0A 2VA0A 4MMNA 1UWNX 4HQAA 4IVIA 4Y17A 1WYBA 2PU4A 4CLCB 4FH2A 3ZHHA 4S2NA 1FSWA 2OAQ1 5TFQA 3N7WA 2J3WA 1M6KA 4FSFA 3VP0A 1LHYA 4I38A 1N9LA 3HREA 4L0LA 4KZ4A 4GD6A 3G34A 2VLGA 1TVFA 4LV0A 4MN7A 3N8SA 4OLDA 1YKDA 4XUXA 4KZ8A 3QP5A 5FAPA 3VSLA 1TD5A 5EPHA 1OPXA 1S66L 5HD3A 3QP4A 2QWSA 1MY8A 3KSFA 1P0ZA 5HWTA 1PW8A 5HL6A 2XDMA 4WLAA 3NJAA 5FQIA 3NHQA 3FKVA 4R6LA 3VOYA 2NUTC 2WZZA 3NDGA 4R3JA 4I3AA 1VETB 4R4RA 2HP9A 3OOVA 3Q82A 4EESA 2I9VA 1YSQA 3SS4A 1TDLA 2J8YA 3G31A 4N92A 2V0UA 1RCJA 5EOEA 3HLWA 5EVLA 3R7WB 4S2LA 3C2WA 5D3OA 4U3TA 4XXRA 1BTLA 2V8FA 3S22A 3ISGA 1Q2PA 3IBRA 1NZOA 3LEQA 1NY0A 1XP4A 4OQ0A 1F5MA 3IQAA 2EFUA 4S2KA 3AGDA 4QD4A 1DP9A 1FR6A 5L8MA 3A3DA 4DE1A 1DY6A 1FCNA 3Q7ZA 3TJZC 5CECA 3BFCA 4PM9A 1FSYA 3IXBA 5HAPA 3BFFA 1JNUA 5DKLA 2ZL1A 5DF8A 3VP4A 4DRTA 4ETXA 4OPYA 1GSXA 2LB5A 1K4EA 3RTYA 3GDIA 3RJUA 4NXFA 1IYPA 1YM1A 3SZTA 4KQOA 2K7SA 1YLYA 3KSIA 3M2KA 4OOLA 1T18A 2OSUA 5IT5A 4QJGA 3DW0A 5DVAA 3MSHA 3Q7VA 4E3NA 4GKUA 3QP2A 5L09A 2A24B 4ID4A 2WGWA 3BRMA 2O9CA 2X01A 5KSHA 3A3JA 2FFFB 5G4ZA 5GL9A 2Y2NA 1J3WA 4LV2A 2C6WB 3T4TA 4B4XA 2L0WA 1BYWA 4EEUA 2ZMFA 5IHVA 5J3WA 2JN7A 2D02A 3N4IA 3LR3A 1O07A 4JKTA 3OC2A 5DTKA 5MC7A 2B5RA 4S2PA 3F1NA 4EWFA 1YAXA 3BFEA 1E3UD 5EOOA 2DCFA 1XPBA 5LBRA 2PD8A 3HLBA 1XGIA 2QJ5A 3E4PA 3T1QB 4DF6A 1IOUA 3WS1A 3EQVA 5CEDA 2EX6A 3LR5A 4UHUA 3VMAA 1O7EA 2QPNA 5CX7A 3ZNYA 2Z2MB 3MZDA 2RL3A 3BEBA 5F6AA 2ZOHA 2KOIA 4QWOA 5HPFA 2Y59A 2CMNA 3E2KA 5EVIA 1ZKJA 1CI8A 2J80A 4P6ZS 3T4JA 5EVEA 3L9KA 3LIDA 3QP8A 4JGRA 5TBMA 5CGSA 5IS1A 1SZVA 3A3EA 3BFGA 4JXVA 4E3KA 1VHMA 4E3LA 3UN7A 1F2KA 4IHQA 3LIFA 1XXMA 5EVIC 1DJBA 2V1BA 3EEHA 4JXGA 3KYQA 4JXWA 1F98A 1KDSA 1VEUA 4GHIA 4O01A 1E25A 5E43A 2ZMAA 1LL8A 3B47A 3FZCA 3K3CA 2ZJ9A 2P7JA 3BQAA 3TSGA 1AXBA 3H82B 2KDKA 1QMEA 3K2NA 5J4EA 2OWJA 5F1GA 3P09A 3VE3A 2HF6A 1K55C 4OQIA 3IS2B 5HAIA 2HDUA 1ZC2A 1GSWA 2GJ3A 1HZOA 3O86A 5JYOA 2VGLM 5A90A 4ZRRA 2HJEA 4Q8IA 1ERMA 4HP4A 3GMWA 3N8RA 1PZPA 2QYBA 3ZGAB 1ZG6A 1BSGA 4Q0IA 4ZAMA 1FCOA 2Y2MA 4O0PA 1NYYA 4Z9QA 1IEMA 4II7A 2Y2QA 1XGJA 3W2ZA 1D06A 3V39A 1Y28A 3O3VA 1KVMA 3IXGA 3NECA 3LIAA 3TG9A 3ZQ5A 3IHBA 2BTFP 1JWZA 1XFQA 4NK3A 4B4ZA 3IWQA 3UDXA 2XR0A 3D9YA 1J9MA 4LGWA 1LI0A 1NRFA 3FYZA 1L3LA 1T1AA 3MZFA 4KZ3A 4EBLA 3G2ZA 4LRYC 5GHXA 1VQQA 2Q9MA 2IWDA 3Q1FA 4LCLA 2PYPA 5FA7A 4WZ5A 4E3IA 2L1MA 2XLNA 4X53A 5EFWA 4FOFA 2YKFA 1SDEA 1X0OA 5IU1A 4LV3A 1KE3A 3T4SA 2W3GA 4XT2A 4E04A 5KZHA 2IWBA 4JF6A 1YPRA 4UA6A 4FTXA 4LRXC 5GLAA 2M1CA 3CHWP
chains in the Genus database with same CATH topology
3GTCA 3ZDJA 1HD8A 2FFYA 3VOZA 5BOHA 4ZTKA 3G2YA 3WS5A 4GDBA 4IVIA 4E3MA 1WYBA 1W8QA 4JPMA 4WEJA 2PU4A 2JC7A 2Y4AA 1NJ4A 4FH2A 2C5WB 1LLBA 4X69A 5AQAA 4DKIA 2V2FF 4GD8A 3ZHHA 5EUAA 4S2NA 1FSWA 2ZQCA 5TFQA 2RCXA 3N7WA 4WM9A 1K6SA 1IELA 1M6KA 5M19A 3WS2A 2VGKA 3VP1A 4FSFA 1KE0A 1ES4A 3VP0A 3HLEA 3NY4A 1BZAA 1LHYA 2EXAA 2JE5A 1L2SA 3DWZA 3IXHA 4K91A 4IBXA 3CJMA 3HREA 4L0LA 4OH0A 1RGZA 2Y2LA 3FV7A 3ZG8B 4KZ4A 2ZQDA 3W4OA 4GD6A 3G34A 4KZAA 1TVFA 3AGEA 4LV0A 3N8SA 4OLDA 1YLPA 5FQ9A 1Q2QA 1W8YA 1W5DA 4XUXA 1KVLA 1L0EA 4KZ8A 4RX3A 3BM6A 5A92A 5FAPA 3VSLA 3ZG7B 5EPHA 4N1XA 5HFOA 1JVJA 4OVDA 4OONA 4WEKA 3W4QA 4QHCA 2EXBA 1U60A 4WMCA 4IBRA 4OLGA 5CXWA 4P85A 1MY8A 2XF3A 3OPHA 1PW8A 4Y0UA 2Y2JA 3B3XA 2XDMA 2Y2IA 3OCLA 5FQIA 3AGFA 3Q7VB 3O87A 3FKVA 3MXRA 3SH9A 4Y0OA 3HL9A 3IF5A 4OP8A 4PM6A 3VOYA 3GQZA 1IYOA 3UPNA 3IXDA 2WZZA 3UPOA 3IWIA 2WGWB 2Y91A 3BLSA 3G35A 3S1YA 2J7VA 3NDGA 2P9VB 2XK1A 1IYQA 4R3JA 3V3SA 3C7VA 4R4RA 5FQJA 2HP9A 3Q82A 1YLZA 1MWRA 2H0YA 4RYEA 4PPRA 3CZDA 1SHVA 2QMIA 3VSKA 4ZDXA 3SS4A 1TDLA 2J8YA 4OQHA 3G31A 4N92A 5FQQA 1RCJA 4M3KA 4BLMA 5EOEA 4DE0A 4P87A 3HLWA 5FI6A 2CC1A 5EVLA 4KZ5A 4S2LA 5D3OA 2HDQA 2Q9NA 4U3TA 4XXRA 4X6TA 1KGEA 1BLSA 1BTLA 2WADA 3NC8A 1GHIA 3S22A 3ISGA 1L0GA 2XEPA 1PI4A 1QMFA 2Y2HA 3PBRA 1Q2PA 4K0XA 2PU2A 3PBOA 1NZOA 1NY0A 1XP4A 4OQ0A 3PBNA 4EUZA 3LY3A 3DTMA 3G32A 3IQAA 2EFUA 4S2KA 1H5XA 3AGDA 4PMAA 1FR6A 4QD4A 4WBGA 4RA7A 2Z2LB 2EX8A 2R9WA 3A3DA 3MFDA 5TGFA 4DE1A 2BG1A 1DY6A 2ZM8A 3M6BA 1FCNA 2H10A 3Q7ZA 4MBKA 3C4OA 5CECA 4RX2A 5L2FA 3CMZA 2XFSA 4S2MA 4C6YA 3BFCA 4PM9A 1FSYA 1S6RA 3IXBA 1ES2A 5HAPA 1BT5A 2ZC4B 3BFFA 1MWSA 4N9KA 4CJNA 2G2WA 4GDNA 3FKWA 2XD1A 5A91A 3RXWA 4GZBA 2ZQ9A 1G68A 5DF8A 2JCHA 2Y2PA 4WELA 4KQRA 3VP4A 4DRTA 4OPYA 4EV4A 5FQKA 3Q07A 1ESUA 2QZ6A 4B88A 4S2IA 1OMEA 2X71A 4XUZA 4O7DA 1K4EA 5F1FA 3V5MA 3RJUA 5GLDA 3UDFA 1YT4A 2EX2A 1IYPA 1YM1A 2G2UA 3WWXA 3C4PA 4KQOA 3BYDA 1YLYA 1PIOA 2PBYA 1BULA 3M2KA 4P6BA 1H8ZA 4HESA 4OOLA 4QY5A 2OSUA 3SOIA 1ES5A 1CI9A 5FDHA 1FOFA 4BQMA 4QJGA 1CEGA 2HPBA 3DW0A 3A3IA 5E2GA 5CHUA 3LEZA 5DVAA 1PYYA 4CPKA 1I2SA 3HUNA 3SS5A 5M18A 1MWTA 5CTNA 2WKEA 2XD5A 3Q7VA 4FD8A 4MEZA 4E3NA 1CK3A 4GKUA 4ZJ3A 2XQZA 3MZEA 3OCNA 2V1ZA 4ID4A 1N9BA 2WGWA 5FAOA 5F83A 3BRMA 1L0DA 2P9VA 2X01A 5KSHA 3A3JA 1S0WA 2WAFA 4WYYA 1TEMA 2FFFB 5GL9A 2Y2NA 4QB8A 3ZVWA 2VGJA 4LV2A 1KE4A 2C6WB 1BLCA 5DTSA 4B4XA 3IH8A 3CG5A 1TDGA 4X68A 2WAEA 3UPPA 4EBNA 5GLBA 2BLSA 3HBRA 2H5SA 1MPLA 3HUOA 4F94A 3EQUA 5CERA 2R9XA 2XGNA 5IHVA 