2PCSA

Crystal structure of conserved protein from geobacillus kaustophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
152
Chain Sequence
LNGNGSIELKGTVEEVWSKLMDPSILSKCIMGCKSLELIGEDKYKADLQIGIAAVKGKYDAIIEVTDIKPPYHYKLLVNGEGGPGFVNAEGVIDLTPINDECTQLTYTYSAEVGGKVAAIGQRMLGGVAKLLISDFFKKIQKEIAKSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title Crystal structure of conserved protein from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 40
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06240 COXG Carbon monoxide dehydrogenase subunit G (CoxG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2pcsA00
4JDAA 4C9IA 4R7KA 1LN1A 4LGBA 4Q0KA 2E3QA 4A84A 3KAZA 4N0GC 4Y31A 2GKDA 3NEGA 4IGWA 3OH8A 2E3PA 3NMPA 1JSSA 4IGVA 2E3SA 4XRTA 1LLTA 1VJHA 2KF2A 4MA6A 4GY9A 3PUTA 3IJTA 3KDJA 3WG8A 3QSZA 2RESA 3KLXA 4JHHA 4LA7A 4XRWA 4QIPA 4DS8A 2I9YA 1T27A 1XN6A 3IE5A 3ZVUA 3KDHA 4IHRA 3JRSA 1KCMA 1E09A 2NS9A 2E3RA 2MOUA 3Q6AA 3UIDA 5E4DA 2LPXA 3GGNA 3P51A 4MAPA 5BRLA 1UW5A 2N4BA 1FSKA 2KTEA 4LGAA 5E4BA 4B9RA 1LN3A 1H2OA 4MNSA 3NR4A 4WVOA 5E46A 4A8UA 4IGYA 1XN5A 2R55A 3P9VA 3W9KA 4PSBA 2L65A 4M9BA 3NEFA 3NMTA 2K7HA 5C9YA 4JHIA 3E85A 2PSOA 5I9JA 2Z9YA 3KDIA 1Z94A 3NMVA 2VNEA 4FPWA 4OICA 3NMNA 4LG5A 3JRQB 4REIA 3K3KA 2LCGA 4BK6A 4BTZA 2FLHA 3NJOA 4A86A 2QPVA 4REHA 3TVRA 3UJLA 3H3RA 2EJXA 3OTLA 3NJ1A 2LE1A 3NS2A 4Z3LA 3KB3A 1QMRA 4JHGA 4A88A 4BKCA 4C94A 3KAYA 4DSBA 1TW0A 3KL1A 4M9WA 2LIOA 2PCSA 1IFVA 5I8FA 2M47A 5AMWA 4C9CA 1ZXFA 2E3MA 3UQHA 2K5GA 2VQ5A 4IH0A 3TFZA 4A87A 3QN1A 4A8GA 4A80A 2A1LA 4A81A 2LUZA 2E3OA 3H3SA 2KCZA 3P0LA 2KEWA 1B6FA 3F08A 3W9RA 4REJA 1FM4A 4DSCA 4BK7A 2FFSA 2QIMA 3H3TA 1XUVA 3Q63A 3Q64A 3RT0C 1TXCA 4IH2A 1XDFA 2LAKA 2LF2A 2L9PA 3H3QA 2WQLA 2M89A 5JO1A 5E4MA 3CNWA 3PU2A 1BTVA 4JDLA 3RD6A 3C0VA 4BKDA 2LGHA 3TL1A 1X53A 3TVQA 4N3EA 3OQUA 3KB0A 2D4RA 2Z9ZA 2REZA 3NMHA 2LEQA 5JNNA 4RYVA 3K90A 2LDKA 1EM2A 2BK0A 2NN5A 4IGXA 2IL5A 4A8VA 1BV1A 3FO5A 3NI8A 1ICXA 4A85A 3NJ0A 1T17A 2RERA 1LN2A 2L8OA 3OJIA 5JO2A 2E3NA 4A83A 3ELIA 2N4AA 1XFSA 2Q3QA 3R6PA 3RT2A
chains in the Genus database with same CATH superfamily