4H8RA 5JYPA 2E8IA 1MBLA 4KZ9A 3N4IA 1LL9A 3HLGA 1O07A 3NBLA 2OLVA 4JKTA 1PW1A 3OC2A 2ZC7A 2A49A 1M40A 3N8LA 4OPZA 4U0XA 5DTKA 2B5RA 5I94A 4FCFA 3UO9A 4S2PA 4HBUA 3ITAA 4EWFA 4MBHA 1K56D 2ZM2A 2WKHA 4DE3A 4A5RA 3BFEA 4DXCA 1E3UD 4ZJ1A 2ZQ8A 4KG6A 3OZHA 5EOOA 2DCFA 5HARA 1XPBA 2EX9A 3LY4A 3NI9A 1ZG4A 3IT9A 3SH8A 3HLBA 4K0WA 1K4FA 1PWDA 1XGIA 4YINA 3V50A 4DF6A 4BENA 3IH9A 3WS1A 5EVID 1EROA 3DWKA 1RGYA 3LO7A 2WGIA 2WZXA 3EQVA 4R23A 4Y7PA 5GHYA 2HDSA 5CEDA 1EWZA 2XH9A 3HLCA 5FI7A 2EX6A 1MKIA 3OPRA 4UHUA 1O7EA 1K56A 2QPNA 1ES3A 2ZLYA 3VMAA 3ZNYA 2Z2MB 1FQGA 3MZDA 1HTZA 2V20A 3P98A 4YFMA 5EECA 5M1AA 3OPPA 1E3UA 2RL3A 3BEBA 1G6AA 1I5QA 4R4SA 5CRFA 3ZCZA 3V3RA 4MNRA 3WRZA 5EE8A 4OQGA 4KZBA 4S2JA 3PBQA 1K25A 2Y59A 4GB7A 4DE2A 3E2KA 5DF9A 3RXXA 3UE3A 4ZBEA 1JWVA 5EVIA 3QNBA 4OOYA 1ZKJA 4DDSA 1CI8A 4E3JA 4P0MA 3I7JA 1NZUA 1PI5A 2ZD8A 1JTDA 5CGSA 1IKIA 3A3EA 3BFGA 4HBTA 2JBFA 4JXVA 4E3KA 5G18A 3ZG5A 2WKIA 2X02A 4UA9A 4E3LA 3UN7A 3UDIA 1DJAA 5KSCA 1KGFA 4GOGA 3LCEA 3S4XA 2J9PA 3ITBA 5DTTA 5AQBA 2OLUA 3WS0A 4X55A 3UE1A 5HAQA 1K54A 1XXMA 1KGGA 3VP3A 5EVIC 3UNWA 1DJBA 4KG2A 3C5AA 2XFTA 4JXGA 4KQQA 4JXWA 1KDSA 3JYIA 4N9LA 3QNCA 1ESIA 3WRTA 4WZ5C 3IF6C 1ALQA 2Y2KA 1YMXA 5U47A 5EVIB 2WUQA 3PBSA 1GCEA 1E25A 1EI5A 4C3QA 5E43A 2ZMAA 3UE0A 2DRWA 2OV5A 1PWGA 3FZCA 2ZJ9A 3HVFA 4MBFA 4JBFA 3TSGA 3IF6B 3W8KA 1AXBA 1K54C 3GR2A 1ONHA 5TR7A 1QMEA 3G30A 3HLFA 4UA7A 4FH4A 5E2FA 3TOIA 2ZC6B 5F1GA 3P09A 3M2JA 4C75A 1K55C 3SS3A 4OP5A 1KDWA 2Y2OA 4OQIA 1E4DA 2UWXA 3MXSA 5FI2A 1LI9A 3NCKA 5HAIA 2IWCA 4KG5A 2HDUA 1ZC2A 3QHYA 4LENA 1HZOA 1YQSA 2Y2GA 3O86A 4IEDA 5A90A 5JYOA 5E2HA 1BLPA 4BD1A 3MKEA 1K57A 3UY6A 1Y54A 4Q8IA 4EBPA 1ERMA 2ZC3B 2WK0A 3BLMA 1JWPA 3GMWA 4KZ6A 1C3BA 4Y0TA 2H0TA 2ZQAA 1LL5A 1PZOA 1NXYA 4WMCD 4WZ4A 3N8RA 3FWLA 1PZPA 5CEBA 4R3BA 4NETA 3WS4A 4LCMA 1ZG6A 1BSGA 1I2WA 4ZAMA 3MBZA 1NYMA 4JXSA 3ZGAB 5GLCA 1FCOA 4PM5A 4BL2A 2Y2MA 2GDNA 2WYXA 1NYYA 1MWUA 1XKZA 4S2NC 1IEMA 4Z9QA 4JF5A 1CEFA 1K57C 2Y2QA 4DDYA 1XGJA 5FSRA 3D4FA 1FCMA 1VM1A 3ZG0A 3PTEA 5DF7A 1XX2A 3N6IA 1YLTA 3MKFA 3V39A 2DNSA 4E6XA 1YLJA 1MXOA 3O3VA 4LV1A 4EQIA 4R0QA 1HVBA 1XA1A 3A3FA 3ZG9B 5CHMA 1KVMA 3IXGA 5CGXA 3TG9A 4KENB 5FASA 5FAQA 3PAGA 3IHBA 3PAEA 2I72A 4KZ7A 1JWZA 4NK3A 1YMSA 4B4ZA 5KMWA 4PM7A 3IWQA 2HP5A 1IKGA 4UAAA 5CTMA 5A93A 1K38A 3HUMA 3HLDA 4OOMA 5CHJA 1BUEA 1Z6FA 3IWOA 1ONGA 2XR0A 4RVAA 3UDXA 1J9MA 4IVKA 4BD0A 3BFDA 1RP5A 1GA0A 4PM8A 1LI0A 5AQ9A 1NRFA 3GSGA 3W4PA 1BLHA 3FYZA 5CGWA 1SKFA 5F82A 3MZFA 4KZ3A 4EBLA 1IYSA 1SDNA 1W7FA 3G2ZA 5FATA 5GHXA 1K6RA 3NIAA 2Y55A 1VQQA 2Q9MA 2IWDA 3ZVTA 4D2OA 3Q1FA 4OKPA 1YLWA 4E3OA 4LCLA 5FA7A 4JLFA 4WZ5A 3IF6A 3IHAA 3O88A 4E3IA 3C7UA 4HEFA 5FQMA 5J8XA 2XLNA 3PBTA 4X53A 4JF4A 1XA7A 2HP6A 2EFXA 4BJPA 3VFFA 5E2EA 1WE4A 5HW3A 1SDEA 2ZQ7A 1SCWA 4U0TA 3E2LA 4DXBA 4ZJ2A 3M6HA 4BL3A 4LV3A 4GN2A 5GHZA 4GNUA 3OPLA 1KE3A 1ERQA 2WGVA 4N1HA 4X56A 3G4PA 4QU3A 3Q81A 1L0FA 2J9OA 1GHPA 1DJCA 1K55A 5AQ7A 2A3UA 1H8YA 4R1GA 1FR1A 3ZFZA 3GV9A 3BECA 4QY6A 3NDEA 1PWCA 1WYCA 2HDRA 5HX9A 3VFHA 5KZHA 2IWBA 3SH7A 3GVBA 4JF6A 4S2OA 3VP2A 4OPRA 4UA6A 4MLLA 1JTGA 1N4OA 2P74A 5HL1A 5GLAA 3GRJA 2ZC5B 3ZNTA 4OPQA 2ZM0A 1GHMA 1W79A 4E6WA 1GA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTC A;  3ZDJ A;  1HD8 A;  2FFY A;  3VOZ A;  5BOH A;  4ZTK A;  3G2Y A;  3WS5 A;  4GDB A;  4IVI A;  4E3M A;  1WYB A;  1W8Q A;  4JPM A;  4WEJ A;  2PU4 A;  2JC7 A;  2Y4A A;  1NJ4 A;  4FH2 A;  2C5W B;  1LLB A;  4X69 A;  5AQA A;  4DKI A;  2V2F F;  4GD8 A;  3ZHH A;  5EUA A;  4S2N A;  1FSW A;  2ZQC A;  5TFQ A;  2RCX A;  3N7W A;  4WM9 A;  1K6S A;  1IEL A;  1M6K A;  5M19 A;  3WS2 A;  2VGK A;  3VP1 A;  4FSF A;  1KE0 A;  1ES4 A;  3VP0 A;  3HLE A;  3NY4 A;  1BZA A;  1LHY A;  2EXA A;  2JE5 A;  1L2S A;  3DWZ A;  3IXH A;  4K91 A;  4IBX A;  3CJM A;  3HRE A;  4L0L A;  4OH0 A;  1RGZ A;  2Y2L A;  3FV7 A;  3ZG8 B;  4KZ4 A;  2ZQD A;  3W4O A;  4GD6 A;  3G34 A;  4KZA A;  1TVF A;  3AGE A;  4LV0 A;  3N8S A;  4OLD A;  1YLP A;  5FQ9 A;  1Q2Q A;  1W8Y A;  1W5D A;  4XUX A;  1KVL A;  1L0E A;  4KZ8 A;  4RX3 A;  3BM6 A;  5A92 A;  5FAP A;  3VSL A;  3ZG7 B;  5EPH A;  4N1X A;  5HFO A;  1JVJ A;  4OVD A;  4OON A;  4WEK A;  3W4Q A;  4QHC A;  2EXB A;  1U60 A;  4WMC A;  4IBR A;  4OLG A;  5CXW A;  4P85 A;  1MY8 A;  2XF3 A;  3OPH A;  1PW8 A;  4Y0U A;  2Y2J A;  3B3X A;  2XDM A;  2Y2I A;  3OCL A;  5FQI A;  3AGF A;  3Q7V B;  3O87 A;  3FKV A;  3MXR A;  3SH9 A;  4Y0O A;  3HL9 A;  3IF5 A;  4OP8 A;  4PM6 A;  3VOY A;  3GQZ A;  1IYO A;  3UPN A;  3IXD A;  2WZZ A;  3UPO A;  3IWI A;  2WGW B;  2Y91 A;  3BLS A;  3G35 A;  3S1Y A;  2J7V A;  3NDG A;  2P9V B;  2XK1 A;  1IYQ A;  4R3J A;  3V3S A;  3C7V A;  4R4R A;  5FQJ A;  2HP9 A;  3Q82 A;  1YLZ A;  1MWR A;  2H0Y A;  4RYE A;  4PPR A;  3CZD A;  1SHV A;  2QMI A;  3VSK A;  4ZDX A;  3SS4 A;  1TDL A;  2J8Y A;  4OQH A;  3G31 A;  4N92 A;  5FQQ A;  1RCJ A;  4M3K A;  4BLM A;  5EOE A;  4DE0 A;  4P87 A;  3HLW A;  5FI6 A;  2CC1 A;  5EVL A;  4KZ5 A;  4S2L A;  5D3O A;  2HDQ A;  2Q9N A;  4U3T A;  4XXR A;  4X6T A;  1KGE A;  1BLS A;  1BTL