4JDAA 4C9IA 3F73A 4NCBA 4R7KA 1LN1A 4LGBA 4Q0KA 2E3QA 4A84A 3GOBA 3KAZA 4N0GC 4QDFA 4Y31A 3NEGA 2GKDA 4IGWA 3OH8A 2E3PA 3TGOC 3HVRA 3NMPA 1JSSA 4N41A 4IGVA 2E3SA 4XRTA 1LLTA 1VJHA 2KF2A 4MA6A 3GTSA 4GY9A 3PUTA 3IJTA 3HJFA 3KDJA 3WG8A 3QSZA 2RESA 3KLXA 4JHHA 4LA7A 4XRWA 4QIPA 4DS8A 2I9YA 1T27A 1XN6A 3IE5A 3ZVUA 3KDHA 4IHRA 3JRSA 1KCMA 1E09A 2NS9A 2E3RA 2MOUA 3Q6AA 3UIDA 2YH6A 5E4DA 2LPXA 3GGNA 3P51A 4MAPA 5BRLA 5EKQC 1UW5A 2N4BA 1FSKA 2KTEA 4LGAA 5E4BA 4B9RA 1LN3A 1H2OA 4MNSA 3NR4A 4WVOA 5E46A 4A8UA 4IGYA 1XN5A 2R55A 3P9VA 2ZYLA 3W9KA 3HK2A 4PSBA 3GTEA 2L65A 4M9BA 3NEFA 3NMTA 2K7HA 5C9YA 4JHIA 3E85A 2PSOA 5I9JA 2Z9YA 3KDIA 1Z94A 3NMVA 3GL0A 2VNEA 4FPWA 4OICA 3NMNA 4LG5A 3JRQB 4REIA 3K3KA 2LCGA 4BK6A 4BTZA 3NQNA 2FLHA 3NJOA 4A86A 2QPVA 4NCAA 4REHA 3TVRA 3UJLA 3H3RA 2EJXA 3OTLA 3NJ1A 4JHYA 2LE1A 3GKEA 3NS2A 4Z3LA 3KB3A 1QMRA 4JHGA 4A88A 4BKCA 4C94A 4E6FA 3HO1A 3GB4A 3KAYA 4DSBA 1TW0A 3KL1A 4M9WA 2LIOA 2PCSA 3DLHA 1IFVA 4N47A 5I8FA 2M47A 5AMWA 4C9CA 4QDDA 1ZXFA 2E3MA 3UQHA 2K5GA 2VQ5A 4IH0A 3TFZA 4A87A 3QN1A 4A8GA 4A80A 2A1LA 4A81A 2LUZA 2E3OA 3H3SA 2KCZA 3P0LA 2KEWA 1B6FA 3F08A 3W9RA 4REJA 1FM4A 4DSCA 4QCKA 4BK7A 3HXMA 2FFSA 2QIMA 3H3TA 1XUVA 3Q63A 3Q64A 3GL2A 3RT0C 1TXCA 4N76A 4IH2A 1XDFA 2LAKA 2LF2A 2L9PA 3H3QA 4QDCA 2WQLA 2M89A 5JO1A 5E4MA 3CNWA 3PU2A 1BTVA 4JDLA 3RD6A 3C0VA 4BKDA 2LGHA 3TL1A 3HM9A 1X53A 3TVQA 4N3EA 3OQUA 3KB0A 2D4RA 2Z9ZA 2LAFA 2REZA 2LEQA 3NMHA 5JNNA 4RYVA 3DLBA 3K90A 2LDKA 1EM2A 2BK0A 2NN5A 4IGXA 2IL5A 4A8VA 1BV1A 3FO5A 3NI8A 1ICXA 4A85A 3NJ0A 1T17A 2RERA 1LN2A 2L8OA 3OJIA 5JO2A 2E3NA 4QDFB 4A83A 3ELIA 2N4AA 1XFSA 2Q3QA 3R6PA 4KPYA 3RT2A
chains in the Genus database with same CATH topology
4JDAA 4C9IA 3F73A 4NCBA 4R7KA 1LN1A 4LGBA 4Q0KA 2E3QA 4A84A 3GOBA 3KAZA 4N0GC 4QDFA 4Y31A 3NEGA 2GKDA 4IGWA 3OH8A 2E3PA 3TGOC 3HVRA 3NMPA 1JSSA 4N41A 4IGVA 2E3SA 4XRTA 1LLTA 1VJHA 2KF2A 4MA6A 3GTSA 4GY9A 3PUTA 3IJTA 3HJFA 3KDJA 3WG8A 3QSZA 2RESA 3KLXA 4JHHA 4LA7A 4XRWA 4QIPA 4DS8A 2I9YA 1T27A 1XN6A 3IE5A 3ZVUA 3KDHA 4IHRA 3JRSA 1KCMA 1E09A 2NS9A 2E3RA 2MOUA 3Q6AA 3UIDA 2YH6A 5E4DA 2LPXA 3GGNA 3P51A 4MAPA 