A;  2WAD A;  3NC8 A;  1GHI A;  3S22 A;  3ISG A;  1L0G A;  2XEP A;  1PI4 A;  1QMF A;  2Y2H A;  3PBR A;  1Q2P A;  4K0X A;  2PU2 A;  3PBO A;  1NZO A;  1NY0 A;  1XP4 A;  4OQ0 A;  3PBN A;  4EUZ A;  3LY3 A;  3DTM A;  3G32 A;  3IQA A;  2EFU A;  4S2K A;  1H5X A;  3AGD A;  4PMA A;  1FR6 A;  4QD4 A;  4WBG A;  4RA7 A;  2Z2L B;  2EX8 A;  2R9W A;  3A3D A;  3MFD A;  5TGF A;  4DE1 A;  2BG1 A;  1DY6 A;  2ZM8 A;  3M6B A;  1FCN A;  2H10 A;  3Q7Z A;  4MBK A;  3C4O A;  5CEC A;  4RX2 A;  5L2F A;  3CMZ A;  2XFS A;  4S2M A;  4C6Y A;  3BFC A;  4PM9 A;  1FSY A;  1S6R A;  3IXB A;  1ES2 A;  5HAP A;  1BT5 A;  2ZC4 B;  3BFF A;  1MWS A;  4N9K A;  4CJN A;  2G2W A;  4GDN A;  3FKW A;  2XD1 A;  5A91 A;  3RXW A;  4GZB A;  2ZQ9 A;  1G68 A;  5DF8 A;  2JCH A;  2Y2P A;  4WEL A;  4KQR A;  3VP4 A;  4DRT A;  4OPY A;  4EV4 A;  5FQK A;  3Q07 A;  1ESU A;  2QZ6 A;  4B88 A;  4S2I A;  1OME A;  2X71 A;  4XUZ A;  4O7D A;  1K4E A;  5F1F A;  3V5M A;  3RJU A;  5GLD A;  3UDF A;  1YT4 A;  2EX2 A;  1IYP A;  1YM1 A;  2G2U A;  3WWX A;  3C4P A;  4KQO A;  3BYD A;  1YLY A;  1PIO A;  2PBY A;  1BUL A;  3M2K A;  4P6B A;  1H8Z A;  4HES A;  4OOL A;  4QY5 A;  2OSU A;  3SOI A;  1ES5 A;  1CI9 A;  5FDH A;  1FOF A;  4BQM A;  4QJG A;  1CEG A;  2HPB A;  3DW0 A;  3A3I A;  5E2G A;  5CHU A;  3LEZ A;  5DVA A;  1PYY A;  4CPK A;  1I2S A;  3HUN A;  3SS5 A;  5M18 A;  1MWT A;  5CTN A;  2WKE A;  2XD5 A;  3Q7V A;  4FD8 A;  4MEZ A;  4E3N A;  1CK3 A;  4GKU A;  4ZJ3 A;  2XQZ A;  3MZE A;  3OCN A;  2V1Z A;  4ID4 A;  1N9B A;  2WGW A;  5FAO A;  5F83 A;  3BRM A;  1L0D A;  2P9V A;  2X01 A;  5KSH A;  3A3J A;  1S0W A;  2WAF A;  4WYY A;  1TEM A;  2FFF B;  5GL9 A;  2Y2N A;  4QB8 A;  3ZVW A;  2VGJ A;  4LV2 A;  1KE4 A;  2C6W B;  1BLC A;  5DTS A;  4B4X A;  3IH8 A;  3CG5 A;  1TDG A;  4X68 A;  2WAE A;  3UPP A;  4EBN A;  5GLB A;  2BLS A;  3HBR A;  2H5S A;  1MPL A;  3HUO A;  4F94 A;  3EQU A;  5CER A;  2R9X A;  2XGN A;  5IHV A;  4H8R A;  5JYP A;  2E8I A;  1MBL A;  4KZ9 A;  3N4I A;  1LL9 A;  3HLG A;  1O07 A;  3NBL A;  2OLV A;  4JKT A;  1PW1 A;  3OC2 A;  2ZC7 A;  2A49 A;  1M40 A;  3N8L A;  4OPZ A;  4U0X A;  5DTK A;  2B5R A;  5I94 A;  4FCF A;  3UO9 A;  4S2P A;  4HBU A;  3ITA A;  4EWF A;  4MBH A;  1K56 D;  2ZM2 A;  2WKH A;  4DE3 A;  4A5R A;  3BFE A;  4DXC A;  1E3U D;  4ZJ1 A;  2ZQ8 A;  4KG6 A;  3OZH A;  5EOO A;  2DCF A;  5HAR A;  1XPB A;  2EX9 A;  3LY4 A;  3NI9 A;  1ZG4 A;  3IT9 A;  3SH8 A;  3HLB A;  4K0W A;  1K4F A;  1PWD A;  1XGI A;  4YIN A;  3V50 A;  4DF6 A;  4BEN A;  3IH9 A;  3WS1 A;  5EVI D;  1ERO A;  3DWK A;  1RGY A;  3LO7 A;  2WGI A;  2WZX A;  3EQV A;  4R23 A;  4Y7P A;  5GHY A;  2HDS A;  5CED A;  1EWZ A;  2XH9 A;  3HLC A;  5FI7 A;  2EX6 A;  1MKI A;  3OPR A;  4UHU A;  1O7E A;  1K56 A;  2QPN A;  1ES3 A;  2ZLY A;  3VMA A;  3ZNY A;  2Z2M B;  1FQG A;  3MZD A;  1HTZ A;  2V20 A;  3P98 A;  4YFM A;  5EEC A;  5M1A A;  3OPP A;  1E3U A;  2RL3 A;  3BEB A;  1G6A A;  1I5Q A;  4R4S A;  5CRF A;  3ZCZ A;  3V3R A;  4MNR A;  3WRZ A;  5EE8 A;  4OQG A;  4KZB A;  4S2J A;  3PBQ A;  1K25 A;  2Y59 A;  4GB7 A;  4DE2 A;  3E2K A;  5DF9 A;  3RXX A;  3UE3 A;  4ZBE A;  1JWV A;  5EVI A;  3QNB A;  4OOY A;  1ZKJ A;  4DDS A;  1CI8 A;  4E3J A;  4P0M A;  3I7J A;  1NZU A;  1PI5 A;  2ZD8 A;  1JTD A;  5CGS A;  1IKI A;  3A3E A;  3BFG A;  4HBT A;  2JBF A;  4JXV A;  4E3K A;  5G18 A;  3ZG5 A;  2WKI A;  2X02 A;  4UA9 A;  4E3L A;  3UN7 A;  3UDI A;  1DJA A;  5KSC A;  1KGF A;  4GOG A;  3LCE A;  3S4X A;  2J9P A;  3ITB A;  5DTT A;  5AQB A;  2OLU A;  3WS0 A;  4X55 A;  3UE1 A;  5HAQ A;  1K54 A;  1XXM A;  1KGG A;  3VP3 A;  5EVI C;  3UNW A;  1DJB A;  4KG2 A;  3C5A A;  2XFT A;  4JXG A;  4KQQ A;  4JXW A;  1KDS A;  3JYI A;  4N9L A;  3QNC A;  1ESI A;  3WRT A;  4WZ5 C;  3IF6 C;  1ALQ A;  2Y2K A;  1YMX A;  5U47 A;  5EVI B;  2WUQ A;  3PBS A;  1GCE A;  1E25 A;  1EI5 A;  4C3Q A;  5E43 A;  2ZMA A;  3UE0 A;  2DRW A;  2OV5 A;  1PWG A;  3FZC A;  2ZJ9 A;  3HVF A;  4MBF A;  4JBF A;  3TSG A;  3IF6 B;  3W8K A;  1AXB A;  1K54 C;  3GR2 A;  1ONH A;  5TR7 A;  1QME A;  3G30 A;  3HLF A;  4UA7 A;  4FH4 A;  5E2F A;  3TOI A;  2ZC6 B;  5F1G A;  3P09 A;  3M2J A;  4C75 A;  1K55 C;  3SS3 A;  4OP5 A;  1KDW A;  2Y2O A;  4OQI A;  1E4D A;  2UWX A;  3MXS A;  5FI2 A;  1LI9 A;  3NCK A;  5HAI A;  2IWC A;  4KG5 A;  2HDU A;  1ZC2 A;  3QHY A;  4LEN A;  1HZO A;  1YQS A;  2Y2G A;  3O86 A;  4IED A;  5A90 A;  5JYO A;  5E2H A;  1BLP A;  4BD1 A;  3MKE A;  1K57 A;  3UY6 A;  1Y54 A;  4Q8I A;  4EBP A;  1ERM A;  2ZC3 B;  2WK0 A;  3BLM A;  1JWP A;  3GMW A;  4KZ6 A;  1C3B A;  4Y0T A;  2H0T A;  2ZQA A;  1LL5 A;  1PZO A;  1NXY A;  4WMC D;  4WZ4 A;  3N8R A;  3FWL A;  1PZP A;  5CEB A;  4R3B A;  4NET A;  3WS4 A;  4LCM A;  1ZG6 A;  1BSG A;  1I2W A;  4ZAM A;  3MBZ A;  1NYM A;  4JXS A;  3ZGA B;  5GLC A;  1FCO A;  4PM5 A;  4BL2 A;  2Y2M A;  2GDN A;  2WYX A;  1NYY A;  1MWU A;  1XKZ A;  4S2N C;  1IEM A;  4Z9Q A;  4JF5 A;  1CEF A;  1K57 C;  2Y2Q A;  4DDY A;  1XGJ A;  5FSR A;  3D4F A;  1FCM A;  1VM1 A;  3ZG0 A;  3PTE A;  5DF7 A;  1XX2 A;  3N6I A;  1YLT A;  3MKF A;  3V39 A;  2DNS A;  4E6X A;  1YLJ A;  1MXO A;  3O3V A;  4LV1 A;  4EQI A;  4R0Q A;  1HVB A;  1XA1 A;  3A3F A;  3ZG9 B;  5CHM A;  1KVM A;  3IXG A;  5CGX A;  3TG9 A;  4KEN B;  5FAS A;  5FAQ A;  3PAG A;  3IHB A;  3PAE A;  2I72 A;  4KZ7 A;  1JWZ A;  4NK3 A;  1YMS A;  4B4Z A;  5KMW A;  4PM7 A;  3IWQ A;  2HP5 A;  1IKG A;  4UAA A;  5CTM A;  5A93 A;  1K38 A;  3HUM A;  3HLD A;  4OOM A;  5CHJ A;  1BUE A;  1Z6F A;  3IWO A;  1ONG A;  2XR0 A;  4RVA A;  3UDX A;  1J9M A;  4IVK A;  4BD0 A;  3BFD A;  1RP5 A;  1GA0 A;  4PM8 A;  1LI0 A;  5AQ9 A;  1NRF A;  3GSG A;  3W4P A;  1BLH A;  3FYZ A;  5CGW A;  1SKF A;  5F82 A;  3MZF A;  4KZ3 A;  4EBL A;  1IYS A;  1SDN A;  1W7F A;  3G2Z A;  5FAT A;  5GHX A;  1K6R A;  3NIA A;  2Y55 A;  1VQQ A;  2Q9M A;  2IWD A;  3ZVT A;  4D2O A;  3Q1F A;  4OKP A;  1YLW A;  4E3O A;  4LCL A;  5FA7 A;  4JLF A;  4WZ5 A;  3IF6 A;  3IHA A;  3O88 A;  4E3I A;  3C7U A;  4HEF A;  5FQM A;  5J8X A;  2XLN A;  3PBT A;  4X53 A;  4JF4 A;  1XA7 A;  2HP6 A;  2EFX A;  4BJP A;  3VFF A;  5E2E A;  1WE4 A;  5HW3 A;  1SDE A;  2ZQ7 A;  1SCW A;  4U0T A;  3E2L A;  4DXB A;  4ZJ2 A;  3M6H A;  4BL3 A;  4LV3 A;  4GN2 A;  5GHZ A;  4GNU A;  3OPL A;  1KE3 A;  1ERQ A;  2WGV A;  4N1H A;  4X56 A;  3G4P A;  4QU3 A;  3Q81 A;  1L0F A;  2J9O A;  1GHP A;  1DJC A;  1K55 A;  5AQ7 A;  2A3U A;  1H8Y A;  4R1G A;  1FR1 A;  3ZFZ A;  3GV9 A;  3BEC A;  4QY6 A;  3NDE A;  1PWC A;  1WYC A;  2HDR A;  5HX9 A;  3VFH A;  5KZH A;  2IWB A;  3SH7 A;  3GVB A;  4JF6 A;  4S2O A;  3VP2 A;  4OPR A;  4UA6 A;  4MLL A;  1JTG A;  1N4O A;  2P74 A;  5HL1 A;  5GLA A;  3GRJ A;  2ZC5 B;  3ZNT A;  4OPQ A;  2ZM0 A;  1GHM A;  1W79 A;  4E6W A;  1GA9 A; 
#chains in the Genus database with same CATH topology
 1OTE A;  2W3H A;  5BOH A;  4ZTK A;  4GDB A;  3T12 B;  4E3M A;  1W8Q A;  4EUV A;  2JC7 A;  2Y4A A;  1LLB A;  4DKI A;  3E0Y A;  1T1C A;  4MCW A;  1K6S A;  5L10 A;  3WS2 A;  2ZL1 B;  2W3E A;  1L2S A;  4K91 A;  3CJM A;  2Y2L A;  1STZ A;  3ZG8 B;  3W4O A;  1OT6 A;  3AGE A;  5FQ9 A;  1Q2Q A;  1W8Y A;  2MJ6 A;  1W5D A;  5DKK A;  3S7N A;  4RX3 A;  5FL3 A;  3BM6 A;  5A92 A;  1G6O A;  3O5Y A;  1JVJ A;  3D72 A;  3W4Q A;  5F69 A;  1MKM A;  3OPH A;  3EGD C;  4HJ3 A;  4Y0U A;  2Y2J A;  3B3X A;  3OCL A;  2Y79 A;  2Y8H A;  3Q7V B;  3O87 A;  3MXR A;  3T1X A;  4GS9 A;  4Y0O A;  3UPN A;  3LI9 A;  2WGW B;  3G35 A;  3DTI A;  3C7V A;  3PR6 A;  1YLZ A;  1MWR A;  2H0Y A;  4RYE A;  2DMW A;  4DMZ A;  4EW7 A;  1SHV A;  3VSK A;  5KIZ A;  3MF0 A;  5FQQ A;  3L7H A;  5FI6 A;  2HDQ A;  4JGQ A;  2XRN A;  1H8M A;  1ACF A;  3GEC A;  4L9F A;  1UGU A;  2VX8 A;  3QP1 A;  4LPZ A;  4I5S A;  4EUZ A;  3DTM A;  1H5X A;  4WBG A;  2Z2L B;  2EX8 A;  1NRJ A;  2NUP C;  5FEF A;  3MFD A;  5TGF A;  2J3T C;  2ZM8 A;  5F5Y A;  4NXE A;  3LIE A;  4RX2 A;  4ETZ A;  2VZW A;  3DTE A;  4S2M A;  2FZ0 A;  4HOI A;  4PKY A;  2ACG A;  1S6R A;  2G2W A;  2W27 A;  2V9A A;  5HWW A;  1ZTU A;  5A91 A;  2ZQ9 A;  5TJJ A;  2Y2P A;  4WEL A;  4KQR A;  4EV4 A;  1TS0 A;  4S2I A;  3T4L A;  4O7D A;  5EM0 A;  3V5M A;  5GLD A;  3UDF A;  1G5U A;  3WWX A;  2R78 A;  1PIO A;  1H8Z A;  4HES A;  4QY5 A;  3SOI A;  1CI9 A;  4BQM A;  3ICY A;  4CPK A;  3HUN A;  2HGV A;  3UME A;  2XQZ A;  2BAS A;  1N9B A;  5FAO A;  5F83 A;  1L0D A;  2P9V A;  1VEU B;  4IUK A;  4WYY A;  3LUQ A;  3ZVW A;  4GHI B;  3LGO A;  1KE4 A;  3UB9 A;  5DTS A;  3CG5 A;  2XA7 M;  4CQH A;  2H5S A;  4LLO B;  3HUO A;  3EQU A;  5CER A;  2R9X A;  2XGN A;  1OJ5 A;  4KZ9 A;  1LL9 A;  3HLG A;  3CWF A;  3LYX A;  3T4K A;  1PW1 A;  1M40 A;  4OPZ A;  1S1Y A;  2VEA A;  4QPR A;  1FIL A;  3T4O A;  4IUH A;  3ITA A;  2Z6D A;  3VOL A;  1XJ3 A;  3LR0 A;  1XJ4 A;  5HAR A;  3LY4 A;  3IT9 A;  3SH8 A;  4K0W A;  4YIN A;  3V50 A;  2XRO A;  1PRQ A;  5EVI D;  1ERO A;  3LO7 A;  4ARZ A;  2W1R A;  2HDS A;  5G4Y A;  1K56 A;  1ES3 A;  4YFM A;  4WUJ A;  3MJQ A;  2VK3 A;  4GJ4 A;  1I5Q A;  4R4S A;  5CRF A;  3ZCZ A;  3V3R A;  3WRZ A;  4OQG A;  4O8G A;  5A8B A;  1K25 A;  2V1A A;  5DF9 A;  3FPW A;  4P0M A;  3I7J A;  2VGL S;  1IKI A;  4HBT A;  2JBF A;  2X02 A;  3NOP C;  4UA9 A;  4Y3I A;  2H28 A;  3UDI A;  1DJA A;  2J9P A;  5J7E A;  3UNW A;  3H9W A;  4KG2 A;  4EXO A;  2B18 A;  4N9L A;  1ESI A;  3P7N A;  3WRT A;  3IF6 C;  2VV7 A;  1ALQ A;  4I39 A;  2PAV P;  1YMX A;  3PBS A;  4L9E A;  3UE0 A;  1PWG A;  4MBF A;  3GR2 A;  5HDD A;  4HI4 A;  3HJI A;  2KLI A;  3M2J A;  4C75 A;  4YNR A;  1E4D A;  2UWX A;  5FI2 A;  1LI9 A;  2IWC A;  4UQI S;  4I3I A;  2ZOI A;  1P9W A;  5E2H A;  1BLP A;  5HDC A;  3UY6 A;  1Y54 A;  2OWH A;  3BLM A;  4KZ6 A;  1PZO A;  4WMC D;  3FWL A;  5CEB A;  3WS4 A;  3MBZ A;  1NYM A;  4JXS A;  5I5L A;  5FEG A;  2GDN A;  1MWU A;  3UB6 A;  1CEF A;  4BBU A;  1FCM A;  3PTE A;  3N6I A;  1YLT A;  4E6X A;  2DNS A;  4LV1 A;  4EQI A;  4R0Q A;  4UEY A;  5CHM A;  5FAS A;  4KZ7 A;  3F1P A;  5KMW A;  2HP5 A;  1IKG A;  5A93 A;  5CTM A;  3HUM A;  2P04 A;  4EER A;  1ONG A;  4RVA A;  3BFD A;  1RP5 A;  4PM8 A;  5F82 A;  3S7P A;  2GX5 A;  2Y55 A;  4DN0 A;  3JVV A;  4E3O A;  5HD5 A;  3FPV A;  5FQM A;  