5BRLA 5EKQC 1UW5A 2N4BA 1FSKA 2KTEA 4LGAA 5E4BA 4B9RA 1LN3A 1H2OA 4MNSA 3NR4A 4WVOA 5E46A 4A8UA 4IGYA 1XN5A 2R55A 3P9VA 2ZYLA 3W9KA 3HK2A 4PSBA 3GTEA 2L65A 4M9BA 3NEFA 3NMTA 2K7HA 5C9YA 4JHIA 3E85A 2PSOA 5I9JA 2Z9YA 3KDIA 1Z94A 3NMVA 3GL0A 2VNEA 4FPWA 4OICA 3NMNA 4LG5A 3JRQB 4REIA 3K3KA 2LCGA 4BK6A 4BTZA 3NQNA 2FLHA 3NJOA 4A86A 2QPVA 4NCAA 4REHA 3TVRA 3UJLA 3H3RA 2EJXA 3OTLA 3NJ1A 4JHYA 2LE1A 3GKEA 3NS2A 4Z3LA 3KB3A 1QMRA 4JHGA 4A88A 4BKCA 4C94A 4E6FA 3HO1A 3GB4A 3KAYA 4DSBA 1TW0A 3KL1A 4M9WA 2LIOA 2PCSA 3DLHA 1IFVA 4N47A 5I8FA 2M47A 5AMWA 4C9CA 4QDDA 1ZXFA 2E3MA 3UQHA 2K5GA 2VQ5A 4IH0A 3TFZA 4A87A 3QN1A 4A8GA 4A80A 2A1LA 4A81A 2LUZA 2E3OA 3H3SA 2KCZA 3P0LA 2KEWA 1B6FA 3F08A 3W9RA 4REJA 1FM4A 4DSCA 4QCKA 4BK7A 3HXMA 2FFSA 2QIMA 3H3TA 1XUVA 3Q63A 3Q64A 3GL2A 3RT0C 1TXCA 4N76A 4IH2A 1XDFA 2LAKA 2LF2A 2L9PA 3H3QA 4QDCA 2WQLA 2M89A 5JO1A 5E4MA 3CNWA 3PU2A 1BTVA 4JDLA 3RD6A 3C0VA 4BKDA 2LGHA 3TL1A 3HM9A 1X53A 3TVQA 4N3EA 3OQUA 3KB0A 2D4RA 2Z9ZA 2LAFA 2REZA 2LEQA 3NMHA 5JNNA 4RYVA 3DLBA 3K90A 2LDKA 1EM2A 2BK0A 2NN5A 4IGXA 2IL5A 4A8VA 1BV1A 3FO5A 3NI8A 1ICXA 4A85A 3NJ0A 1T17A 2RERA 1LN2A 2L8OA 3OJIA 5JO2A 2E3NA 4QDFB 4A83A 3ELIA 2N4AA 1XFSA 2Q3QA 3R6PA 4KPYA 3RT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JDA A;  4C9I A;  4R7K A;  1LN1 A;  4LGB A;  4Q0K A;  2E3Q A;  4A84 A;  3KAZ A;  4N0G C;  4Y31 A;  2GKD A;  3NEG A;  4IGW A;  3OH8 A;  2E3P A;  3NMP A;  1JSS A;  4IGV A;  2E3S A;  4XRT A;  1LLT A;  1VJH A;  2KF2 A;  4MA6 A;  4GY9 A;  3PUT A;  3IJT A;  3KDJ A;  3WG8 A;  3QSZ A;  2RES A;  3KLX A;  4JHH A;  4LA7 A;  4XRW A;  4QIP A;  4DS8 A;  2I9Y A;  1T27 A;  1XN6 A;  3IE5 A;  3ZVU A;  3KDH A;  4IHR A;  3JRS A;  1KCM A;  1E09 A;  2NS9 A;  2E3R A;  2MOU A;  3Q6A A;  3UID A;  5E4D A;  2LPX A;  3GGN A;  3P51 A;  4MAP A;  5BRL A;  1UW5 A;  2N4B A;  1FSK A;  2KTE A;  4LGA A;  5E4B A;  4B9R A;  1LN3 A;  1H2O A;  4MNS A;  3NR4 A;  4WVO A;  5E46 A;  4A8U A;  4IGY A;  1XN5 A;  2R55 A;  3P9V A;  3W9K A;  4PSB A;  2L65 A;  4M9B A;  3NEF A;  3NMT A;  2K7H A;  5C9Y A;  4JHI A;  3E85 A;  2PSO A;  5I9J A;  2Z9Y A;  3KDI A;  1Z94 A;  