1D7E A;  4HEF A;  3PBT A;  1N9O A;  1LSW A;  4GS9 B;  2B95 A;  4BJP A;  4G3K A;  5E2E A;  5HZH A;  1UWP X;  1WE4 A;  5HW3 A;  4GW9 A;  1SCW A;  4U0T A;  3LIB A;  4BL3 A;  4GN2 A;  4LFU A;  2PR5 A;  3OPL A;  5GHZ A;  4QU3 A;  3Q81 A;  5AQ7 A;  1K55 A;  1WA9 A;  2A3U A;  4KQD A;  3ZFZ A;  3GV9 A;  3BEC A;  3SH7 A;  2KX6 A;  2VKS A;  3GVB A;  4S2O A;  3MR0 A;  4OPR A;  3LI8 A;  2P74 A;  1Y4O A;  1SKO B;  4CLC C;  2L4R A;  5U47 A;  1W79 A;  3QP6 A;  3D3O A;  3P01 A;  2C5W B;  2ZBB A;  4GD8 A;  3BJN A;  2ZQC A;  2RCX A;  5M19 A;  2E8J A;  2VGK A;  3VP1 A;  1KE0 A;  1ES4 A;  3HLE A;  1BZA A;  1PNE A;  3K3D A;  3IXH A;  1RGZ A;  3BY9 A;  2ZQD A;  4HP9 A;  4L9G A;  1VET A;  2P08 A;  1KVL A;  1L0E A;  4N1X A;  4OVD A;  4WEK A;  4QHC A;  2EXB A;  4WMC A;  4IBR A;  4OLG A;  2W0N A;  1LSX A;  1V9Z A;  2PR6 A;  4PAU A;  2XF3 A;  2Y2I A;  4MN6 A;  5EV0 A;  3AGF A;  4HH2 A;  5DJU A;  3FC7 A;  3SH9 A;  3HL9 A;  3KYE A;  4OP8 A;  3V67 A;  2J3T D;  1IYO A;  3GQZ A;  3PYP A;  3IXD A;  3TRC A;  2Y91 A;  4YOF A;  2P9V B;  2XK1 A;  2JHE A;  5FQJ A;  5AVE A;  4OQH A;  5AVF A;  4M3K A;  4DE0 A;  4P87 A;  4KZ5 A;  1A0K A;  2Q9N A;  4X6T A;  1BLS A;  1L0G A;  2XEP A;  3LIC A;  2OAP 1;  3MQ0 A;  1QMF A;  3PBR A;  4K0X A;  4RQ9 A;  2PU2 A;  3OBF A;  5HWV A;  1AWI A;  3LY3 A;  1IFQ A;  2BG1 A;  4WL9 A;  2H10 A;  3H7W A;  3C4O A;  3JVU A;  5HDS A;  5L07 A;  4HHD A;  2XFS A;  1TS8 A;  2XA7 S;  5DJT A;  4ARZ B;  4NXG A;  1ES2 A;  4N9K A;  3FKW A;  4H6J A;  3UB8 A;  3RXW A;  2A24 A;  3Q07 A;  1ESU A;  2QZ6 A;  2X71 A;  4XUZ A;  2LB9 A;  3CLO A;  2EX2 A;  2M7U A;  2G2U A;  3C8C A;  1ZHH B;  3BYD A;  2PBY A;  4P6B A;  1XFN A;  2QJ7 A;  5FDH A;  1FOF A;  3A3I A;  5E2G A;  5CHU A;  3LEZ A;  1PYY A;  1I2S A;  3MXQ A;  5CTN A;  2WKE A;  4FD8 A;  2INW A;  4MEZ A;  3MZE A;  3OCN A;  2V1Z A;  2Z6C A;  3CPT A;  4WN5 A;  1EW0 A;  4P6Z M;  2EWW A;  1S0W A;  1TF1 A;  2VGJ A;  4R38 A;  4G3W A;  1BLC A;  2YKH A;  1N9N A;  3IH8 A;  1TDG A;  2WAE A;  3UPP A;  3TE8 A;  1MPL A;  4F94 A;  5JYP A;  2E8I A;  4Q0J A;  5HSQ A;  3NBL A;  4GCZ A;  4EEP A;  1S4R A;  2ZC7 A;  2A49 A;  5I94 A;  4HBU A;  2PHY A;  4MBH A;  1K56 D;  2ZM2 A;  4DE3 A;  4DXC A;  4ZJ1 A;  2ZQ8 A;  1VB6 A;  3S7Q A;  5FDS A;  3IH9 A;  3T50 A;  1XJ6 A;  3DWK A;  3U4L P;  1RGY A;  2WGI A;  4R23 A;  1H0M A;  5GHY A;  2XH9 A;  3HLC A;  5FI7 A;  1S67 L;  3OPR A;  2PDR A;  1FQG A;  2QKP A;  5EEC A;  2V20 A;  3P98 A;  1G6A A;  4IJG A;  3F1N B;  2PRF A;  1TS6 A;  1NLY A;  3PBQ A;  1CQA A;  4DE2 A;  1MZU A;  3RXX A;  3UE3 A;  4HY8 A;  4ZBE A;  3R4K A;  3QNB A;  2JKT M;  4E3J A;  1NZU A;  1PI5 A;  1LT0 A;  4ME4 A;  2WKQ A;  1HLU P;  3F1P B;  2WKI A;  3VV4 A;  3S4X A;  3ITB A;  1OJG A;  5AQB A;  4X55 A;  3UE1 A;  5HAQ A;  3KO6 A;  1KGG A;  3IS2 A;  3C5A A;  2XFT A;  4F3L A;  4KQQ A;  4X25 A;  2WKR A;  3JYI A;  3QNC A;  5F68 A;  5EVI B;  2JKR I;  4C3Q A;  5TBM B;  3HVF A;  4PKY G;  4JBF A;  2IA2 A;  4BBV A;  1ONH A;  5TR7 A;  2K2N A;  3G30 A;  5E2F A;  2Y2O A;  3MXS A;  3C30 A;  3NCK A;  2Y2G A;  1YQS A;  3CUE C;  1K57 A;  3ULF A;  3F1O A;  3E4Q A;  1JWP A;  1C3B A;  2H0T A;  3G6O A;  1LL5 A;  4DJ3 A;  4R3B A;  1I2W A;  4PM5 A;  4LRZ E;  4BL2 A;  2WYX A;  1XKZ A;  4S2N C;  1PFL A;  1K57 C;  1VM1 A;  1XX2 A;  3MKF A;  1GSV A;  1YLJ A;  1MXO A;  2HV1 A;  4Z1W A;  1XA1 A;  3A3F A;  3DTK A;  3A0V A;  3ZG9 B;  4KEN B;  1P9R A;  5FAQ A;  3PAE A;  2I72 A;  4HIA A;  1YMS A;  3A0R A;  4PM7 A;  4Y5F A;  4UAA A;  1K38 A;  3HLD A;  4OOM A;  1Z6F A;  3IWO A;  3UB5 P;  5AQ9 A;  3GSG A;  1SKF A;  3OLO A;  2JKT I;  1W7F A;  5FAT A;  3HCY A;  1K6R A;  3NIA A;  2ZMV A;  1D1J A;  2W1T A;  3ZVT A;  4D2O A;  4KUK A;  4CLC D;  1YLW A;  1CF0 A;  3CIT A;  3B33 A;  4CLC E;  3IF6 A;  3IHA A;  4B9O A;  2EFX A;  3E2L A;  3PXP A;  4NKP A;  4DXB A;  3KSH A;  4GNU A;  2WGV A;  3ZYT A;  4N1H A;  2J9O A;  1G28 A;  1H8Y A;  2VJW A;  1WYC A;  3VFH A;  2HDR A;  5C5K A;  3VP2 A;  4MLL A;  1N4O A;  5HL1 A;  3GRJ A;  2ZC5 B;  3MMH A;  2ZM0 A;  3CAX A;  4H8R A;  2XSS A;  3GTC A;  3ZDJ A;  1HD8 A;  2FFY A;  3VOZ A;  3SW1 A;  3G2Y A;  3WS5 A;  3BY8 A;  4JPM A;  4WEJ A;  1NJ4 A;  4X69 A;  2Q0O A;  5AQA A;  3H7W B;  3UE6 A;  2V2F F;  5EUA A;  2O99 A;  4XT2 B;  4WM9 A;  1IEL A;  3IX8 A;  4NXB A;  2HZ5 A;  3NY4 A;  3KX0 X;  2EXA A;  2JE5 A;  1T19 A;  4D60 A;  3DWZ A;  4H6J B;  4IBX A;  4OH0 A;  3MFX A;  3FV7 A;  4KZA A;  3KYZ A;  1YLP A;  4M4X A;  2OOL A;  2UV0 E;  4YWZ A;  3ZG7 B;  4EET B;  5HFO A;  3KSG A;  3IX3 A;  5EM1 A;  4OON A;  1OTI A;  1DRM A;  1U60 A;  5CXW A;  4P85 A;  3CI6 A;  1XJ2 A;  4BMW A;  3IF5 A;  4PM6 A;  3MS6 A;  3UPO A;  3IWI A;  3CPT B;  3BLS A;  3S1Y A;  2J7V A;  3EOI A;  3V3S A;  1IYQ A;  1NLZ A;  2VV8 A;  3T1R A;  3PHY A;  3CZD A;  4PPR A;  2QMI A;  4ZDX A;  4ESP A;  4BLM A;  3EEA A;  2CC1 A;  2G7U A;  1KGE A;  2WAD A;  3NC8 A;  4MDZ A;  4AFI A;  1GHI A;  1OTD A;  1PI4 A;  1DP8 A;  2Y2H A;  3UMD A;  3PBO A;  3FG8 A;  1FIK A;  4NEE D;  3PBN A;  3G32 A;  4HH3 A;  3U2A A;  