3NMV A;  2VNE A;  4FPW A;  4OIC A;  3NMN A;  4LG5 A;  3JRQ B;  4REI A;  3K3K A;  2LCG A;  4BK6 A;  4BTZ A;  2FLH A;  3NJO A;  4A86 A;  2QPV A;  4REH A;  3TVR A;  3UJL A;  3H3R A;  2EJX A;  3OTL A;  3NJ1 A;  2LE1 A;  3NS2 A;  4Z3L A;  3KB3 A;  1QMR A;  4JHG A;  4A88 A;  4BKC A;  4C94 A;  3KAY A;  4DSB A;  1TW0 A;  3KL1 A;  4M9W A;  2LIO A;  2PCS A;  1IFV A;  5I8F A;  2M47 A;  5AMW A;  4C9C A;  1ZXF A;  2E3M A;  3UQH A;  2K5G A;  2VQ5 A;  4IH0 A;  3TFZ A;  4A87 A;  3QN1 A;  4A8G A;  4A80 A;  2A1L A;  4A81 A;  2LUZ A;  2E3O A;  3H3S A;  2KCZ A;  3P0L A;  2KEW A;  1B6F A;  3F08 A;  3W9R A;  4REJ A;  1FM4 A;  4DSC A;  4BK7 A;  2FFS A;  2QIM A;  3H3T A;  1XUV A;  3Q63 A;  3Q64 A;  3RT0 C;  1TXC A;  4IH2 A;  1XDF A;  2LAK A;  2LF2 A;  2L9P A;  3H3Q A;  2WQL A;  2M89 A;  5JO1 A;  5E4M A;  3CNW A;  3PU2 A;  1BTV A;  4JDL A;  3RD6 A;  3C0V A;  4BKD A;  2LGH A;  3TL1 A;  1X53 A;  3TVQ A;  4N3E A;  3OQU A;  3KB0 A;  2D4R A;  2Z9Z A;  2REZ A;  3NMH A;  2LEQ A;  5JNN A;  4RYV A;  3K90 A;  2LDK A;  1EM2 A;  2BK0 A;  2NN5 A;  4IGX A;  2IL5 A;  4A8V A;  1BV1 A;  3FO5 A;  3NI8 A;  1ICX A;  4A85 A;  3NJ0 A;  1T17 A;  2RER A;  1LN2 A;  2L8O A;  3OJI A;  5JO2 A;  2E3N A;  4A83 A;  3ELI A;  2N4A A;  1XFS A;  2Q3Q A;  3R6P A;  3RT2 A; 
#chains in the Genus database with same CATH topology
 4JDA A;  4C9I A;  3F73 A;  4NCB A;  4R7K A;  1LN1 A;  4LGB A;  4Q0K A;  2E3Q A;  4A84 A;  3GOB A;  3KAZ A;  4N0G C;  4QDF A;  4Y31 A;  3NEG A;  2GKD A;  4IGW A;  3OH8 A;  2E3P A;  3TGO C;  3HVR A;  3NMP A;  1JSS A;  4N41 A;  4IGV A;  2E3S A;  4XRT A;  1LLT A;  1VJH A;  2KF2 A;  4MA6 A;  3GTS A;  4GY9 A;  3PUT A;  3IJT A;  3HJF A;  3KDJ A;  3WG8 A;  3QSZ A;  2RES A;  3KLX A;  4JHH A;  4LA7 A;  4XRW A;  4QIP A;  4DS8 A;  2I9Y A;  1T27 A;  1XN6 A;  3IE5 A;  3ZVU A;  3KDH A;  4IHR A;  3JRS A;  1KCM A;  1E09 A;  2NS9 A;  2E3R A;  2MOU A;  3Q6A A;  3UID A;  2YH6 A;  5E4D A;  2LPX A;  3GGN A;  3P51 A;  4MAP A;  5BRL A;  5EKQ C;  1UW5 A;  2N4B A;  1FSK A;  2KTE A;  4LGA A;  5E4B A;  4B9R A;  1LN3 A;  1H2O A;  4MNS A;  3NR4 A;  4WVO A;  5E46 A;  4A8U A;  4IGY