3RFB A;  4EQ1 A;  4PMA A;  4RA7 A;  2R9W A;  4CLC A;  2PD7 A;  3M6B A;  4MBK A;  1ODV A;  5L2F A;  3CMZ A;  3LFV A;  1W63 Q;  4C6Y A;  1CJF A;  1BT5 A;  2ZC4 B;  3NOT C;  1NWZ A;  1MWS A;  2HJ9 C;  4CJN A;  4GDN A;  3BW6 A;  2XD1 A;  4HJ6 A;  2B02 A;  4GZB A;  1G68 A;  2JCH A;  3EWK A;  1OT9 A;  5FQK A;  4B88 A;  1MC0 A;  1OME A;  5F1F A;  1W63 M;  1YT4 A;  2JKF A;  3C4P A;  1BUL A;  1P97 A;  4Q0H A;  3JPU A;  3DAV A;  1ES5 A;  1CEG A;  2HPB A;  3T4Q A;  3UB7 A;  4EU0 A;  3BWL A;  3SS5 A;  4DJ2 A;  1KOU A;  1MWT A;  5M18 A;  2M7V A;  2PBD P;  2XD5 A;  1S4S A;  1CK3 A;  4ZJ3 A;  5K5B A;  4F3L B;  2WAF A;  1TEM A;  4QB8 A;  5DFX A;  4X68 A;  4EBN A;  5GLB A;  2BLS A;  3HBR A;  3R7W A;  4Y15 A;  1MBL A;  3T1S A;  2OLV A;  2WKP A;  3N8L A;  4U0X A;  4FUW A;  4FCF A;  3UO9 A;  1TS7 A;  4X1L A;  2EA9 A;  2WKH A;  4A5R A;  4Y13 A;  2AVX A;  4JGO A;  4KG6 A;  3OZH A;  2V8C A;  2EX9 A;  3NI9 A;  1ZG4 A;  3F1O B;  4R70 A;  1K4F A;  1PWD A;  3IX4 A;  3EGX C;  4BEN A;  2A2L A;  2WZX A;  4K08 A;  4Y7P A;  3B42 A;  3BQ8 A;  1EWZ A;  5DFY A;  1MKI A;  2ZLY A;  1HTZ A;  4UQI M;  5M1A A;  3OPP A;  1E3U A;  2EWV A;  3E98 A;  4MNR A;  5EE8 A;  4KZB A;  4S2J A;  4GB7 A;  1JWV A;  4KUO A;  4OOY A;  4DDS A;  3A0S A;  2ZD8 A;  1JTD A;  5G18 A;  3ZG5 A;  3TW8 A;  5KSC A;  1KGF A;  4GOG A;  3LCE A;  3WS0 A;  5DTT A;  2OLU A;  1K54 A;  3VE4 A;  3VP3 A;  1LSV A;  3NOU C;  3E4O A;  1V9Y A;  2FH5 A;  3C38 A;  4WZ5 C;  2Y2K A;  4BWI A;  2W1T B;  2WUQ A;  3HJK A;  1GCE A;  5HPI A;  1EI5 A;  4HJ4 A;  4R3A A;  2PT7 A;  2DRW A;  3IBJ A;  2OV5 A;  3W8K A;  3IF6 B;  1K54 C;  2JKR M;  3HLF A;  4FH4 A;  4UA7 A;  3TOI A;  2ZC6 B;  2GZA A;  2D01 A;  4GLQ A;  1YSP A;  3SS3 A;  4OP5 A;  1KDW A;  1OTA A;  4KG5 A;  4X1M A;  3QHY A;  4LEN A;  2W3D A;  4NG2 A;  4IED A;  4BD1 A;  3MKE A;  3RH8 B;  4MN5 A;  4EBP A;  2ZC3 B;  2WK0 A;  4Y0T A;  1OTB A;  2ZQA A;  4WZ4 A;  1NXY A;  4NET A;  4LCM A;  5GLC A;  1DP6 A;  3MQQ A;  4JF5 A;  4DDY A;  5FSR A;  3D4F A;  3ZG0 A;  3MQO A;  5DF7 A;  1S1Z A;  1F9I A;  1HVB A;  5AJG A;  4JGP A;  5CGX A;  4G3V A;  4I3J A;  3PAG A;  4BBT A;  4Y2F A;  5CHJ A;  1BUE A;  4IVK A;  1GA0 A;  2QHK A;  3NUL A;  3S7O A;  3W4P A;  1BLH A;  5CGW A;  3LR4 A;  1IYS A;  1SDN A;  2VV6 A;  2PYR A;  2W3F A;  1T1B A;  2O9B A;  4OKP A;  4B93 A;  1H3Q A;  4JLF A;  3O88 A;  5J8X A;  3C7U A;  2GNX A;  3H82 A;  4JF4 A;  1XA7 A;  2HP6 A;  1SKO A;  3VFF A;  2ZQ7 A;  4ZJ2 A;  3M6H A;  4PHT A;  1ERQ A;  1K0K A;  2O0Y A;  4X56 A;  3G4P A;  2V0W A;  1L0F A;  2O9A A;  1GHP A;  1DJC A;  3DBA A;  4R1G A;  1FR1 A;  1Z09 A;  4QY6 A;  3NDE A;  1PWC A;  5HX9 A;  2K31 A;  3CUE A;  4HNB A;  2JKG A;  4WF0 A;  1JTG A;  3ZNT A;  4OPQ A;  1GHM A;  4E6W A;  1GA9 A;  4BD0 A;  2VA0 A;  4MMN A;  1UWN X;  4HQA A;  4IVI A;  4Y17 A;  1WYB A;  2PU4 A;  4CLC B;  4FH2 A;  3ZHH A;  4S2N A;  1FSW A;  2OAQ 1;  5TFQ A;  3N7W A;  2J3W A;  1M6K A;  4FSF A;  3VP0 A;  1LHY A;  4I38 A;  1N9L A;  3HRE A;  4L0L A;  4KZ4 A;  4GD6 A;  3G34 A;  2VLG A;  1TVF A;  4LV0 A;  4MN7 A;  3N8S A;  4OLD A;  1YKD A;  4XUX A;  4KZ8 A;  3QP5 A;  5FAP A;  3VSL A;  1TD5 A;  5EPH A;  1OPX A;  1S66 L;  5HD3 A;  3QP4 A;  2QWS A;  1MY8 A;  3KSF A;  1P0Z A;  5HWT A;  1PW8 A;  5HL6 A;  2XDM A;  4WLA A;  3NJA A;  5FQI A;  3NHQ A;  3FKV A;  4R6L A;  3VOY A;  2NUT C;  2WZZ A;  3NDG A;  4R3J A;  4I3A A;  1VET B;  4R4R A;  2HP9 A;  3OOV A;  3Q82 A;  4EES A;  2I9V A;  1YSQ A;  3SS4 A;  1TDL A;  2J8Y A;  3G31 A;  4N92 A;  2V0U A;  1RCJ A;  5EOE A;  3HLW A;  5EVL A;  3R7W B;  4S2L A;  3C2W A;  5D3O A;  4U3T A;  4XXR A;  1BTL A;  2V8F A;  3S22 A;  3ISG A;  1Q2P A;  3IBR A;  1NZO A;  3LEQ A;  1NY0 A;  1XP4 A;  4OQ0 A;  1F5M A;  3IQA A;  2EFU A;  4S2K A;  3AGD A;  4QD4 A;  1DP9 A;  1FR6 A;  5L8M A;  3A3D A;  4DE1 A;  1DY6 A;  1FCN A;  3Q7Z A;  3TJZ C;  5CEC A;  3BFC A;  4PM9 A;  1FSY A;  3IXB A;  5HAP A;  3BFF A;  1JNU A;  5DKL A;  2ZL1 A;  5DF8 A;  3VP4 A;  4DRT A;  4ETX A;  4OPY A;  1GSX A;  2LB5 A;  1K4E A;  3RTY A;  3GDI A;  3RJU A;  4NXF A;  1IYP A;  1YM1 A;  3SZT A;  4KQO A;  2K7S A;  1YLY A;  3KSI A;  3M2K A;  4OOL A;  1T18 A;  2OSU A;  5IT5 A;  4QJG A;  3DW0 A;  5DVA A;  3MSH A;  3Q7V A;  4E3N A;  4GKU A;  3QP2 A;  5L09 A;  2A24 B;  4ID4 A;  2WGW A;  3BRM A;  2O9C A;  2X01 A;  5KSH A;  3A3J A;  2FFF B;  5G4Z A;  5GL9 A;  2Y2N A;  1J3W A;  4LV2 A;  2C6W B;  3T4T A;  4B4X A;  2L0W A;  1BYW A;  4EEU A;  2ZMF A;  5IHV A;  5J3W A;  2JN7 A;  2D02 A;  3N4I A;  3LR3 A;  1O07 A;  4JKT A;  3OC2 A;  5DTK A;  5MC7 A;  2B5R A;  4S2P A;  3F1N A;  4EWF A;  1YAX A;  3BFE A;  1E3U D;  5EOO A;  2DCF A;  1XPB A;  5LBR A;  2PD8 A;  3HLB A;  1XGI A;  2QJ5 A;  3E4P A;  3T1Q B;  4DF6 A;  1IOU A;  3WS1 A;  3EQV A;  5CED A;  2EX6 A;  3LR5 A;  4UHU A;  3VMA A;  1O7E A;  2QPN A;  5CX7 A;  3ZNY A;  2Z2M B;  3MZD A;  2RL3 A;  3BEB A;  5F6A A;  2ZOH A;  2KOI A;  4QWO A;  5HPF A;  2Y59 A;  2CMN A;  3E2K A;  5EVI A;  1ZKJ A;  1CI8 A;  2J80 A;  4P6Z S;  3T4J A;  5EVE A;  3L9K A;  3LID A;  3QP8 A;  4JGR A;  5TBM A;  5CGS A;  5IS1 A;  1SZV A;  3A3E A;  3BFG A;  4JXV A;  4E3K A;  1VHM A;  4E3L A;  3UN7 A;  1F2K A;  4IHQ A;  3LIF A;  1XXM A;  5EVI C;  1DJB A;  2V1B A;  3EEH A;  4JXG A;  3KYQ A;  4JXW A;  1F98 A;  1KDS A;  1VEU A;  4GHI A;  4O01 A;  1E25 A;  5E43 A;  2ZMA A;  1LL8 A;  3B47 A;  3FZC A;  3K3C A;  2ZJ9 A;  2P7J A;  3BQA A;  3TSG A;  1AXB A;  3H82 B;  2KDK A;  1QME A;  3K2N A;  5J4E A;  2OWJ A;  5F1G A;  3P09 A;  3VE3 A;  2HF6 A;  1K55 C;  4OQI A;  3IS2 B;  5HAI A;  2HDU A;  1ZC2 A;  1GSW A;  2GJ3 A;  1HZO A;  3O86 A;  5JYO A;  2VGL M;  5A90 A;  4ZRR A;  2HJE A;  4Q8I A;  1ERM A;  4HP4 A;  3GMW A;  3N8R A;  1PZP A;  2QYB A;  3ZGA B;  1ZG6 A;  1BSG A;  4Q0I A;  4ZAM A;  1FCO A;  2Y2M A;  4O0P A;  1NYY A;  4Z9Q A;  1IEM A;  4II7 A;  2Y2Q A;  1XGJ A;  3W2Z A;  1D06 A;  3V39 A;  1Y28 A;  3O3V A;  1KVM A;  3IXG A;  3NEC A;  3LIA A;  3TG9 A;  3ZQ5 A;  3IHB A;  2BTF P;  1JWZ A;  1XFQ A;  4NK3 A;  4B4Z A;  3IWQ A;  3UDX A;  2XR0 A;  3D9Y A;  1J9M A;  4LGW A;  1LI0 A;  1NRF A;  3FYZ A;  1L3L A;  1T1A A;  3MZF A;  4KZ3 A;  4EBL A;  3G2Z A;  4LRY C;  5GHX A;  1VQQ A;  2Q9M A;  2IWD A;  3Q1F A;  4LCL A;  2PYP A;  5FA7 A;  4WZ5 A;  4E3I A;  2L1M A;  2XLN A;  4X53 A;  5EFW A;  4FOF A;  2YKF A;  1SDE A;  1X0O A;  5IU1 A;  4LV3 A;  1KE3 A;  3T4S A;  2W3G A;  4XT2 A;  4E04 A;  5KZH A;  2IWB A;  4JF6 A;  1YPR A;  4UA6 A;  4FTX A;  4LRX C;  5GLA A;  2M1C A;  3CHW P; 
#chains in the Genus database with same CATH homology
 3GTC A;  3ZDJ A;  1HD8 A;  2FFY A;  3VOZ A;  5BOH A;  4ZTK A;  3G2Y A;  3WS5 A;  4GDB A;  4IVI A;  4E3M A;  1WYB A;  1W8Q A;  4JPM A;  4WEJ A;  2PU4 A;  2JC7 A;  2Y4A A;  1NJ4 A;  4FH2 A;  2C5W B;  1LLB A;  4X69 A;  5AQA A;  4DKI A;  2V2F F;  4GD8 A;  3ZHH A;  5EUA A;  4S2N A;  1FSW A;  2ZQC A;  5TFQ A;  2RCX A;  3N7W A;  4WM9 A;  1K6S A;  1IEL A;  1M6K A;  5M19 A;  3WS2 A;  2VGK A;  3VP1 A;  4FSF A;  1KE0 A;  1ES4 A;  3VP0 A;  3HLE A;  3NY4 A;  1BZA A;  1LHY A;  2EXA A;  2JE5 A;  1L2S A;  3DWZ A;  3IXH A;  4K91 A;  4IBX A;  3CJM A;  3HRE A;  4L0L A;  4OH0 A;  1RGZ A;  2Y2L A;  3FV7 A;  3ZG8 B;  4KZ4 A;  2ZQD A;  3W4O A;  4GD6 A;  3G34 A;  4KZA A;  1TVF A;  3AGE A;  4LV0 A;  3N8S A;  4OLD A;  1YLP A;  5FQ9 A;  1Q2Q A;  1W8Y A;  1W5D A;  4XUX A;  1KVL A;  1L0E A;  4KZ8 A;  4RX3 A;  3BM6 A;  5A92 A;  5FAP A;  3VSL A;  3ZG7 B;  5EPH A;  4N1X A;  5HFO A;  1JVJ A;  4OVD A;  4OON A;  4WEK A;  3W4Q A;  4QHC A;  2EXB A;  1U60 A;  4WMC A;  4IBR A;  4OLG A;  5CXW A;  4P85 A;  1MY8 A;  2XF3 A;  3OPH A;  1PW8 A;  4Y0U A;  2Y2J A;  3B3X A;  2XDM A;  2Y2I A;  3OCL A;  5FQI A;  3AGF A;  3Q7V B;  3O87 A;  3FKV A;  3MXR A;  3SH9 A;  4Y0O A;  3HL9 A;  3IF5 A;  4OP8 A;  4PM6 A;  3VOY A;  3GQZ A;  1IYO A;  3UPN A;  3IXD A;  2WZZ A;  3UPO A;  3IWI A;  2WGW B;  2Y91 A;  3BLS A;  3G35 A;  3S1Y A;  2J7V A;  3NDG A;  2P9V B;  2XK1 A;  1IYQ A;  4R3J A;  3V3S A;  3C7V A;  4R4R A;  5FQJ A;  2HP9 A;  3Q82 A;  1YLZ A;  1MWR A;  2H0Y A;  4RYE A;  4PPR A;  3CZD A;  1SHV A;  2QMI A;  3VSK A;  4ZDX A;  3SS4 A;  1TDL A;  2J8Y A;  4OQH A;  3G31 A;  4N92 A;  5FQQ A;  1RCJ A;  4M3K A;  4BLM A;  5EOE A;  4DE0 A;  4P87 A;  3HLW A;  5FI6 A;  2CC1 A;  5EVL A;  4KZ5 A;  4S2L A;  5D3O A;  2HDQ A;  2Q9N A;  4U3T A;  4XXR A;  4X6T A;  1KGE A;  1BLS A;  1BTL A;  2WAD A;  3NC8 A;  1GHI A;  3S22 A;  3ISG A;  1L0G A;  2XEP A;  1PI4 A;  1QMF A;  2Y2H A;  3PBR A;  1Q2P A;  4K0X A;  2PU2 A;  3PBO A;  1NZO A;  1NY0 A;  1XP4 A;  4OQ0 A;  3PBN A;  4EUZ A;  3LY3 A;  3DTM A;  3G32 A;  3IQA A;  2EFU A;  4S2K A;  1H5X A;  3AGD A;  4PMA A;  1FR6 A;  4QD4 A;  4WBG A;  4RA7 A;  2Z2L B;  2EX8 A;  2R9W A;  3A3D A;  3MFD A;  5TGF A;  4DE1 A;  2BG1 A;  1DY6 A;  2ZM8 A;  3M6B A;  1FCN A;  2H10 A;  3Q7Z A;  4MBK A;  3C4O A;  5CEC A;  4RX2 A;  5L2F A;  3CMZ A;  2XFS A;  4S2M A;  4C6Y A;  3BFC A;  4PM9 A;  1FSY A;  1S6R A;  3IXB A;  1ES2 A;  5HAP A;  1BT5 A;  2ZC4 B;  3BFF A;  1MWS A;  4N9K A;  4CJN A;  2G2W A;  4GDN A;  3FKW A;  2XD1 A;  5A91 A;  3RXW A;  4GZB A;  2ZQ9 A;  1G68 A;  5DF8 A;  2JCH A;  2Y2P A;  4WEL A;  4KQR A;  3VP4 A;  4DRT A;  4OPY A;  4EV4 A;  5FQK A;  3Q07 A;  1ESU A;  2QZ6 A;  4B88 A;  4S2I A;  1OME A;  2X71 A;  4XUZ A;  4O7D A;  1K4E A;  5F1F A;  3V5M A;  3RJU A;  5GLD A;  3UDF A;  1YT4 A;  2EX2 A;  1IYP A;  1YM1 A;  2G2U A;  3WWX A;  3C4P A;  4KQO A;  3BYD A;  1YLY A;  1PIO A;  2PBY A;  1BUL A;  3M2K A;  4P6B A;  1H8Z A;  4HES A;  4OOL A;  4QY5 A;  2OSU A;  3SOI A;  1ES5 A;  1CI9 A;  5FDH A;  1FOF A;  4BQM A;  4QJG A;  1CEG A;  2HPB A;  3DW0 A;  3A3I A;  5E2G A;  5CHU A;  3LEZ A;  5DVA A;  1PYY A;  4CPK A;  1I2S A;  3HUN A;  3SS5 A;  5M18 A;  1MWT A;  5CTN A;  2WKE A;  2XD5 A;  3Q7V A;  4FD8 A;  4MEZ A;  4E3N A;  1CK3 A;  4GKU A;  4ZJ3 A;  2XQZ A;  3MZE A;  3OCN A;  2V1Z A;  4ID4 A;  1N9B A;  2WGW A;  5FAO A;  5F83 A;  3BRM A;  1L0D A;  2P9V A;  2X01 A;  5KSH A;  3A3J A;  1S0W A;  2WAF A;  4WYY A;  1TEM A;  2FFF B;  5GL9 A;  2Y2N A;  4QB8 A;  3ZVW A;  2VGJ A;  4LV2 A;  1KE4 