A;  1XN5 A;  2R55 A;  3P9V A;  2ZYL A;  3W9K A;  3HK2 A;  4PSB A;  3GTE A;  2L65 A;  4M9B A;  3NEF A;  3NMT A;  2K7H A;  5C9Y A;  4JHI A;  3E85 A;  2PSO A;  5I9J A;  2Z9Y A;  3KDI A;  1Z94 A;  3NMV A;  3GL0 A;  2VNE A;  4FPW A;  4OIC A;  3NMN A;  4LG5 A;  3JRQ B;  4REI A;  3K3K A;  2LCG A;  4BK6 A;  4BTZ A;  3NQN A;  2FLH A;  3NJO A;  4A86 A;  2QPV A;  4NCA A;  4REH A;  3TVR A;  3UJL A;  3H3R A;  2EJX A;  3OTL A;  3NJ1 A;  4JHY A;  2LE1 A;  3GKE A;  3NS2 A;  4Z3L A;  3KB3 A;  1QMR A;  4JHG A;  4A88 A;  4BKC A;  4C94 A;  4E6F A;  3HO1 A;  3GB4 A;  3KAY A;  4DSB A;  1TW0 A;  3KL1 A;  4M9W A;  2LIO A;  2PCS A;  3DLH A;  1IFV A;  4N47 A;  5I8F A;  2M47 A;  5AMW A;  4C9C A;  4QDD A;  1ZXF A;  2E3M A;  3UQH A;  2K5G A;  2VQ5 A;  4IH0 A;  3TFZ A;  4A87 A;  3QN1 A;  4A8G A;  4A80 A;  2A1L A;  4A81 A;  2LUZ A;  2E3O A;  3H3S A;  2KCZ A;  3P0L A;  2KEW A;  1B6F A;  3F08 A;  3W9R A;  4REJ A;  1FM4 A;  4DSC A;  4QCK A;  4BK7 A;  3HXM A;  2FFS A;  2QIM A;  3H3T A;  1XUV A;  3Q63 A;  3Q64 A;  3GL2 A;  3RT0 C;  1TXC A;  4N76 A;  4IH2 A;  1XDF A;  2LAK A;  2LF2 A;  2L9P A;  3H3Q A;  4QDC A;  2WQL A;  2M89 A;  5JO1 A;  5E4M A;  3CNW A;  3PU2 A;  1BTV A;  4JDL A;  3RD6 A;  3C0V A;  4BKD A;  2LGH A;  3TL1 A;  3HM9 A;  1X53 A;  3TVQ A;  4N3E A;  3OQU A;  3KB0 A;  2D4R A;  2Z9Z A;  2LAF A;  2REZ A;  2LEQ A;  3NMH A;  5JNN A;  4RYV A;  3DLB A;  3K90 A;  2LDK A;  1EM2 A;  2BK0 A;  2NN5 A;  4IGX A;  2IL5 A;  4A8V A;  1BV1 A;  3FO5 A;  3NI8 A;  1ICX A;  4A85 A;  3NJ0 A;  1T17 A;  2RER A;  1LN2 A;  2L8O A;  3OJI A;  5JO2 A;  2E3N A;  4QDF B;  4A83 A;  3ELI A;  2N4A A;  1XFS A;  2Q3Q A;  3R6P A;  4KPY A;  3RT2 A; 
#chains in the Genus database with same CATH homology
 4JDA A;  4C9I A;  3F73 A;  4NCB A;  4R7K A;  1LN1 A;  4LGB A;  4Q0K A;  2E3Q A;  4A84 A;  3GOB A;  3KAZ A;  4N0G C;  4QDF A;  4Y31 A;  3NEG A;  2GKD A;  4IGW A;  3OH8 A;  2E3P A;  3TGO C;  3HVR A;  3NMP A;  1JSS A;  4N41 A;  4IGV A;  2E3S A;  4XRT A;  1LLT A;  1VJH A;  2KF2 A;  4MA6 A;  3GTS A;  4GY9 A;  3PUT A;  3IJT A;  3HJF A;  3KDJ A;  3WG8 A;  3QSZ A;  2RES A;  3KLX A;  