A;  2C6W B;  1BLC A;  5DTS A;  4B4X A;  3IH8 A;  3CG5 A;  1TDG A;  4X68 A;  2WAE A;  3UPP A;  4EBN A;  5GLB A;  2BLS A;  3HBR A;  2H5S A;  1MPL A;  3HUO A;  4F94 A;  3EQU A;  5CER A;  2R9X A;  2XGN A;  5IHV A;  4H8R A;  5JYP A;  2E8I A;  1MBL A;  4KZ9 A;  3N4I A;  1LL9 A;  3HLG A;  1O07 A;  3NBL A;  2OLV A;  4JKT A;  1PW1 A;  3OC2 A;  2ZC7 A;  2A49 A;  1M40 A;  3N8L A;  4OPZ A;  4U0X A;  5DTK A;  2B5R A;  5I94 A;  4FCF A;  3UO9 A;  4S2P A;  4HBU A;  3ITA A;  4EWF A;  4MBH A;  1K56 D;  2ZM2 A;  2WKH A;  4DE3 A;  4A5R A;  3BFE A;  4DXC A;  1E3U D;  4ZJ1 A;  2ZQ8 A;  4KG6 A;  3OZH A;  5EOO A;  2DCF A;  5HAR A;  1XPB A;  2EX9 A;  3LY4 A;  3NI9 A;  1ZG4 A;  3IT9 A;  3SH8 A;  3HLB A;  4K0W A;  1K4F A;  1PWD A;  1XGI A;  4YIN A;  3V50 A;  4DF6 A;  4BEN A;  3IH9 A;  3WS1 A;  5EVI D;  1ERO A;  3DWK A;  1RGY A;  3LO7 A;  2WGI A;  2WZX A;  3EQV A;  4R23 A;  4Y7P A;  5GHY A;  2HDS A;  5CED A;  1EWZ A;  2XH9 A;  3HLC A;  5FI7 A;  2EX6 A;  1MKI A;  3OPR A;  4UHU A;  1O7E A;  1K56 A;  2QPN A;  1ES3 A;  2ZLY A;  3VMA A;  3ZNY A;  2Z2M B;  1FQG A;  3MZD A;  1HTZ A;  2V20 A;  3P98 A;  4YFM A;  5EEC A;  5M1A A;  3OPP A;  1E3U A;  2RL3 A;  3BEB A;  1G6A A;  1I5Q A;  4R4S A;  5CRF A;  3ZCZ A;  3V3R A;  4MNR A;  3WRZ A;  5EE8 A;  4OQG A;  4KZB A;  4S2J A;  3PBQ A;  1K25 A;  2Y59 A;  4GB7 A;  4DE2 A;  3E2K A;  5DF9 A;  3RXX A;  3UE3 A;  4ZBE A;  1JWV A;  5EVI A;  3QNB A;  4OOY A;  1ZKJ A;  4DDS A;  1CI8 A;  4E3J A;  4P0M A;  3I7J A;  1NZU A;  1PI5 A;  2ZD8 A;  1JTD A;  5CGS A;  1IKI A;  3A3E A;  3BFG A;  4HBT A;  2JBF A;  4JXV A;  4E3K A;  5G18 A;  3ZG5 A;  2WKI A;  2X02 A;  4UA9 A;  4E3L A;  3UN7 A;  3UDI A;  1DJA A;  5KSC A;  1KGF A;  4GOG A;  3LCE A;  3S4X A;  2J9P A;  3ITB A;  5DTT A;  5AQB A;  2OLU A;  3WS0 A;  4X55 A;  3UE1 A;  5HAQ A;  1K54 A;  1XXM A;  1KGG A;  3VP3 A;  5EVI C;  3UNW A;  1DJB A;  4KG2 A;  3C5A A;  2XFT A;  4JXG A;  4KQQ A;  4JXW A;  1KDS A;  3JYI A;  4N9L A;  3QNC A;  1ESI A;  3WRT A;  4WZ5 C;  3IF6 C;  1ALQ A;  2Y2K A;  1YMX A;  5U47 A;  5EVI B;  2WUQ A;  3PBS A;  1GCE A;  1E25 A;  1EI5 A;  4C3Q A;  5E43 A;  2ZMA A;  3UE0 A;  2DRW A;  2OV5 A;  1PWG A;  3FZC A;  2ZJ9 A;  3HVF A;  4MBF A;  4JBF A;  3TSG A;  3IF6 B;  3W8K A;  1AXB A;  1K54 C;  3GR2 A;  1ONH A;  5TR7 A;  1QME A;  3G30 A;  3HLF A;  4UA7 A;  4FH4 A;  5E2F A;  3TOI A;  2ZC6 B;  5F1G A;  3P09 A;  3M2J A;  4C75 A;  1K55 C;  3SS3 A;  4OP5 A;  1KDW A;  2Y2O A;  4OQI A;  1E4D A;  2UWX A;  3MXS A;  5FI2 A;  1LI9 A;  3NCK A;  5HAI A;  2IWC A;  4KG5 A;  2HDU A;  1ZC2 A;  3QHY A;  4LEN A;  1HZO A;  1YQS A;  2Y2G A;  3O86 A;  4IED A;  5A90 A;  5JYO A;  5E2H A;  1BLP A;  4BD1 A;  3MKE A;  1K57 A;  3UY6 A;  1Y54 A;  4Q8I A;  4EBP A;  1ERM A;  2ZC3 B;  2WK0 A;  3BLM A;  1JWP A;  3GMW A;  4KZ6 A;  1C3B A;  4Y0T A;  2H0T A;  2ZQA A;  1LL5 A;  1PZO A;  1NXY A;  4WMC D;  4WZ4 A;  3N8R A;  3FWL A;  1PZP A;  5CEB A;  4R3B A;  4NET A;  3WS4 A;  4LCM A;  1ZG6 A;  1BSG A;  1I2W A;  4ZAM A;  3MBZ A;  1NYM A;  4JXS A;  3ZGA B;  5GLC A;  1FCO A;  4PM5 A;  4BL2 A;  2Y2M A;  2GDN A;  2WYX A;  1NYY A;  1MWU A;  1XKZ A;  4S2N C;  1IEM A;  4Z9Q A;  4JF5 A;  1CEF A;  1K57 C;  2Y2Q A;  4DDY A;  1XGJ A;  5FSR A;  3D4F A;  1FCM A;  1VM1 A;  3ZG0 A;  3PTE A;  5DF7 A;  1XX2 A;  3N6I A;  1YLT A;  3MKF A;  3V39 A;  2DNS A;  4E6X A;  1YLJ A;  1MXO A;  3O3V A;  4LV1 A;  4EQI A;  4R0Q A;  1HVB A;  1XA1 A;  3A3F A;  3ZG9 B;  5CHM A;  1KVM A;  3IXG A;  5CGX A;  3TG9 A;  4KEN B;  5FAS A;  5FAQ A;  3PAG A;  3IHB A;  3PAE A;  2I72 A;  4KZ7 A;  1JWZ A;  4NK3 A;  1YMS A;  4B4Z A;  5KMW A;  4PM7 A;  3IWQ A;  2HP5 A;  1IKG A;  4UAA A;  5CTM A;  5A93 A;  1K38 A;  3HUM A;  3HLD A;  4OOM A;  5CHJ A;  1BUE A;  1Z6F A;  3IWO A;  1ONG A;  2XR0 A;  4RVA A;  3UDX A;  1J9M A;  4IVK A;  4BD0 A;  3BFD A;  1RP5 A;  1GA0 A;  4PM8 A;  1LI0 A;  5AQ9 A;  1NRF A;  3GSG A;  3W4P A;  1BLH A;  3FYZ A;  5CGW A;  1SKF A;  5F82 A;  3MZF A;  4KZ3 A;  4EBL A;  1IYS A;  1SDN A;  1W7F A;  3G2Z A;  5FAT A;  5GHX A;  1K6R A;  3NIA A;  2Y55 A;  1VQQ A;  2Q9M A;  2IWD A;  3ZVT A;  4D2O A;  3Q1F A;  4OKP A;  1YLW A;  4E3O A;  4LCL A;  5FA7 A;  4JLF A;  4WZ5 A;  3IF6 A;  3IHA A;  3O88 A;  4E3I A;  3C7U A;  4HEF A;  5FQM A;  5J8X A;  2XLN A;  3PBT A;  4X53 A;  4JF4 A;  1XA7 A;  2HP6 A;  2EFX A;  4BJP A;  3VFF A;  5E2E A;  1WE4 A;  5HW3 A;  1SDE A;  2ZQ7 A;  1SCW A;  4U0T A;  3E2L A;  4DXB A;  4ZJ2 A;  3M6H A;  4BL3 A;  4LV3 A;  4GN2 A;  5GHZ A;  4GNU A;  3OPL A;  1KE3 A;  1ERQ A;  2WGV A;  4N1H A;  4X56 A;  3G4P A;  4QU3 A;  3Q81 A;  1L0F A;  2J9O A;  1GHP A;  1DJC A;  1K55 A;  5AQ7 A;  2A3U A;  1H8Y A;  4R1G A;  1FR1 A;  3ZFZ A;  3GV9 A;  3BEC A;  4QY6 A;  3NDE A;  1PWC A;  1WYC A;  2HDR A;  5HX9 A;  3VFH A;  5KZH A;  2IWB A;  3SH7 A;  3GVB A;  4JF6 A;  4S2O A;  3VP2 A;  4OPR A;  4UA6 A;  4MLL A;  1JTG A;  1N4O A;  2P74 A;  5HL1 A;  5GLA A;  3GRJ A;  2ZC5 B;  3ZNT A;  4OPQ A;  2ZM0 A;  1GHM A;  1W79 A;  4E6W A;  1GA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...