4JHH A;  4LA7 A;  4XRW A;  4QIP A;  4DS8 A;  2I9Y A;  1T27 A;  1XN6 A;  3IE5 A;  3ZVU A;  3KDH A;  4IHR A;  3JRS A;  1KCM A;  1E09 A;  2NS9 A;  2E3R A;  2MOU A;  3Q6A A;  3UID A;  2YH6 A;  5E4D A;  2LPX A;  3GGN A;  3P51 A;  4MAP A;  5BRL A;  5EKQ C;  1UW5 A;  2N4B A;  1FSK A;  2KTE A;  4LGA A;  5E4B A;  4B9R A;  1LN3 A;  1H2O A;  4MNS A;  3NR4 A;  4WVO A;  5E46 A;  4A8U A;  4IGY A;  1XN5 A;  2R55 A;  3P9V A;  2ZYL A;  3W9K A;  3HK2 A;  4PSB A;  3GTE A;  2L65 A;  4M9B A;  3NEF A;  3NMT A;  2K7H A;  5C9Y A;  4JHI A;  3E85 A;  2PSO A;  5I9J A;  2Z9Y A;  3KDI A;  1Z94 A;  3NMV A;  3GL0 A;  2VNE A;  4FPW A;  4OIC A;  3NMN A;  4LG5 A;  3JRQ B;  4REI A;  3K3K A;  2LCG A;  4BK6 A;  4BTZ A;  3NQN A;  2FLH A;  3NJO A;  4A86 A;  2QPV A;  4NCA A;  4REH A;  3TVR A;  3UJL A;  3H3R A;  2EJX A;  3OTL A;  3NJ1 A;  4JHY A;  2LE1 A;  3GKE A;  3NS2 A;  4Z3L A;  3KB3 A;  1QMR A;  4JHG A;  4A88 A;  4BKC A;  4C94 A;  4E6F A;  3HO1 A;  3GB4 A;  3KAY A;  4DSB A;  1TW0 A;  3KL1 A;  4M9W A;  2LIO A;  2PCS A;  3DLH A;  1IFV A;  4N47 A;  5I8F A;  2M47 A;  5AMW A;  4C9C A;  4QDD A;  1ZXF A;  2E3M A;  3UQH A;  2K5G A;  2VQ5 A;  4IH0 A;  3TFZ A;  4A87 A;  3QN1 A;  4A8G A;  4A80 A;  2A1L A;  4A81 A;  2LUZ A;  2E3O A;  3H3S A;  2KCZ A;  3P0L A;  2KEW A;  1B6F A;  3F08 A;  3W9R A;  4REJ A;  1FM4 A;  4DSC A;  4QCK A;  4BK7 A;  3HXM A;  2FFS A;  2QIM A;  3H3T A;  1XUV A;  3Q63 A;  3Q64 A;  3GL2 A;  3RT0 C;  1TXC A;  4N76 A;  4IH2 A;  1XDF A;  2LAK A;  2LF2 A;  2L9P A;  3H3Q A;  4QDC A;  2WQL A;  2M89 A;  5JO1 A;  5E4M A;  3CNW A;  3PU2 A;  1BTV A;  4JDL A;  3RD6 A;  3C0V A;  4BKD A;  2LGH A;  3TL1 A;  3HM9 A;  1X53 A;  3TVQ A;  4N3E A;  3OQU A;  3KB0 A;  2D4R A;  2Z9Z A;  2LAF A;  2REZ A;  2LEQ A;  3NMH A;  5JNN A;  4RYV A;  3DLB A;  3K90 A;  2LDK A;  1EM2 A;  2BK0 A;  2NN5 A;  4IGX A;  2IL5 A;  4A8V A;  1BV1 A;  3FO5 A;  3NI8 A;  1ICX A;  4A85 A;  3NJ0 A;  1T17 A;  2RER A;  1LN2 A;  2L8O A;  3OJI A;  5JO2 A;  2E3N A;  4QDF B;  4A83 A;  3ELI A;  2N4A A;  1XFS A;  2Q3Q A;  3R6P A;  4KPY A;  3RT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...